Polyadenylate-binding protein

Overview
NamePolyadenylate-binding protein
Smed IDSMED30005231
Length (bp)2255
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Polyadenylate-binding protein (SMED30005231) t-SNE clustered cells

Violin plots show distribution of expression levels for Polyadenylate-binding protein (SMED30005231) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Polyadenylate-binding protein (SMED30005231) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Polyadenylate-binding protein (SMED30005231) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005231

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30005231SMESG000014734.1 Contig3487GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30005231SMESG000058745.1 Contig3487GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30005231SMESG000058745.1 dd_Smed_v4_93_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30005231SMESG000058745.1 dd_Smed_v4_93_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30005231SMESG000058745.1 dd_Smed_v4_93_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005231SMESG000058745.1 dd_Smed_v4_93_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30005231SMESG000058745.1 dd_Smed_v4_93_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30005231SMESG000058745.1 dd_Smed_v4_93_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30005231SMESG000058745.1 dd_Smed_v4_93_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005231SMESG000058745.1 dd_Smed_v4_93_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30005231SMESG000058745.1 dd_Smed_v4_93_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30005231SMESG000058745.1 dd_Smed_v4_93_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005231SMESG000058745.1 Contig39861newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005231SMESG000058745.1 Contig39861uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 2 cellSMED30005231SMESG000058745.1 dd_Smed_v6_93_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30005231SMESG000058745.1 dd_Smed_v6_93_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Polyadenylate-binding protein vs. Ensembl Human
Match: PABPC1 (poly(A) binding protein cytoplasmic 1 [Source:HGNC Symbol;Acc:HGNC:8554])

HSP 1 Score: 546.584 bits (1407), Expect = 0.000e+0
Identity = 303/630 (48.10%), Postives = 399/630 (63.33%), Query Frame = 2
Query:   89 PTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQRSTP----NKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQRGHQ----PQPVFNP-------GMVNFMMNSNVQRPFMARPGNILQ----NRW----PQTMPYI-QPRNIGMPANQNIMMTGMPQNQQRRNIM----VDPMMNQNRNARPITGNVQLN---QTRPQYNMVANGRQGNNIMYQYPIQDNQPMLNPDQMKMPDIESQ-IDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAHKGGEG 1882
            P+ P ASLYVGDLHPDVTEA+LYEKF   G +LSIRVCRD++TR+SLGYAYVN+Q   +A+ A+D +NF+ I G+P RIMWSQRDP+ R+SGVGNIFIKNLD SI  K + DTF+ FG I SCKV  DENG SKG+ FV+F  +  AE+AI+ +NG ++ ++ V+V +F  R +R        K+FTN YIKNFG  + D+ L+DLF + G  +S KVM D+ G SKGFGFVSF+ HEDA KAV+ +NG+ +  K IYVGRA KK ERQ EL+ ++E+ +Q+R+ +++ GVNLY+KNL + I+DERLR EF+ FG ITSAKVM+  E   SKGFGFVCFS+P+EAT+AV+EMNG+IV  KPLYVALAQ+KE+R AHL +Q+ QR       P PV NP       G     +     R     P  I Q     RW     +  P+   P  I   A +    T  P + Q   +M    V     Q    RP           +T PQY   A  R     +      + QP +    M+ P +  Q  +  T S +A+A   E KQ+LGE+++PL+      +AGKITGM LE+DN+ELL+M+E+  SL+ K+DEA+ VL AH+  E 
Sbjct:    6 PSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRYQ-GVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMM--EGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRAAYYPPSQIAQLRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQRVANTSTQTMGPRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHL------NAQPQVT---MQQPAVHVQGQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEA 622          
BLAST of Polyadenylate-binding protein vs. Ensembl Human
Match: PABPC4 (poly(A) binding protein cytoplasmic 4 [Source:HGNC Symbol;Acc:HGNC:8557])

HSP 1 Score: 543.502 bits (1399), Expect = 0.000e+0
Identity = 298/610 (48.85%), Postives = 399/610 (65.41%), Query Frame = 2
Query:   83 ANPTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQR----STPNKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQR--GHQPQPV------FNPGMVNFMMNSNVQRPFMARPGNILQNRWPQTMPYIQPRNIGMPANQNIMMTGMPQNQQRRNIMVDPMMNQNRNARPITGNVQLNQTRPQYNMVANGRQGNNIMYQYP--IQDNQPMLNPDQMKMPDIESQ-IDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAH 1867
            A  + P ASLYVGDLH DVTEA+LYEKF   G VLSIRVCRD++TR+SLGYAYVN+Q   +A+ A+D +NF+ I G+P RIMWSQRDP+ R+SGVGN+FIKNLD SI  K + DTF+ FG I SCKV  DENG SKG+AFV+F  +  A+KAI+ +NG ++ ++ V+V +F  R +R        K+FTN YIKNFG  + D+SL++LF Q G+ +S KVM D  G SKGFGFVS+++HEDA KAV  +NG+ I  K I+VGRA KK ERQ EL+ ++E+ +QER+ +++ GVNLYIKNL + I+DE+LR EF+ FG+ITSAKVML  E+  SKGFGFVCFS+P+EAT+AV+EMNG+IV  KPLYVALAQ+KE+R AHL +Q+ QR  G +  P       F P    + + +  Q     RP     N+  Q  P  + +  G P     M + + Q+  R  +         R+  P TG     Q       VA         Y+Y   ++   P + P Q   P +  Q  +  T S +A A   E KQ+LGE+++PL+     ++AGKITGM LE+DN+ELL+M+E+  SL+ K+DEA+ VL AH
Sbjct:    4 AASSYPMASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYAFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAKEFTNVYIKNFGEEVDDESLKELFSQFGKTLSVKVMRDPNGKSKGFGFVSYEKHEDANKAVEEMNGKEISGKIIFVGRAQKKVERQAELKRKFEQLKQERISRYQ-GVNLYIKNLDDTIDDEKLRKEFSPFGSITSAKVML--EDGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEERKAHLTNQYMQRVAGMRALPANAILNQFQPAAGGYFVPAVPQA--QGRPPYYTPNQLAQMRPNPRWQQGGRPQGFQGMPSAIRQSGPRPTL---------RHLAP-TGVPTAVQNLAPRAAVAAAAPRAVAPYKYASSVRSPHPAIQPLQAPQPAVHVQGQEPLTASMLAAAPPQEQKQMLGERLFPLIQTMHSNLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAH 597          
BLAST of Polyadenylate-binding protein vs. Ensembl Human
Match: PABPC4 (poly(A) binding protein cytoplasmic 4 [Source:HGNC Symbol;Acc:HGNC:8557])

HSP 1 Score: 541.576 bits (1394), Expect = 0.000e+0
Identity = 300/626 (47.92%), Postives = 403/626 (64.38%), Query Frame = 2
Query:   83 ANPTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQR----STPNKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQR--GHQPQPV------FNPGMVNFMMNSNVQRPFMARPGNILQNRWPQTMPYIQPRNIGMPANQNIMMTGMPQNQQRRNIMVDPMMNQNRNARPITGNVQLNQTRP---QYNMVANGRQG-------------NNIMYQYP--IQDNQPMLNPDQMKMPDIESQ-IDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAH 1867
            A  + P ASLYVGDLH DVTEA+LYEKF   G VLSIRVCRD++TR+SLGYAYVN+Q   +A+ A+D +NF+ I G+P RIMWSQRDP+ R+SGVGN+FIKNLD SI  K + DTF+ FG I SCKV  DENG SKG+AFV+F  +  A+KAI+ +NG ++ ++ V+V +F  R +R        K+FTN YIKNFG  + D+SL++LF Q G+ +S KVM D  G SKGFGFVS+++HEDA KAV  +NG+ I  K I+VGRA KK ERQ EL+ ++E+ +QER+ +++ GVNLYIKNL + I+DE+LR EF+ FG+ITSAKVML  E+  SKGFGFVCFS+P+EAT+AV+EMNG+IV  KPLYVALAQ+KE+R AHL +Q+ QR  G +  P       F P    + + +  Q     RP     N+  Q  P  + +  G P     M + + Q+  R  +         R+  P TGN   ++  P   Q   V    Q                  Y+Y   ++   P + P Q   P +  Q  +  T S +A A   E KQ+LGE+++PL+     ++AGKITGM LE+DN+ELL+M+E+  SL+ K+DEA+ VL AH
Sbjct:    4 AASSYPMASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYAFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAKEFTNVYIKNFGEEVDDESLKELFSQFGKTLSVKVMRDPNGKSKGFGFVSYEKHEDANKAVEEMNGKEISGKIIFVGRAQKKVERQAELKRKFEQLKQERISRYQ-GVNLYIKNLDDTIDDEKLRKEFSPFGSITSAKVML--EDGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEERKAHLTNQYMQRVAGMRALPANAILNQFQPAAGGYFVPAVPQA--QGRPPYYTPNQLAQMRPNPRWQQGGRPQGFQGMPSAIRQSGPRPTL---------RHLAP-TGNAPASRGLPTTTQRVGVPTAVQNLAPRAAVAAAAPRAVAPYKYASSVRSPHPAIQPLQAPQPAVHVQGQEPLTASMLAAAPPQEQKQMLGERLFPLIQTMHSNLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAH 613          
BLAST of Polyadenylate-binding protein vs. Ensembl Human
Match: PABPC4 (poly(A) binding protein cytoplasmic 4 [Source:HGNC Symbol;Acc:HGNC:8557])

HSP 1 Score: 535.413 bits (1378), Expect = 0.000e+0
Identity = 299/629 (47.54%), Postives = 401/629 (63.75%), Query Frame = 2
Query:   83 ANPTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQR----STPNKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQR--GHQPQPV------FNPGMVNFMMNSNVQRPFMARPGNILQNRWPQTMPYIQPRNIGMPANQNIMMTGMPQNQQR---RNIMVDPMMNQNRNARPITGNVQLNQ---TRPQYNMVANGRQG-------------NNIMYQYP--IQDNQPMLNPDQMKMPDIESQ-IDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAH 1867
            A  + P ASLYVGDLH DVTEA+LYEKF   G VLSIRVCRD++TR+SLGYAYVN+Q   +A+ A+D +NF+ I G+P RIMWSQRDP+ R+SGVGN+FIKNLD SI  K + DTF+ FG I SCKV  DENG SKG+AFV+F  +  A+KAI+ +NG ++ ++ V+V +F  R +R        K+FTN YIKNFG  + D+SL++LF Q G+ +S KVM D  G SKGFGFVS+++HEDA KAV  +NG+ I  K I+VGRA KK ERQ EL+ ++E+ +QER+ +++ GVNLYIKNL + I+DE+LR EF+ FG+ITSAKVML  E+  SKGFGFVCFS+P+EAT+AV+EMNG+IV  KPLYVALAQ+KE+R AHL +Q+ QR  G +  P       F P    + + +  Q     RP     N+  Q  P  + +  G P     M + + Q+  R   R++        +R A    G     Q      Q   V    Q                  Y+Y   ++   P + P Q   P +  Q  +  T S +A A   E KQ+LGE+++PL+     ++AGKITGM LE+DN+ELL+M+E+  SL+ K+DEA+ VL AH
Sbjct:    4 AASSYPMASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYAFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAKEFTNVYIKNFGEEVDDESLKELFSQFGKTLSVKVMRDPNGKSKGFGFVSYEKHEDANKAVEEMNGKEISGKIIFVGRAQKKVERQAELKRKFEQLKQERISRYQ-GVNLYIKNLDDTIDDEKLRKEFSPFGSITSAKVML--EDGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEERKAHLTNQYMQRVAGMRALPANAILNQFQPAAGGYFVPAVPQA--QGRPPYYTPNQLAQMRPNPRWQQGGRPQGFQGMPSAIRQSGPRPTLRHLAPTGSECPDRLAMDFGGAGAAQQGLTDSCQSGGVPTAVQNLAPRAAVAAAAPRAVAPYKYASSVRSPHPAIQPLQAPQPAVHVQGQEPLTASMLAAAPPQEQKQMLGERLFPLIQTMHSNLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAH 626          
BLAST of Polyadenylate-binding protein vs. Ensembl Human
Match: PABPC4 (poly(A) binding protein cytoplasmic 4 [Source:HGNC Symbol;Acc:HGNC:8557])

HSP 1 Score: 533.872 bits (1374), Expect = 0.000e+0
Identity = 301/643 (46.81%), Postives = 406/643 (63.14%), Query Frame = 2
Query:   83 ANPTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQR----STPNKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQR--GHQPQPV------FNPGMVNFMMNSNVQ---RPFMARPGNILQ----NRWP--------QTMPYIQPRNIGMPANQNIMMT-------GMPQNQQRRNIMVDPMMNQNRNA-----RPITGNVQLN------QTRPQYNMVANGRQGNNIMYQYP--IQDNQPMLNPDQMKMPDIESQ-IDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAH 1867
            A  + P ASLYVGDLH DVTEA+LYEKF   G VLSIRVCRD++TR+SLGYAYVN+Q   +A+ A+D +NF+ I G+P RIMWSQRDP+ R+SGVGN+FIKNLD SI  K + DTF+ FG I SCKV  DENG SKG+AFV+F  +  A+KAI+ +NG ++ ++ V+V +F  R +R        K+FTN YIKNFG  + D+SL++LF Q G+ +S KVM D  G SKGFGFVS+++HEDA KAV  +NG+ I  K I+VGRA KK ERQ EL+ ++E+ +QER+ +++ GVNLYIKNL + I+DE+LR EF+ FG+ITSAKVML  E+  SKGFGFVCFS+P+EAT+AV+EMNG+IV  KPLYVALAQ+KE+R AHL +Q+ QR  G +  P       F P    + + +  Q   RP    P  + Q     RW         Q MP    ++   P  +++  T       G+P   QR        +  +        + +T + Q        Q       VA         Y+Y   ++   P + P Q   P +  Q  +  T S +A A   E KQ+LGE+++PL+     ++AGKITGM LE+DN+ELL+M+E+  SL+ K+DEA+ VL AH
Sbjct:    4 AASSYPMASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYAFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAKEFTNVYIKNFGEEVDDESLKELFSQFGKTLSVKVMRDPNGKSKGFGFVSYEKHEDANKAVEEMNGKEISGKIIFVGRAQKKVERQAELKRKFEQLKQERISRYQ-GVNLYIKNLDDTIDDEKLRKEFSPFGSITSAKVML--EDGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEERKAHLTNQYMQRVAGMRALPANAILNQFQPAAGGYFVPAVPQAQGRPPYYTPNQLAQMRPNPRWQQGGRPQGFQGMPSAIRQSGPRPTLRHLAPTGNAPASRGLPTTTQRVGSECPDRLAMDFGGAGAAQQGLTDSCQSGGVPTAVQNLAPRAAVAAAAPRAVAPYKYASSVRSPHPAIQPLQAPQPAVHVQGQEPLTASMLAAAPPQEQKQMLGERLFPLIQTMHSNLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAH 642          
BLAST of Polyadenylate-binding protein vs. Ensembl Celegans
Match: pab-1 (Polyadenylate-binding protein [Source:UniProtKB/TrEMBL;Acc:Q7K797])

HSP 1 Score: 476.863 bits (1226), Expect = 2.019e-159
Identity = 290/631 (45.96%), Postives = 370/631 (58.64%), Query Frame = 2
Query:  104 ASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQR----STPNKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIE--DKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQRGHQPQPVFNPGMVNFMMNSNVQ-----RPFMARPGNILQNRWPQTMPYIQPRNIGMPANQNIMMTGMP-QNQQRRNIMVDPMMNQNRNARPITGNVQLNQTRP--QYNMVANGRQGNNIMYQYPIQDNQPMLNPDQM-----------------KMPDIESQI-------------DLTTTSKIANADSMEAKQLLGEKIYPLVSK-YAGDM-AGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVL 1858
            ASLYVGDLHPDV E+IL+EKF   G VLSIRVCRD  TR SLGYAYVN+Q   +A+ AMD +NFE +HG+P RIMWSQRDPA RRSG GNIFIKNLD  I  K I DTF+ FG I SCKV  DE+G SKG+ FV+F  E  A+ AIQ +NG ++  K V+V KF PR QR        K FTN Y+KNFG H + ++L  LF + G I S +VM   EG SKGFGFV+F   E+A  AV  L+   IE  D  ++V RA KK+ER  EL+ ++E+ + ER+Q+++ GVNLY+KNL   ++D+ L+ +F  +GNITSAKVM + EN  SKGFGFVCF  P+EAT AV+EMN K+V  KPLYVA+AQ+KEDR A L SQ+ QR           + +  M+ NV       P    PG  + N   Q   +   + +  P  +  M    P QNQ    +   P + QNR  RP   N Q     P  QYN VA G     +  Q P +   P +    +                 K P    Q              +  T++ +A A   E KQLLGE+IY L+ K Y G   AGKITGM LE+DN+EL+ M+++    + K+DEA  VL
Sbjct:   32 ASLYVGDLHPDVNESILFEKFSAAGPVLSIRVCRDNATRLSLGYAYVNFQQPADAERAMDTMNFEALHGKPMRIMWSQRDPAMRRSGAGNIFIKNLDKVIDNKSIYDTFSLFGNILSCKVAIDEDGFSKGYGFVHFETEEAAQNAIQKVNGMLLAGKKVFVGKFQPRAQRNRELGETAKQFTNVYVKNFGDHYNKETLEKLFAKFGNITSCEVMT-VEGKSKGFGFVAFANPEEAETAVQALHDSTIEGTDLKLHVCRAQKKSERHAELKKKHEQHKAERMQKYQ-GVNLYVKNLDETVDDDGLKKQFESYGNITSAKVMTD-ENGRSKGFGFVCFEKPEEATSAVTEMNSKMVCSKPLYVAIAQRKEDRRAQLASQYMQR-----------LASMRMHGNVPGAAMYNPTQPGPGYYVANPMQQQRNFAGGQQMVRPGGRWGMQNQYPVQNQYM--MAQGPGVYQNRMGRPQ--NQQGGPRGPPQQYNQVAQG----GVRMQGPPRTQNPGVQQQNVPRPPQQQQQQRPAPTGPKAPPQPYQAYQQRPQGIVIGGQEPLTSAMLAAAAPQEQKQLLGERIYALIEKLYPGHKDAGKITGMMLEIDNSELIMMLQDSELFRSKVDEAASVL 640          
BLAST of Polyadenylate-binding protein vs. Ensembl Celegans
Match: pab-1 (Polyadenylate-binding protein [Source:UniProtKB/TrEMBL;Acc:Q7K797])

HSP 1 Score: 476.863 bits (1226), Expect = 2.019e-159
Identity = 290/631 (45.96%), Postives = 370/631 (58.64%), Query Frame = 2
Query:  104 ASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQR----STPNKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIE--DKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQRGHQPQPVFNPGMVNFMMNSNVQ-----RPFMARPGNILQNRWPQTMPYIQPRNIGMPANQNIMMTGMP-QNQQRRNIMVDPMMNQNRNARPITGNVQLNQTRP--QYNMVANGRQGNNIMYQYPIQDNQPMLNPDQM-----------------KMPDIESQI-------------DLTTTSKIANADSMEAKQLLGEKIYPLVSK-YAGDM-AGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVL 1858
            ASLYVGDLHPDV E+IL+EKF   G VLSIRVCRD  TR SLGYAYVN+Q   +A+ AMD +NFE +HG+P RIMWSQRDPA RRSG GNIFIKNLD  I  K I DTF+ FG I SCKV  DE+G SKG+ FV+F  E  A+ AIQ +NG ++  K V+V KF PR QR        K FTN Y+KNFG H + ++L  LF + G I S +VM   EG SKGFGFV+F   E+A  AV  L+   IE  D  ++V RA KK+ER  EL+ ++E+ + ER+Q+++ GVNLY+KNL   ++D+ L+ +F  +GNITSAKVM + EN  SKGFGFVCF  P+EAT AV+EMN K+V  KPLYVA+AQ+KEDR A L SQ+ QR           + +  M+ NV       P    PG  + N   Q   +   + +  P  +  M    P QNQ    +   P + QNR  RP   N Q     P  QYN VA G     +  Q P +   P +    +                 K P    Q              +  T++ +A A   E KQLLGE+IY L+ K Y G   AGKITGM LE+DN+EL+ M+++    + K+DEA  VL
Sbjct:   32 ASLYVGDLHPDVNESILFEKFSAAGPVLSIRVCRDNATRLSLGYAYVNFQQPADAERAMDTMNFEALHGKPMRIMWSQRDPAMRRSGAGNIFIKNLDKVIDNKSIYDTFSLFGNILSCKVAIDEDGFSKGYGFVHFETEEAAQNAIQKVNGMLLAGKKVFVGKFQPRAQRNRELGETAKQFTNVYVKNFGDHYNKETLEKLFAKFGNITSCEVMT-VEGKSKGFGFVAFANPEEAETAVQALHDSTIEGTDLKLHVCRAQKKSERHAELKKKHEQHKAERMQKYQ-GVNLYVKNLDETVDDDGLKKQFESYGNITSAKVMTD-ENGRSKGFGFVCFEKPEEATSAVTEMNSKMVCSKPLYVAIAQRKEDRRAQLASQYMQR-----------LASMRMHGNVPGAAMYNPTQPGPGYYVANPMQQQRNFAGGQQMVRPGGRWGMQNQYPVQNQYM--MAQGPGVYQNRMGRPQ--NQQGGPRGPPQQYNQVAQG----GVRMQGPPRTQNPGVQQQNVPRPPQQQQQQRPAPTGPKAPPQPYQAYQQRPQGIVIGGQEPLTSAMLAAAAPQEQKQLLGERIYALIEKLYPGHKDAGKITGMMLEIDNSELIMMLQDSELFRSKVDEAASVL 640          
BLAST of Polyadenylate-binding protein vs. Ensembl Celegans
Match: pab-1 (Polyadenylate-binding protein [Source:UniProtKB/TrEMBL;Acc:Q7K797])

HSP 1 Score: 476.863 bits (1226), Expect = 2.019e-159
Identity = 290/631 (45.96%), Postives = 370/631 (58.64%), Query Frame = 2
Query:  104 ASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQR----STPNKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIE--DKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQRGHQPQPVFNPGMVNFMMNSNVQ-----RPFMARPGNILQNRWPQTMPYIQPRNIGMPANQNIMMTGMP-QNQQRRNIMVDPMMNQNRNARPITGNVQLNQTRP--QYNMVANGRQGNNIMYQYPIQDNQPMLNPDQM-----------------KMPDIESQI-------------DLTTTSKIANADSMEAKQLLGEKIYPLVSK-YAGDM-AGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVL 1858
            ASLYVGDLHPDV E+IL+EKF   G VLSIRVCRD  TR SLGYAYVN+Q   +A+ AMD +NFE +HG+P RIMWSQRDPA RRSG GNIFIKNLD  I  K I DTF+ FG I SCKV  DE+G SKG+ FV+F  E  A+ AIQ +NG ++  K V+V KF PR QR        K FTN Y+KNFG H + ++L  LF + G I S +VM   EG SKGFGFV+F   E+A  AV  L+   IE  D  ++V RA KK+ER  EL+ ++E+ + ER+Q+++ GVNLY+KNL   ++D+ L+ +F  +GNITSAKVM + EN  SKGFGFVCF  P+EAT AV+EMN K+V  KPLYVA+AQ+KEDR A L SQ+ QR           + +  M+ NV       P    PG  + N   Q   +   + +  P  +  M    P QNQ    +   P + QNR  RP   N Q     P  QYN VA G     +  Q P +   P +    +                 K P    Q              +  T++ +A A   E KQLLGE+IY L+ K Y G   AGKITGM LE+DN+EL+ M+++    + K+DEA  VL
Sbjct:   32 ASLYVGDLHPDVNESILFEKFSAAGPVLSIRVCRDNATRLSLGYAYVNFQQPADAERAMDTMNFEALHGKPMRIMWSQRDPAMRRSGAGNIFIKNLDKVIDNKSIYDTFSLFGNILSCKVAIDEDGFSKGYGFVHFETEEAAQNAIQKVNGMLLAGKKVFVGKFQPRAQRNRELGETAKQFTNVYVKNFGDHYNKETLEKLFAKFGNITSCEVMT-VEGKSKGFGFVAFANPEEAETAVQALHDSTIEGTDLKLHVCRAQKKSERHAELKKKHEQHKAERMQKYQ-GVNLYVKNLDETVDDDGLKKQFESYGNITSAKVMTD-ENGRSKGFGFVCFEKPEEATSAVTEMNSKMVCSKPLYVAIAQRKEDRRAQLASQYMQR-----------LASMRMHGNVPGAAMYNPTQPGPGYYVANPMQQQRNFAGGQQMVRPGGRWGMQNQYPVQNQYM--MAQGPGVYQNRMGRPQ--NQQGGPRGPPQQYNQVAQG----GVRMQGPPRTQNPGVQQQNVPRPPQQQQQQRPAPTGPKAPPQPYQAYQQRPQGIVIGGQEPLTSAMLAAAAPQEQKQLLGERIYALIEKLYPGHKDAGKITGMMLEIDNSELIMMLQDSELFRSKVDEAASVL 640          
BLAST of Polyadenylate-binding protein vs. Ensembl Celegans
Match: pab-1 (Polyadenylate-binding protein [Source:UniProtKB/TrEMBL;Acc:Q7K797])

HSP 1 Score: 476.863 bits (1226), Expect = 2.019e-159
Identity = 290/631 (45.96%), Postives = 370/631 (58.64%), Query Frame = 2
Query:  104 ASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQR----STPNKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIE--DKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQRGHQPQPVFNPGMVNFMMNSNVQ-----RPFMARPGNILQNRWPQTMPYIQPRNIGMPANQNIMMTGMP-QNQQRRNIMVDPMMNQNRNARPITGNVQLNQTRP--QYNMVANGRQGNNIMYQYPIQDNQPMLNPDQM-----------------KMPDIESQI-------------DLTTTSKIANADSMEAKQLLGEKIYPLVSK-YAGDM-AGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVL 1858
            ASLYVGDLHPDV E+IL+EKF   G VLSIRVCRD  TR SLGYAYVN+Q   +A+ AMD +NFE +HG+P RIMWSQRDPA RRSG GNIFIKNLD  I  K I DTF+ FG I SCKV  DE+G SKG+ FV+F  E  A+ AIQ +NG ++  K V+V KF PR QR        K FTN Y+KNFG H + ++L  LF + G I S +VM   EG SKGFGFV+F   E+A  AV  L+   IE  D  ++V RA KK+ER  EL+ ++E+ + ER+Q+++ GVNLY+KNL   ++D+ L+ +F  +GNITSAKVM + EN  SKGFGFVCF  P+EAT AV+EMN K+V  KPLYVA+AQ+KEDR A L SQ+ QR           + +  M+ NV       P    PG  + N   Q   +   + +  P  +  M    P QNQ    +   P + QNR  RP   N Q     P  QYN VA G     +  Q P +   P +    +                 K P    Q              +  T++ +A A   E KQLLGE+IY L+ K Y G   AGKITGM LE+DN+EL+ M+++    + K+DEA  VL
Sbjct:   32 ASLYVGDLHPDVNESILFEKFSAAGPVLSIRVCRDNATRLSLGYAYVNFQQPADAERAMDTMNFEALHGKPMRIMWSQRDPAMRRSGAGNIFIKNLDKVIDNKSIYDTFSLFGNILSCKVAIDEDGFSKGYGFVHFETEEAAQNAIQKVNGMLLAGKKVFVGKFQPRAQRNRELGETAKQFTNVYVKNFGDHYNKETLEKLFAKFGNITSCEVMT-VEGKSKGFGFVAFANPEEAETAVQALHDSTIEGTDLKLHVCRAQKKSERHAELKKKHEQHKAERMQKYQ-GVNLYVKNLDETVDDDGLKKQFESYGNITSAKVMTD-ENGRSKGFGFVCFEKPEEATSAVTEMNSKMVCSKPLYVAIAQRKEDRRAQLASQYMQR-----------LASMRMHGNVPGAAMYNPTQPGPGYYVANPMQQQRNFAGGQQMVRPGGRWGMQNQYPVQNQYM--MAQGPGVYQNRMGRPQ--NQQGGPRGPPQQYNQVAQG----GVRMQGPPRTQNPGVQQQNVPRPPQQQQQQRPAPTGPKAPPQPYQAYQQRPQGIVIGGQEPLTSAMLAAAAPQEQKQLLGERIYALIEKLYPGHKDAGKITGMMLEIDNSELIMMLQDSELFRSKVDEAASVL 640          
BLAST of Polyadenylate-binding protein vs. Ensembl Celegans
Match: pab-1 (Polyadenylate-binding protein [Source:UniProtKB/TrEMBL;Acc:Q7K797])

