Protein kinase domain-containing protein

Overview
NameProtein kinase domain-containing protein
Smed IDSMED30005222
Uniprot Best hitMyosin light chain kinase A OS=Dictyostelium discoideum OX=44689 GN=mlkA PE=1 SV=2 (E=1.17987e-24)
Length (bp)2309
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase domain-containing protein (SMED30005222) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30005222) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase domain-containing protein (SMED30005222) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30005222) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005222

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
tailSMED30005222SMESG000063586.1 SmedASXL_016414SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30005222SMESG000063586.1 dd_Smed_v4_12058_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30005222SMESG000063586.1 dd_Smed_v4_12058_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
ventral epidermisSMED30005222SMESG000063586.1 dd_Smed_v4_12058_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: DCLK2 (doublecortin like kinase 2 [Source:HGNC Symbol;Acc:HGNC:19002])

HSP 1 Score: 113.235 bits (282), Expect = 3.118e-25
Identity = 90/315 (28.57%), Postives = 147/315 (46.67%), Query Frame = 1
Query: 1330 HGRLEANTNTKDKAIQCTFDSGLLSVRSNNKNEKSFSKDSIFLTEKYQLINILSKSSRSIVYLTNDFKQNK-FIVKQIN----LGNHGEIRMKEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIY---YQSNPQKFLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEPKQAVEEFSMDM-----------QHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLTQSENRE 2214
            HGR  +N N   +  +C    G+      N N  S   +S  L EKY++  ++   + ++V    D    K F +K I+     G    I   E  IL    H NII   E   +  ++ +VME    G+L D   S  +  E+D   MV ++ + L YLH + I+HR I+P+N+    Y    +   +G+ G A +  E  ++    T T ++APE+  +  Y  KVDIW+ GVIT  ++C  + P ++      D+             P W N +   + L+++MLQ +   R  A Q+L HPW++   ++E
Sbjct:  356 HGRSSSNVNGGPELDRCISPEGV------NGNRCS---ESSTLLEKYKIGKVIGDGNFAVVKECIDRSTGKEFALKIIDKAKCCGKEHLIE-NEVSILRRVKHPNIIMLVEEMETATELFLVMELVKGGDLFDAITSSTKYTERDGSAMVYNLANALRYLHGLSIVHRDIKPENLLVCEYPDGTKSLKLGDFGLATV-VEGPLYTVCGTPT-YVAPEIIAETGYGLKVDIWAAGVITYILLCG-FPPFRSENNLQEDLFDQILAGKLEFPAPYWDNITDSAKELISQMLQVNVEARCTAGQILSHPWVSDDASQE 657          

HSP 2 Score: 67.3958 bits (163), Expect = 7.097e-11
Identity = 56/239 (23.43%), Postives = 106/239 (44.35%), Query Frame = 1
Query:   34 QTHKMNERSKIIKLLINGNDQYKGKIISITKNRFVNFNEFLDQLT--LYFKSFLPNGIRRVYRYGNFQMVHRLEELENYGCYICCSHERLKKMAYDSNFIDKAIFSQTEKRNFFNNKIERNSLINSIVPNYKIFREIEESREMNQRKIKENISPKLIKIVFSD-KPQDIFKIFINRNLEISLNECLWKISNNLNRKTHKHDKIKIFTVSGREITNMPDLYINRSPILAFTNSMMMYPQD 741
            Q     +++K  +   NG+  +KG + +I+ +RF +F+  L +LT  L     LP G+R +Y     + V  L+EL     Y+C S+E  +K+ Y  N             N+  N   +     ++     +  E++ES++         I PKL+ ++ S  KP+   +I +N+    S  + L  I+  +  K       ++ T+ G+++T + D + +    +A       Y QD
Sbjct:   63 QALSSEKKAKKARFYRNGDRYFKGLVFAISSDRFRSFDALLIELTRSLSDNVNLPQGVRTIYTIDGSRKVTSLDELLEGESYVCASNEPFRKVDYTKNI----------NPNWSVNI--KGGTSRALAAASSVKSEVKESKDF--------IKPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITEAI--KLDSGVVKRLCTLDGKQVTCLQDFFGDDDVFIACGPEKFRYAQD 279          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: DCLK2 (doublecortin like kinase 2 [Source:HGNC Symbol;Acc:HGNC:19002])