HSP 1 Score: 476.863 bits (1226), Expect = 2.019e-159
Identity = 290/631 (45.96%), Postives = 370/631 (58.64%), Query Frame = 2
Query:  104 ASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQR----STPNKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIE--DKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQRGHQPQPVFNPGMVNFMMNSNVQ-----RPFMARPGNILQNRWPQTMPYIQPRNIGMPANQNIMMTGMP-QNQQRRNIMVDPMMNQNRNARPITGNVQLNQTRP--QYNMVANGRQGNNIMYQYPIQDNQPMLNPDQM-----------------KMPDIESQI-------------DLTTTSKIANADSMEAKQLLGEKIYPLVSK-YAGDM-AGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVL 1858
            ASLYVGDLHPDV E+IL+EKF   G VLSIRVCRD  TR SLGYAYVN+Q   +A+ AMD +NFE +HG+P RIMWSQRDPA RRSG GNIFIKNLD  I  K I DTF+ FG I SCKV  DE+G SKG+ FV+F  E  A+ AIQ +NG ++  K V+V KF PR QR        K FTN Y+KNFG H + ++L  LF + G I S +VM   EG SKGFGFV+F   E+A  AV  L+   IE  D  ++V RA KK+ER  EL+ ++E+ + ER+Q+++ GVNLY+KNL   ++D+ L+ +F  +GNITSAKVM + EN  SKGFGFVCF  P+EAT AV+EMN K+V  KPLYVA+AQ+KEDR A L SQ+ QR           + +  M+ NV       P    PG  + N   Q   +   + +  P  +  M    P QNQ    +   P + QNR  RP   N Q     P  QYN VA G     +  Q P +   P +    +                 K P    Q              +  T++ +A A   E KQLLGE+IY L+ K Y G   AGKITGM LE+DN+EL+ M+++    + K+DEA  VL
Sbjct:   32 ASLYVGDLHPDVNESILFEKFSAAGPVLSIRVCRDNATRLSLGYAYVNFQQPADAERAMDTMNFEALHGKPMRIMWSQRDPAMRRSGAGNIFIKNLDKVIDNKSIYDTFSLFGNILSCKVAIDEDGFSKGYGFVHFETEEAAQNAIQKVNGMLLAGKKVFVGKFQPRAQRNRELGETAKQFTNVYVKNFGDHYNKETLEKLFAKFGNITSCEVMT-VEGKSKGFGFVAFANPEEAETAVQALHDSTIEGTDLKLHVCRAQKKSERHAELKKKHEQHKAERMQKYQ-GVNLYVKNLDETVDDDGLKKQFESYGNITSAKVMTD-ENGRSKGFGFVCFEKPEEATSAVTEMNSKMVCSKPLYVAIAQRKEDRRAQLASQYMQR-----------LASMRMHGNVPGAAMYNPTQPGPGYYVANPMQQQRNFAGGQQMVRPGGRWGMQNQYPVQNQYM--MAQGPGVYQNRMGRPQ--NQQGGPRGPPQQYNQVAQG----GVRMQGPPRTQNPGVQQQNVPRPPQQQQQQRPAPTGPKAPPQPYQAYQQRPQGIVIGGQEPLTSAMLAAAAPQEQKQLLGERIYALIEKLYPGHKDAGKITGMMLEIDNSELIMMLQDSELFRSKVDEAASVL 640          
BLAST of Polyadenylate-binding protein vs. Ensembl Fly
Match: pAbp (gene:FBgn0265297 transcript:FBtr0086738)

HSP 1 Score: 489.574 bits (1259), Expect = 2.080e-164
Identity = 292/646 (45.20%), Postives = 391/646 (60.53%), Query Frame = 2
Query:  104 ASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQR----STPNKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVI-EDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKS--GVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQF---------QQRGHQPQPVFNPGMVNFMMNSNVQRPFMARPGNILQN--RW-PQTMPYIQPRNI------------------GMPAN----QNIMMTGMPQNQQRRNIMVDPMMNQNRNARPITG------NVQLNQTRPQYNMVANGRQGNNIMYQYP----------IQDNQPMLNPDQMKMPDIESQIDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAHK 1870
            ASLYVGDL  DV E+ L++KF + G VLSIRVCRD++TR+SLGYAYVN+Q   +A+ A+D +NF+ +  +P RIMWSQRDP+ RRSGVGN+FIKNLD +I  K I DTF+ FG I SCKV TDE G SKG+ FV+F  E  A  +I  +NG ++  K VYV KFIPR +R        K FTN Y+KNF     D+ L++ FE  G+I S KVM  ++G SKGFGFV+F+  E A  AV  LNG+ + E K++YV RA KKAERQ+EL+ ++E+ +Q+R   H+S  GVNLY+KNL + I+D+RLR  F+ +GNITSAKVM ++E   SKGFGFVCF+A  EAT AV+E+NG++V  KPLYVALAQ+KE+R AHL SQ+         QQ G   QP    G     + SN QR F ++    ++N  RW PQ  P   P  I                   +P              PQ Q            +N  AR ITG      N+Q+   +     +A G Q     Y+Y           +   QP+  P Q++  + E  I     S +ANA   E KQ+LGE++YP++     ++AGKITGM LE++N+ELL+MIE++ +LK K++EA+ VL  H+
Sbjct:    2 ASLYVGDLPQDVNESGLFDKFSSAGPVLSIRVCRDVITRRSLGYAYVNFQQPADAERALDTMNFDLVRNKPIRIMWSQRDPSLRRSGVGNVFIKNLDRAIDNKAIYDTFSAFGNILSCKVATDEKGNSKGYGFVHFETEEAANTSIDKVNGMLLNGKKVYVGKFIPRKEREKELGEKAKLFTNVYVKNFTEDFDDEKLKEFFEPYGKITSYKVMSKEDGKSKGFGFVAFETTEAAEAAVQALNGKDMGEGKSLYVARAQKKAERQQELKRKFEELKQKR---HESVFGVNLYVKNLDDTIDDDRLRIAFSPYGNITSAKVMTDEEGR-SKGFGFVCFNAASEATCAVTELNGRVVGSKPLYVALAQRKEERKAHLASQYMRHMTGMRMQQLGQIYQPNAASGFFVPTLPSN-QRFFGSQVATQMRNTPRWVPQVRP---PAAIQGVQAGAAAAGGFQGTAGAVPTQFRSAAAGARGAQPQVQGTHAAAAAANNMRNTGARAITGQQTAAPNMQIPGAQ-----IAGGAQQRTSNYKYTSNMRNPPVPQLHQTQPI--PQQLQGKNSEKLI----ASLLANAKPQEQKQILGERLYPMIEHMHANLAGKITGMLLEIENSELLHMIEDQEALKAKVEEAVAVLQVHR 628          
BLAST of Polyadenylate-binding protein vs. Ensembl Fly
Match: pAbp (gene:FBgn0265297 transcript:FBtr0086736)

HSP 1 Score: 489.574 bits (1259), Expect = 2.080e-164
Identity = 292/646 (45.20%), Postives = 391/646 (60.53%), Query Frame = 2
Query:  104 ASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQR----STPNKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVI-EDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKS--GVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQF---------QQRGHQPQPVFNPGMVNFMMNSNVQRPFMARPGNILQN--RW-PQTMPYIQPRNI------------------GMPAN----QNIMMTGMPQNQQRRNIMVDPMMNQNRNARPITG------NVQLNQTRPQYNMVANGRQGNNIMYQYP----------IQDNQPMLNPDQMKMPDIESQIDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAHK 1870
            ASLYVGDL  DV E+ L++KF + G VLSIRVCRD++TR+SLGYAYVN+Q   +A+ A+D +NF+ +  +P RIMWSQRDP+ RRSGVGN+FIKNLD +I  K I DTF+ FG I SCKV TDE G SKG+ FV+F  E  A  +I  +NG ++  K VYV KFIPR +R        K FTN Y+KNF     D+ L++ FE  G+I S KVM  ++G SKGFGFV+F+  E A  AV  LNG+ + E K++YV RA KKAERQ+EL+ ++E+ +Q+R   H+S  GVNLY+KNL + I+D+RLR  F+ +GNITSAKVM ++E   SKGFGFVCF+A  EAT AV+E+NG++V  KPLYVALAQ+KE+R AHL SQ+         QQ G   QP    G     + SN QR F ++    ++N  RW PQ  P   P  I                   +P              PQ Q            +N  AR ITG      N+Q+   +     +A G Q     Y+Y           +   QP+  P Q++  + E  I     S +ANA   E KQ+LGE++YP++     ++AGKITGM LE++N+ELL+MIE++ +LK K++EA+ VL  H+
Sbjct:    2 ASLYVGDLPQDVNESGLFDKFSSAGPVLSIRVCRDVITRRSLGYAYVNFQQPADAERALDTMNFDLVRNKPIRIMWSQRDPSLRRSGVGNVFIKNLDRAIDNKAIYDTFSAFGNILSCKVATDEKGNSKGYGFVHFETEEAANTSIDKVNGMLLNGKKVYVGKFIPRKEREKELGEKAKLFTNVYVKNFTEDFDDEKLKEFFEPYGKITSYKVMSKEDGKSKGFGFVAFETTEAAEAAVQALNGKDMGEGKSLYVARAQKKAERQQELKRKFEELKQKR---HESVFGVNLYVKNLDDTIDDDRLRIAFSPYGNITSAKVMTDEEGR-SKGFGFVCFNAASEATCAVTELNGRVVGSKPLYVALAQRKEERKAHLASQYMRHMTGMRMQQLGQIYQPNAASGFFVPTLPSN-QRFFGSQVATQMRNTPRWVPQVRP---PAAIQGVQAGAAAAGGFQGTAGAVPTQFRSAAAGARGAQPQVQGTHAAAAAANNMRNTGARAITGQQTAAPNMQIPGAQ-----IAGGAQQRTSNYKYTSNMRNPPVPQLHQTQPI--PQQLQGKNSEKLI----ASLLANAKPQEQKQILGERLYPMIEHMHANLAGKITGMLLEIENSELLHMIEDQEALKAKVEEAVAVLQVHR 628          
BLAST of Polyadenylate-binding protein vs. Ensembl Fly
Match: pAbp (gene:FBgn0265297 transcript:FBtr0086740)

HSP 1 Score: 489.574 bits (1259), Expect = 2.080e-164
Identity = 292/646 (45.20%), Postives = 391/646 (60.53%), Query Frame = 2
Query:  104 ASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQR----STPNKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVI-EDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKS--GVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQF---------QQRGHQPQPVFNPGMVNFMMNSNVQRPFMARPGNILQN--RW-PQTMPYIQPRNI------------------GMPAN----QNIMMTGMPQNQQRRNIMVDPMMNQNRNARPITG------NVQLNQTRPQYNMVANGRQGNNIMYQYP----------IQDNQPMLNPDQMKMPDIESQIDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAHK 1870
            ASLYVGDL  DV E+ L++KF + G VLSIRVCRD++TR+SLGYAYVN+Q   +A+ A+D +NF+ +  +P RIMWSQRDP+ RRSGVGN+FIKNLD +I  K I DTF+ FG I SCKV TDE G SKG+ FV+F  E  A  +I  +NG ++  K VYV KFIPR +R        K FTN Y+KNF     D+ L++ FE  G+I S KVM  ++G SKGFGFV+F+  E A  AV  LNG+ + E K++YV RA KKAERQ+EL+ ++E+ +Q+R   H+S  GVNLY+KNL + I+D+RLR  F+ +GNITSAKVM ++E   SKGFGFVCF+A  EAT AV+E+NG++V  KPLYVALAQ+KE+R AHL SQ+         QQ G   QP    G     + SN QR F ++    ++N  RW PQ  P   P  I                   +P              PQ Q            +N  AR ITG      N+Q+   +     +A G Q     Y+Y           +   QP+  P Q++  + E  I     S +ANA   E KQ+LGE++YP++     ++AGKITGM LE++N+ELL+MIE++ +LK K++EA+ VL  H+
Sbjct:    2 ASLYVGDLPQDVNESGLFDKFSSAGPVLSIRVCRDVITRRSLGYAYVNFQQPADAERALDTMNFDLVRNKPIRIMWSQRDPSLRRSGVGNVFIKNLDRAIDNKAIYDTFSAFGNILSCKVATDEKGNSKGYGFVHFETEEAANTSIDKVNGMLLNGKKVYVGKFIPRKEREKELGEKAKLFTNVYVKNFTEDFDDEKLKEFFEPYGKITSYKVMSKEDGKSKGFGFVAFETTEAAEAAVQALNGKDMGEGKSLYVARAQKKAERQQELKRKFEELKQKR---HESVFGVNLYVKNLDDTIDDDRLRIAFSPYGNITSAKVMTDEEGR-SKGFGFVCFNAASEATCAVTELNGRVVGSKPLYVALAQRKEERKAHLASQYMRHMTGMRMQQLGQIYQPNAASGFFVPTLPSN-QRFFGSQVATQMRNTPRWVPQVRP---PAAIQGVQAGAAAAGGFQGTAGAVPTQFRSAAAGARGAQPQVQGTHAAAAAANNMRNTGARAITGQQTAAPNMQIPGAQ-----IAGGAQQRTSNYKYTSNMRNPPVPQLHQTQPI--PQQLQGKNSEKLI----ASLLANAKPQEQKQILGERLYPMIEHMHANLAGKITGMLLEIENSELLHMIEDQEALKAKVEEAVAVLQVHR 628          
BLAST of Polyadenylate-binding protein vs. Ensembl Fly
Match: CG4612 (gene:FBgn0035016 transcript:FBtr0306137)

HSP 1 Score: 150.984 bits (380), Expect = 2.705e-40
Identity = 79/189 (41.80%), Postives = 121/189 (64.02%), Query Frame = 2
Query:  374 IFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQRSTPNK-DFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIED-KTIYVGRAMKKAERQRELRTRYEKTRQERLQQ 934
            I+IKNL+ SI  K + DTF+ FG I +C V  DE+G S+G+ FV+F+ E  A  AI+ +NG +   + V+V KFIPR  R       F N Y+KN      ++ LR++FE  G I S K+M+D+EG S+ FGFV+++  + A+ AV  L+G+ + D K +YV RA+ KAERQ+E+  + E+ ++++  Q
Sbjct:  115 IYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHVVKFIPRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEINRKLEERKRQKAGQ 303          

HSP 2 Score: 109.383 bits (272), Expect = 7.784e-26
Identity = 67/199 (33.67%), Postives = 110/199 (55.28%), Query Frame = 2
Query:  644 YIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGK-IVEGKPLYVALAQKKEDRVAHLRSQFQQRGHQ 1237
            YIKN    + +K++ D F   G I++  V  D++GNS+G+GFV F   E A  A+  +NG +  ++ ++V + + + +R++E  T ++              NLY+KNL  E  ++ LR  F  +G ITS K+ML++E   S+ FGFV +  P  A  AV  ++GK + + K LYVA A  K +R   +  + ++R  Q
Sbjct:  116 YIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHVVKFIPRRDREQEKATHFK--------------NLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEE-GRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEINRKLEERKRQ 299          

HSP 3 Score: 72.7886 bits (177), Expect = 1.630e-13
Identity = 44/172 (25.58%), Postives = 90/172 (52.33%), Query Frame = 2
Query:  110 LYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIM--WSQRD-PAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIRE-KIVYVAKFIPRTQR 613
            +Y+ +L   +    +Y+ F   GN+L+  V +D     S GY +V++     A++A++ +N    + +   ++    +RD    + +   N+++KNL    T + + + F  +G I+S K+  DE G S+ F FV + +   A  A+  ++GK + + K +YVA+ + + +R
Sbjct:  115 IYIKNLERSIDNKAVYDTFSVFGNILNCNVAKD-EDGNSRGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHVVKFIPRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAER 285          
BLAST of Polyadenylate-binding protein vs. Ensembl Fly
Match: CG4612 (gene:FBgn0035016 transcript:FBtr0072346)

HSP 1 Score: 150.984 bits (380), Expect = 2.705e-40
Identity = 79/189 (41.80%), Postives = 121/189 (64.02%), Query Frame = 2
Query:  374 IFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQRSTPNK-DFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIED-KTIYVGRAMKKAERQRELRTRYEKTRQERLQQ 934
            I+IKNL+ SI  K + DTF+ FG I +C V  DE+G S+G+ FV+F+ E  A  AI+ +NG +   + V+V KFIPR  R       F N Y+KN      ++ LR++FE  G I S K+M+D+EG S+ FGFV+++  + A+ AV  L+G+ + D K +YV RA+ KAERQ+E+  + E+ ++++  Q
Sbjct:  115 IYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHVVKFIPRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEINRKLEERKRQKAGQ 303          

HSP 2 Score: 109.383 bits (272), Expect = 7.784e-26
Identity = 67/199 (33.67%), Postives = 110/199 (55.28%), Query Frame = 2
Query:  644 YIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGK-IVEGKPLYVALAQKKEDRVAHLRSQFQQRGHQ 1237
            YIKN    + +K++ D F   G I++  V  D++GNS+G+GFV F   E A  A+  +NG +  ++ ++V + + + +R++E  T ++              NLY+KNL  E  ++ LR  F  +G ITS K+ML++E   S+ FGFV +  P  A  AV  ++GK + + K LYVA A  K +R   +  + ++R  Q
Sbjct:  116 YIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHVVKFIPRRDREQEKATHFK--------------NLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEE-GRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEINRKLEERKRQ 299          

HSP 3 Score: 72.7886 bits (177), Expect = 1.630e-13
Identity = 44/172 (25.58%), Postives = 90/172 (52.33%), Query Frame = 2
Query:  110 LYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIM--WSQRD-PAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIRE-KIVYVAKFIPRTQR 613
            +Y+ +L   +    +Y+ F   GN+L+  V +D     S GY +V++     A++A++ +N    + +   ++    +RD    + +   N+++KNL    T + + + F  +G I+S K+  DE G S+ F FV + +   A  A+  ++GK + + K +YVA+ + + +R
Sbjct:  115 IYIKNLERSIDNKAVYDTFSVFGNILNCNVAKD-EDGNSRGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHVVKFIPRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAER 285          
BLAST of Polyadenylate-binding protein vs. Ensembl Zebrafish
Match: pabpc4 (poly(A) binding protein, cytoplasmic 4 (inducible form) [Source:ZFIN;Acc:ZDB-GENE-030131-9663])

HSP 1 Score: 534.643 bits (1376), Expect = 0.000e+0
Identity = 297/630 (47.14%), Postives = 402/630 (63.81%), Query Frame = 2
Query:   92 TIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQR----STPNKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQR--GHQPQPV------FNPGMVNFM--MNSNVQRPFMARPGNILQ----NRW--------------PQTMPYIQPR-NIG--MPANQNIMMTGMPQNQQRRNIMVDPMMNQNRNARPITGNVQLNQTRPQYNMVANGRQGN-NIMYQYPIQDNQPMLNPDQMKMPDIESQIDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAHKG 1873
            + P ASLYVGDLHPD+TEA+LYEKF   G VLSIRVCRD++TR+SLGYAYVN+Q   +A+ A+D +NF+ + G+P RIMWSQRDP+ R+SGVGN+FIKNLD SI  K + DTF+ FG I SCKV  DENG SKG+AFV+F  +  A++AI+ +NG ++ ++ V+V +F  R +R        K+FTN YIKNFG  + D+ L++LF++ G+ +S KVM D  G S+GFGFVS+++HEDA KAV  +NG  +  KT++VGRA KK ERQ EL+ ++E+ +QER+ +++ GVNLYIKNL + I+DE+LR EF+ FG+ITSAKVML  E   SKGFGFVCFS+P+EAT+AV+EMNG+IV  KPLYVALAQ+KE+R AHL +Q+ QR  G +  P       F P    FM  +     R     P  + Q     RW              P ++    PR NI    P   N    GMP   QR      PM       RP  G +   +  P Y   +  R     ++    +Q  QP ++        ++ Q  L T S +A A   E KQ+LGE+++PL+      +AGKITGM LE+DN+ELL+M+E+  SL+ K++EA+ VL AH+ 
Sbjct:    8 SYPMASLYVGDLHPDITEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVVKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYAFVHFETQDAADRAIEKMNGMLLNDRKVFVGRFKSRKEREAEMGAKAKEFTNVYIKNFGDDMDDQRLKELFDKYGKTLSVKVMTDPTGKSRGFGFVSYEKHEDANKAVEEMNGTELNGKTVFVGRAQKKMERQAELKRKFEQLKQERISRYQ-GVNLYIKNLDDTIDDEKLRKEFSPFGSITSAKVML--EEGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEERKAHLTNQYMQRIAGMRAMPANAIINQFQPAGGYFMPAVPQAQNRTTYYAPNQLTQMRPNPRWQQQGGRGQGGFQGMPSSLRQPGPRANIRHLAPNASNQGPRGMPTGAQRVGGTGQPM-----GPRPAMG-MTTPRAMPPYKYASTIRNTQPQVVQPIALQQAQPAVH--------VQGQEPL-TASMLAAAPPQEQKQMLGERLFPLIQAMHPSLAGKITGMLLEIDNSELLHMLESHESLRSKVEEAVAVLQAHQA 618          
BLAST of Polyadenylate-binding protein vs. Ensembl Zebrafish
Match: pabpc4 (poly(A) binding protein, cytoplasmic 4 (inducible form) [Source:ZFIN;Acc:ZDB-GENE-030131-9663])

HSP 1 Score: 534.643 bits (1376), Expect = 0.000e+0
Identity = 297/630 (47.14%), Postives = 402/630 (63.81%), Query Frame = 2
Query:   92 TIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQR----STPNKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQR--GHQPQPV------FNPGMVNFM--MNSNVQRPFMARPGNILQ----NRW--------------PQTMPYIQPR-NIG--MPANQNIMMTGMPQNQQRRNIMVDPMMNQNRNARPITGNVQLNQTRPQYNMVANGRQGN-NIMYQYPIQDNQPMLNPDQMKMPDIESQIDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAHKG 1873
            + P ASLYVGDLHPD+TEA+LYEKF   G VLSIRVCRD++TR+SLGYAYVN+Q   +A+ A+D +NF+ + G+P RIMWSQRDP+ R+SGVGN+FIKNLD SI  K + DTF+ FG I SCKV  DENG SKG+AFV+F  +  A++AI+ +NG ++ ++ V+V +F  R +R        K+FTN YIKNFG  + D+ L++LF++ G+ +S KVM D  G S+GFGFVS+++HEDA KAV  +NG  +  KT++VGRA KK ERQ EL+ ++E+ +QER+ +++ GVNLYIKNL + I+DE+LR EF+ FG+ITSAKVML  E   SKGFGFVCFS+P+EAT+AV+EMNG+IV  KPLYVALAQ+KE+R AHL +Q+ QR  G +  P       F P    FM  +     R     P  + Q     RW              P ++    PR NI    P   N    GMP   QR      PM       RP  G +   +  P Y   +  R     ++    +Q  QP ++        ++ Q  L T S +A A   E KQ+LGE+++PL+      +AGKITGM LE+DN+ELL+M+E+  SL+ K++EA+ VL AH+ 
Sbjct:    8 SYPMASLYVGDLHPDITEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVVKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYAFVHFETQDAADRAIEKMNGMLLNDRKVFVGRFKSRKEREAEMGAKAKEFTNVYIKNFGDDMDDQRLKELFDKYGKTLSVKVMTDPTGKSRGFGFVSYEKHEDANKAVEEMNGTELNGKTVFVGRAQKKMERQAELKRKFEQLKQERISRYQ-GVNLYIKNLDDTIDDEKLRKEFSPFGSITSAKVML--EEGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEERKAHLTNQYMQRIAGMRAMPANAIINQFQPAGGYFMPAVPQAQNRTTYYAPNQLTQMRPNPRWQQQGGRGQGGFQGMPSSLRQPGPRANIRHLAPNASNQGPRGMPTGAQRVGGTGQPM-----GPRPAMG-MTTPRAMPPYKYASTIRNTQPQVVQPIALQQAQPAVH--------VQGQEPL-TASMLAAAPPQEQKQMLGERLFPLIQAMHPSLAGKITGMLLEIDNSELLHMLESHESLRSKVEEAVAVLQAHQA 618          
BLAST of Polyadenylate-binding protein vs. Ensembl Zebrafish
Match: pabpc1a (poly(A) binding protein, cytoplasmic 1a [Source:ZFIN;Acc:ZDB-GENE-030131-3238])

HSP 1 Score: 534.258 bits (1375), Expect = 0.000e+0
Identity = 299/641 (46.65%), Postives = 398/641 (62.09%), Query Frame = 2
Query:   89 PTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQRSTP----NKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQRGHQPQPVFNPGMVNFMMNSNVQRPFMARPGNILQNRWPQTMPYIQPRNIGMPANQNIMMTGMPQNQQRRNIMVDPMMNQ---NRNARPITGNVQ-LNQTRPQYN---MVANGRQGNNIM---------------------YQY-----------PIQDNQPMLNPDQMKMPDIESQIDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAHKGGEG 1882
            P+ P ASLYVGDLHPDVTEA+LYEKF   G +LSIRVCRD++TR+SLGYAYVN+Q   +A+ A+D +NF+ I GRP RIMWSQRDP+ R+SGVGNIFIKNLD SI  K + DTF+ FG I SCKV  DENG SKG+ FV+F     AE+AI+ +NG ++ ++ V+V +F  R +R        K+FTN YIKNFG  + D+ L+++F + G  +S +VM D  G SKGFGFVSF+ HEDA +AV+ +NG+ +  K +YVGRA KK ERQ EL+ ++E+ +Q+R+ +++ GVNLY+KNL + ++DERLR EF+ FG ITSAKVM+  E   SKGFGFVCFS+P+EAT+AV+EMNG+IV  KPLYVALAQ+KE+R AHL SQ+ QR    + V NP          V  P+   P +     +   +P  Q R    P +Q   +   P+   +    V P   Q   N   RP     Q  N  RP      M+ + R G+  M                     Y+Y           P Q   PM  P       ++ Q  L T S +A A   E KQ+LGE+++PL+      +AGKITGM LE+DN+ELL+M+E+  SL+ K+DEA+ VL AH+  E 
Sbjct:    6 PSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMMTRRSLGYAYVNFQQPADAERALDTMNFDVIKGRPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETHEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAEMGARAKEFTNVYIKNFGEDMDDEKLKEIFCKYGPALSIRVMTDDSGKSKGFGFVSFERHEDAQRAVDEMNGKEMNGKQVYVGRAQKKGERQTELKRKFEQMKQDRMTRYQ-GVNLYVKNLDDGLDDERLRKEFSPFGTITSAKVMM--EGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTSQYMQRMASVRAVPNP----------VLNPYQPAPPS---GYFMAAIPQAQNRAAYYPTSQLAQLRPSPRWATQG---VRPQHFQNMPNAAVRPSAPRPQTFNPVRPASQVPRMMTSQRMGSQAMGPRPAAAGAATGPAQVRGVPQYKYAPGVRNPQQHMPTQPQVPMQQPAV----HVQGQEPL-TASMLAAAPPQEQKQMLGERLFPLIQNMHPSLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEA 621          
BLAST of Polyadenylate-binding protein vs. Ensembl Zebrafish
Match: pabpc1a (poly(A) binding protein, cytoplasmic 1a [Source:ZFIN;Acc:ZDB-GENE-030131-3238])

HSP 1 Score: 534.258 bits (1375), Expect = 0.000e+0
Identity = 299/641 (46.65%), Postives = 398/641 (62.09%), Query Frame = 2
Query:   89 PTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQRSTP----NKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQRGHQPQPVFNPGMVNFMMNSNVQRPFMARPGNILQNRWPQTMPYIQPRNIGMPANQNIMMTGMPQNQQRRNIMVDPMMNQ---NRNARPITGNVQ-LNQTRPQYN---MVANGRQGNNIM---------------------YQY-----------PIQDNQPMLNPDQMKMPDIESQIDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAHKGGEG 1882
            P+ P ASLYVGDLHPDVTEA+LYEKF   G +LSIRVCRD++TR+SLGYAYVN+Q   +A+ A+D +NF+ I GRP RIMWSQRDP+ R+SGVGNIFIKNLD SI  K + DTF+ FG I SCKV  DENG SKG+ FV+F     AE+AI+ +NG ++ ++ V+V +F  R +R        K+FTN YIKNFG  + D+ L+++F + G  +S +VM D  G SKGFGFVSF+ HEDA +AV+ +NG+ +  K +YVGRA KK ERQ EL+ ++E+ +Q+R+ +++ GVNLY+KNL + ++DERLR EF+ FG ITSAKVM+  E   SKGFGFVCFS+P+EAT+AV+EMNG+IV  KPLYVALAQ+KE+R AHL SQ+ QR    + V NP          V  P+   P +     +   +P  Q R    P +Q   +   P+   +    V P   Q   N   RP     Q  N  RP      M+ + R G+  M                     Y+Y           P Q   PM  P       ++ Q  L T S +A A   E KQ+LGE+++PL+      +AGKITGM LE+DN+ELL+M+E+  SL+ K+DEA+ VL AH+  E 
Sbjct:    6 PSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMMTRRSLGYAYVNFQQPADAERALDTMNFDVIKGRPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETHEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAEMGARAKEFTNVYIKNFGEDMDDEKLKEIFCKYGPALSIRVMTDDSGKSKGFGFVSFERHEDAQRAVDEMNGKEMNGKQVYVGRAQKKGERQTELKRKFEQMKQDRMTRYQ-GVNLYVKNLDDGLDDERLRKEFSPFGTITSAKVMM--EGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTSQYMQRMASVRAVPNP----------VLNPYQPAPPS---GYFMAAIPQAQNRAAYYPTSQLAQLRPSPRWATQG---VRPQHFQNMPNAAVRPSAPRPQTFNPVRPASQVPRMMTSQRMGSQAMGPRPAAAGAATGPAQVRGVPQYKYAPGVRNPQQHMPTQPQVPMQQPAV----HVQGQEPL-TASMLAAAPPQEQKQMLGERLFPLIQNMHPSLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEA 621          
BLAST of Polyadenylate-binding protein vs. Ensembl Zebrafish
Match: pabpc1b (poly A binding protein, cytoplasmic 1 b [Source:ZFIN;Acc:ZDB-GENE-050308-1])

HSP 1 Score: 532.717 bits (1371), Expect = 0.000e+0
Identity = 298/633 (47.08%), Postives = 398/633 (62.88%), Query Frame = 2
Query:   89 PTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQRSTP----NKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQRGHQ----PQPVFNPGM----VNFMMNS--NVQRPFMARPGNILQN-----RWPQTMPYIQPRNI-GMPANQNIMMTGMPQNQQ----RRNIMVDPMMNQNRNARPITGNVQLNQTR----------PQYNMVANGRQGNNIMYQYPIQDNQPMLNPDQMKMPDIESQ-IDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAHKGGEG 1882
            P+ P ASLYVGDLH DVTEA+LYEKF   G +LSIRVCRD++TR+SLGYAYVN+Q   +A+ A+D +NF+ I GRP RIMWSQRDP+ R+SGVGNIFIKNLD SI  K + DTF+ FG I SCKV  DENG SKG+ FV+F  +  AE+AI+ +NG ++ ++ V+V +F  R +R        K+FTN YIKNFG  + D  L+D+F + G  +S +VM D+ G S+GFGFVSF+ HEDA +AV+ +NG+ +  K IYVGRA KK ERQ EL+ ++E+ +Q+R+ +++ GVNLY+KNL + I+DERLR EF+ FG ITSAKVM++     SKGFGFVCFS+P+EAT+AV+EMNG+IV  KPLYVALAQ+KE+R AHL +Q+ QR       P PV NP        + M +    Q      P + L       RW  T   ++P++   MP     M    P+ Q     R    V  MM+  R A    G                  PQY    + R     M      + QP +    M+ P +  Q  +  T S +A A   E KQ+LGE+++PL+      +AGKITGM LE+DN+ELL+M+E+  SL+ K+DEA+ VL AH+  E 
Sbjct:    6 PSYPMASLYVGDLHQDVTEAMLYEKFSPAGAILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGRPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDDKLKDIFSKYGNAMSIRVMTDENGKSRGFGFVSFERHEDAQRAVDEMNGKEMNGKLIYVGRAQKKVERQTELKRKFEQMKQDRMTRYQ-GVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMMD--GGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQAQNRAAYYPTSQLAQLRPSPRW--TTQGVRPQHFQNMPGT---MRPSAPRPQTFSTMRPASQVPRMMSTQRVATQTMGPRPSTAAAAASAPPVRGVPQYKYAPSVRNPQQHM------NTQPQVT---MQQPAVHVQGQEPLTASMLAAAPPQEQKQMLGERLFPLIQNMHPSLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEA 620          
BLAST of Polyadenylate-binding protein vs. Ensembl Xenopus
Match: tmem101 (transmembrane protein 101 [Source:Xenbase;Acc:XB-GENE-977590])

HSP 1 Score: 540.421 bits (1391), Expect = 0.000e+0
Identity = 305/633 (48.18%), Postives = 397/633 (62.72%), Query Frame = 2
Query:   89 PTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQRSTP----NKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQRGHQ---PQPVFNPGM---VNFMMNSNVQRPFMARPGNILQ----NRWP---------QTMPYIQPRNIGMPANQNIMMTGMPQNQQRRNIMVDPMMN---QNRNARPITGNVQLN---QTRPQYNMVA---NGRQGNNIMYQYP---IQDNQPMLNPDQMKMPDIESQIDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAHKGGEG 1882
            P+ P ASLYVGDLHPDVTEA+LYEKF   G +LSIRVCRD++TR+SLGYAYVN+Q   +A+ A+D +NF+ I G+P RIMWSQRDP+ R+SGVGNIFIKNLD SI  K + DTF+ FG I SCKV  DENG SKG+ FV+F  +  AE+AI  +NG ++ ++ V+V +F  R +R        K+FTN YIKNFG  + D+ L+++F + G  +S KVM D  G SKGFGFVSF+ HEDA KAV+ +NG+ +  K IYVGRA KK ERQ EL+ ++E+ +Q+R+ +++ GVNLY+KNL + I+DERLR EF+ FG ITSAKVM+  E   SKGFGFVCFS+P+EAT+AV+EMNG+IV  KPLYVALAQ+KE+R AHL +Q+ QR      P PV NP      ++ M  N  R     PG I Q     RW          Q MP         P   + M      NQ  R +    + N   Q    RP T         +T PQY   A   N +Q  N   Q P   +Q  +P+                  T S +A A   E KQ+LGE+++PL+      +AGKITGM LE+DN+ELL+M+E+  SL+ K+DEA+ VL AH+  E 
Sbjct:    6 PSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIDKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKEMFGKYGPALSVKVMTDDNGKSKGFGFVSFERHEDAQKAVDDMNGKDMNGKAIYVGRAQKKVERQTELKRKFEQMKQDRITRYQ-GVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMM--EGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRVPNPVINPYQPPPSSYFMAQN--RAAYYPPGQIAQLRPSPRWTAQGARPHPFQNMPGAIRPTAPRPPTFSTMRPA--SNQVPRVVSAQRVANTSTQTMGPRPTTAAAAATSAVRTVPQYKYAAGVRNPQQHLNTQPQVPAVHVQGQEPL------------------TASMLAAAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEA 612          
BLAST of Polyadenylate-binding protein vs. Ensembl Xenopus
Match: pabpc4 (poly(A) binding protein cytoplasmic 4 [Source:NCBI gene;Acc:548470])

HSP 1 Score: 535.028 bits (1377), Expect = 0.000e+0
Identity = 296/633 (46.76%), Postives = 405/633 (63.98%), Query Frame = 2
Query:   83 ANPTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQR----STPNKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQR--GHQPQPV------FNPGMVNFMMNSNVQRPFMARPGNILQNRWPQTMPYIQPRNIGMPANQNIMMTGMPQNQQRRNIMVDPMMNQ--NRNARPIT-----GNVQLNQTRPQYNMVANGRQGNNIM-------------YQY---PIQDNQPMLNPDQMKMPDIESQ-IDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAHKG 1873
            A  + P ASLYVGDLHPDVTEA+LYEKF   G VLSIRVCRD++TR+SLGYAYVN+Q   +A+ A+D +NF+ I G+P RIMWSQRDP+ R+SGVGN+FIKNLD SI  K + DTF+ FG I SCKV  DENG SKG+AFV+F  +  A++AI+ +NG ++ ++ V+V +F  R +R        K+FTN YIKNFG  + D+ L++ F + G+ +S KVM D  G SKGFGFVSF+ HEDA KAV+ +NG+ +  K ++VGRA KK ERQ EL+ R+E+ +QER+ +++ GVNLYIKNL + I+DE+LR EF+ FG+ITSAKVML  E   SKGFGFVCFS+P+EAT+AV+EMNG+IV  KPLYVALAQ+KE+R AHL +Q+ QR  G +  P       F P    + + +  Q    +RP     N   Q  P  + +  G P     M   + Q+  R+++   P  N    R    +T      ++Q       +N V++  Q                  Y+Y   P+   QP+  P     P +  Q  +  T S +A+A   E KQ+LGE+++PL+      +AGKITGM LE+DN+ELL+M+E+  SL+ K++EA+ VL AH+ 
Sbjct:    4 AASSYPMASLYVGDLHPDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYAFVHFETQDAADRAIEKMNGMLLNDRKVFVGRFKCRREREAELGAKAKEFTNVYIKNFGEDMDDERLKETFSKYGKTLSVKVMTDPSGKSKGFGFVSFERHEDANKAVDDMNGKDVNGKIMFVGRAQKKVERQAELKRRFEQLKQERISRYQ-GVNLYIKNLDDTIDDEKLRKEFSPFGSITSAKVML--EEGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEERKAHLTNQYMQRIAGMRALPANTLINQFQPAPGGYFVPAVPQT--QSRPTYYAPNHMAQIRPGPRWQQTGRPQGFQPMPNTLRQSGPRQSLRHMPPSNTQGTRGIPSVTQRVGKKHIQTCAFALHFNRVSSSTQTMGPRPPVSAPPPRAVPPYKYTRCPLPGVQPLQTPQ----PAVHVQGQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPSLAGKITGMLLEIDNSELLHMLESPESLRSKVEEAVAVLQAHQA 626          
BLAST of Polyadenylate-binding protein vs. Ensembl Xenopus
Match: tmem101 (transmembrane protein 101 [Source:Xenbase;Acc:XB-GENE-977590])

HSP 1 Score: 533.872 bits (1374), Expect = 0.000e+0
Identity = 295/613 (48.12%), Postives = 387/613 (63.13%), Query Frame = 2
Query:   89 PTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQRSTP----NKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQRGHQ---PQPVFNPGMVNFMMNSNVQRP----FMARPGNILQNRWPQTMPYIQPRNIGMPANQNIMMTGMPQNQQRRNIMVDPMMNQNRNARPITGNVQLN---QTRPQYNMVANGRQGNNIMYQYPIQDNQPMLNPDQMKMPDIESQ-IDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAHKGGEG 1882
            P+ P ASLYVGDLHPDVTEA+LYEKF   G +LSIRVCRD++TR+SLGYAYVN+Q   +A+ A+D +NF+ I G+P RIMWSQRDP+ R+SGVGNIFIKNLD SI  K + DTF+ FG I SCKV  DENG SKG+ FV+F  +  AE+AI  +NG ++ ++ V+V +F  R +R        K+FTN YIKNFG  + D+ L+++F + G  +S KVM D  G SKGFGFVSF+ HEDA KAV+ +NG+ +  K IYVGRA KK ERQ EL+ ++E+ +Q+R+ +++ GVNLY+KNL + I+DERLR EF+ FG ITSAKVM+  E   SKGFGFVCFS+P+EAT+AV+EMNG+IV  KPLYVALAQ+KE+R AHL +Q+ QR      P PV NP           Q P    FMA             +P  Q R    P  Q   +   P+   +          Q    RP T         +T PQY   A  R     +   P       +    +  P +  Q  +  T S +A A   E KQ+LGE+++PL+      +AGKITGM LE+DN+ELL+M+E+  SL+ K+DEA+ VL AH+  E 
Sbjct:    6 PSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIDKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKEMFGKYGPALSVKVMTDDNGKSKGFGFVSFERHEDAQKAVDDMNGKDMNGKAIYVGRAQKKVERQTELKRKFEQMKQDRITRYQ-GVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMM--EGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRVPNPVINP----------YQPPPSSYFMA------------AIPPAQNRAAYYPPGQIAQLRPSPRWTAQGARPHPNTSTQTMGPRPTTAAAAATSAVRTVPQYKYAAGVRNPQQHLNTQPQTALYTTILITCLLQPAVHVQGQEPLTASMLAAAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEA 592          
BLAST of Polyadenylate-binding protein vs. Ensembl Xenopus
Match: tmem101 (transmembrane protein 101 [Source:Xenbase;Acc:XB-GENE-977590])

HSP 1 Score: 531.176 bits (1367), Expect = 1.428e-180
Identity = 307/627 (48.96%), Postives = 396/627 (63.16%), Query Frame = 2
Query:   89 PTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQRSTP----NKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQRGHQ---PQPVFNPGMVNFMMNSNVQRP----FMAR--PGNILQ----NRWP----QTMP-YIQPRNIGMPANQNIMMTGMPQNQQRRNIMVDPMMN---QNRNARPITGNVQLN---QTRPQYNMVANGRQGNNIMYQYPIQDNQPMLNPDQMKMPDIESQ-IDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAHKGGEG 1882
            P+ P ASLYVGDLHPDVTEA+LYEKF   G +LSIRVCRD++TR+SLGYAYVN+Q   +A+ A+D +NF+ I G+P RIMWSQRDP+ R+SGVGNIFIKNLD SI  K + DTF+ FG I SCKV  DENG SKG+ FV+F  +  AE+AI  +NG ++ ++ V+V +F  R +R        K+FTN YIKNFG  + D+ L+++F +    +S KVM D  G SKGFGFVSF+ HEDA KAV+ +NG+ +  K IYVGRA KK ERQ EL+ ++E+ +Q+R+ +++ GVNLY+KNL + I+DERLR EF+ FG ITSAKVM+  E   SKGFGFVCFS+P+EAT+AV+EMNG+IV  KPLYVALAQ+KE+R AHL +Q+ QR      P PV NP           Q P    FMA   P  I Q     RW     Q MP  I+P     P   + M      NQ  R +    + N   Q    RP T         +T PQY   A  R   N       Q    M N      P +  Q  +  T S +A A   E KQ+LGE+++PL+      +AGKITGM LE+DN+ELL+M+E+  SL+ K+DEA+ VL AH+  E 
Sbjct:    6 PSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIDKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKEMFGKYA--LSVKVMTDDNGKSKGFGFVSFERHEDAQKAVDDMNGKDMNGKAIYVGRAQKKVERQTELKRKFEQMKQDRITRYQ-GVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMM--EGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRVPNPVINP----------YQPPPSSYFMAAIPPVCIAQLRPSPRWTAQAFQNMPGAIRP-TAPRPPTFSTMRPA--SNQVPRVVSAQRVANTSTQTMGPRPTTAAAAATSAVRTVPQYKYAAGVR---NPQQHLNTQPQVAMQNIHNFPRPAVHVQGQEPLTASMLAAAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEA 610          
BLAST of Polyadenylate-binding protein vs. Ensembl Xenopus
Match: tmem101 (transmembrane protein 101 [Source:Xenbase;Acc:XB-GENE-977590])

HSP 1 Score: 528.865 bits (1361), Expect = 1.389e-179
Identity = 301/630 (47.78%), Postives = 397/630 (63.02%), Query Frame = 2
Query:   89 PTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQRSTP----NKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQRGHQ---PQPVFN----PGMVNFM--MNSNVQRPFMARPGNILQ----NRWP---------QTMP-YIQPRNIGMPANQNIMMTG--MPQNQQRRNIMVDPMMNQNRNARPITGNVQLN---QTRPQYNMVANGRQGNNIMYQYPIQDNQPMLNPDQMKMPDIESQIDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAHKGGEG 1882
            P+ P ASLYVGDLHPDVTEA+LYEKF   G +LSIRVCRD++TR+SLGYAYVN+Q   +A+ A+D +NF+ I G+P RIMWSQRDP+ R+SGVGNIFIKNLD SI  K + DTF+ FG I SCKV  DENG SKG+ FV+F  +  AE+AI  +NG ++ ++ V+V +F  R +R        K+FTN YIKNFG  + D+ L+++F + G  +S KVM D  G SKGFGFVSF+ HEDA KAV+ +NG+ +  K IYVGRA KK ERQ EL+ ++E+ +Q+R+ +++ GVNLY+KNL + I+DERLR EF+ FG ITSAKVM+  E   SKGFGFVCFS+P+EAT+AV+EMNG+IV  KPLYVALAQ+KE+R AHL +Q+ QR      P PV N    P    FM  +     R     PG I Q     RW          Q MP  I+P     P    +      +P+    + +       Q    RP T         +T PQY   A       I+    +Q   P ++        ++ Q  LT  S +A A   E KQ+LGE+++PL+      +AGKITGM LE+DN+ELL+M+E+  SL+ K+DEA+ VL AH+  E 
Sbjct:    6 PSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIDKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKEMFGKYGPALSVKVMTDDNGKSKGFGFVSFERHEDAQKAVDDMNGKDMNGKAIYVGRAQKKVERQTELKRKFEQMKQDRITRYQ-GVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMM--EGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRVPNPVINPYQPPPSSYFMAAIPPAQNRAAYYPPGQIAQLRPSPRWTAQGARPHPFQNMPGAIRPTAPRPPTFSTMRPASNQVPRVVSAQRVGKANTSTQTMGPRPTTAAAAATSAVRTVPQYKYTA---LYTTILITCLLQ---PAVH--------VQGQEPLTA-SMLAAAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEA 616          
BLAST of Polyadenylate-binding protein vs. Ensembl Mouse
Match: Pabpc1 (poly(A) binding protein, cytoplasmic 1 [Source:MGI Symbol;Acc:MGI:1349722])

HSP 1 Score: 545.043 bits (1403), Expect = 0.000e+0
Identity = 302/630 (47.94%), Postives = 399/630 (63.33%), Query Frame = 2
Query:   89 PTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQRSTP----NKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQRGHQ----PQPVFNP-------GMVNFMMNSNVQRPFMARPGNILQ----NRW----PQTMPYI-QPRNIGMPANQNIMMTGMPQNQQRRNIM----VDPMMNQNRNARPITGNVQLN---QTRPQYNMVANGRQGNNIMYQYPIQDNQPMLNPDQMKMPDIESQ-IDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAHKGGEG 1882
            P+ P ASLYVGDLHPDVTEA+LYEKF   G +LSIRVCRD++TR+SLGYAYVN+Q   +A+ A+D +NF+ I G+P RIMWSQRDP+ R+SGVGNIFIKNLD SI  K + DTF+ FG I SCKV  DENG SKG+ FV+F  +  AE+AI+ +NG ++ ++ V+V +F  R +R        K+FTN YIKNFG  + D+ L++LF + G  +S KVM D+ G SKGFGFVSF+ HEDA KAV+ +NG+ +  K IYVGRA KK ERQ EL+ ++E+ +Q+R+ +++ GVNLY+KNL + I+DERLR EF+ FG ITSAKVM+  E   SKGFGFVCFS+P+EAT+AV+EMNG+IV  KPLYVALAQ+KE+R AHL +Q+ QR       P PV NP       G     +     R     P  I Q     RW     +  P+   P  I   A +    T  P + Q   +M    V     Q    RP           +T PQY   A  R     +      + QP +    M+ P +  Q  +  T S +A+A   E KQ+LGE+++PL+      +AGKITGM LE+DN+ELL+M+E+  SL+ K+DEA+ VL AH+  E 
Sbjct:    6 PSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKELFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRYQ-GVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMM--EGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRAAYYPPSQIAQLRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQRVANTSTQTMGPRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHL------NAQPQVT---MQQPAVHVQGQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPSLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEA 622          
BLAST of Polyadenylate-binding protein vs. Ensembl Mouse
Match: Pabpc4 (poly(A) binding protein, cytoplasmic 4 [Source:MGI Symbol;Acc:MGI:2385206])

HSP 1 Score: 537.339 bits (1383), Expect = 0.000e+0
Identity = 296/626 (47.28%), Postives = 401/626 (64.06%), Query Frame = 2
Query:   83 ANPTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQR----STPNKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQR--GHQPQPV------FNPGMVNFMMNSNVQRPFMARPGNILQNRWPQTMPYIQPRNIGMPANQNIMMTGMPQNQQRRNIMVDPMMNQNRNARPITGNVQLNQTRPQY-------NMVAN---------GRQGNNIMYQYP--IQDNQPMLNPDQMKMPDIESQ-IDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAH 1867
            A  + P ASLYVGDLH DVTEA+LYEKF   G VLSIRVCRD++TR+SLGYAYVN+Q   +A+ A+D +NF+ + G+P RIMWSQRDP+ R+SGVGN+FIKNLD SI  K + DTF+ FG I SCKV  DENG SKG+AFV+F  +  A+KAI+ +NG ++ ++ V+V +F  R +R        K+FTN YIKNFG  + D +L++LF Q G+ +S KVM D  G SKGFGFVS+++HEDA KAV  +NG+ +  K I+VGRA KK ERQ EL+ ++E+ +QER+ +++ GVNLYIKNL + I+DE+LR EF+ FG+ITSAKVML  E+  SKGFGFVCFS+P+EAT+AV+EMNG+IV  KPLYVALAQ+KE+R AHL +Q+ QR  G +  P       F P    + + +  Q     RP     N+  Q  P  + +  G P     M + + Q+  R  +         R+  P TGN   ++  P           V N                 Y+Y   ++   P + P Q   P +  Q  +  T S +A A   E KQ+LGE+++PL+     ++AGKITGM LE+DN+ELL+M+E+  SL+ K+DEA+ VL AH
Sbjct:    4 AASSYPMASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVMKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYAFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAKEFTNVYIKNFGEEVDDGNLKELFSQFGKTLSVKVMRDSSGKSKGFGFVSYEKHEDANKAVEEMNGKEMSGKAIFVGRAQKKVERQAELKRKFEQLKQERISRYQ-GVNLYIKNLDDTIDDEKLRREFSPFGSITSAKVML--EDGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEERKAHLTNQYMQRVAGMRALPASAILNQFQPAAGGYFVPAVPQA--QGRPPYYTPNQLAQMRPNPRWQQGGRPQGFQGMPSALRQSGPRPAL---------RHLAP-TGNAPASRGLPTTAQRVGVPTAVPNLAPRAAVAAAAPRAVAPYKYASSVRSPHPAIQPLQAPQPAVHVQGQEPLTASMLAAAPPQEQKQMLGERLFPLIQTMHSNLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAH 613          
BLAST of Polyadenylate-binding protein vs. Ensembl Mouse
Match: Pabpc4 (poly(A) binding protein, cytoplasmic 4 [Source:MGI Symbol;Acc:MGI:2385206])

HSP 1 Score: 536.954 bits (1382), Expect = 0.000e+0
Identity = 294/610 (48.20%), Postives = 397/610 (65.08%), Query Frame = 2
Query:   83 ANPTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQR----STPNKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQR--GHQPQPV------FNPGMVNFMMNSNVQRPFMARPGNILQNRWPQTMPYIQPRNIGMPANQNIMMTGMPQNQQRRNIMVDPMMNQNRNARPITGNVQLNQTRPQYNMVANGRQGNNIMYQYP--IQDNQPMLNPDQMKMPDIESQ-IDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAH 1867
            A  + P ASLYVGDLH DVTEA+LYEKF   G VLSIRVCRD++TR+SLGYAYVN+Q   +A+ A+D +NF+ + G+P RIMWSQRDP+ R+SGVGN+FIKNLD SI  K + DTF+ FG I SCKV  DENG SKG+AFV+F  +  A+KAI+ +NG ++ ++ V+V +F  R +R        K+FTN YIKNFG  + D +L++LF Q G+ +S KVM D  G SKGFGFVS+++HEDA KAV  +NG+ +  K I+VGRA KK ERQ EL+ ++E+ +QER+ +++ GVNLYIKNL + I+DE+LR EF+ FG+ITSAKVML  E+  SKGFGFVCFS+P+EAT+AV+EMNG+IV  KPLYVALAQ+KE+R AHL +Q+ QR  G +  P       F P    + + +  Q     RP     N+  Q  P  + +  G P     M + + Q+  R  +         R+  P TG             VA         Y+Y   ++   P + P Q   P +  Q  +  T S +A A   E KQ+LGE+++PL+     ++AGKITGM LE+DN+ELL+M+E+  SL+ K+DEA+ VL AH
Sbjct:    4 AASSYPMASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVMKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYAFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAKEFTNVYIKNFGEEVDDGNLKELFSQFGKTLSVKVMRDSSGKSKGFGFVSYEKHEDANKAVEEMNGKEMSGKAIFVGRAQKKVERQAELKRKFEQLKQERISRYQ-GVNLYIKNLDDTIDDEKLRREFSPFGSITSAKVML--EDGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEERKAHLTNQYMQRVAGMRALPASAILNQFQPAAGGYFVPAVPQA--QGRPPYYTPNQLAQMRPNPRWQQGGRPQGFQGMPSALRQSGPRPAL---------RHLAP-TGVPTAVPNLAPRAAVAAAAPRAVAPYKYASSVRSPHPAIQPLQAPQPAVHVQGQEPLTASMLAAAPPQEQKQMLGERLFPLIQTMHSNLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAH 597          
BLAST of Polyadenylate-binding protein vs. Ensembl Mouse
Match: Pabpc4 (poly(A) binding protein, cytoplasmic 4 [Source:MGI Symbol;Acc:MGI:2385206])