HSP 1 Score: 113.235 bits (282), Expect = 3.637e-25
Identity = 90/315 (28.57%), Postives = 147/315 (46.67%), Query Frame = 1
Query: 1330 HGRLEANTNTKDKAIQCTFDSGLLSVRSNNKNEKSFSKDSIFLTEKYQLINILSKSSRSIVYLTNDFKQNK-FIVKQIN----LGNHGEIRMKEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIY---YQSNPQKFLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEPKQAVEEFSMDM-----------QHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLTQSENRE 2214
            HGR  +N N   +  +C    G+      N N  S   +S  L EKY++  ++   + ++V    D    K F +K I+     G    I   E  IL    H NII   E   +  ++ +VME    G+L D   S  +  E+D   MV ++ + L YLH + I+HR I+P+N+    Y    +   +G+ G A +  E  ++    T T ++APE+  +  Y  KVDIW+ GVIT  ++C  + P ++      D+             P W N +   + L+++MLQ +   R  A Q+L HPW++   ++E
Sbjct:  373 HGRSSSNVNGGPELDRCISPEGV------NGNRCS---ESSTLLEKYKIGKVIGDGNFAVVKECIDRSTGKEFALKIIDKAKCCGKEHLIE-NEVSILRRVKHPNIIMLVEEMETATELFLVMELVKGGDLFDAITSSTKYTERDGSAMVYNLANALRYLHGLSIVHRDIKPENLLVCEYPDGTKSLKLGDFGLATV-VEGPLYTVCGTPT-YVAPEIIAETGYGLKVDIWAAGVITYILLCG-FPPFRSENNLQEDLFDQILAGKLEFPAPYWDNITDSAKELISQMLQVNVEARCTAGQILSHPWVSDDASQE 674          

HSP 2 Score: 67.3958 bits (163), Expect = 7.292e-11
Identity = 56/239 (23.43%), Postives = 106/239 (44.35%), Query Frame = 1
Query:   34 QTHKMNERSKIIKLLINGNDQYKGKIISITKNRFVNFNEFLDQLT--LYFKSFLPNGIRRVYRYGNFQMVHRLEELENYGCYICCSHERLKKMAYDSNFIDKAIFSQTEKRNFFNNKIERNSLINSIVPNYKIFREIEESREMNQRKIKENISPKLIKIVFSD-KPQDIFKIFINRNLEISLNECLWKISNNLNRKTHKHDKIKIFTVSGREITNMPDLYINRSPILAFTNSMMMYPQD 741
            Q     +++K  +   NG+  +KG + +I+ +RF +F+  L +LT  L     LP G+R +Y     + V  L+EL     Y+C S+E  +K+ Y  N             N+  N   +     ++     +  E++ES++         I PKL+ ++ S  KP+   +I +N+    S  + L  I+  +  K       ++ T+ G+++T + D + +    +A       Y QD
Sbjct:   63 QALSSEKKAKKARFYRNGDRYFKGLVFAISSDRFRSFDALLIELTRSLSDNVNLPQGVRTIYTIDGSRKVTSLDELLEGESYVCASNEPFRKVDYTKNI----------NPNWSVNI--KGGTSRALAAASSVKSEVKESKDF--------IKPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITEAI--KLDSGVVKRLCTLDGKQVTCLQDFFGDDDVFIACGPEKFRYAQD 279          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: DCLK2 (doublecortin like kinase 2 [Source:HGNC Symbol;Acc:HGNC:19002])

HSP 1 Score: 113.235 bits (282), Expect = 4.327e-25
Identity = 90/315 (28.57%), Postives = 147/315 (46.67%), Query Frame = 1
Query: 1330 HGRLEANTNTKDKAIQCTFDSGLLSVRSNNKNEKSFSKDSIFLTEKYQLINILSKSSRSIVYLTNDFKQNK-FIVKQIN----LGNHGEIRMKEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIY---YQSNPQKFLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEPKQAVEEFSMDM-----------QHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLTQSENRE 2214
            HGR  +N N   +  +C    G+      N N  S   +S  L EKY++  ++   + ++V    D    K F +K I+     G    I   E  IL    H NII   E   +  ++ +VME    G+L D   S  +  E+D   MV ++ + L YLH + I+HR I+P+N+    Y    +   +G+ G A +  E  ++    T T ++APE+  +  Y  KVDIW+ GVIT  ++C  + P ++      D+             P W N +   + L+++MLQ +   R  A Q+L HPW++   ++E
Sbjct:  356 HGRSSSNVNGGPELDRCISPEGV------NGNRCS---ESSTLLEKYKIGKVIGDGNFAVVKECIDRSTGKEFALKIIDKAKCCGKEHLIE-NEVSILRRVKHPNIIMLVEEMETATELFLVMELVKGGDLFDAITSSTKYTERDGSAMVYNLANALRYLHGLSIVHRDIKPENLLVCEYPDGTKSLKLGDFGLATV-VEGPLYTVCGTPT-YVAPEIIAETGYGLKVDIWAAGVITYILLCG-FPPFRSENNLQEDLFDQILAGKLEFPAPYWDNITDSAKELISQMLQVNVEARCTAGQILSHPWVSDDASQE 657          

HSP 2 Score: 67.3958 bits (163), Expect = 7.134e-11
Identity = 56/239 (23.43%), Postives = 106/239 (44.35%), Query Frame = 1
Query:   34 QTHKMNERSKIIKLLINGNDQYKGKIISITKNRFVNFNEFLDQLT--LYFKSFLPNGIRRVYRYGNFQMVHRLEELENYGCYICCSHERLKKMAYDSNFIDKAIFSQTEKRNFFNNKIERNSLINSIVPNYKIFREIEESREMNQRKIKENISPKLIKIVFSD-KPQDIFKIFINRNLEISLNECLWKISNNLNRKTHKHDKIKIFTVSGREITNMPDLYINRSPILAFTNSMMMYPQD 741
            Q     +++K  +   NG+  +KG + +I+ +RF +F+  L +LT  L     LP G+R +Y     + V  L+EL     Y+C S+E  +K+ Y  N             N+  N   +     ++     +  E++ES++         I PKL+ ++ S  KP+   +I +N+    S  + L  I+  +  K       ++ T+ G+++T + D + +    +A       Y QD
Sbjct:   63 QALSSEKKAKKARFYRNGDRYFKGLVFAISSDRFRSFDALLIELTRSLSDNVNLPQGVRTIYTIDGSRKVTSLDELLEGESYVCASNEPFRKVDYTKNI----------NPNWSVNI--KGGTSRALAAASSVKSEVKESKDF--------IKPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITEAI--KLDSGVVKRLCTLDGKQVTCLQDFFGDDDVFIACGPEKFRYAQD 279          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: DCLK2 (doublecortin like kinase 2 [Source:HGNC Symbol;Acc:HGNC:19002])