HSP 1 Score: 531.946 bits (1369), Expect = 1.410e-180
Identity = 294/639 (46.01%), Postives = 402/639 (62.91%), Query Frame = 2
Query:   83 ANPTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQR----STPNKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQR--GHQPQPV------FNPGMVNFMMNSNVQRPFMARPGNILQNRWPQTMPYIQPRNIGMPANQNIMMTGMPQNQQRRNIMVDPMMNQNRNARPITGNVQLNQTRPQYNMVANGRQG-----------------------------NNIMYQYP--IQDNQPMLNPDQMKMPDIESQ-IDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAH 1867
            A  + P ASLYVGDLH DVTEA+LYEKF   G VLSIRVCRD++TR+SLGYAYVN+Q   +A+ A+D +NF+ + G+P RIMWSQRDP+ R+SGVGN+FIKNLD SI  K + DTF+ FG I SCKV  DENG SKG+AFV+F  +  A+KAI+ +NG ++ ++ V+V +F  R +R        K+FTN YIKNFG  + D +L++LF Q G+ +S KVM D  G SKGFGFVS+++HEDA KAV  +NG+ +  K I+VGRA KK ERQ EL+ ++E+ +QER+ +++ GVNLYIKNL + I+DE+LR EF+ FG+ITSAKVML  E+  SKGFGFVCFS+P+EAT+AV+EMNG+IV  KPLYVALAQ+KE+R AHL +Q+ QR  G +  P       F P    + + +  Q     RP     N+  Q  P  + +  G P     M + + Q+  R  +         R+  P TG+   ++    +      +QG                                 Y+Y   ++   P + P Q   P +  Q  +  T S +A A   E KQ+LGE+++PL+     ++AGKITGM LE+DN+ELL+M+E+  SL+ K+DEA+ VL AH
Sbjct:    4 AASSYPMASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVMKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYAFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAKEFTNVYIKNFGEEVDDGNLKELFSQFGKTLSVKVMRDSSGKSKGFGFVSYEKHEDANKAVEEMNGKEMSGKAIFVGRAQKKVERQAELKRKFEQLKQERISRYQ-GVNLYIKNLDDTIDDEKLRREFSPFGSITSAKVML--EDGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEERKAHLTNQYMQRVAGMRALPASAILNQFQPAAGGYFVPAVPQA--QGRPPYYTPNQLAQMRPNPRWQQGGRPQGFQGMPSALRQSGPRPAL---------RHLAP-TGSECPDRLAMDFGGAGAAQQGLTDSCQSGGVPTAVPNLAPRAAVAAAAPRAVAPYKYASSVRSPHPAIQPLQAPQPAVHVQGQEPLTASMLAAAPPQEQKQMLGERLFPLIQTMHSNLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAH 626          
BLAST of Polyadenylate-binding protein vs. Ensembl Mouse
Match: Pabpc4 (poly(A) binding protein, cytoplasmic 4 [Source:MGI Symbol;Acc:MGI:2385206])

HSP 1 Score: 531.561 bits (1368), Expect = 2.880e-180
Identity = 300/643 (46.66%), Postives = 404/643 (62.83%), Query Frame = 2
Query:   83 ANPTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQR----STPNKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQR--GHQPQPV------FNPGMVNFMMNSNVQ---RPFMARPGNILQ----NRWP--------QTMPYIQPRNIGMPANQNIMMT-------GMPQNQQR------RNIMVD----PMMNQNRNARPITGNVQL---NQTRPQYNMVANGRQGNNIMYQYPIQDNQPMLNPDQMKMPDIESQ-IDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAH 1867
            A  + P ASLYVGDLH DVTEA+LYEKF   G VLSIRVCRD++TR+SLGYAYVN+Q   +A+ A+D +NF+ + G+P RIMWSQRDP+ R+SGVGN+FIKNLD SI  K + DTF+ FG I SCKV  DENG SKG+AFV+F  +  A+KAI+ +NG ++ ++ V+V +F  R +R        K+FTN YIKNFG  + D +L++LF Q G+ +S KVM D  G SKGFGFVS+++HEDA KAV  +NG+ +  K I+VGRA KK ERQ EL+ ++E+ +QER+ +++ GVNLYIKNL + I+DE+LR EF+ FG+ITSAKVML  E+  SKGFGFVCFS+P+EAT+AV+EMNG+IV  KPLYVALAQ+KE+R AHL +Q+ QR  G +  P       F P    + + +  Q   RP    P  + Q     RW         Q MP    ++   PA +++  T       G+P   QR        + +D        Q       +G V     N         A  R      Y   ++   P + P Q   P +  Q  +  T S +A A   E KQ+LGE+++PL+     ++AGKITGM LE+DN+ELL+M+E+  SL+ K+DEA+ VL AH
Sbjct:    4 AASSYPMASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVMKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYAFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAKEFTNVYIKNFGEEVDDGNLKELFSQFGKTLSVKVMRDSSGKSKGFGFVSYEKHEDANKAVEEMNGKEMSGKAIFVGRAQKKVERQAELKRKFEQLKQERISRYQ-GVNLYIKNLDDTIDDEKLRREFSPFGSITSAKVML--EDGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEERKAHLTNQYMQRVAGMRALPASAILNQFQPAAGGYFVPAVPQAQGRPPYYTPNQLAQMRPNPRWQQGGRPQGFQGMPSALRQSGPRPALRHLAPTGNAPASRGLPTTAQRVGSECPDRLAMDFGGAGAAQQGLTDSCQSGGVPTAVPNLAPRAAVAAAAPRAVAPYKYASSVRSPHPAIQPLQAPQPAVHVQGQEPLTASMLAAAPPQEQKQMLGERLFPLIQTMHSNLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAH 642          
BLAST of Polyadenylate-binding protein vs. UniProt/SwissProt
Match: sp|P11940|PABP1_HUMAN (Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2)

HSP 1 Score: 546.584 bits (1407), Expect = 0.000e+0
Identity = 303/630 (48.10%), Postives = 399/630 (63.33%), Query Frame = 2
Query:   89 PTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQRSTP----NKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQRGHQ----PQPVFNP-------GMVNFMMNSNVQRPFMARPGNILQ----NRW----PQTMPYI-QPRNIGMPANQNIMMTGMPQNQQRRNIM----VDPMMNQNRNARPITGNVQLN---QTRPQYNMVANGRQGNNIMYQYPIQDNQPMLNPDQMKMPDIESQ-IDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAHKGGEG 1882
            P+ P ASLYVGDLHPDVTEA+LYEKF   G +LSIRVCRD++TR+SLGYAYVN+Q   +A+ A+D +NF+ I G+P RIMWSQRDP+ R+SGVGNIFIKNLD SI  K + DTF+ FG I SCKV  DENG SKG+ FV+F  +  AE+AI+ +NG ++ ++ V+V +F  R +R        K+FTN YIKNFG  + D+ L+DLF + G  +S KVM D+ G SKGFGFVSF+ HEDA KAV+ +NG+ +  K IYVGRA KK ERQ EL+ ++E+ +Q+R+ +++ GVNLY+KNL + I+DERLR EF+ FG ITSAKVM+  E   SKGFGFVCFS+P+EAT+AV+EMNG+IV  KPLYVALAQ+KE+R AHL +Q+ QR       P PV NP       G     +     R     P  I Q     RW     +  P+   P  I   A +    T  P + Q   +M    V     Q    RP           +T PQY   A  R     +      + QP +    M+ P +  Q  +  T S +A+A   E KQ+LGE+++PL+      +AGKITGM LE+DN+ELL+M+E+  SL+ K+DEA+ VL AH+  E 
Sbjct:    6 PSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRYQ-GVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMM--EGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRAAYYPPSQIAQLRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQRVANTSTQTMGPRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHL------NAQPQVT---MQQPAVHVQGQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEA 622          
BLAST of Polyadenylate-binding protein vs. UniProt/SwissProt
Match: sp|P61286|PABP1_BOVIN (Polyadenylate-binding protein 1 OS=Bos taurus OX=9913 GN=PABPC1 PE=2 SV=1)

HSP 1 Score: 546.584 bits (1407), Expect = 0.000e+0
Identity = 303/630 (48.10%), Postives = 399/630 (63.33%), Query Frame = 2
Query:   89 PTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQRSTP----NKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQRGHQ----PQPVFNP-------GMVNFMMNSNVQRPFMARPGNILQ----NRW----PQTMPYI-QPRNIGMPANQNIMMTGMPQNQQRRNIM----VDPMMNQNRNARPITGNVQLN---QTRPQYNMVANGRQGNNIMYQYPIQDNQPMLNPDQMKMPDIESQ-IDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAHKGGEG 1882
            P+ P ASLYVGDLHPDVTEA+LYEKF   G +LSIRVCRD++TR+SLGYAYVN+Q   +A+ A+D +NF+ I G+P RIMWSQRDP+ R+SGVGNIFIKNLD SI  K + DTF+ FG I SCKV  DENG SKG+ FV+F  +  AE+AI+ +NG ++ ++ V+V +F  R +R        K+FTN YIKNFG  + D+ L+DLF + G  +S KVM D+ G SKGFGFVSF+ HEDA KAV+ +NG+ +  K IYVGRA KK ERQ EL+ ++E+ +Q+R+ +++ GVNLY+KNL + I+DERLR EF+ FG ITSAKVM+  E   SKGFGFVCFS+P+EAT+AV+EMNG+IV  KPLYVALAQ+KE+R AHL +Q+ QR       P PV NP       G     +     R     P  I Q     RW     +  P+   P  I   A +    T  P + Q   +M    V     Q    RP           +T PQY   A  R     +      + QP +    M+ P +  Q  +  T S +A+A   E KQ+LGE+++PL+      +AGKITGM LE+DN+ELL+M+E+  SL+ K+DEA+ VL AH+  E 
Sbjct:    6 PSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRYQ-GVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMM--EGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRAAYYPPSQIAQLRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQRVANTSTQTMGPRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHL------NAQPQVT---MQQPAVHVQGQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEA 622          
BLAST of Polyadenylate-binding protein vs. UniProt/SwissProt
Match: sp|P29341|PABP1_MOUSE (Polyadenylate-binding protein 1 OS=Mus musculus OX=10090 GN=Pabpc1 PE=1 SV=2)

HSP 1 Score: 545.043 bits (1403), Expect = 0.000e+0
Identity = 302/630 (47.94%), Postives = 399/630 (63.33%), Query Frame = 2
Query:   89 PTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQRSTP----NKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQRGHQ----PQPVFNP-------GMVNFMMNSNVQRPFMARPGNILQ----NRW----PQTMPYI-QPRNIGMPANQNIMMTGMPQNQQRRNIM----VDPMMNQNRNARPITGNVQLN---QTRPQYNMVANGRQGNNIMYQYPIQDNQPMLNPDQMKMPDIESQ-IDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAHKGGEG 1882
            P+ P ASLYVGDLHPDVTEA+LYEKF   G +LSIRVCRD++TR+SLGYAYVN+Q   +A+ A+D +NF+ I G+P RIMWSQRDP+ R+SGVGNIFIKNLD SI  K + DTF+ FG I SCKV  DENG SKG+ FV+F  +  AE+AI+ +NG ++ ++ V+V +F  R +R        K+FTN YIKNFG  + D+ L++LF + G  +S KVM D+ G SKGFGFVSF+ HEDA KAV+ +NG+ +  K IYVGRA KK ERQ EL+ ++E+ +Q+R+ +++ GVNLY+KNL + I+DERLR EF+ FG ITSAKVM+  E   SKGFGFVCFS+P+EAT+AV+EMNG+IV  KPLYVALAQ+KE+R AHL +Q+ QR       P PV NP       G     +     R     P  I Q     RW     +  P+   P  I   A +    T  P + Q   +M    V     Q    RP           +T PQY   A  R     +      + QP +    M+ P +  Q  +  T S +A+A   E KQ+LGE+++PL+      +AGKITGM LE+DN+ELL+M+E+  SL+ K+DEA+ VL AH+  E 
Sbjct:    6 PSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKELFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRYQ-GVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMM--EGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRAAYYPPSQIAQLRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQRVANTSTQTMGPRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHL------NAQPQVT---MQQPAVHVQGQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPSLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEA 622          
BLAST of Polyadenylate-binding protein vs. UniProt/SwissProt
Match: sp|Q5R8F7|PABP1_PONAB (Polyadenylate-binding protein 1 OS=Pongo abelii OX=9601 GN=PABPC1 PE=2 SV=1)

HSP 1 Score: 544.658 bits (1402), Expect = 0.000e+0
Identity = 302/630 (47.94%), Postives = 398/630 (63.17%), Query Frame = 2
Query:   89 PTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQRSTP----NKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQRGHQ----PQPVFNP-------GMVNFMMNSNVQRPFMARPGNILQ----NRW----PQTMPYI-QPRNIGMPANQNIMMTGMPQNQQRRNIM----VDPMMNQNRNARPITGNVQLN---QTRPQYNMVANGRQGNNIMYQYPIQDNQPMLNPDQMKMPDIESQ-IDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAHKGGEG 1882
            P+ P ASLYVGDLHPD TEA+LYEKF   G +LSIRVCRD++TR+SLGYAYVN+Q   +A+ A+D +NF+ I G+P RIMWSQRDP+ R+SGVGNIFIKNLD SI  K + DTF+ FG I SCKV  DENG SKG+ FV+F  +  AE+AI+ +NG ++ ++ V+V +F  R +R        K+FTN YIKNFG  + D+ L+DLF + G  +S KVM D+ G SKGFGFVSF+ HEDA KAV+ +NG+ +  K IYVGRA KK ERQ EL+ ++E+ +Q+R+ +++ GVNLY+KNL + I+DERLR EF+ FG ITSAKVM+  E   SKGFGFVCFS+P+EAT+AV+EMNG+IV  KPLYVALAQ+KE+R AHL +Q+ QR       P PV NP       G     +     R     P  I Q     RW     +  P+   P  I   A +    T  P + Q   +M    V     Q    RP           +T PQY   A  R     +      + QP +    M+ P +  Q  +  T S +A+A   E KQ+LGE+++PL+      +AGKITGM LE+DN+ELL+M+E+  SL+ K+DEA+ VL AH+  E 
Sbjct:    6 PSYPMASLYVGDLHPDATEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRYQ-GVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMM--EGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRAAYYPPSQIAQLRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQRVANTSTQTMGPRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHL------NAQPQVT---MQQPAVHVQGQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEA 622          
BLAST of Polyadenylate-binding protein vs. UniProt/SwissProt
Match: sp|Q9EPH8|PABP1_RAT (Polyadenylate-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Pabpc1 PE=1 SV=1)

HSP 1 Score: 540.036 bits (1390), Expect = 0.000e+0
Identity = 302/630 (47.94%), Postives = 399/630 (63.33%), Query Frame = 2
Query:   89 PTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQRSTP----NKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQRGHQ----PQPVFNP-------GMVNFMMNSNVQRPFMARPGNILQ----NRW----PQTMPYI-QPRNIGMPANQNIMMTGMPQNQQRRNIM----VDPMMNQNRNARPITGNVQLN---QTRPQYNMVANGRQGNNIMYQYPIQDNQPMLNPDQMKMPDIESQ-IDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAHKGGEG 1882
            P+ P ASLYVGDLHPDVTEA+LYEKF   G +LSIRVCRD++TR+SLGYAYVN+Q   +A+ A+D +NF+ I G+P RIMWSQRDP+ R+SGVGNIFIKNLD SI  K + DTF+ FG I SCKV  DENG SKG+ FV+F  +  AE+AI+ +NG ++ ++ V+V +F  R +R        K+FTN YIKNFG  + D+ L++LF + G  +S KVM D+ G SKGFGFVSF+ HEDA KAV+ +NG+ +  K IYVGRA KK ERQ EL+ ++E+ +Q+R+ +++ GVNLY+KNL + I+DERLR EF+ FG ITSAKVM+  E   SKGFGFVCFS+P+EAT+AV+EMNG+IV  KPLYVALAQ+KE+R AHL +Q+ QR       P PV NP       G     +     R     P  I Q     RW     +  P+   P  I   A +    T  P + Q   +M    V     Q    RP           +T PQY   A  R     +      + QP +    M+ P +  Q  +  T S +A+A   E KQ+LGE+++PL+      +AGKITGM LE+DN+ELL+M+E+  SL+ K+DEA+ VL AH+  E 
Sbjct:    6 PSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKELFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRYQ-GVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMM--EGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRAAYYPPSQIAQLRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQRVANTSTQTMGPRPAAAATAATPAVRTVPQYKYAAGVRNPQQHL------NAQPQVT---MQQPAVHVQGQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPSLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEA 622          
BLAST of Polyadenylate-binding protein vs. TrEMBL
Match: A0A2J7QJ01 (Polyadenylate-binding protein OS=Cryptotermes secundus OX=105785 GN=Pabpc1_1 PE=3 SV=1)

HSP 1 Score: 564.688 bits (1454), Expect = 0.000e+0
Identity = 316/637 (49.61%), Postives = 408/637 (64.05%), Query Frame = 2
Query:   83 ANPTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQR----STPNKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGR-VIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQR---------GHQPQPVFNPGMVNFMMNSNVQRP--FMARPGNILQ----NRW---PQTMPYIQPRNIGMPANQNIMMTGMPQNQQRRNIMVDP-MMNQNRNARPITG-------NVQLNQTRPQYNMVANGRQGNNIMYQYPIQDNQPMLNPDQ----MKMPDIESQIDL-----TTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAHKG 1873
              P  P ASLYVGDLH DVTEA+L+EKF T G VLSIRVCRD++TR+SLGYAYVN+Q   +A+ A+D +NF+ I GRP RIMWSQRDP+ R+SGVGN+FIKNLD SI  K + DTF+ FG I SCKV  DE G SKG+ FV+F  E  A K+I+ +NG ++  K V+V KF+PR +R        K FTN YIKNFG   +D+ LR++FE+ G+I S KVM   +G S+GFGFV+F+E EDA +AV+ LNG+ +IE K +YVGRA KKAERQ+EL+ ++E+ + ERL +++ GVNLY+KNL + I+DERLR EF  +G ITSAKVML  E   SKGFGFVCFS+P+EAT+AV+EMNG+IV  KPLYVALAQ+KEDR AHL SQ+ QR         G Q   +F PG         + +P  F   P  + Q     RW   PQ  P  Q    G P  Q    T        R     P  M    +ARPITG       N+Q     P  ++ A GRQ N   Y+Y       M NP Q     + P ++  + +      T S +A A   E KQ+LGE+++PL+ +   D+AGKITGM LE+DN+ELL+M+E+  SLK K++EA+ VL AH+ 
Sbjct:    4 GGPNYPMASLYVGDLHHDVTEAMLFEKFSTAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDMIKGRPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKAMYDTFSAFGNILSCKVAQDETGASKGYGFVHFETEEAATKSIEKVNGMLLNGKKVFVGKFVPRKEREKELGEKAKLFTNVYIKNFGEDFNDELLREMFEKYGQITSHKVMSKDDGKSRGFGFVAFEEPEDAERAVDELNGKELIEGKPLYVGRAQKKAERQQELKRKFEQLKIERLNRYQ-GVNLYVKNLDDTIDDERLRKEFTPYGTITSAKVML--EEGRSKGFGFVCFSSPEEATKAVTEMNGRIVGTKPLYVALAQRKEDRKAHLASQYMQRMANMRMQQMGTQ---MFQPGGAGGYFVPTLPQPQRFYG-PAQMAQIRATPRWPAQPQVRPSAQAGASGFPNMQGPFRTA------PRAPGAQPGSMRNALSARPITGQQPVGAANIQGRPMAPTVSVSAQGRQTN---YKYTAN----MRNPPQPIPVAQQPPVQQAVHIQGQEPLTASMLAAAPPQEQKQMLGERLFPLIQRMYPDLAGKITGMLLEIDNSELLHMLEHHESLKAKVEEAVAVLQAHQA 620          
BLAST of Polyadenylate-binding protein vs. TrEMBL
Match: A0A087T5F4 (Polyadenylate-binding protein (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_02472 PE=3 SV=1)

HSP 1 Score: 564.303 bits (1453), Expect = 0.000e+0
Identity = 316/647 (48.84%), Postives = 411/647 (63.52%), Query Frame = 2
Query:   83 ANPTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQR----STPNKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQR--GHQPQ--PVFNPGMVNFMMNS--NVQRPFMARPGNILQN-RWPQTMPYIQPRNIGMPANQNIMMTGMPQNQQRRNIMV----DPMMNQNRNARPITGN-------------------VQLNQTRPQYNMVANGRQGNNIMYQYPIQDNQPMLNPDQ--------------MKMPDIESQIDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAHKGGE 1879
            + P  P ASLYVGDLH DVTEA+L+EKF T G VLSIRVCRDL+TR+SLGYAYVN+Q   +A+ A+D +NF+ + GRP RIMWSQRDP+ R+SGVGN+FIKNLD SI  K + DTF+ FG I SCKV TDE   SKG+ FV+F  E  A  AI  +NG ++  + V+V KFIPR +R        + F N YIKNFG  L D+ LR+LFE+ G+I SAKVM D+ G +KGFGFVSF+E E+A KAV  LNG+ +  KT+YVGRA KK+ER  EL+ R+E  + ER+ +++ GVNLY+KNL + I+DERLR EFA FG ITSAKVM +  N  SKGFGFVCFS+P+EAT+AV+EMNG+IV  KPLYVALAQ+KE+R AHL SQ+ QR  G + Q   +FNPG   + + +    QR +  +   +    RWP T P ++P   G PA     M   P  +      V    +P M    NARPITG                      +   RP     AN  Q     Y+Y       M NP Q               +   I+ Q  L T S +A+A++ E KQ+LGE+++P++ ++  +MAGKITGM LE+DN+ELL+M+E++ SLK K++EA+ VL AH   E
Sbjct:    4 SGPNYPIASLYVGDLHADVTEAMLFEKFSTAGPVLSIRVCRDLITRRSLGYAYVNFQQPVDAERALDTMNFDTVKGRPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKAMYDTFSAFGNILSCKVATDEESTSKGYGFVHFETEEAANNAIMKVNGMLLNGRKVFVGKFIPRKEREKLLGEKARRFMNVYIKNFGDDLDDEKLRELFEKYGKITSAKVMTDELGKAKGFGFVSFEEPENAEKAVEDLNGKELNGKTLYVGRAQKKSERAAELKRRFELMKMERMNRYQ-GVNLYVKNLDDAIDDERLRKEFAPFGTITSAKVMTDG-NGRSKGFGFVCFSSPEEATKAVTEMNGRIVVSKPLYVALAQRKEERKAHLASQYMQRMAGMRMQLGQMFNPGSAGYFVPTMPQAQRSYFPQMAQMRATPRWP-TQPQMRPG--GQPAAAFQAMQSAPFARAATRPAVAASQNPGMRAGMNARPITGQQPTAAAAAASGTRVAAMGPTGVGAARPTSMASANVNQ-RPATYKY----TSNMRNPPQPQTVQQAVTQQAVAQQAVHIQGQEPL-TASMLADANAQEQKQMLGERLFPVIHRWYPEMAGKITGMLLEIDNSELLHMLEHQESLKAKVEEAVAVLQAHHAKE 639          
BLAST of Polyadenylate-binding protein vs. TrEMBL
Match: A0A2J7QKS7 (Polyadenylate-binding protein OS=Cryptotermes secundus OX=105785 GN=Pabpc1_0 PE=3 SV=1)

HSP 1 Score: 562.762 bits (1449), Expect = 0.000e+0
Identity = 316/637 (49.61%), Postives = 406/637 (63.74%), Query Frame = 2
Query:   83 ANPTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQR----STPNKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGR-VIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQR---------GHQPQPVFNPGMVNFMMNSNVQRP--FMARPGNILQ----NRW---PQTMPYIQPRNIGMPANQNIMMTGMPQNQQRRNIMVDP-MMNQNRNARPITG-------NVQLNQTRPQYNMVANGRQGNNIMYQYPIQDNQPMLNPDQ----MKMPDIESQIDL-----TTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAHKG 1873
              P  P ASLYVGDLH DVTEA+L+EKF T G VLSIRVCRD++TR+SLGYAYVN+Q   +A+ A+D +NF+ I GRP RIMWSQRDP+ R+SGVGN+FIKNLD SI  K + DTF+ FG I SCKV  DE G SKG+ FV+F  E  A K+I+ +NG ++  K V+V KF+PR +R        K FTN YIKNFG    D+ LR++FE+ G I S KVM   +G S+GFGFV+F+E EDA +AV+ LNG+ +IE K +YVGRA KKAERQ+EL+ ++E+ + ERL +++ GVNLY+KNL + I+DERLR EF  +G ITSAKVML  E   SKGFGFVCFS+P+EAT+AV+EMNG+IV  KPLYVALAQ+KEDR AHL SQ+ QR         G Q   +F PG         + +P  F   P  + Q     RW   PQ  P  Q    G P  Q    T        R     P  M    +ARPITG       N+Q     P  ++ A GRQ N   Y+Y       M NP Q     + P ++  + +      T S +A A   E KQ+LGE+++PL+ +   D+AGKITGM LE+DN+ELL+M+E+  SLK K++EA+ VL AH+ 
Sbjct:    4 GGPNYPMASLYVGDLHHDVTEAMLFEKFSTAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDMIKGRPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKAMYDTFSAFGNILSCKVAQDETGASKGYGFVHFETEEAATKSIEKVNGMLLNGKKVFVGKFVPRKEREKELGEKAKLFTNVYIKNFGEDFSDELLREMFEKYGRITSHKVMSKDDGKSRGFGFVAFEEPEDAERAVDELNGKELIEGKPLYVGRAQKKAERQQELKRKFEQLKIERLNRYQ-GVNLYVKNLDDTIDDERLRKEFTPYGTITSAKVML--EEGRSKGFGFVCFSSPEEATKAVTEMNGRIVGTKPLYVALAQRKEDRKAHLASQYMQRMANMRMQQMGTQ---MFQPGGAGGYFVPTLPQPQRFYG-PAQMAQIRATPRWPAQPQVRPNAQGGASGFPNMQGPFRTA------PRAPGAQPGSMRNALSARPITGQQPVGAANIQGRPMAPTVSVSAQGRQTN---YKYTAN----MRNPPQPIPVAQQPPVQQAVHIQGQEPLTASMLAAAPPQEQKQMLGERLFPLIQRMYPDLAGKITGMLLEIDNSELLHMLEHHESLKAKVEEAVAVLQAHQA 620          
BLAST of Polyadenylate-binding protein vs. TrEMBL
Match: A0A1W7R9X3 (Polyadenylate-binding protein OS=Hadrurus spadix OX=141984 PE=3 SV=1)