HSP 1 Score: 112.849 bits (281), Expect = 4.763e-25
Identity = 90/315 (28.57%), Postives = 147/315 (46.67%), Query Frame = 1
Query: 1330 HGRLEANTNTKDKAIQCTFDSGLLSVRSNNKNEKSFSKDSIFLTEKYQLINILSKSSRSIVYLTNDFKQNK-FIVKQIN----LGNHGEIRMKEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIY---YQSNPQKFLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEPKQAVEEFSMDM-----------QHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLTQSENRE 2214
            HGR  +N N   +  +C    G+      N N  S   +S  L EKY++  ++   + ++V    D    K F +K I+     G    I   E  IL    H NII   E   +  ++ +VME    G+L D   S  +  E+D   MV ++ + L YLH + I+HR I+P+N+    Y    +   +G+ G A +  E  ++    T T ++APE+  +  Y  KVDIW+ GVIT  ++C  + P ++      D+             P W N +   + L+++MLQ +   R  A Q+L HPW++   ++E
Sbjct:  374 HGRSSSNVNGGPELDRCISPEGV------NGNRCS---ESSTLLEKYKIGKVIGDGNFAVVKECIDRSTGKEFALKIIDKAKCCGKEHLIE-NEVSILRRVKHPNIIMLVEEMETATELFLVMELVKGGDLFDAITSSTKYTERDGSAMVYNLANALRYLHGLSIVHRDIKPENLLVCEYPDGTKSLKLGDFGLATV-VEGPLYTVCGTPT-YVAPEIIAETGYGLKVDIWAAGVITYILLCG-FPPFRSENNLQEDLFDQILAGKLEFPAPYWDNITDSAKELISQMLQVNVEARCTAGQILSHPWVSDDASQE 675          

HSP 2 Score: 67.3958 bits (163), Expect = 6.803e-11
Identity = 56/239 (23.43%), Postives = 106/239 (44.35%), Query Frame = 1
Query:   34 QTHKMNERSKIIKLLINGNDQYKGKIISITKNRFVNFNEFLDQLT--LYFKSFLPNGIRRVYRYGNFQMVHRLEELENYGCYICCSHERLKKMAYDSNFIDKAIFSQTEKRNFFNNKIERNSLINSIVPNYKIFREIEESREMNQRKIKENISPKLIKIVFSD-KPQDIFKIFINRNLEISLNECLWKISNNLNRKTHKHDKIKIFTVSGREITNMPDLYINRSPILAFTNSMMMYPQD 741
            Q     +++K  +   NG+  +KG + +I+ +RF +F+  L +LT  L     LP G+R +Y     + V  L+EL     Y+C S+E  +K+ Y  N             N+  N   +     ++     +  E++ES++         I PKL+ ++ S  KP+   +I +N+    S  + L  I+  +  K       ++ T+ G+++T + D + +    +A       Y QD
Sbjct:   63 QALSSEKKAKKARFYRNGDRYFKGLVFAISSDRFRSFDALLIELTRSLSDNVNLPQGVRTIYTIDGSRKVTSLDELLEGESYVCASNEPFRKVDYTKNI----------NPNWSVNI--KGGTSRALAAASSVKSEVKESKDF--------IKPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITEAI--KLDSGVVKRLCTLDGKQVTCLQDFFGDDDVFIACGPEKFRYAQD 279          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: DCLK2 (doublecortin like kinase 2 [Source:HGNC Symbol;Acc:HGNC:19002])

HSP 1 Score: 112.849 bits (281), Expect = 4.856e-25
Identity = 90/315 (28.57%), Postives = 147/315 (46.67%), Query Frame = 1
Query: 1330 HGRLEANTNTKDKAIQCTFDSGLLSVRSNNKNEKSFSKDSIFLTEKYQLINILSKSSRSIVYLTNDFKQNK-FIVKQIN----LGNHGEIRMKEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIY---YQSNPQKFLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEPKQAVEEFSMDM-----------QHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLTQSENRE 2214
            HGR  +N N   +  +C    G+      N N  S   +S  L EKY++  ++   + ++V    D    K F +K I+     G    I   E  IL    H NII   E   +  ++ +VME    G+L D   S  +  E+D   MV ++ + L YLH + I+HR I+P+N+    Y    +   +G+ G A +  E  ++    T T ++APE+  +  Y  KVDIW+ GVIT  ++C  + P ++      D+             P W N +   + L+++MLQ +   R  A Q+L HPW++   ++E
Sbjct:  357 HGRSSSNVNGGPELDRCISPEGV------NGNRCS---ESSTLLEKYKIGKVIGDGNFAVVKECIDRSTGKEFALKIIDKAKCCGKEHLIE-NEVSILRRVKHPNIIMLVEEMETATELFLVMELVKGGDLFDAITSSTKYTERDGSAMVYNLANALRYLHGLSIVHRDIKPENLLVCEYPDGTKSLKLGDFGLATV-VEGPLYTVCGTPT-YVAPEIIAETGYGLKVDIWAAGVITYILLCG-FPPFRSENNLQEDLFDQILAGKLEFPAPYWDNITDSAKELISQMLQVNVEARCTAGQILSHPWVSDDASQE 658          

HSP 2 Score: 67.3958 bits (163), Expect = 7.263e-11
Identity = 56/239 (23.43%), Postives = 106/239 (44.35%), Query Frame = 1
Query:   34 QTHKMNERSKIIKLLINGNDQYKGKIISITKNRFVNFNEFLDQLT--LYFKSFLPNGIRRVYRYGNFQMVHRLEELENYGCYICCSHERLKKMAYDSNFIDKAIFSQTEKRNFFNNKIERNSLINSIVPNYKIFREIEESREMNQRKIKENISPKLIKIVFSD-KPQDIFKIFINRNLEISLNECLWKISNNLNRKTHKHDKIKIFTVSGREITNMPDLYINRSPILAFTNSMMMYPQD 741
            Q     +++K  +   NG+  +KG + +I+ +RF +F+  L +LT  L     LP G+R +Y     + V  L+EL     Y+C S+E  +K+ Y  N             N+  N   +     ++     +  E++ES++         I PKL+ ++ S  KP+   +I +N+    S  + L  I+  +  K       ++ T+ G+++T + D + +    +A       Y QD
Sbjct:   63 QALSSEKKAKKARFYRNGDRYFKGLVFAISSDRFRSFDALLIELTRSLSDNVNLPQGVRTIYTIDGSRKVTSLDELLEGESYVCASNEPFRKVDYTKNI----------NPNWSVNI--KGGTSRALAAASSVKSEVKESKDF--------IKPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITEAI--KLDSGVVKRLCTLDGKQVTCLQDFFGDDDVFIACGPEKFRYAQD 279          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: cmk-1 (Calcium/calmodulin-dependent protein kinase type 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TXJ0])

HSP 1 Score: 108.612 bits (270), Expect = 2.513e-25
Identity = 79/268 (29.48%), Postives = 131/268 (48.88%), Query Frame = 1
Query: 1456 LTEKYQLINILSKSSRSIVYLT---NDFKQNKFIVKQIN---LGNHGEIRMKEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYY--QSNPQKFLIGNMGQAELKTENLIFIENWTQTQ-FMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEP----------KQAVE-EFSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLT 2196
            + EKY   ++L   + S V+L    +D  Q  + VK I+   L    E    E ++L    H NI+Q F+ Y  +  V +VME    G L D+ ++K    E+D   +++ V   + ++H  G++HR ++P+N+ Y  Q    K +I + G +  KTE+   +     T  ++APE+  QK Y + VD+WS+GVI   ++C  Y P           Q ++ E+  D   P W   S   +  +T ++  DP  RF     L HPW++
Sbjct:   18 IREKYDFRDVLGTGAFSKVFLAESKSDAGQ-MYAVKCIDKKALKGKEESLENEIKVLRKLRHNNIVQLFDTYDEKQFVYLVMELVTGGELFDRIVAKGSYTEQDASNLIRQVLEAVGFMHDNGVVHRDLKPENLLYYNQDEDSKIMISDFGLS--KTEDSGVMATACGTPGYVAPEVLQQKPYGKAVDVWSIGVIAYILLCG-YPPFYDESDANLFAQIIKGEYEFDA--PYWDQISDSAKDFITHLMCCDPEARFTCQDALSHPWIS 279          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: rskn-1 (Putative ribosomal protein S6 kinase alpha-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21734])