HSP 1 Score: 561.607 bits (1446), Expect = 0.000e+0
Identity = 314/643 (48.83%), Postives = 404/643 (62.83%), Query Frame = 2
Query:   89 PTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQRSTPNKD----FTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQR--GHQPQP----VFNPGMVNFMMNSNVQRPFMARPGNILQ----NRWPQTMPYIQPRN--IGMPANQNIMMTGMPQNQQRRNIMVDPM---MNQNRNARPITGN--------------------------VQLNQTRPQYNMVANGRQGNNIMYQYPIQDNQPMLNPDQMKMPDIESQIDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAHKGGEG 1882
            P  P ASLYVGDLHPD TEA+L+EKF + G VLSIRVCRD++TR+SLGYAYVN+Q   +A+ A+D +NF+ I GRP RIMWSQRDP+ R+SGVGN+FIKNLD SI  K + DTF+ FG I SCKV TD+ G SKG+ FV+F  E  A  AI  +NG ++  + VYV KFIPR +R     D    F N YIKNF   L D  LR++FE+ G I SAKVM   +G SKGFGFVSF++ E A KAV+ LNG+ +  K +YVGRA KKAERQ EL+ R+E+ + ER+ +++ GVNLY+KNL + I+DERLR EF+ FG ITSAKVM +  N+ S+GFGFVCFS+P+EAT+AV+EMNG+I+  KPLYVALAQ+KEDR AHL SQ+ QR  G + QP    +F P    + + +  Q      P  + Q     RW    P ++P N   G PA Q    T   +   R N+        M  N NARPITG                             + Q  P Y   AN R   +   Q P+          Q     I+ Q  L TTS +A+A+  E KQ+LGE+++PL+ ++  DMAGKITGM LE+DN+ELL+M+E+  +LK K+DEA+ VL AH   E 
Sbjct:    6 PNCPIASLYVGDLHPDGTEAMLFEKFSSAGPVLSIRVCRDMITRRSLGYAYVNFQHPQDAERALDTMNFDLIKGRPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKAMYDTFSAFGNILSCKVATDDEGNSKGYGFVHFETEEAANNAIAKVNGMLLNGRKVYVGKFIPRREREKMLGDKARRFMNVYIKNFADDLDDDKLREMFEKYGAITSAKVMASDDGKSKGFGFVSFEDPESAEKAVDELNGKELGGKQLYVGRAQKKAERQAELKRRFEQLKMERMSRYQ-GVNLYVKNLDDAIDDERLRKEFSPFGTITSAKVMTDAHNH-SRGFGFVCFSSPEEATKAVTEMNGRIMVSKPLYVALAQRKEDRRAHLASQYVQRMQGMRMQPHLGQIFQPSGTGYFVPTMPQTQRNYFPPQLQQMRATPRW-TAQPPLRPGNQPAGFPAIQPTQFT---RPTPRPNVAAAAQAAGMRANMNARPITGQQTAAAPGRRMAPLATVAPATRATLPAANVAQPCPAYKYTANMRNPPSATMQAPVV---------QQAAVHIQGQEPL-TTSMLADANPQEQKQMLGERLFPLIHRWYPDMAGKITGMLLEIDNSELLHMLEHHEALKAKVDEAVAVLQAHHAKEA 632          
BLAST of Polyadenylate-binding protein vs. TrEMBL
Match: A0A067REV7 (Polyadenylate-binding protein OS=Zootermopsis nevadensis OX=136037 GN=L798_01722 PE=3 SV=1)

HSP 1 Score: 559.296 bits (1440), Expect = 0.000e+0
Identity = 314/633 (49.61%), Postives = 404/633 (63.82%), Query Frame = 2
Query:   83 ANPTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQR----STPNKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGR-VIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQR---------GHQPQPVFNPGMVNFMMNSNVQRP---FMARPGNILQN--RW---PQTMPYIQPRNIGMPANQNIMMTGMPQNQQRRNIMVDP-MMNQNRNARPITGNVQLN----QTRPQYNMVANGRQGNNIMYQYPIQDNQPMLNPDQ----MKMPDIESQIDL-----TTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAHKG 1873
              P  P ASLYVGDLH DVTEA+L+EKF T G VLSIRVCRD++TR+SLGYAYVN+Q   +A+ A+D +NF+ I GRP RIMWSQRDP+ R+SGVGN+FIKNLD SI  K + DTF+ FG I SCKV  DE G SKG+ FV+F  E  A K+I+ +NG ++  K V+V KF+PR +R        K FTN YIKNFG    D+ LR++FE+ G I S KVM   +G S+GFGFV+F+E EDA +AV+ LNG+ +IE K +YVGRA KKAERQ+EL+ ++E+ + ERL +++ GVNLY+KNL + I+DERLR EF  FG ITSAKVML  E   SKGFGFVCFS+P+EAT+AV+EMNG+IV  KPLYVALAQ+KEDR AHL SQ+ QR         G Q   +F PG         + +P   +   P   ++   RW   PQ  P  Q    G P  Q    T        R   V P  M    +ARPITG   +     Q RP    V+   QG    Y+Y       M NP Q     + P ++  + +      T S +A A   E KQ+LGE+++PL+ +   D+AGKITGM LE+DN+ELL+M+E+  SLK K++EA+ VL AH+ 
Sbjct:    4 GGPNYPMASLYVGDLHHDVTEAMLFEKFSTAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDMIKGRPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKAMYDTFSAFGNILSCKVAQDETGASKGYGFVHFETEEAAIKSIEKVNGMLLNGKKVFVGKFVPRKEREKELGEKAKLFTNVYIKNFGEDFSDELLREMFEKYGRITSHKVMNKDDGKSRGFGFVAFEEPEDAERAVDELNGKELIEGKPLYVGRAQKKAERQQELKRKFEQLKIERLNRYQ-GVNLYVKNLDDTIDDERLRKEFTPFGTITSAKVML--EEGRSKGFGFVCFSSPEEATKAVTEMNGRIVGTKPLYVALAQRKEDRKAHLASQYMQRMANMRMQQMGTQ---MFQPGGAGGYFVPTLPQPQRFYGPTPMTQIRATPRWPAQPQVRPNAQGGASGFPNMQGPFRTA------PRAPGVQPGSMRNALSARPITGQQPVGAANIQGRPMAPTVSVNAQGRPTNYKYTAN----MRNPPQPMPVAQQPPVQQAVHIQGQEPLTASMLAAAPPQEQKQMLGERLFPLIQRMYPDLAGKITGMLLEIDNSELLHMLEHHESLKAKVEEAVAVLQAHQA 620          
BLAST of Polyadenylate-binding protein vs. Ensembl Cavefish
Match: ENSAMXT00000035946.1 (polyadenylate-binding protein 1-like [Source:NCBI gene;Acc:103030422])

HSP 1 Score: 533.102 bits (1372), Expect = 0.000e+0
Identity = 300/634 (47.32%), Postives = 399/634 (62.93%), Query Frame = 2
Query:   89 PTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQRSTP----NKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQRGHQ----PQPVFNPGM----VNFMMNS--NVQRPFMARPGNILQN-----RWP---------QTMP-YIQPRNIGMPANQNIMMTGMPQNQQRRNIMVDPMMNQNRNARPITGNVQLN----QTRPQYNM---VANGRQGNNIMYQYPIQDNQPMLNPDQMKMPDIESQIDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAHKGGEG 1882
            P+ P ASLYVGDLH DVTEA+LYEKF   G +LSIRVCRD++TR+SLGYAYVN+Q   +A+ A+D +NF+ I GRP RIMWSQRDP+ R+SGVGNIFIKNLD SI  K + DTF+ FG I SCKV  DENG SKG+ FV+F     AE+AI+ +NG ++ ++ V+V +F  R +R        K+FTN YIKNFG  + D+ L+D+F + G  +S +VM D+ G SKGFGFVSF+ HEDA +AV+ +NG+ +  K +YVGRA KK ERQ EL+ ++E+ +Q+R+ +++ GVNLY+KNL + ++DERLR EF+ FG ITSAKVM+  E   SKGFGFVCFS+P+EAT+AV+EMNG+IV  KPLYVALAQ+KE+R AHL +Q+ QR       P PV NP        + M +    Q      P + L       RW          Q MP  I+P     P  Q         +Q  R +    M +Q    RP            +  PQY     V N +Q      Q P+Q  QP ++        ++ Q  L T S +A A   E KQ+LGE+++PL+      +AGKITGM LE+DN+ELL+M+E+  SL+ K+DEA+ VL AH+  E 
Sbjct:    6 PSYPMASLYVGDLHQDVTEAMLYEKFSPAGPILSIRVCRDMMTRRSLGYAYVNFQQPADAERALDTMNFDVIKGRPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETHEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAEMGARAKEFTNVYIKNFGEDMDDEKLKDVFGKYGPALSIRVMTDESGKSKGFGFVSFERHEDAQRAVDEMNGKELNGKQVYVGRAQKKGERQTELKRKFEQMKQDRMTRYQ-GVNLYVKNLDDGLDDERLRKEFSPFGTITSAKVMM--EGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVLNPYQPAPPSGYFMAAIPQAQNRAAYYPSSQLAQLRPSPRWATQSVRPQHFQNMPNAIRP---AAPRPQTFSTIRPTASQLPRMMTSQRMASQPMGPRPTGAGAATGTAPVRAVPQYKYGPGVRNPQQHLGAQPQVPMQ--QPAVH--------VQGQEPL-TASMLAAAPPQEQKQMLGERLFPLIQNMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEA 621          
BLAST of Polyadenylate-binding protein vs. Ensembl Cavefish
Match: pabpc1b (poly(A) binding protein cytoplasmic 1 [Source:NCBI gene;Acc:103023186])

HSP 1 Score: 532.717 bits (1371), Expect = 0.000e+0
Identity = 297/631 (47.07%), Postives = 397/631 (62.92%), Query Frame = 2
Query:   89 PTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQRSTP----NKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQRGHQ----PQPVFNPGM----VNFMMNS--NVQRPFMARPGNILQN-----RWP---------QTMPYIQPRNIGMPANQNIMMTGMPQNQQRRNIMVDPMMNQNRNARPITGNVQLN----QTRPQYNMVANGRQGNNIMYQYPIQDNQPMLNPDQMKMPDIESQ-IDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAHKGGEG 1882
            P+ P ASLYVGDLH DVTEA+LYEKF   G +LSIRVCRD++TR+SLGYAYVN+Q   +A+ A+D +NF+ I GRP RIMWSQRDP+ R+SGVGNIFIKNLD SI  K + DTF+ FG I SCKV  DENG SKG+ FV+F  +  AE+AI+ +NG ++ ++ V+V +F  R +R        K+FTN YIKNFG  + D+ L+++F + G  +S +VM D  G S+GFGFVSF+ HEDA KAV+ +NG+ +  K IYVGRA KK ERQ EL+ ++E+ +Q+R+ +++ GVNLY+KNL + I+DERLR EF+ FG ITSAKVM++     SKGFGFVCFS+P+EAT+AV+EMNG+IV  KPLYVALAQ+KE+R AHL +Q+ QR       P PV NP        + M +    Q      P + L       RW          Q MP     +   P     M    P +Q  R +    +  Q    RP T          ++ PQY   A  R     M      + QP ++   M+ P +  Q  +  T S +A A   E KQ+LGE+++PL+      +AGKITGM LE+DN+ELL+M+E+  SL+ K+DEA+ VL AH+  E 
Sbjct:    6 PSYPMASLYVGDLHQDVTEAMLYEKFSPAGAILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGRPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDEKLKEVFSKYGNSMSIRVMTDDSGKSRGFGFVSFERHEDAQKAVDEMNGKELNGKLIYVGRAQKKVERQTELKRKFEQMKQDRMTRYQ-GVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMMD--GGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVLNPYQPAPPSGYFMAAIPQAQNRAAYYPTSQLAQLRPSPRWATQGVRPQHFQNMPATMRPSAPRPQTFGAM---RPPSQVPRMMSAQRVAAQTMGPRPATAAAAAAAAPVRSVPQYKYAAGVRNPQQHM------NTQPQVS---MQQPAVHVQGQEPLTASMLAAAPPQEQKQMLGERLFPLIQNMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEA 620          
BLAST of Polyadenylate-binding protein vs. Ensembl Cavefish
Match: ENSAMXT00000018970.2 (polyadenylate-binding protein 1-like [Source:NCBI gene;Acc:103030422])

HSP 1 Score: 530.406 bits (1365), Expect = 0.000e+0
Identity = 286/603 (47.43%), Postives = 393/603 (65.17%), Query Frame = 2
Query:   89 PTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQRSTP----NKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQRGHQPQPVFNPGMVNFMMNSNVQRPFMARPGNILQNRWPQTMPYIQPRNIGMPANQNIMMTGMPQNQQRRNIMVDPMMNQNRNARPITGNVQLNQTRPQYNM-VANGRQGNNIMYQYPIQDNQPMLNPDQMKMPDIESQIDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAHKGGEG 1882
            P+ P ASLYVGDLH DVTEA+LYEKF   G +LSIRVCRD++TR+SLGYAYVN+Q   +A+ A+D +NF+ I GRP RIMWSQRDP+ R+SGVGNIFIKNLD SI  K + DTF+ FG I SCKV  DENG SKG+ FV+F     AE+AI+ +NG ++ ++ V+V +F  R +R        K+FTN YIKNFG  + D+ L+D+F + G  +S +VM D+ G SKGFGFVSF+ HEDA +AV+ +NG+ +  K +YVGRA KK ERQ EL+ ++E+ +Q+R+ +++ GVNLY+KNL + ++DERLR EF+ FG ITSAKVM+  E   SKGFGFVCFS+P+EAT+AV+EMNG+IV  KPLYVALAQ+KE+R AHL +Q+ QR    + V NP          V  P+   P +     +   +P  Q R    P++Q   +   P+   +    V P     R  R  T ++    T   Y    A+     +++      ++ P ++        ++ Q  L T S +A A   E KQ+LGE+++PL+      +AGKITGM LE+DN+ELL+M+E+  SL+ K+DEA+ VL AH+  E 
Sbjct:    6 PSYPMASLYVGDLHQDVTEAMLYEKFSPAGPILSIRVCRDMMTRRSLGYAYVNFQQPADAERALDTMNFDVIKGRPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETHEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAEMGARAKEFTNVYIKNFGEDMDDEKLKDVFGKYGPALSIRVMTDESGKSKGFGFVSFERHEDAQRAVDEMNGKELNGKQVYVGRAQKKGERQTELKRKFEQMKQDRMTRYQ-GVNLYVKNLDDGLDDERLRKEFSPFGTITSAKVMM--EGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNP----------VLNPYQPAPPS---GYFMAAIPQAQNRAAYYPSSQLAQLRPSPRWATQS---VRP----QRKTRAHTHHIHAQHTHTIYTADTAHTLLRRSLLGSMKAVNSLPAVH--------VQGQEPL-TASMLAAAPPQEQKQMLGERLFPLIQNMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEA 575          
BLAST of Polyadenylate-binding protein vs. Ensembl Cavefish
Match: pabpc1l (embryonic polyadenylate-binding protein B-like [Source:NCBI gene;Acc:103022532])

HSP 1 Score: 521.161 bits (1341), Expect = 7.940e-177
Identity = 286/628 (45.54%), Postives = 402/628 (64.01%), Query Frame = 2
Query:   83 ANPTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQR----STPNKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQRGHQPQPVFNPGMVNFMMNSNVQRPFMARP-GNILQNRWPQTMPYIQ-----PRNIGMPANQNIMMTGMPQNQQRRNIMVDPMMNQNRNARPITGNVQLNQTRPQYNMVANGRQ-GNNIM-----YQYP--IQDNQ------PMLNPDQMKMPDIESQIDL-----TTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAHKGGE 1879
            + P  P ASLYVGDLHPDVTEA+LY+KF   G ++SIRVCRD++TR+SLGYAY+N+Q   +A+ A+D +N+E I GRP RIMWSQRDP  R+SGVGNIFIKN+D SI  K + DTF+ FG I SCKV  D+NG SKG+ FV+F     A +AI+ +NG ++ ++ V+V  F  R +R         +FTN YIKNFG    ++ LR++F + G+ +S +VM D++G S+GFGFV+F+ HEDA KAV  +NG+ +  K +YVGRA K+ ERQ EL+ ++E+ +QERL +++ GVNLY+KNL + I+D++LR EFA +G ITSAKVM   E   SKGFGFVCFS+P+EAT+AV+EMNG+IV  KPLYVALAQ+KE+R A L +Q+ QR    + + +P M  F  ++    P + +  G    N  P   P  +     PR  G P +  ++ + MP   +R +  +  M   +  A  I    ++     Q    A GR  G  +M     Y+Y   +++ Q      P +    +  P +E  + +      T S +A A  +E KQLLGE++YPL+     ++AGKITGM LE+DN+ELL+M+E+  SL  K+DEA+ VL AH+  E
Sbjct:    4 SGPAYPLASLYVGDLHPDVTEAMLYQKFSPAGPIMSIRVCRDIITRRSLGYAYINFQQPADAECALDTMNYEVIKGRPIRIMWSQRDPCLRKSGVGNIFIKNMDESIDNKALYDTFSVFGNILSCKVVCDDNG-SKGYGFVHFETHEAANRAIETMNGMLLNDRKVFVGHFKSRKEREAEFGAKAMEFTNVYIKNFGEDFDNEKLRNIFSEYGKTLSVRVMTDEKGRSRGFGFVNFENHEDAQKAVAEMNGKELNGKILYVGRAQKRLERQGELKRKFEQIKQERLNRYQ-GVNLYVKNLDDGIDDDKLRKEFAPYGTITSAKVM--TEGGLSKGFGFVCFSSPEEATKAVTEMNGRIVSTKPLYVALAQRKEERKAILTNQYMQRLASVRAISSPAMPAFQQSAGYYMPSIPQAQGRAFYNAVPNLRPAPRFAAQAPRPQG-PYSAQMVRSAMP---RRASTPISTMRQASTQAPGIINTQRMAHIGTQ---TAGGRTVGGAVMRGVNQYKYSSGVRNMQQVISVPPPIAQQVVPPPVMEPAVHVKGQEPLTPSMLAAAPLLEQKQLLGERLYPLIQALHPNLAGKITGMLLEIDNSELLHMLESPESLDAKVDEAVAVLQAHQAKE 620          
BLAST of Polyadenylate-binding protein vs. Ensembl Cavefish
Match: pabpc1l (embryonic polyadenylate-binding protein B-like [Source:NCBI gene;Acc:103022532])

HSP 1 Score: 506.523 bits (1303), Expect = 1.125e-170
Identity = 286/655 (43.66%), Postives = 402/655 (61.37%), Query Frame = 2
Query:   83 ANPTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIV---------------------------YVAKFIPRTQR----STPNKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQRGHQPQPVFNPGMVNFMMNSNVQRPFMARP-GNILQNRWPQTMPYIQ-----PRNIGMPANQNIMMTGMPQNQQRRNIMVDPMMNQNRNARPITGNVQLNQTRPQYNMVANGRQ-GNNIM-----YQYP--IQDNQ------PMLNPDQMKMPDIESQIDLT-----TTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAHKGGE 1879
            + P  P ASLYVGDLHPDVTEA+LY+KF   G ++SIRVCRD++TR+SLGYAY+N+Q   +A+ A+D +N+E I GRP RIMWSQRDP  R+SGVGNIFIKN+D SI  K + DTF+ FG I SCKV  D+NG SKG+ FV+F     A +AI+ +NG ++ ++ V                           +V  F  R +R         +FTN YIKNFG    ++ LR++F + G+ +S +VM D++G S+GFGFV+F+ HEDA KAV  +NG+ +  K +YVGRA K+ ERQ EL+ ++E+ +QERL +++ GVNLY+KNL + I+D++LR EFA +G ITSAKVM   E   SKGFGFVCFS+P+EAT+AV+EMNG+IV  KPLYVALAQ+KE+R A L +Q+ QR    + + +P M  F  ++    P + +  G    N  P   P  +     PR  G P +  ++ + MP   +R +  +  M   +  A  I    ++     Q    A GR  G  +M     Y+Y   +++ Q      P +    +  P +E  + +      T S +A A  +E KQLLGE++YPL+     ++AGKITGM LE+DN+ELL+M+E+  SL  K+DEA+ VL AH+  E
Sbjct:    4 SGPAYPLASLYVGDLHPDVTEAMLYQKFSPAGPIMSIRVCRDIITRRSLGYAYINFQQPADAECALDTMNYEVIKGRPIRIMWSQRDPCLRKSGVGNIFIKNMDESIDNKALYDTFSVFGNILSCKVVCDDNG-SKGYGFVHFETHEAANRAIETMNGMLLNDRKVKEAGKDLESCPGQVCQLGSKIQLSMLSFVGHFKSRKEREAEFGAKAMEFTNVYIKNFGEDFDNEKLRNIFSEYGKTLSVRVMTDEKGRSRGFGFVNFENHEDAQKAVAEMNGKELNGKILYVGRAQKRLERQGELKRKFEQIKQERLNRYQ-GVNLYVKNLDDGIDDDKLRKEFAPYGTITSAKVM--TEGGLSKGFGFVCFSSPEEATKAVTEMNGRIVSTKPLYVALAQRKEERKAILTNQYMQRLASVRAISSPAMPAFQQSAGYYMPSIPQAQGRAFYNAVPNLRPAPRFAAQAPRPQG-PYSAQMVRSAMP---RRASTPISTMRQASTQAPGIINTQRMAHIGTQ---TAGGRTVGGAVMRGVNQYKYSSGVRNMQQVISVPPPIAQQVVPPPVMEPAVHVKGQEPLTPSMLAAAPLLEQKQLLGERLYPLIQALHPNLAGKITGMLLEIDNSELLHMLESPESLDAKVDEAVAVLQAHQAKE 647          
BLAST of Polyadenylate-binding protein vs. Ensembl Sea Lamprey
Match: pabpc4 (poly(A) binding protein, cytoplasmic 4 (inducible form) [Source:ZFIN;Acc:ZDB-GENE-030131-9663])

HSP 1 Score: 457.603 bits (1176), Expect = 1.920e-153
Identity = 267/581 (45.96%), Postives = 358/581 (61.62%), Query Frame = 2
Query:   83 ANPTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIV---YVAKFIPRTQR----STPNKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQRGH------------QPQPVFNPGMVNFMMNSNVQRPFMARPGNILQNRWPQTMPYIQPRNIGMPANQNIMMTGMPQNQQRRNIMVDPMMNQNRNARPITGNVQLNQTRPQYNMVAN----------GRQGNNI-MYQYPIQDNQPMLNPDQMKMPDIESQI---------DLTTTSKIANADSMEAKQLLGE 1708
            + P+ P ASLYVGDLHPDVTEA+LYEKF   G VLSIRVCRD++TR+SLGYAYVN+Q   +A+ A+D +NF+ I G+P RIMWSQRDP+ R+SGVGN+FIKNLD SI  K + DTF+ FG I SCKV  DENG S+G+ FV+F  +  A++AI+ +NG ++ +++    +V +F  R +R        K+FTN YIKNFG  + +  LR+ F + G+ +S  VM D+ G S+GFGFVSF++HEDA +AVN +NG+ +  +T++VGRA KK ERQ EL+ ++E  +QER+ +++ GVNLY+KNL + I+DE+LR EFA +G ITS KVM   E   SKGFGFVCFS+P+EAT+AV+EMNG+IV  KPLYVALAQ+KE+R AHL SQ+ QR              Q QP    G     M     R     P  + Q R  Q  P  Q R  G        M      +Q++     P +   R   PIT N Q+ ++ P  + VA           G    N+  Y+Y     QPM NP    M  + +Q+         +  T S +A+A   E KQ+LGE
Sbjct:    4 SGPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKAMYDTFSAFGNILSCKVVCDENG-SRGYGFVHFETQEAADRAIEKMNGMLLNDRLARRRFVGRFKSRKEREQEMGARAKEFTNVYIKNFGDDMDEDKLREFFGKFGKALSVCVMSDECGKSRGFGFVSFEQHEDAQRAVNEMNGKELNGRTVFVGRAQKKGERQAELKRKFEMLKQERISRYQ-GVNLYVKNLDDNIDDEQLRKEFAPYGTITSTKVM--SEEGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEERKAHLTSQYMQRIAGMRALPPSTVIGQYQPAAPSGYFMPAMPQAQTRTAYYAPNQMTQIRPQQRWPTQQVRPQGGYQGMQGGMMRQSGTRQQQQQQQQPPI---RTMSPIT-NTQIVRSIPGGHRVAATQTLGPRAMPGMGPRNVGAYKY----GQPMRNPIHGHMQQLRAQMHQAVHVHGQEPLTPSMLASAPLQEQKQMLGE 572          
BLAST of Polyadenylate-binding protein vs. Ensembl Sea Lamprey
Match: pabpc4 (poly(A) binding protein, cytoplasmic 4 (inducible form) [Source:ZFIN;Acc:ZDB-GENE-030131-9663])

HSP 1 Score: 332.413 bits (851), Expect = 3.208e-106
Identity = 208/498 (41.77%), Postives = 280/498 (56.22%), Query Frame = 2
Query:  497 AFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQR----STPNKDFTNCYIKNFGIHLHDKSLRDLFEQ-CGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQRGH------------QPQPVFNPGMVNFMMNSNVQ-RPFMARPGNILQ----NRWPQTMPYIQPRNIGMPANQNIMMTGMPQNQQRRNIMVD-----PMMNQNRNARPITGNVQLNQTR--PQYNMVAN-------GRQGNNIMYQYP-----IQDNQPMLNPDQMKMPDIESQIDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAH 1867
             FV+F  +  A+KAI+ +NG ++ ++ V+V +F  R +R        ++FTN YIKNFG  + D+ LR+ FEQ  G+ +S KVM+D+ G SKGFGFVSF+ HEDA KAV+ +N + +  + IYVGRA KKAERQ EL+ ++E  +QER+ +++ GVNLY+KNL + INDERL  EF+ FG ITSAKVM+  E   S+GFGFVCFS+P+EAT+AV+EMNG+I+  KPLYVALAQ+KE+R  HL SQF QR              Q QP    G     M    Q R     P  +       RWP  +        G  A    M    P+  Q R +        P  +Q    RP T   Q    R  P Y    +       G QG   M Q P     IQ  +P+                  T S +A A   E KQ+LGE+++PL+      +AGKITGM LE+DN+ELL+M+E+  SL+ K++EA+ VL AH
Sbjct:    1 GFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKEREAEFGAKAREFTNVYIKNFGDDMDDERLREYFEQYVGKTLSVKVMMDEGGKSKGFGFVSFERHEDAQKAVDEMNTKELNGRAIYVGRAQKKAERQTELKRKFEMLKQERMSKYQ-GVNLYVKNLDDNINDERLWKEFSPFGTITSAKVMM--EEGRSRGFGFVCFSSPEEATKAVTEMNGRIIGSKPLYVALAQRKEERKMHLTSQFMQRLAGMRAVPPSAIIGQYQPAAASGYFMAAMPQQAQGRTAYYTPSPMAPMRPNPRWPLQVRPQGAHAAGFQAITGPMRQPAPRPTQMRTVNPASVPQVPRASQGMMPRP-TFPTQAAGPRALPGYKYTGSVRNPQQPGVQGPGAMQQAPQSAVHIQGQEPL------------------TASMLAAAPPHEQKQMLGERLFPLIHGMYPTLAGKITGMLLEIDNSELLHMLESPESLRAKVEEAVAVLQAH 476          

HSP 2 Score: 122.865 bits (307), Expect = 6.662e-30
Identity = 70/193 (36.27%), Postives = 105/193 (54.40%), Query Frame = 2
Query:  371 NIFIKNLDPSITVKEINDTFANF-GEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQRSTPNK--------------DFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRY 904
            N++IKN    +  + + + F  + G+  S KV  DE G SKGF FV+F    DA+KA+  +N K +  + +YV +   + +R T  K                 N Y+KN   +++D+ L   F   G I SAKVM++ EG S+GFGFV F   E+A KAV  +NGR+I  K +YV  A +K ER+  L +++
Sbjct:   52 NVYIKNFGDDMDDERLREYFEQYVGKTLSVKVMMDEGGKSKGFGFVSFERHEDAQKAVDEMNTKELNGRAIYVGRAQKKAERQTELKRKFEMLKQERMSKYQGVNLYVKNLDDNINDERLWKEFSPFGTITSAKVMME-EGRSRGFGFVCFSSPEEATKAVTEMNGRIIGSKPLYVALAQRKEERKMHLTSQF 243          
BLAST of Polyadenylate-binding protein vs. Ensembl Sea Lamprey
Match: ncl (nucleolin [Source:ZFIN;Acc:ZDB-GENE-030131-6986])