HSP 1 Score: 101.293 bits (251), Expect = 9.120e-22
Identity = 87/316 (27.53%), Postives = 148/316 (46.84%), Query Frame = 1
Query: 1387 DSGLLSVRSNNKN-EKSFSKDSIFLTEKYQLINILSKSSRSI-VYLTNDFKQNKFIVKQINLGNHGEI---RMK--------------------EAQILMS-CDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEI-YEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYYQ---SNPQKFLIGNMGQA-ELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIV--CNKYE------PKQAVEEFS---MDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLTQSE 2205
            DS  L   +N     + FS  S  + E+ +LI   +KS RS+    TN F  +  I+++I  G H  +   +MK                    E  IL+    H+ +++ F+VY  E  + ++ E    G L DK ++KK +  EK++  ++ ++ + + YLH+  + HR +   NI +     +P    I + G A + + EN + +      QF+APE+  ++ Y+   D+WSLGV+   ++  C  +       P Q ++      + M HP W   S + + LV +ML  DP+ R  A Q L H W+ Q E
Sbjct:  365 DSPALPASANGHEIFRGFSFVSNAVMEERKLI---AKSVRSVPTAKTNPFTDDYEILEKIGNGAHSVVHKCQMKATRRKYAVKIVKKAVFDATEEVDILLRHSHHQFVVKLFDVYEDETAIYMIEELCEGGELLDKLVNKKSLGSEKEVAAIMANLLNAVQYLHSQQVAHRDLTAANILFALKDGDPSSLRIVDFGFAKQSRAENGMLMTPCYTAQFVAPEVLRKQGYDRSCDVWSLGVLLHTMLTGCTPFAMGPNDTPDQILQRVGDGKISMTHPVWDTISDEAKDLVRKMLDVDPNRRVTAKQALQHKWIGQKE 677          

HSP 2 Score: 63.929 bits (154), Expect = 3.791e-10
Identity = 45/192 (23.44%), Postives = 99/192 (51.56%), Query Frame = 1
Query: 1465 KYQLINILSKSSRSIVYLTNDFKQNKF-------IVKQINLGNHGEIRMK-EAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNLDKYLSKKEIYEKDIMKM-VQDVGSGLLYLHTVGIIHRYIQPKNIYYQSNPQ-KFLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVI 2010
            +++L+ +L + S   V+L    +           ++K+  L      R K E  IL    H  I++    +++E K+ +++++   G+L   LSK+ ++ +D +K  + ++   L +LH++GI++R ++P+NI   ++   K     + +  + +E   +    T  ++MAPE+  ++ ++   D WSLGV+
Sbjct:   64 QFELLKVLGQGSFGKVFLVRKVRGRDSGHVYAMKVLKKATLKVRDRQRTKLERNILAHISHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEDDVKFYLAELTLALEHLHSLGIVYRDLKPENILLDADGHIKVTDFGLSKEAIDSEKKTYSFCGT-VEYMAPEVINRRGHSMAADFWSLGVL 254          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: rskn-1 (Putative ribosomal protein S6 kinase alpha-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21734])

HSP 1 Score: 101.293 bits (251), Expect = 9.636e-22
Identity = 85/316 (26.90%), Postives = 147/316 (46.52%), Query Frame = 1
Query: 1387 DSGLLSVRSNNKN-EKSFSKDSIFLTEKYQLINILSKSSRSI-VYLTNDFKQNKFIVKQINLGNHGEI---RMKEAQ---------------------ILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEI-YEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYYQ---SNPQKFLIGNMGQA-ELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIV--CNKYE------PKQAVEEFS---MDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLTQSE 2205
            DS  L   +N     + FS  S  + E+ +LI   +KS RS+    TN F  +  I+++I  G H  +   +MK  +                     +L    H+ +++ F+VY  E  + ++ E    G L DK ++KK +  EK++  ++ ++ + + YLH+  + HR +   NI +     +P    I + G A + + EN + +      QF+APE+  ++ Y+   D+WSLGV+   ++  C  +       P Q ++      + M HP W   S + + LV +ML  DP+ R  A Q L H W+ Q E
Sbjct:  398 DSPALPASANGHEIFRGFSFVSNAVMEERKLI---AKSVRSVPTAKTNPFTDDYEILEKIGNGAHSVVHKCQMKATRRKYAVKIVKKAVFDATEEVDILLRHSHHQFVVKLFDVYEDETAIYMIEELCEGGELLDKLVNKKSLGSEKEVAAIMANLLNAVQYLHSQQVAHRDLTAANILFALKDGDPSSLRIVDFGFAKQSRAENGMLMTPCYTAQFVAPEVLRKQGYDRSCDVWSLGVLLHTMLTGCTPFAMGPNDTPDQILQRVGDGKISMTHPVWDTISDEAKDLVRKMLDVDPNRRVTAKQALQHKWIGQKE 710          