HSP 1 Score: 108.227 bits (269), Expect = 1.343e-24
Identity = 76/291 (26.12%), Postives = 143/291 (49.14%), Query Frame = 2
Query:  320 RIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQRSTPNKDFTNCY-IKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKE-GNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKK 1186
            R+++++RD          +F+KN+  S TV+ + + F    E+   ++    NG S+G A+V F  E DAE A++   G  +  + V +     ++ ++ P    +N   ++N      + SLR +FE    +   +V++D+E G  +G  FV F   +DA  A+   +G  +E      GRA         +R  +   R        S   L+++ LG + +++ L + F      T+A+++ ++++  SKG+ +V FS+ DEA  A++ M G  ++G  +YV  A+ K
Sbjct:  363 RVLFTERD-------AKTLFVKNIAWSSTVESLTEAFEGAVEV---RIPLGPNGKSRGIAYVEFPSEEDAEAAMKEYQGADVDGRAVLLDYVGDKSNKAKPQGPESNTLMVRNLSFQADEDSLRSVFENAEAV---RVLMDRETGKPRGMAFVDFASIDDAKAAMKAHSGAEVE------GRA---------IRLEFSTPRGTPGPSEASS-TLFVRGLGEDTSEDTLMDSFE---GATAARIVTDRDSGQSKGYAYVDFSSADEAKSALNAMKGVEIDGSQIYVDFARPK 621          
BLAST of Polyadenylate-binding protein vs. Ensembl Sea Lamprey
Match: sf3b4 (splicing factor 3b, subunit 4 [Source:ZFIN;Acc:ZDB-GENE-020419-22])

HSP 1 Score: 93.5893 bits (231), Expect = 1.748e-20
Identity = 56/165 (33.94%), Postives = 96/165 (58.18%), Query Frame = 2
Query:  104 ASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVG-NIFIKNLDPSITVKEINDTFANFGEI--SSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVA 589
            A++YVG L   V+EA+L+E F   G V++  + +D +T++  GY +V +    +A  A+  +N   ++G+P R+  ++     +   VG NIFI NLD  I  K + DTF+ FG I  +   ++  E G SKG+AF+NF     ++ AI+A+NG+ +  + + V+
Sbjct:   13 ATVYVGGLDDKVSEALLWELFLQAGPVVNTHMPKDRITQQHQGYGFVEFLGEEDADYAIKIMNMIKLYGKPIRV--NKASAHNKNLDVGANIFIGNLDTEIDEKLLYDTFSAFGVILQTPKTMRDPETGNSKGYAFINFASFEASDAAIEAMNGQYLCNRPISVS 175          

HSP 2 Score: 78.9518 bits (193), Expect = 8.496e-16
Identity = 55/193 (28.50%), Postives = 95/193 (49.22%), Query Frame = 2
Query:  623 NKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDK-EGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNIT-SAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDR 1195
            N+D T  Y+      + +  L +LF Q G +V+  +  D+     +G+GFV F   EDA  A+  +N   +  K I V +A   +   + L                 G N++I NL  EI+++ L + F+ FG I  + K M + E   SKG+ F+ F++ + +  A+  MNG+ +  +P+ V+ A KK+ +
Sbjct:   10 NQDAT-VYVGGLDDKVSEALLWELFLQAGPVVNTHMPKDRITQQHQGYGFVEFLGEEDADYAIKIMNMIKLYGKPIRVNKA---SAHNKNLDV---------------GANIFIGNLDTEIDEKLLYDTFSAFGVILQTPKTMRDPETGNSKGYAFINFASFEASDAAIEAMNGQYLCNRPISVSYAFKKDSK 183          

HSP 3 Score: 47.7506 bits (112), Expect = 6.191e-6
Identity = 24/89 (26.97%), Postives = 51/89 (57.30%), Query Frame = 2
Query:  104 ASLYVGDLHPDVTEAILYEKFQTHGNVL-SIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWS-QRDPAARRSG 364
            A++++G+L  ++ E +LY+ F   G +L + +  RD  T  S GYA++N+     + +A++ +N + +  RP  + ++ ++D    R G
Sbjct:  100 ANIFIGNLDTEIDEKLLYDTFSAFGVILQTPKTMRDPETGNSKGYAFINFASFEASDAAIEAMNGQYLCNRPISVSYAFKKDSKGERHG 188          
BLAST of Polyadenylate-binding protein vs. Ensembl Sea Lamprey
Match: tia1l (cytotoxic granule-associated RNA binding protein 1, like [Source:ZFIN;Acc:ZDB-GENE-030131-2167])

HSP 1 Score: 81.2629 bits (199), Expect = 2.575e-17
Identity = 55/178 (30.90%), Postives = 85/178 (47.75%), Query Frame = 2
Query:  371 NIFIKNLDPSITVKEINDTFANFGEISSCKVQTD-ENGVSKGFAFVNFNHEGDAEKAI-----QAINGKMIREKIVYVAKFIPRTQRSTPNKDF-----------TNCYIKNFGI--HLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTI 847
            ++F+ +L P I+  ++   FA FG+IS  +V  D   G SKG+ FV+F  + DAE AI     Q + G+ IR          P+  + T  K             TNC +   GI   L ++ +R  F   G+I+  +V  D     KG+ F+ F  HE A  A+ ++NG  IE  ++
Sbjct:    4 HVFVGDLSPEISTDDLRAAFAPFGKISDARVVKDLATGKSKGYGFVSFFQKLDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKGSQDTDPKHLSFEEVLNQSSPTNCTVYCGGITQGLTEQLMRQTFLLFGQILEIRVFPD-----KGYSFIRFATHESAAHAIVSVNGSTIEGFSV 176          

HSP 2 Score: 80.4925 bits (197), Expect = 4.534e-17
Identity = 54/210 (25.71%), Postives = 96/210 (45.71%), Query Frame = 2
Query:  629 DFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVD-KEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKK--AERQRELRTRYEKTRQERLQQHK-SGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQRGHQPQP 1246
            D  + ++ +    +    LR  F   G+I  A+V+ D   G SKG+GFVSF +  DA  A+  + G+ +  + I    A +K  A +  +       + +E L Q   +   +Y   +   + ++ +R  F +FG I   +V  +K      G+ F+ F+  + A  A+  +NG  +EG  +     ++  D V   + QF Q G+  QP
Sbjct:    1 DHYHVFVGDLSPEISTDDLRAAFAPFGKISDARVVKDLATGKSKGYGFVSFFQKLDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKGSQDTDPKHLSFEEVLNQSSPTNCTVYCGGITQGLTEQLMRQTFLLFGQILEIRVFPDK------GYSFIRFATHESAAHAIVSVNGSTIEGFSVKCFWGKEASDPVNQFQQQFSQVGYTQQP 204          

HSP 3 Score: 71.2478 bits (173), Expect = 5.700e-14
Identity = 45/172 (26.16%), Postives = 77/172 (44.77%), Query Frame = 2
Query:  110 LYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVG--------------------NIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMI 565
            ++VGDL P+++   L   F   G +   RV +DL T KS GY +V++    +A++A+  +  + + GR  R  W+ R P A +                         ++   +   +T + +  TF  FG+I   +V  D     KG++F+ F     A  AI ++NG  I
Sbjct:    5 VFVGDLSPEISTDDLRAAFAPFGKISDARVVKDLATGKSKGYGFVSFFQKLDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKGSQDTDPKHLSFEEVLNQSSPTNCTVYCGGITQGLTEQLMRQTFLLFGQILEIRVFPD-----KGYSFIRFATHESAAHAIVSVNGSTI 171          
BLAST of Polyadenylate-binding protein vs. Ensembl Yeast
Match: PAB1 (Poly(A) binding protein; part of the 3'-end RNA-processing complex, mediates interactions between the 5' cap structure and the 3' mRNA poly(A) tail, involved in control of poly(A) tail length, interacts with translation factor eIF-4G; stimulates, but is not required for the deadenylation activity of the Pan2p-Pan3p poly(A)-ribonuclease complex [Source:SGD;Acc:S000000967])

HSP 1 Score: 404.445 bits (1038), Expect = 5.203e-133
Identity = 246/601 (40.93%), Postives = 333/601 (55.41%), Query Frame = 2
Query:  101 CASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQRSTPNKD----FTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQRGHQPQPVFNPGMVNFMMNSNVQRPFMARPGNILQNRWPQTMPYIQPRNIGMPAN-----QNIMMTGMPQNQQRRNIMVDPMMNQNRNARPITGNVQLNQTRPQYNMVANGRQGNNIMYQYPIQDNQPMLNPDQMKMPDIESQIDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAG--DMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAHK 1870
             ASLYVGDL P V+EA LY+ F   G+V SIRVCRD +T+ SLGYAYVN+      + A++ LN+  I GR CRIMWSQRDP+ R+ G GNIFIKNL P I  K + DTF+ FG+I S K+ TDENG SKGF FV+F  EG A++AI A+NG ++  + +YVA  + R +R +  ++    +TN Y+KN      D+  ++LF + G IVSA +  D +G  KGFGFV++++HEDA+KAV  LN   +  + +YVGRA KK ER   L+ +YE  R E++ +++ GVNL++KNL + ++DE+L  EFA +G ITSAKVM   EN  SKGFGFVCFS P+EAT+A++E N +IV GKPLYVA+AQ+K+ R + L  Q Q R           M      +         PG  +   +   MP   PR  G+P N     Q   M GMP+N          M  Q RN  P+ G        PQ     N    NN  YQ                                      + +Q LGE++Y  VS      + AGKITGM L+L   E+  ++E++   +    EA     + K
Sbjct:   37 SASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQ-GVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVM-RTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQ---------MRYQQATAAAAAAAAGMPGQFMPPMFYGVMP---PR--GVPFNGPNPQQMNPMGGMPKNG---------MPPQFRNG-PVYG------VPPQGGFPRNAND-NNQFYQ-------------------------------------QKQRQALGEQLYKKVSAKTSNEEAAGKITGMILDLPPQEVFPLLESDELFEQHYKEASAAYESFK 567          
BLAST of Polyadenylate-binding protein vs. Ensembl Yeast
Match: PES4 (Poly(A) binding protein, suppressor of DNA polymerase epsilon mutation; PES4 has a paralog, MIP6, that arose from the whole genome duplication [Source:SGD;Acc:S000001919])

HSP 1 Score: 118.627 bits (296), Expect = 3.157e-28
Identity = 107/389 (27.51%), Postives = 172/389 (44.22%), Query Frame = 2
Query:  110 LYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNL---DPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQRSTPN-----------------------------KDFTNCY--------IKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLN-KENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEG 1153
            L++GDLH  VTE  L   F+ + + +S +VC D VT+KSLG+ Y+N++   EA+ AM+ LN+  ++G+  RIM S R+   R++   N+F  NL   +P +T +   DTF+ +G+I SCK+ +      K   FV F  E  A   I+  N      K +       +  RS PN                             K+  N Y        IKN         + + F + G I S   + +       + FV++K   D+ KA+   N      K + V RA  K ER + + ++   T             L+++NL    N E L+       NI   K+ ++  + N+S   GF+ F   ++ATR  + +N ++V G
Sbjct:   93 LFIGDLHETVTEETLKGIFKKYPSFVSAKVCLDSVTKKSLGHGYLNFEDKEEAEKAMEELNYTKVNGKEIRIMPSLRNTTFRKNFGTNVFFSNLPLNNPLLTTRVFYDTFSRYGKILSCKLDS-----RKDIGFVYFEDEKTARNVIKMYNNTSFFGKKILCGIHFDKEVRSVPNFETQKSRLDAETIIEKEQSLNEKHSKGNDKESKNIYSSSQNSIFIKNLPTITTRDDILNFFSEVGPIKSI-YLSNATKVKYLWAFVTYKNSSDSEKAIKRYNNFYFRGKKLLVTRAQDKEERAKFIESQKIST-------------LFLENLSAVCNKEFLK-YLCHQENIRPFKIQIDGYDENSSTYSGFIKFRNFEDATRIFNFLNNRLVGG 461          
BLAST of Polyadenylate-binding protein vs. Ensembl Yeast
Match: MIP6 (Putative RNA-binding protein; interacts with Mex67p, which is a component of the nuclear pore involved in nuclear mRNA export; MIP6 has a paralog, PES4, that arose from the whole genome duplication [Source:SGD;Acc:S000001057])

HSP 1 Score: 101.679 bits (252), Expect = 9.580e-23
Identity = 101/397 (25.44%), Postives = 178/397 (44.84%), Query Frame = 2
Query:  107 SLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNL---DPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAING----------------------------KMIREKIVYVAKFIPRTQRSTPNKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGF-GFV-CFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRV 1198
            SL++G+L   VTE +L + F+ + +  S +VCRD +T+KSLGY Y+N++   +A+SA    N+    G+  +IM S ++   R++   N+F  NL   +P +T +        +G + SC ++  +N       FV F+++  A   I+  N                             KMI   IV   + +     S   +  T   +KN       + + D F   G I S   + +K+ N+    FV++K  E++ KA   LN  + ++ TI+VG    K     ++ T  +KT+            +Y+KNL    N E + ++  +   I  +++ +   N+ +  F G V CFS  D A R  + ++ +++ G  L  A   K  D +
Sbjct:  112 SLFIGNLKSTVTEEMLRKIFKRYQSFESAKVCRDFLTKKSLGYGYLNFKDKNDAESARKEFNYTVFFGQEVKIMPSMKNTLFRKNIGTNVFFSNLPLENPQLTTRSFYLIMIEYGNVLSCLLERRKN-----IGFVYFDNDISARNVIKKYNNQEFFGNKIICGLHFDKEVRTRPEFTKRKKMIGSDIVIEDELLASNNLSDNARSKT-ILVKNLPSDTTQEEVLDYFSTIGPIKSV-FISEKQANTPHKAFVTYKNEEESKKAQKCLNKTIFKNHTIWVGPGKDKP-VHNQIGTN-KKTK------------VYLKNLSFNCNKEFI-SQLCLQEKIRFSEIKITNYNSLNWTFCGHVECFSRSD-AERLFNILDRRLI-GSSLVEASWSKNNDNI 484          
BLAST of Polyadenylate-binding protein vs. Ensembl Yeast
Match: PUB1 (Poly (A)+ RNA-binding protein; abundant mRNP-component protein that binds mRNA and is required for stability of many mRNAs; component of glucose deprivation induced stress granules, involved in P-body-dependent granule assembly; implicated in regulation of translation; carries Q/N-rich domain at C- terminus, identified as candidate prion; human homolog Tia1 is critical for normal synaptic plasticity; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004961])

HSP 1 Score: 96.6709 bits (239), Expect = 1.177e-21
Identity = 51/182 (28.02%), Postives = 92/182 (50.55%), Query Frame = 2
Query:  644 YIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKE 1189
            Y+ N    + +  L+  F+  G I + K+M+DK   +  + FV + +  DA  A+ TLNG+ IE+  + +  A +  +   +                    NL++ +L   ++DE LRN F  F +  S  VM + +  +S+G+GFV F++ D+A  A+  M G+ + G+PL +  A K++
Sbjct:   78 YVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLNGKQIENNIVKINWAFQSQQSSSD-----------------DTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINWAAKRD 242          

HSP 2 Score: 92.4337 bits (228), Expect = 3.410e-20
Identity = 50/167 (29.94%), Postives = 98/167 (58.68%), Query Frame = 2
Query:  374 IFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQRSTPNKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVD-KEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKK 871
            +++ NLD +IT   +   F   G I++ K+  D+N  +  +AFV ++   DA  A+Q +NGK I   IV +  +  ++Q+S+ +  F N ++ +  +++ D++LR+ F+     +S  VM D + G+S+G+GFVSF   +DA  A++++ G+ +  + + +  A K+
Sbjct:   77 LYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLNGKQIENNIVKI-NWAFQSQQSSSDDTF-NLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINWAAKR 241          

HSP 3 Score: 78.5666 bits (192), Expect = 8.650e-16
Identity = 51/167 (30.54%), Postives = 89/167 (53.29%), Query Frame = 2
Query:  110 LYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTD-ENGVSKGFAFVNFNHEGDAEKAI-----QAINGKMIREKIVYVAK 592
            LYVG+L   +TE IL + FQ  G + +I++  D    K++ YA+V Y  S +A  A+  LN + I     +I W+ +   +      N+F+ +L+ ++  + + + F +F    S  V  D + G S+G+ FV+F  + DA+ A+     Q +NG+ +R  I + AK
Sbjct:   77 LYVGNLDKAITEDILKQYFQVGGPIANIKIMIDK-NNKNVNYAFVEYHQSHDANIALQTLNGKQIENNIVKINWAFQSQQSSSDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLR--INWAAK 240          
BLAST of Polyadenylate-binding protein vs. Ensembl Yeast
Match: GBP2 (Poly(A+) RNA-binding protein; key surveillance factor for the selective export of spliced mRNAs from the nucleus to the cytoplasm; preference for intron-containing genes; similar to Npl3p; also binds single-stranded telomeric repeat sequence in vitro; relocalizes to the cytosol in response to hypoxia; GBP2 has a paralog, HRB1, that arose from the whole genome duplication [Source:SGD;Acc:S000000517])

HSP 1 Score: 80.4925 bits (197), Expect = 1.825e-16
Identity = 75/315 (23.81%), Postives = 137/315 (43.49%), Query Frame = 2
Query:  347 AARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYV----------AKFIPRTQRSTPNKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYV--GRAMKKA--ERQRELRTRYEKTR--------------QERLQQHKSGVN--------LYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQK 1183
            A +R+   +IF++NL    T +++ + F   GE+    + T + G  +G   V F      + AI   +G +  ++ + V           +F  +  R   +  F   +I N    ++ +SL+D+F++CG ++ A V +D  G S+GFG V +   ++ I+A++T NG  +E + + V  GR  K+   +R  + R   E TR               E   +   GVN        +Y  NL        L + F   G I +A+ +  +EN    G   V +    +A   + ++N     G  L ++ A++
Sbjct:  115 ATKRNFENSIFVRNLTFDCTPEDLKELFGTVGEVVEADIITSK-GHHRGMGTVEFTKNESVQDAISKFDGALFMDRKLMVRQDNPPPEAAKEFSKKATREEIDNGFE-VFIINLPYSMNWQSLKDMFKECGHVLRADVELDFNGFSRGFGSVIYPTEDEMIRAIDTFNGMEVEGRVLEVREGRFNKRKNNDRYNQRREDLEDTRGTEPGLAQDAAVHIDETAAKFTEGVNPGGDRNCFIYCSNLPFSTARSDLFDLFGPIGKINNAE-LKPQENGQPTGVAVVEYENLVDADFCIQKLNNYNYGGCSLQISYARR 426          

HSP 2 Score: 78.5666 bits (192), Expect = 7.813e-16
Identity = 62/217 (28.57%), Postives = 104/217 (47.93%), Query Frame = 2
Query:  608 QRSTPNKDFTNC-YIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALA----QKKEDRVAHLRSQFQQ-RGHQP 1240
            Q     ++F N  +++N       + L++LF   GE+V A ++  K G+ +G G V F ++E    A++  +G +  D+ + V +     E  +E   +   TR+E      +G  ++I NL   +N + L++ F   G++  A V L+  N  S+GFG V +   DE  RA+   NG  VEG+ L V       +K  DR    R   +  RG +P
Sbjct:  112 QFDATKRNFENSIFVRNLTFDCTPEDLKELFGTVGEVVEADIITSK-GHHRGMGTVEFTKNESVQDAISKFDGALFMDRKLMVRQDNPPPEAAKEFSKK--ATREE----IDNGFEVFIINLPYSMNWQSLKDMFKECGHVLRADVELDF-NGFSRGFGSVIYPTEDEMIRAIDTFNGMEVEGRVLEVREGRFNKRKNNDRYNQRREDLEDTRGTEP 320          
BLAST of Polyadenylate-binding protein vs. Ensembl Nematostella
Match: EDO33206 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSV8])

HSP 1 Score: 518.464 bits (1334), Expect = 9.350e-177
Identity = 288/603 (47.76%), Postives = 386/603 (64.01%), Query Frame = 2
Query:   98 PCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQR----STPNKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQRGHQPQPVFNPGMVNFMMNSNVQRPFMARPGNILQNRWPQTMPYIQPRNIGMPANQNIMMTGMPQNQQRRNIMVDPMMNQNRNARPITGNVQLNQTRPQYNMVANGRQGNNIMYQYPIQDNQPMLNPDQM-KMPD----IESQIDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAHKGGE 1879
            P ASLYVGDL PDVTEA+LYEKF T G+VLSIRVCRDLVTR+SLGYAYVN+Q    A+ A+D +NF+ I GRPCRIMW QRDP+ R+SGVGNIFIKNLD SI  K + DTF+ FG I SCK+  DE G  KG+ FV+F  E  A +AI  ++G ++ +K V+V +++ + +R     T  K FTN Y+KNFG  + D+ ++++  + G+IVS KVM D EG SKGFGFVSF+  E+A +AVN LNG+ I  + ++ GRA K+AER  E++   EK RQER+ + + GVNLYIKNL + I+DERLR EF+ +G I+SAKVM + + N SKGFGFVCFS+P+EAT+AV+EMNG+I+  KPLYVALAQ++E+R A L +Q   R            ++ +     QRPF            PQ MP ++PR             GMP  QQ++ +    + N    A    G        P    V   R G     + P + +Q + NP    +MP+    I    +    S +A A   E KQ+LGE+++PL+     DMAGKITGM LE+DNAELL+M+E+ ++L+MK+DEA+ VL AH+  E
Sbjct:   11 PIASLYVGDLAPDVTEAMLYEKFSTAGSVLSIRVCRDLVTRRSLGYAYVNFQQPGHAEKALDTMNFDPIKGRPCRIMWQQRDPSLRKSGVGNIFIKNLDKSIDNKSLYDTFSAFGNILSCKIAQDELGNPKGYGFVHFETEDAALEAIARVDGMLLNDKKVFVGRWMSKKERIEKMGTQPKKFTNVYVKNFGDDMDDEQMKEICAEAGKIVSLKVMTDPEGKSKGFGFVSFETPEEAEEAVNVLNGKEIGGRRLWAGRAKKRAERAAEVKAEIEKKRQERINRFQ-GVNLYIKNLDDPIDDERLREEFSPYGTISSAKVMKDDKGN-SKGFGFVCFSSPEEATKAVTEMNGRILISKPLYVALAQRREERKAQLAAQHMHR------------ISGLRMHQGQRPFFT----------PQ-MPQVRPR------------WGMPPQQQQQQMRPTGVQNMGGQAGMPQGGPAGMPRMP----VQQARMGGVPPQRQPYKFSQTVRNPPPAGQMPEGGQGIPGGQEPLNPSVLAAATPQEQKQMLGERLFPLIQTNHPDMAGKITGMLLEIDNAELLHMLESRDALQMKVDEAVSVLRAHQAKE 572          
BLAST of Polyadenylate-binding protein vs. Ensembl Nematostella
Match: EDO29565 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T3A0])

HSP 1 Score: 97.8265 bits (242), Expect = 3.153e-24
Identity = 58/119 (48.74%), Postives = 74/119 (62.18%), Query Frame = 2
Query:   98 PCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISS 454
            P ASLYVGDL PDVTEA+LYEKF T G+VLSIRVCRDLVTR+SLGYA    +    A+ A +             I   +++   R  GV N++IKNLD  I  + + + F+ +G ISS
Sbjct:   11 PIASLYVGDLAPDVTEAMLYEKFSTAGSVLSIRVCRDLVTRRSLGYALWAGRAKKRAERAAE---------VKAEIEKKRQERINRFQGV-NLYIKNLDDPIDDERLREEFSPYGTISS 119          

HSP 2 Score: 70.8626 bits (172), Expect = 7.563e-15
Identity = 34/63 (53.97%), Postives = 47/63 (74.60%), Query Frame = 2
Query:  845 IYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITS 1033
            ++ GRA K+AER  E++   EK RQER+ + + GVNLYIKNL + I+DERLR EF+ +G I+S
Sbjct:   58 LWAGRAKKRAERAAEVKAEIEKKRQERINRFQ-GVNLYIKNLDDPIDDERLREEFSPYGTISS 119          
BLAST of Polyadenylate-binding protein vs. Ensembl Nematostella
Match: EDO42673 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S105])

HSP 1 Score: 102.449 bits (254), Expect = 8.306e-24
Identity = 84/295 (28.47%), Postives = 131/295 (44.41%), Query Frame = 2
Query:  428 FANFGEISSCK-VQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQRSTPNKDFT---NCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKE-GNSKGFGFVSFKEHEDAIKAVNTLNG------------RVIEDKTIYV---------GRAMKKAERQRELRTRYEK---------TRQERL-------QQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKK 1186
            F     +++CK V+   +G S GF FV++N   DA+KAI  +NG  I  K++ VA        S P  D T   N Y+ N    L +   R  FE  G IV+ +++ DK  G  KG GFV + +  +A  A+++L+G            R  +D +  V         G+ M      R    R++            Q+++        Q   G  LY+ N+G + N E +   FA  G +    +M + +    KGF FV  +  +EA  A+  +NG +   KPL V+L  K+
Sbjct:   25 FEAVASLNNCKIVRHKPSGWSYGFGFVDYNTTEDAQKAIDKLNGFTIGNKVLKVA-------FSRPGGDNTKGANLYVCNIPKQLPEAEFRKAFEAYGNIVNCRLLRDKSTGLPKGCGFVLYDKKAEAQAAISSLSGTFFPGSTMGLQIRYADDNSAKVRPPNNVPNFGQQMGGPGPIRPPANRFQARFNPMGGGPLPQQKMTHMNGNKSQAPPGCTLYVYNIGYDANQEGITALFAQCGIVNKVDIMWDWQRQQCKGFCFVTMATQEEAQNAIQTLNGFMYTNKPLQVSLYSKR 312          

HSP 2 Score: 82.8037 bits (203), Expect = 3.211e-17
Identity = 66/309 (21.36%), Postives = 129/309 (41.75%), Query Frame = 2
Query:  107 SLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDEN-GVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIV---------------------------------------YVAKFIPRTQRSTPNKDFTN-----------C--YIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVD-KEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKK 871
            +L V  +  D+T+      F+   ++ + ++ R   +  S G+ +V+Y  + +A+ A+D LN   I  +  ++ +S+  P    +   N+++ N+   +   E    F  +G I +C++  D++ G+ KG  FV ++ + +A+ AI +++G       +                                       + A+F P      P +  T+           C  Y+ N G   + + +  LF QCG +    +M D +    KGF FV+    E+A  A+ TLNG +  +K + V    K+
Sbjct:    6 TLIVNYIPQDMTDQTFRMMFEAVASLNNCKIVRHKPSGWSYGFGFVDYNTTEDAQKAIDKLNGFTIGNKVLKVAFSR--PGGDNTKGANLYVCNIPKQLPEAEFRKAFEAYGNIVNCRLLRDKSTGLPKGCGFVLYDKKAEAQAAISSLSGTFFPGSTMGLQIRYADDNSAKVRPPNNVPNFGQQMGGPGPIRPPANRFQARFNPMGGGPLPQQKMTHMNGNKSQAPPGCTLYVYNIGYDANQEGITALFAQCGIVNKVDIMWDWQRQQCKGFCFVTMATQEEAQNAIQTLNGFMYTNKPLQVSLYSKR 312          

HSP 3 Score: 82.8037 bits (203), Expect = 3.211e-17
Identity = 54/203 (26.60%), Postives = 93/203 (45.81%), Query Frame = 2
Query:  668 LHDKSLRDLFEQCGEIVSAKVMVDK-EGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLR-----SQFQQRGHQPQPVFNP 1258
            + D++ R +FE    + + K++  K  G S GFGFV +   EDA KA++ LNG  I +K + V  +    +  +                   G NLY+ N+  ++ +   R  F  +GNI + +++ +K     KG GFV +    EA  A+S ++G    G  + + + +  +D  A +R       F Q+   P P+  P
Sbjct:   16 MTDQTFRMMFEAVASLNNCKIVRHKPSGWSYGFGFVDYNTTEDAQKAIDKLNGFTIGNKVLKVAFSRPGGDNTK-------------------GANLYVCNIPKQLPEAEFRKAFEAYGNIVNCRLLRDKSTGLPKGCGFVLYDKKAEAQAAISSLSGTFFPGSTMGLQI-RYADDNSAKVRPPNNVPNFGQQMGGPGPIRPP 198          
BLAST of Polyadenylate-binding protein vs. Ensembl Nematostella
Match: EDO42417 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1S3])

HSP 1 Score: 94.7449 bits (234), Expect = 8.270e-21
Identity = 55/165 (33.33%), Postives = 97/165 (58.79%), Query Frame = 2
Query:  104 ASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVG-NIFIKNLDPSITVKEINDTFANFGEI-SSCKVQTD-ENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVA 589
            A++YVG L   V+EA+++E F   G V+++ + +D +T+   GY +V +    +A  A+  +N   ++G+P R+  ++     +   VG N+FI NLD  +  K + DTF+ FG I  + K+  D + G SKGFAF+NF     ++ AI+A+NG+ +  + + V+
Sbjct:   13 ATIYVGGLDEKVSEALIWELFLQSGPVVNVHMPKDRITQLHQGYGFVEFLGEEDADYAIKVMNMIKVYGKPIRV--NKASAHNKNLDVGANLFIGNLDTEVDEKLLYDTFSAFGVILQTPKIMRDSDTGNSKGFAFINFASFDASDAAIEAMNGQYLCNRPITVS 175          

HSP 2 Score: 82.4185 bits (202), Expect = 1.010e-16
Identity = 56/193 (29.02%), Postives = 96/193 (49.74%), Query Frame = 2
Query:  623 NKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGN-SKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNIT-SAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDR 1195
            N+D T  Y+      + +  + +LF Q G +V+  +  D+     +G+GFV F   EDA  A+  +N   +  K I V +A   +   + L                 G NL+I NL  E++++ L + F+ FG I  + K+M + +   SKGF F+ F++ D +  A+  MNG+ +  +P+ V+ A KKE +
Sbjct:   10 NQDAT-IYVGGLDEKVSEALIWELFLQSGPVVNVHMPKDRITQLHQGYGFVEFLGEEDADYAIKVMNMIKVYGKPIRVNKA---SAHNKNLDV---------------GANLFIGNLDTEVDEKLLYDTFSAFGVILQTPKIMRDSDTGNSKGFAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKESK 183          

HSP 3 Score: 48.1358 bits (113), Expect = 7.843e-6
Identity = 24/89 (26.97%), Postives = 52/89 (58.43%), Query Frame = 2
Query:  104 ASLYVGDLHPDVTEAILYEKFQTHGNVL-SIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWS-QRDPAARRSG 364
            A+L++G+L  +V E +LY+ F   G +L + ++ RD  T  S G+A++N+     + +A++ +N + +  RP  + ++ +++    R G
Sbjct:  100 ANLFIGNLDTEVDEKLLYDTFSAFGVILQTPKIMRDSDTGNSKGFAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKESKGERHG 188          
BLAST of Polyadenylate-binding protein vs. Ensembl Nematostella
Match: EDO34879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN30])

HSP 1 Score: 85.8853 bits (211), Expect = 3.488e-18
Identity = 50/155 (32.26%), Postives = 88/155 (56.77%), Query Frame = 2
Query:  371 NIFIKNLDPSITVKEINDTFANFGEISSCKVQTDE-NGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQRSTPNKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVI 832
            N+ I  + PS++ ++I   F   G ++SCK+  D   G S G+AFVN+++  DA KA++ +NG  ++ K + V+   P    ST  K+  N YI      + ++ +  LF+  G+I+++KV+ D  G  +G GFV F +  +A  A++ LN + +
Sbjct:   11 NLIINYVPPSMSQEDIKKIFGTVGNVTSCKLIRDRATGQSLGYAFVNYDNPDDANKAVREMNGARLQNKTLKVSFARP---SSTEIKN-ANLYISGLPKDMKEEEVEALFKPFGKIITSKVLKDVSGEGRGTGFVRFDKRCEAQTAIDDLNNKTL 161          

HSP 2 Score: 77.0258 bits (188), Expect = 3.406e-15
Identity = 44/152 (28.95%), Postives = 81/152 (53.29%), Query Frame = 2
Query:  110 LYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMI 565
            L +  + P +++  + + F T GNV S ++ RD  T +SLGYA+VNY    +A  A+  +N   +  +  ++ +++  P++      N++I  L   +  +E+   F  FG+I + KV  D +G  +G  FV F+   +A+ AI  +N K +
Sbjct:   12 LIINYVPPSMSQEDIKKIFGTVGNVTSCKLIRDRATGQSLGYAFVNYDNPDDANKAVREMNGARLQNKTLKVSFAR--PSSTEIKNANLYISGLPKDMKEEEVEALFKPFGKIITSKVLKDVSGEGRGTGFVRFDKRCEAQTAIDDLNNKTL 161          

HSP 3 Score: 67.3958 bits (163), Expect = 4.256e-12
Identity = 48/174 (27.59%), Postives = 80/174 (45.98%), Query Frame = 2
Query:  635 TNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKE-GNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEG 1153
            TN  I      +  + ++ +F   G + S K++ D+  G S G+ FV++   +DA KAV  +NG  +++KT+ V  A   +   +                     NLYI  L  ++ +E +   F  FG I ++KV L   +   +G GFV F    EA  A+ ++N K + G
Sbjct:   10 TNLIINYVPPSMSQEDIKKIFGTVGNVTSCKLIRDRATGQSLGYAFVNYDNPDDANKAVREMNGARLQNKTLKVSFARPSSTEIKN-------------------ANLYISGLPKDMKEEEVEALFKPFGKIITSKV-LKDVSGEGRGTGFVRFDKRCEAQTAIDDLNNKTLPG 163          

HSP 4 Score: 54.6842 bits (130), Expect = 5.541e-8
Identity = 27/84 (32.14%), Postives = 46/84 (54.76%), Query Frame = 2
Query:  947 VNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRV 1198
             NL I  +   ++ E ++  F   GN+TS K++ ++    S G+ FV +  PD+A +AV EMNG  ++ K L V+ A+     +
Sbjct:   10 TNLIINYVPPSMSQEDIKKIFGTVGNVTSCKLIRDRATGQSLGYAFVNYDNPDDANKAVREMNGARLQNKTLKVSFARPSSTEI 93          
BLAST of Polyadenylate-binding protein vs. Ensembl Medaka
Match: pabpc1a (poly(A) binding protein cytoplasmic 1 [Source:NCBI gene;Acc:101163762])

HSP 1 Score: 531.561 bits (1368), Expect = 1.041e-180
Identity = 300/633 (47.39%), Postives = 392/633 (61.93%), Query Frame = 2
Query:   89 PTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQRSTP----NKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQRGHQ----PQPVFNP-------GMVNFMMNSNVQRPFMARPGNILQ----NRW------PQTMPYIQ-------PRNIGMPANQNIMMTGMPQNQQRRNIMVDPMM-NQNRNARPITGNVQLNQTR--PQYNMVANGRQGNNIMYQYPIQDNQPMLNPDQMKMPDIESQIDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAHKGGEG 1882
            P+ P ASLYVGDLHPDVTEA+LYEKF   G +LSIRVCRD++TR+SLGYAYVN+Q   +A+ A+D +NF+ I GRP RIMWSQRDP+ R+SGVGNIFIKNLD SI  K + DTF+ FG I SCKV  DENG SKG+ FV+F     AE+AI+ +NG ++ ++ V+V +F  R +R        ++FTN YIKNFG  + D+ L++LF   G  +S +VM D  G SKGFGFVSF+ HEDA KAV+ +NG+ +  + +YVGRA KK ERQ EL+ ++E+ +Q+R+ +++ GVNLY+KNL + ++DERLR EF+ FG ITSAKVM+  E   SKGFGFVCFS+P+EAT+AV+EMNG+IV  KPLYVALAQ+KE+R AHL +Q+ QR       P PV NP       G     +     R        + Q     RW      PQ    IQ       PR    P   N +      N Q   +M    M  Q  + RP   +      R  PQY      R     M     Q   PM  P       ++ Q  LT  S +A A   E KQ+LGE+++PL+      +AGKITGM LE+DN+ELL+M+E+  SL+ K+DEA+ VL AH+  E 
Sbjct:    6 PSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGRPLRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETHEAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAREFTNVYIKNFGEDMDDEKLKELFGNYGPALSVRVMTDDTGKSKGFGFVSFERHEDAQKAVDDMNGKELNGRQVYVGRAQKKGERQNELKRKFEQMKQDRMTRYQ-GVNLYVKNLDDGLDDERLRKEFSPFGTITSAKVMM--EGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMATVRAVPNPVLNPYQPAPPSGYFMAAIPQAQNRAAYYSANQLAQLRPSPRWATQGVRPQHFQNIQNAMRPSAPR----PQTFNAIRASTATNTQVPRMMASQRMPTQALSQRPAAASATTAPVRAMPQYKYAPGVRNPQQHMAS---QQQVPMPQPAV----HVQGQEPLTA-SMLAAAPPQEQKQMLGERLFPLIQNMHPSLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEA 622          
BLAST of Polyadenylate-binding protein vs. Ensembl Medaka
Match: pabpc4 (poly(A) binding protein cytoplasmic 4 [Source:NCBI gene;Acc:101159058])

HSP 1 Score: 529.25 bits (1362), Expect = 7.055e-180
Identity = 295/626 (47.12%), Postives = 404/626 (64.54%), Query Frame = 2
Query:   83 ANPTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQR----STPNKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQR--GHQPQPV------FNPGMVNFM--MNSNVQRPFMARPGNILQ----NRWPQTMPYIQPRNIGMPAN----------QNIMMTGMPQNQQRRNIMVDPMMNQNRNARPITGNVQLNQTRPQYNMVANGRQGN-NIMYQYPIQDNQPMLNPDQMKMPDIESQIDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAHKG 1873
            A  + P ASLYVGDLHPD+TEA+LYEKF   G VLSIRVCRD++TR+SLGYAYVN+    +A+ A+D +NF+ + G+P RIMWSQRDP+ R+SGVGN+FIKNLD SI  K + DTF+ FG I SCKV  DENG SKG+AFV+F  +  A++AI+ +NG ++ ++ V+V +F  R +R        K+FTN YIKNFG  + D+ L+++FE+ G+ +S KVM D  G S+GFGFVSF++HEDA KAV  +NG  +  KT++VGRA KK ERQ EL+ ++E  +QER+ +++ GVNLYIKNL + I+DE+LR EF+ FG+ITSAKVML  E+  SKGFGFVCFS+P+EAT+AV+EMNG+IV  KPLYVALAQ+KE+R AHL +Q+ QR  G +  P       F P    FM  +     R     P  + Q     RW Q     Q    GMP++          +++  +G  Q  +     + P        RP  G V   +T   Y    + R  N  ++    +Q  QP ++        I+ Q  L T S +A A   E KQ+LGE+++PL+     ++AGKITGM LE+DN+ELL+M+E+  SL+ K++EA+ VL AH+ 
Sbjct:    4 ATGSYPMASLYVGDLHPDITEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFSQPADAERALDTMNFDVVKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SKGYAFVHFETQDAADRAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAKEFTNVYIKNFGDEMEDEQLKEMFEKYGKTLSVKVMTDSSGKSRGFGFVSFEKHEDANKAVEEINGTELNGKTVFVGRAQKKMERQAELKRKFELLKQERISRYQ-GVNLYIKNLDDTIDDEKLRKEFSPFGSITSAKVML--EDGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEERKAHLTNQYMQRIAGMRAMPPNAIINQFQPTSGYFMPAVPQAQNRTTYYAPNQLAQMRPNPRWQQQGGRGQGGFQGMPSSLRQPGPRGNMRHMSPSGGSQGPRASGQSMAP--------RPSMG-VPGPRTMSPYKYATSVRNPNPQVVQPIALQQAQPAVH--------IQGQEPL-TASMLAAAPPQEQKQMLGERLFPLIQAMHANLAGKITGMLLEIDNSELLHMLESHESLQSKVEEAVAVLQAHQA 607          
BLAST of Polyadenylate-binding protein vs. Ensembl Medaka
Match: pabpc1b (polyadenylate-binding protein 1-like [Source:NCBI gene;Acc:101169122])

HSP 1 Score: 526.168 bits (1354), Expect = 9.997e-179
Identity = 293/634 (46.21%), Postives = 400/634 (63.09%), Query Frame = 2
Query:   89 PTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQRSTP----NKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQRG-------------HQPQPVFNPGMVNFMMNSNVQ----RPFMARPGNILQ----NRWPQTMPYIQPRNI-GMPANQNIMMTGMPQNQQ----RRNIMVDPMMNQNRNA-------RPITGNVQLNQTRPQYNMVANGRQGNNIMYQYPIQDNQPMLNPDQMKMPDIESQIDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAHKGGE 1879
            P+ P ASLYVGDLH DVTEA+LYEKF   G ++SIRVCRD++TR+SLGYAYVN+Q   +A+ A+D +NF+ I G+P RIMWSQRDP+ R+SGVGNIFIKNLD SI  K + DTF+ FG I SCKV  DENG S+G+ FV+F     AE+AI+ +NG ++ ++ V+V +F  R +R        ++FTN YIKNFG  + D+ L+++F + G   S +VM D+ G  +GFGFVSF+ HEDA KAV+ +NG+ +  + ++VGRA KK ERQ EL+ R+E+ +Q+R  +++ GVNLY+KNL + I+DERLR EF+ FG+ITSAKVM+  E   SKGFGFVCFS+P+EAT+AV+EMNG+IV  KPLYVALAQ+KE+R AHL +Q+ QR              +QP P        F+M +  Q      +    G + Q     RW  T   ++P++   MP    +M    P+ Q     R +  V PMMN  R A        P+       +  PQY      R     +   P    QP ++        I+ Q  L T S +A A   E KQ+LGE+++PL+      +AGKITGM LE+DN+ELL+M+E+  SL+ K+DEA+ VL AH+  E
Sbjct:    6 PSYPIASLYVGDLHQDVTEAMLYEKFSPAGAIVSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGQPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENG-SRGYGFVHFETHDAAERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAREFTNVYIKNFGEDMDDEKLKEIFSKFGNATSVRVMTDESGGGRGFGFVSFENHEDAQKAVDEMNGKELNGRIMFVGRAQKKMERQMELKRRFEQMKQDRTTRYQ-GVNLYVKNLDDGIDDERLRKEFSPFGSITSAKVMM--EGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLITQYMQRVANARAAANPVMNPYQPAPP-----SGFIMTAIPQAQSRSAYYPTAGQMAQLRPGPRW--TTQSVRPQHFQNMPG---VMRPPRPRPQNFSTVRASSQVPPMMNTQRVAAQSSGPRHPVATAATHVRGGPQYKYSTGVRNPQQHVATQPQVTLQPAVH--------IQGQEPL-TASMLAAAPLQEQKQMLGERLFPLIQNMHPSLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKE 616          
BLAST of Polyadenylate-binding protein vs. Ensembl Medaka
Match: pabpc1l (embryonic polyadenylate-binding protein [Source:NCBI gene;Acc:101167536])

HSP 1 Score: 502.286 bits (1292), Expect = 3.208e-170
Identity = 275/601 (45.76%), Postives = 385/601 (64.06%), Query Frame = 2
Query:   83 ANPTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQR----STPNKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQRGHQPQPVFNPGMVNFMMNSNVQRPFMARPGNILQNRWPQTMPYIQPRNIGMPANQNIMMTGMPQNQQRRNIMVDPMMNQNRNARPITGNVQLNQTRPQYNMVANGRQGNNIMYQYPIQDNQPMLNPDQMKMPDIESQIDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAHKG 1873
              P  P ASLYVGDLHPDVTEA+LY+KF   G ++SIRVCRD++TR+SLGYAY+N+Q   +A+ A+D +N++ I GRP RIMWSQRDPA R+SGVGNIFIKN+D SI  K + DTF+ FG I SCKV  DE G SKG+ FV+F  +  A +AI+ +NG ++ ++ V+V  F  R +R     T    FTN YIKNFG +L D+ L++ F   G+ +S +VM D++G S+GFGFV++  HEDA KAV+ +NG+ +  K IYVGRA K+ ERQ EL+ ++++ +Q+R+Q+++ GVNLY+KNL + I+DERLR EF+ +G ITSAKVM   E   SKGFGFVCFS+P+EAT+AV+EMNG+IV  KPLYVALAQ++E+R A L +++ QR    + + +P +++    S         P     N    +     PR  G P          PQ+    +I+        R +  IT   Q +   P+  +V         M + P+     +L P+ +            T S +A A  M+ KQLLG+++YPL+     ++AGKITGM LE+DN+ELL+M+E+  SLK K+DEA+ VL AH+ 
Sbjct:    4 GGPGYPLASLYVGDLHPDVTEAMLYQKFSPAGPIVSIRVCRDIITRRSLGYAYINFQQPADAECALDTMNYDVIKGRPIRIMWSQRDPALRKSGVGNIFIKNIDDSIDNKALYDTFSAFGNILSCKVVCDERG-SKGYGFVHFETQEAANRAIETMNGMLLNDRKVFVGHFKSRKEREVEFGTKVMKFTNIYIKNFGDNLTDEKLKEAFSAFGKTLSVRVMRDEKGRSRGFGFVNYAHHEDAQKAVDEMNGKEMNGKIIYVGRAQKRLERQGELKRKFDQLKQDRIQRYQ-GVNLYVKNLDDSIDDERLRKEFSPYGTITSAKVM--TEAGQSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRREERKAILTNKYMQRMATLRTMPSP-IIDSYHQSGYYMTVPQPPTRSFYNHNAVSNVRPIPRWPGQPQR--------PQDPYSSHIVGGSF--ARRGSTTITTVKQASTQAPRIIVVPVS------MVEPPVH----ILGPEPL------------TASMLAAAPPMDQKQLLGDRLYPLILAQQPNLAGKITGMLLEIDNSELLHMLESPESLKSKVDEAIAVLQAHQA 567          
BLAST of Polyadenylate-binding protein vs. Ensembl Medaka
Match: pabpc1l (embryonic polyadenylate-binding protein [Source:NCBI gene;Acc:101167536])

HSP 1 Score: 492.656 bits (1267), Expect = 7.563e-166
Identity = 281/632 (44.46%), Postives = 394/632 (62.34%), Query Frame = 2
Query:   83 ANPTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQR----STPNKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKED-----------RVAHLRS-------QFQQRGHQ---PQPVFNPGMVNFMMNSNVQRPFMARPGNILQNRWPQTMPYIQPRNIGMPANQNIMMTGMPQNQQRRNIMVDPMMNQNRNARPITGNVQLN-----QTRPQYNMVANGRQGNNIMYQYPIQDNQPMLNPDQMKMPDIESQIDLT-----TTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAHKG 1873
              P  P ASLYVGDLHPDVTEA+LY+KF   G ++SIRVCRD++TR+SLGYAY+N+Q   +A+ A+D +N++ I GRP RIMWSQRDPA R+SGVGNIFIKN+D SI  K + DTF+ FG I SCKV  DE G SKG+ FV+F  +  A +AI+ +NG ++ ++ V+V  F  R +R     T    FTN YIKNFG +L D+ L++ F   G+ +S +VM D++G S+GFGFV++  HEDA KAV+ +NG+ +  K IYVGRA K+ ERQ EL+ ++++ +Q+R+Q+++ GVNLY+KNL + I+DERLR EF+ +G ITSAKVM   E   SKGFGFVCFS+P+EAT+AV+EMNG+IV  KPLYVALAQ++E+           R+A LR+        + Q G+    PQP       N    SNV RP           RWP      QP+    P + +I+        +R +  +  +   +  A  I  + Q       QT      VA   +     Y   +++   ++    + +  +E  + +      T S +A A  M+ KQLLG+++YPL+     ++AGKITGM LE+DN+ELL+M+E+  SLK K+DEA+ VL AH+ 
Sbjct:    4 GGPGYPLASLYVGDLHPDVTEAMLYQKFSPAGPIVSIRVCRDIITRRSLGYAYINFQQPADAECALDTMNYDVIKGRPIRIMWSQRDPALRKSGVGNIFIKNIDDSIDNKALYDTFSAFGNILSCKVVCDERG-SKGYGFVHFETQEAANRAIETMNGMLLNDRKVFVGHFKSRKEREVEFGTKVMKFTNIYIKNFGDNLTDEKLKEAFSAFGKTLSVRVMRDEKGRSRGFGFVNYAHHEDAQKAVDEMNGKEMNGKIIYVGRAQKRLERQGELKRKFDQLKQDRIQRYQ-GVNLYVKNLDDSIDDERLRKEFSPYGTITSAKVM--TEAGQSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRREERKAILTNKYMQRMATLRTMPSPIIDSYHQSGYYMTVPQPPTR-SFYNHNAVSNV-RPI---------PRWPG-----QPQRPQDPYSSHIVGGSF---ARRGSTTITTVKQASTQAPRIIASTQKTNNIGTQTVGGRADVAGVLRSGQYKYSSAVRNPLHVVTVPVVPVSMVEPPVHILGPEPLTASMLAAAPPMDQKQLLGDRLYPLILAQQPNLAGKITGMLLEIDNSELLHMLESPESLKSKVDEAIAVLQAHQA 612          
BLAST of Polyadenylate-binding protein vs. Planmine SMEST
Match: SMESG000058745.1 (SMESG000058745.1)

HSP 1 Score: 1266.91 bits (3277), Expect = 0.000e+0
Identity = 606/607 (99.84%), Postives = 606/607 (99.84%), Query Frame = 2
Query:   80 MANPTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQRSTPNKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQRGHQPQPVFNPGMVNFMMNSNVQRPFMARPGNILQNRWPQTMPYIQPRNIGMPANQNIMMTGMPQNQQRRNIMVDPMMNQNRNARPITGNVQLNQTRPQYNMVANGRQGNNIMYQYPIQDNQPMLNPDQMKMPDIESQIDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAHKGGEGDVVRHD 1900
            MANPTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQRSTPNKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELR RYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQRGHQPQPVFNPGMVNFMMNSNVQRPFMARPGNILQNRWPQTMPYIQPRNIGMPANQNIMMTGMPQNQQRRNIMVDPMMNQNRNARPITGNVQLNQTRPQYNMVANGRQGNNIMYQYPIQDNQPMLNPDQMKMPDIESQIDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAHKGGEGDVVRHD
Sbjct:    1 MANPTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQRSTPNKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRARYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQRGHQPQPVFNPGMVNFMMNSNVQRPFMARPGNILQNRWPQTMPYIQPRNIGMPANQNIMMTGMPQNQQRRNIMVDPMMNQNRNARPITGNVQLNQTRPQYNMVANGRQGNNIMYQYPIQDNQPMLNPDQMKMPDIESQIDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAHKGGEGDVVRHD 607          
BLAST of Polyadenylate-binding protein vs. Planmine SMEST
Match: SMESG000004978.1 (SMESG000004978.1)

HSP 1 Score: 576.244 bits (1484), Expect = 0.000e+0
Identity = 323/665 (48.57%), Postives = 421/665 (63.31%), Query Frame = 2
Query:   86 NPTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQRSTPNKD--FTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQRGHQPQ----------------PVFNPGMVNFMMNSNVQRPFMARPGNIL---QNRW-----PQTMPY----------------------IQPRNIGMPANQNIMMTGMPQ---------NQQRRNIMVDPMMNQNR----NARPITGNVQLNQTRPQYNMVANGRQGN----NIMYQYPIQDNQPMLNP-----DQMKMPDIESQIDLTTTSKIANADSMEAKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAHK 1870
            N +IP ASLYVGDLHP+VTEA++YEKF + G VLSIRVCRD++TRKSLGYAYVN+Q + +A+SA+D +NF+ + GR  RIMWSQRDP+ R+SG+GNIFIKNLD SIT KE++DTF  FG I SCK+  DE   SKG+ FV+F  E  A  AI AING +I+ K V+V +FIPRT R+  + D  FTNCYIKNFG  L D+ LR++F + GEI SAKVM+D+ G SKGFGFV FK+ E A  AV  LNG++ +D+ +YVGRA KK ER  ELR+ +EK R ER  ++  GVNLY+KNL + I+D RL+ EF VFGNITSAKVM +  NN SKGFGFVCFS P+EAT+AV+EMNGKI   KPLYVALAQ+KEDR AHL SQ+ QR +  +                P   P ++ +    N   P +          QNRW     P  + +                      IQ   +GM ANQ   ++ +P          N    N+M++ + N  +    N+RPITG VQ+  T  Q + ++  R  N     I  Q  I  NQ +  P     +Q+    +   ++  T S +A+A   E KQ+LGE++YPLV +   ++AGKITGM LE+DN ELL+M+E+E+SL  KI+EAM VL +HK
Sbjct:    9 NNSIPMASLYVGDLHPEVTEAMIYEKFSSCGPVLSIRVCRDMITRKSLGYAYVNFQNAADAESALDRMNFDTMKGRSIRIMWSQRDPSLRKSGIGNIFIKNLDKSITQKELHDTFVAFGNILSCKIAADERSKSKGYGFVHFETEAAATNAIDAINGMLIKNKKVFVGRFIPRTNRANSDSDVKFTNCYIKNFGEDLDDEKLREMFLEFGEITSAKVMIDENGKSKGFGFVCFKDSETAESAVKALNGKMFKDRQLYVGRAQKKNERLDELRSHFEKQRAERSSRYTQGVNLYVKNLDDSIDDTRLKQEFVVFGNITSAKVMTD-SNNRSKGFGFVCFSNPEEATKAVTEMNGKICGSKPLYVALAQRKEDRKAHLASQYMQRVNPHRNNYPNQVSVNTLISGGPPGGPSILPYAFAPNASTPRVYTQSAAFMPPQNRWSNRMHPSQLQFNGGNMRQLANAHFGNMEGSSVPIQNNTMGMQANQIRQVSMIPNQRPMLSNNANVSASNVMMNGVANTVKSAPQNSRPITG-VQMPITS-QASNISQQRPPNQPTRQITGQSVISGNQNVNRPINNGSNQL----VSGNLEPLTISTLASAPIAEQKQMLGERLYPLVHRMYPELAGKITGMLLEIDNTELLHMLESEDSLTTKIEEAMNVLQSHK 666          
BLAST of Polyadenylate-binding protein vs. Planmine SMEST
Match: SMESG000062663.1 (SMESG000062663.1)

HSP 1 Score: 419.468 bits (1077), Expect = 8.873e-141
Identity = 205/383 (53.52%), Postives = 281/383 (73.37%), Query Frame = 2
Query:   80 MANPTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQRSTPNKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRE-LRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQ 1225
            M N  +  ASLYVGDL+ DVTE+ L++ F+  G ++SI VCRDL+   SLGYAY+N+  S++AK+A+D +N E+I G PCR+ WSQRD + R+S VGNI IKNL  ++TVKE+ + F  FGEI+SC ++TDENG+SKG AFVNF+  G A+KAI++ING+ I++++VYV KFIP+ Q     K FTN Y+KNFGIHL+++SL +LF   GEI+S KVM  ++G SKGFGFV FK H DA+K++  LN   I DK IYVG A++K +   E LRT   K++ +   Q    VN+++KNL   INDE+L+ EF+VFGN+TSAKVM++K N  SKGFGFVCFS  +EA +A+ EMN K++  K +YVA+A K+E+   H+ S+FQ+
Sbjct:    1 MENKNLNAASLYVGDLNKDVTESNLFDVFKNFGKIISIHVCRDLIKNVSLGYAYINFTNSSDAKAAIDKVNLENIKGTPCRVTWSQRDSSVRKSNVGNIIIKNLPQTVTVKELREKFECFGEITSCSMKTDENGLSKGCAFVNFSEAGYADKAIESINGQKIQDEVVYVGKFIPKDQLK---KTFTNVYVKNFGIHLNNQSLEELFSPFGEIISVKVMATEKGISKGFGFVCFKNHSDALKSIEKLNETTIIDKVIYVGLAVEKPKSVEEKLRTVESKSKDK--PQLVESVNVFVKNLDESINDEKLKAEFSVFGNVTSAKVMVDKSNGVSKGFGFVCFSNSNEAAQAILEMNYKVLCDKQIYVAVAYKRENSDNHVHSKFQK 378          

HSP 2 Score: 127.102 bits (318), Expect = 2.277e-31
Identity = 88/284 (30.99%), Postives = 146/284 (51.41%), Query Frame = 2
Query:  110 LYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRI-MWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVA------KFIPRTQRSTPNK--------DFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKE-GNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKT 913
            + + +L   VT   L EKF+  G + S  +  D     S G A+VN+  +  A  A++++N + I      +  +  +D   +     N+++KN    +  + + + F+ FGEI S KV   E G+SKGF FV F +  DA K+I+ +N   I +K++YV       K +    R+  +K        +  N ++KN    ++D+ L+  F   G + SAKVMVDK  G SKGFGFV F    +A +A+  +N +V+ DK IYV  A K+      + ++++K+
Sbjct:   99 IIIKNLPQTVTVKELREKFECFGEITSCSMKTDE-NGLSKGCAFVNFSEAGYADKAIESINGQKIQDEVVYVGKFIPKDQLKKT--FTNVYVKNFGIHLNNQSLEELFSPFGEIISVKVMATEKGISKGFGFVCFKNHSDALKSIEKLNETTIIDKVIYVGLAVEKPKSVEEKLRTVESKSKDKPQLVESVNVFVKNLDESINDEKLKAEFSVFGNVTSAKVMVDKSNGVSKGFGFVCFSNSNEAAQAILEMNYKVLCDKQIYVAVAYKRENSDNHVHSKFQKS 379          
BLAST of Polyadenylate-binding protein vs. Planmine SMEST
Match: SMESG000058799.1 (SMESG000058799.1)

HSP 1 Score: 318.161 bits (814), Expect = 6.644e-95
Identity = 166/399 (41.60%), Postives = 253/399 (63.41%), Query Frame = 2
Query:  104 ASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQRSTPNKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQRGHQPQPVFNPGMVNFMMNSNVQRP 1300
            + +++ +LHPDV E  LY+ F ++G +LSIR+ R+  T+KSLG AY+ +   ++AK+AMD +NF+ I+   CRI WS+ +   R+S +GN+FIKNLD S+  K+I + F  FGEI SCK++T+E G S GF FV ++ E  AE AI+ +NGK+I  K+VYV KF+ +  R+  ++  TNCY+KN    + ++ LR+LF   GEIVS+ V VD +G SKG GFV+FK+H++A++A+ T+NG +I D+ I V  A  +  +                 ++    N+YI  L + +++  L  EF++FG+ITSAKVM ++EN  S G+GFVC+S P EA  AV++MNGK +EGK ++V +  K+  +V + +S   +    P+PV        M   N Q P
Sbjct:  579 SEIFLENLHPDVDEEFLYKLFHSYGEILSIRLMRNSETQKSLGVAYITFVRRSDAKTAMDKVNFKKIYRNECRIKWSESNKVIRKSEIGNVFIKNLDLSLNTKDIYEIFKRFGEIISCKLRTNEIGESLGFGFVRYDSEPTAELAIRKMNGKLIGNKVVYVGKFLSKQHRACVDEKSTNCYVKNLETSIDNEKLRELFAGFGEIVSSIVQVDSKGISKGRGFVAFKKHDEALRAITTMNGEMINDQRIEVSIAQHQMAKG---------------NKNALNCNVYINRLDSIVDETMLLKEFSIFGSITSAKVMRDEENKFSLGYGFVCYSNPQEAQLAVTKMNGKNLEGKKIFVNICGKRM-KVENYKS-CSENNPSPKPV--------MWTENRQEP 952          

HSP 2 Score: 63.1586 bits (152), Expect = 6.888e-10
Identity = 30/53 (56.60%), Postives = 38/53 (71.70%), Query Frame = 2
Query: 1688 AKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEA 1846
             KQ+ GE +Y  V KYAG+++GKI GMFLELDN EL  ++E+EN L  KI  A
Sbjct:  963 TKQIFGELLYKKVEKYAGNLSGKIVGMFLELDNRELTTLLEDENELIKKIQMA 1015          

HSP 3 Score: 53.5286 bits (127), Expect = 6.222e-7
Identity = 28/60 (46.67%), Postives = 40/60 (66.67%), Query Frame = 2
Query: 1685 EAKQLLGEKIYPLVSKYAGDMAGKITGM-FLELDNAELLYMIENENSLKMKIDEAMLVLN 1861
            E KQ+ GEKIY +V +Y+   AGKIT M  L LD  +L+ +I++EN L+ +I+E    LN
Sbjct:  141 EIKQIYGEKIYSIVKEYSPKEAGKITAMLLLALDETDLVKLIDDENLLRKQIEETFSWLN 200          
BLAST of Polyadenylate-binding protein vs. Planmine SMEST
Match: SMESG000058799.1 (SMESG000058799.1)

HSP 1 Score: 317.39 bits (812), Expect = 1.023e-94
Identity = 157/361 (43.49%), Postives = 239/361 (66.20%), Query Frame = 2
Query:  104 ASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSLGYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIFIKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDAEKAIQAINGKMIREKIVYVAKFIPRTQRSTPNKDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKK 1186
            + +++ +LHPDV E  LY+ F ++G +LSIR+ R+  T+KSLG AY+ +   ++AK+AMD +NF+ I+   CRI WS+ +   R+S +GN+FIKNLD S+  K+I + F  FGEI SCK++T+E G S GF FV ++ E  AE AI+ +NGK+I  K+VYV KF+ +  R+  ++  TNCY+KN    + ++ LR+LF   GEIVS+ V VD +G SKG GFV+FK+H++A++A+ T+NG +I D+ I V  A  +  +                 ++    N+YI  L + +++  L  EF++FG+ITSAKVM ++EN  S G+GFVC+S P EA  AV++MNGK +EGK ++V +  K+
Sbjct:  579 SEIFLENLHPDVDEEFLYKLFHSYGEILSIRLMRNSETQKSLGVAYITFVRRSDAKTAMDKVNFKKIYRNECRIKWSESNKVIRKSEIGNVFIKNLDLSLNTKDIYEIFKRFGEIISCKLRTNEIGESLGFGFVRYDSEPTAELAIRKMNGKLIGNKVVYVGKFLSKQHRACVDEKSTNCYVKNLETSIDNEKLRELFAGFGEIVSSIVQVDSKGISKGRGFVAFKKHDEALRAITTMNGEMINDQRIEVSIAQHQMAKG---------------NKNALNCNVYINRLDSIVDETMLLKEFSIFGSITSAKVMRDEENKFSLGYGFVCYSNPQEAQLAVTKMNGKNLEGKKIFVNICGKR 924          

HSP 2 Score: 69.3218 bits (168), Expect = 7.559e-12
Identity = 57/201 (28.36%), Postives = 101/201 (50.25%), Query Frame = 2
Query:  608 QRSTPN--KDFTNCYIKNFGIHLHDKSLRDLFEQCGEIVSAKVMVDKEG-NSKGFGFVSFKEHEDAIKAVNTLNGRVIEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNEINDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSEMNGKIVEGKPLYVALAQKKEDRVA 1201
            Q++ P+   D +  +++N    + ++ L  LF   GEI+S ++M + E   S G  +++F    DA  A++ +N      K IY          + E R ++ ++ +  +++ + G N++IKNL   +N + +   F  FG I S K+  N E   S GFGFV + +   A  A+ +MNGK++  K +YV     K+ R  
Sbjct:  568 QKTKPSWYSDDSEIFLENLHPDVDEEFLYKLFHSYGEILSIRLMRNSETQKSLGVAYITFVRRSDAKTAMDKVNF-----KKIY----------RNECRIKWSESNK-VIRKSEIG-NVFIKNLDLSLNTKDIYEIFKRFGEIISCKLRTN-EIGESLGFGFVRYDSEPTAELAIRKMNGKLIGNKVVYVGKFLSKQHRAC 750          

HSP 3 Score: 62.3882 bits (150), Expect = 1.260e-9
Identity = 28/50 (56.00%), Postives = 37/50 (74.00%), Query Frame = 2
Query: 1688 AKQLLGEKIYPLVSKYAGDMAGKITGMFLELDNAELLYMIENENSLKMKI 1837
             KQ+ GE +Y  V KYAG+++GKI GMFLELDN EL  ++E+EN L  K+
Sbjct:  961 TKQIFGELLYKKVEKYAGNLSGKIVGMFLELDNRELTTLLEDENELIKKV 1010          

HSP 4 Score: 53.5286 bits (127), Expect = 5.704e-7
Identity = 28/60 (46.67%), Postives = 40/60 (66.67%), Query Frame = 2
Query: 1685 EAKQLLGEKIYPLVSKYAGDMAGKITGM-FLELDNAELLYMIENENSLKMKIDEAMLVLN 1861
            E KQ+ GEKIY +V +Y+   AGKIT M  L LD  +L+ +I++EN L+ +I+E    LN
Sbjct:  141 EIKQIYGEKIYSIVKEYSPKEAGKITAMLLLALDETDLVKLIDDENLLRKQIEETFSWLN 200          
The following BLAST results are available for this feature:
BLAST of Polyadenylate-binding protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PABPC10.000e+048.10poly(A) binding protein cytoplasmic 1 [Source:HGNC... [more]
PABPC40.000e+048.85poly(A) binding protein cytoplasmic 4 [Source:HGNC... [more]
PABPC40.000e+047.92poly(A) binding protein cytoplasmic 4 [Source:HGNC... [more]
PABPC40.000e+047.54poly(A) binding protein cytoplasmic 4 [Source:HGNC... [more]
PABPC40.000e+046.81poly(A) binding protein cytoplasmic 4 [Source:HGNC... [more]
back to top
BLAST of Polyadenylate-binding protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pab-12.019e-15945.96Polyadenylate-binding protein [Source:UniProtKB/T... [more]
pab-12.019e-15945.96Polyadenylate-binding protein [Source:UniProtKB/T... [more]
pab-12.019e-15945.96Polyadenylate-binding protein [Source:UniProtKB/T... [more]
pab-12.019e-15945.96Polyadenylate-binding protein [Source:UniProtKB/T... [more]
pab-12.019e-15945.96Polyadenylate-binding protein [Source:UniProtKB/T... [more]
back to top
BLAST of Polyadenylate-binding protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pAbp2.080e-16445.20gene:FBgn0265297 transcript:FBtr0086738[more]
pAbp2.080e-16445.20gene:FBgn0265297 transcript:FBtr0086736[more]
pAbp2.080e-16445.20gene:FBgn0265297 transcript:FBtr0086740[more]
CG46122.705e-4041.80gene:FBgn0035016 transcript:FBtr0306137[more]
CG46122.705e-4041.80gene:FBgn0035016 transcript:FBtr0072346[more]
back to top
BLAST of Polyadenylate-binding protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pabpc40.000e+047.14poly(A) binding protein, cytoplasmic 4 (inducible ... [more]
pabpc40.000e+047.14poly(A) binding protein, cytoplasmic 4 (inducible ... [more]
pabpc1a0.000e+046.65poly(A) binding protein, cytoplasmic 1a [Source:ZF... [more]
pabpc1a0.000e+046.65poly(A) binding protein, cytoplasmic 1a [Source:ZF... [more]
pabpc1b0.000e+047.08poly A binding protein, cytoplasmic 1 b [Source:ZF... [more]
back to top
BLAST of Polyadenylate-binding protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmem1010.000e+048.18transmembrane protein 101 [Source:Xenbase;Acc:XB-G... [more]
pabpc40.000e+046.76poly(A) binding protein cytoplasmic 4 [Source:NCBI... [more]
tmem1010.000e+048.12transmembrane protein 101 [Source:Xenbase;Acc:XB-G... [more]
tmem1011.428e-18048.96transmembrane protein 101 [Source:Xenbase;Acc:XB-G... [more]
tmem1011.389e-17947.78transmembrane protein 101 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Polyadenylate-binding protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pabpc10.000e+047.94poly(A) binding protein, cytoplasmic 1 [Source:MGI... [more]
Pabpc40.000e+047.28poly(A) binding protein, cytoplasmic 4 [Source:MGI... [more]
Pabpc40.000e+048.20poly(A) binding protein, cytoplasmic 4 [Source:MGI... [more]
Pabpc41.410e-18046.01poly(A) binding protein, cytoplasmic 4 [Source:MGI... [more]
Pabpc42.880e-18046.66poly(A) binding protein, cytoplasmic 4 [Source:MGI... [more]
back to top
BLAST of Polyadenylate-binding protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P11940|PABP1_HUMAN0.000e+048.10Polyadenylate-binding protein 1 OS=Homo sapiens OX... [more]
sp|P61286|PABP1_BOVIN0.000e+048.10Polyadenylate-binding protein 1 OS=Bos taurus OX=9... [more]
sp|P29341|PABP1_MOUSE0.000e+047.94Polyadenylate-binding protein 1 OS=Mus musculus OX... [more]
sp|Q5R8F7|PABP1_PONAB0.000e+047.94Polyadenylate-binding protein 1 OS=Pongo abelii OX... [more]
sp|Q9EPH8|PABP1_RAT0.000e+047.94Polyadenylate-binding protein 1 OS=Rattus norvegic... [more]
back to top
BLAST of Polyadenylate-binding protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2J7QJ010.000e+049.61Polyadenylate-binding protein OS=Cryptotermes secu... [more]
A0A087T5F40.000e+048.84Polyadenylate-binding protein (Fragment) OS=Stegod... [more]
A0A2J7QKS70.000e+049.61Polyadenylate-binding protein OS=Cryptotermes secu... [more]
A0A1W7R9X30.000e+048.83Polyadenylate-binding protein OS=Hadrurus spadix O... [more]
A0A067REV70.000e+049.61Polyadenylate-binding protein OS=Zootermopsis neva... [more]
back to top
BLAST of Polyadenylate-binding protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000035946.10.000e+047.32polyadenylate-binding protein 1-like [Source:NCBI ... [more]
pabpc1b0.000e+047.07poly(A) binding protein cytoplasmic 1 [Source:NCBI... [more]
ENSAMXT00000018970.20.000e+047.43polyadenylate-binding protein 1-like [Source:NCBI ... [more]
pabpc1l7.940e-17745.54embryonic polyadenylate-binding protein B-like [So... [more]
pabpc1l1.125e-17043.66embryonic polyadenylate-binding protein B-like [So... [more]
back to top
BLAST of Polyadenylate-binding protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pabpc41.920e-15345.96poly(A) binding protein, cytoplasmic 4 (inducible ... [more]
pabpc43.208e-10641.77poly(A) binding protein, cytoplasmic 4 (inducible ... [more]
ncl1.343e-2426.12nucleolin [Source:ZFIN;Acc:ZDB-GENE-030131-6986][more]
sf3b41.748e-2033.94splicing factor 3b, subunit 4 [Source:ZFIN;Acc:ZDB... [more]
tia1l2.575e-1730.90cytotoxic granule-associated RNA binding protein 1... [more]
back to top
BLAST of Polyadenylate-binding protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PAB15.203e-13340.93Poly(A) binding protein; part of the 3'-end RNA-pr... [more]
PES43.157e-2827.51Poly(A) binding protein, suppressor of DNA polymer... [more]
MIP69.580e-2325.44Putative RNA-binding protein; interacts with Mex67... [more]
PUB11.177e-2128.02Poly (A)+ RNA-binding protein; abundant mRNP-compo... [more]
GBP21.825e-1623.81Poly(A+) RNA-binding protein; key surveillance fac... [more]
back to top
BLAST of Polyadenylate-binding protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO332069.350e-17747.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO295653.153e-2448.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426738.306e-2428.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424178.270e-2133.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348793.488e-1832.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Polyadenylate-binding protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pabpc1a1.041e-18047.39poly(A) binding protein cytoplasmic 1 [Source:NCBI... [more]
pabpc47.055e-18047.12poly(A) binding protein cytoplasmic 4 [Source:NCBI... [more]
pabpc1b9.997e-17946.21polyadenylate-binding protein 1-like [Source:NCBI ... [more]
pabpc1l3.208e-17045.76embryonic polyadenylate-binding protein [Source:NC... [more]
pabpc1l7.563e-16644.46embryonic polyadenylate-binding protein [Source:NC... [more]
back to top
BLAST of Polyadenylate-binding protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000058745.10.000e+099.84SMESG000058745.1[more]
SMESG000004978.10.000e+048.57SMESG000004978.1[more]
SMESG000062663.18.873e-14153.52SMESG000062663.1[more]
SMESG000058799.16.644e-9541.60SMESG000058799.1[more]
SMESG000058799.11.023e-9443.49SMESG000058799.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005231 ID=SMED30005231|Name=Polyadenylate-binding protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2255bp
CGATAAATTACTATTTGTTTAAATGAACAGTTTTACAAAACATTAAAAAA
CATAAATAGTACCACTTTAAAAAAAAGCTATGGCAAATCCAACAATTCCT
TGCGCTAGTCTTTATGTTGGAGACTTGCATCCTGACGTAACTGAAGCAAT
TTTGTATGAAAAATTCCAAACCCATGGTAATGTTTTATCGATTCGTGTAT
GTCGAGATTTAGTCACCAGAAAATCTTTGGGCTATGCTTACGTAAACTAC
CAAGTTAGTACTGAAGCAAAAAGTGCAATGGATAATTTAAACTTTGAGGA
TATCCATGGTCGTCCTTGTAGAATTATGTGGTCCCAAAGAGATCCTGCAG
CTAGAAGGTCTGGTGTCGGAAATATTTTCATCAAAAATCTCGACCCATCA
ATTACAGTTAAGGAAATCAATGACACATTTGCTAATTTTGGAGAAATATC
ATCTTGTAAAGTCCAAACTGACGAAAATGGTGTGTCAAAAGGATTTGCAT
TTGTGAATTTCAATCATGAAGGGGATGCTGAAAAGGCTATTCAAGCTATC
AATGGTAAAATGATTAGAGAAAAGATTGTATACGTTGCAAAATTTATACC
ACGAACCCAACGAAGCACTCCAAACAAGGACTTTACTAACTGTTACATCA
AGAATTTCGGAATTCATTTACATGACAAATCTTTGAGAGACCTATTTGAA
CAATGTGGTGAAATAGTAAGTGCTAAAGTAATGGTTGATAAAGAAGGAAA
TTCTAAAGGGTTTGGCTTCGTAAGTTTCAAGGAGCACGAAGACGCAATCA
AAGCTGTTAATACTTTAAATGGTCGTGTAATAGAGGATAAAACCATTTAT
GTAGGTCGCGCGATGAAGAAAGCTGAACGCCAAAGGGAATTACGCACAAG
GTACGAAAAAACTAGACAAGAAAGATTGCAACAACATAAGTCTGGAGTTA
ACCTTTATATTAAGAACTTGGGAAATGAAATCAACGACGAGCGACTAAGA
AATGAATTTGCTGTTTTTGGAAATATCACAAGTGCTAAAGTTATGCTTAA
TAAAGAAAACAATACTTCTAAAGGATTTGGTTTCGTGTGCTTCTCAGCTC
CTGATGAAGCAACTCGTGCAGTTTCAGAAATGAATGGTAAAATTGTAGAA
GGTAAACCTTTATATGTTGCTTTGGCTCAAAAAAAAGAAGACAGAGTCGC
TCATTTGCGATCTCAATTCCAACAACGAGGTCATCAACCTCAACCAGTTT
TCAACCCAGGAATGGTTAATTTCATGATGAATTCCAATGTTCAAAGGCCT
TTCATGGCTAGACCAGGTAACATACTTCAAAATAGATGGCCACAAACTAT
GCCATATATTCAACCAAGAAATATTGGAATGCCAGCCAATCAAAATATAA
TGATGACAGGTATGCCACAAAACCAACAACGTCGTAACATAATGGTGGAT
CCTATGATGAATCAAAACAGAAATGCACGTCCAATTACAGGAAATGTTCA
ATTAAATCAAACAAGACCACAGTATAACATGGTAGCGAACGGTAGACAAG
GCAACAACATTATGTACCAATATCCAATTCAAGACAACCAACCGATGCTG
AATCCTGATCAAATGAAAATGCCTGACATTGAAAGTCAAATTGATTTGAC
CACAACTTCTAAAATTGCAAATGCCGATTCAATGGAAGCCAAGCAATTGT
TAGGTGAAAAAATTTATCCATTGGTTAGCAAATATGCTGGAGATATGGCA
GGGAAAATTACCGGTATGTTTTTGGAATTAGATAATGCAGAATTGCTTTA
CATGATTGAGAATGAAAATTCTTTAAAGATGAAGATTGACGAGGCTATGT
TAGTTTTAAATGCACACAAAGGAGGAGAAGGTGACGTCGTTCGACATGAC
TAGCGCTAAGGCTCGTATTTGTTATATGCTATTAAAAATCAAAAAAATAG
CAAATAGATAAAAAAAATAAATTTTGGATTGGATGTATTTGTATTACTTA
ATAAATTAGATAAATTCAATTTTTGTGTTTGATATTTCCAGATTGGAAAT
ATCGATTTTTATGAATTTTGTTTTTGAAGTTGCCATAGTGATTGTTAAAA
TTTTGAAAATCTAATCAAATTTTCGTGTGTAAGTTATTTAATCTAATTCC
GTGTTTTGTATGAATTTATTGTGTATATATTTGAGTATATTTTTAAGTGT
AGGTTTTATAAAAATAGTTTGCTACGTGTTAGAAATCAACACGTCACAAC
TTATA
back to top

protein sequence of SMED30005231-orf-1

>SMED30005231-orf-1 ID=SMED30005231-orf-1|Name=SMED30005231-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=608bp
MANPTIPCASLYVGDLHPDVTEAILYEKFQTHGNVLSIRVCRDLVTRKSL
GYAYVNYQVSTEAKSAMDNLNFEDIHGRPCRIMWSQRDPAARRSGVGNIF
IKNLDPSITVKEINDTFANFGEISSCKVQTDENGVSKGFAFVNFNHEGDA
EKAIQAINGKMIREKIVYVAKFIPRTQRSTPNKDFTNCYIKNFGIHLHDK
SLRDLFEQCGEIVSAKVMVDKEGNSKGFGFVSFKEHEDAIKAVNTLNGRV
IEDKTIYVGRAMKKAERQRELRTRYEKTRQERLQQHKSGVNLYIKNLGNE
INDERLRNEFAVFGNITSAKVMLNKENNTSKGFGFVCFSAPDEATRAVSE
MNGKIVEGKPLYVALAQKKEDRVAHLRSQFQQRGHQPQPVFNPGMVNFMM
NSNVQRPFMARPGNILQNRWPQTMPYIQPRNIGMPANQNIMMTGMPQNQQ
RRNIMVDPMMNQNRNARPITGNVQLNQTRPQYNMVANGRQGNNIMYQYPI
QDNQPMLNPDQMKMPDIESQIDLTTTSKIANADSMEAKQLLGEKIYPLVS
KYAGDMAGKITGMFLELDNAELLYMIENENSLKMKIDEAMLVLNAHKGGE
GDVVRHD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000028Category 2 cell
PLANA:0000035Category 3 cell
PLANA:0000070intestinal phagocyte
PLANA:0000429neoblast
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR006515PABP_1234
IPR035979RBD_domain_sf
IPR036053PABP-dom
IPR000504RRM_dom
IPR002004PABP_HYD
IPR003954RRM_dom_euk
IPR012677Nucleotide-bd_a/b_plait_sf
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0003723RNA binding
GO:0000166nucleotide binding
GO:0008143poly(A) binding
GO:0031370eukaryotic initiation factor 4G binding
GO:0043621protein self-association
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005844polysome
Vocabulary: biological process
TermDefinition
GO:0006397mRNA processing
GO:0006412translation
GO:0006417regulation of translation
GO:0031047gene silencing by RNA
GO:0048255mRNA stabilization
GO:0060212negative regulation of nuclear-transcribed mRNA poly(A) tail shortening
GO:0060213positive regulation of nuclear-transcribed mRNA poly(A) tail shortening
GO:1900153positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 261..281
NoneNo IPR availableGENE3DG3DSA:1.10.1900.10coord: 517..598
e-value: 2.8E-25
score: 90.1
NoneNo IPR availablePANTHERPTHR24012:SF409POLYADENYLATE-BINDING PROTEIN 1coord: 7..600
NoneNo IPR availablePANTHERPTHR24012RNA BINDING PROTEINcoord: 7..600
NoneNo IPR availableCDDcd12380RRM3_I_PABPscoord: 185..264
e-value: 7.2732E-35
score: 124.223
NoneNo IPR availableCDDcd12379RRM2_I_PABPscoord: 95..171
e-value: 2.8498E-34
score: 122.66
NoneNo IPR availableCDDcd12381RRM4_I_PABPscoord: 289..368
e-value: 8.68143E-46
score: 154.314
NoneNo IPR availableCDDcd12378RRM1_I_PABPscoord: 10..89
e-value: 9.29237E-46
score: 154.229
IPR003954RNA recognition motif domain, eukaryoteSMARTSM00361rrm2_1coord: 187..259
e-value: 0.0099
score: 25.1
coord: 98..170
e-value: 7.8
score: 5.0
coord: 291..364
e-value: 0.013
score: 24.7
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 10..83
e-value: 4.5E-19
score: 79.4
coord: 187..259
e-value: 3.8E-24
score: 96.2
coord: 291..364
e-value: 3.0E-23
score: 93.2
coord: 98..170
e-value: 7.2E-23
score: 92.0
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 99..165
e-value: 1.3E-19
score: 69.8
coord: 292..361
e-value: 9.0E-18
score: 63.9
coord: 11..80
e-value: 1.6E-16
score: 59.8
coord: 189..256
e-value: 3.7E-19
score: 68.3
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 97..174
score: 17.848
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 9..87
score: 15.784
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 290..368
score: 18.717
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 186..263
score: 17.796
IPR002004Polyadenylate-binding protein/Hyperplastic disc proteinSMARTSM00517poly_2coord: 533..596
e-value: 3.7E-22
score: 89.6
IPR002004Polyadenylate-binding protein/Hyperplastic disc proteinPFAMPF00658PABPcoord: 527..593
e-value: 4.8E-21
score: 74.7
IPR002004Polyadenylate-binding protein/Hyperplastic disc proteinPROSITEPS51309PABCcoord: 521..598
score: 16.255
IPR006515Polyadenylate binding protein, human types 1, 2, 3, 4TIGRFAMTIGR01628TIGR01628coord: 9..594
e-value: 8.5E-201
score: 667.1
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 273..375
e-value: 4.6E-27
score: 96.3
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 2..90
e-value: 2.7E-21
score: 78.2
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 175..272
e-value: 1.4E-25
score: 91.7
coord: 91..174
e-value: 3.4E-21
score: 77.5
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 184..371
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 8..177
IPR036053PABC (PABP) domainSUPERFAMILYSSF63570PABC (PABP) domaincoord: 458..600