HSP 2 Score: 64.3142 bits (155), Expect = 2.842e-10
Identity = 45/192 (23.44%), Postives = 99/192 (51.56%), Query Frame = 1
Query: 1465 KYQLINILSKSSRSIVYLTNDFKQNKF-------IVKQINLGNHGEIRMK-EAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNLDKYLSKKEIYEKDIMKM-VQDVGSGLLYLHTVGIIHRYIQPKNIYYQSNPQ-KFLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVI 2010
            +++L+ +L + S   V+L    +           ++K+  L      R K E  IL    H  I++    +++E K+ +++++   G+L   LSK+ ++ +D +K  + ++   L +LH++GI++R ++P+NI   ++   K     + +  + +E   +    T  ++MAPE+  ++ ++   D WSLGV+
Sbjct:   97 QFELLKVLGQGSFGKVFLVRKVRGRDSGHVYAMKVLKKATLKVRDRQRTKLERNILAHISHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEDDVKFYLAELTLALEHLHSLGIVYRDLKPENILLDADGHIKVTDFGLSKEAIDSEKKTYSFCGT-VEYMAPEVINRRGHSMAADFWSLGVL 287          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: rskn-1 (Putative ribosomal protein S6 kinase alpha-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21734])

HSP 1 Score: 100.908 bits (250), Expect = 9.717e-22
Identity = 87/316 (27.53%), Postives = 148/316 (46.84%), Query Frame = 1
Query: 1387 DSGLLSVRSNNKN-EKSFSKDSIFLTEKYQLINILSKSSRSI-VYLTNDFKQNKFIVKQINLGNHGEI---RMK--------------------EAQILMS-CDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEI-YEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYYQ---SNPQKFLIGNMGQA-ELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIV--CNKYE------PKQAVEEFS---MDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLTQSE 2205
            DS  L   +N     + FS  S  + E+ +LI   +KS RS+    TN F  +  I+++I  G H  +   +MK                    E  IL+    H+ +++ F+VY  E  + ++ E    G L DK ++KK +  EK++  ++ ++ + + YLH+  + HR +   NI +     +P    I + G A + + EN + +      QF+APE+  ++ Y+   D+WSLGV+   ++  C  +       P Q ++      + M HP W   S + + LV +ML  DP+ R  A Q L H W+ Q E
Sbjct:  347 DSPALPASANGHEIFRGFSFVSNAVMEERKLI---AKSVRSVPTAKTNPFTDDYEILEKIGNGAHSVVHKCQMKATRRKYAVKIVKKAVFDATEEVDILLRHSHHQFVVKLFDVYEDETAIYMIEELCEGGELLDKLVNKKSLGSEKEVAAIMANLLNAVQYLHSQQVAHRDLTAANILFALKDGDPSSLRIVDFGFAKQSRAENGMLMTPCYTAQFVAPEVLRKQGYDRSCDVWSLGVLLHTMLTGCTPFAMGPNDTPDQILQRVGDGKISMTHPVWDTISDEAKDLVRKMLDVDPNRRVTAKQALQHKWIGQKE 659          

HSP 2 Score: 63.5438 bits (153), Expect = 4.330e-10
Identity = 45/192 (23.44%), Postives = 99/192 (51.56%), Query Frame = 1
Query: 1465 KYQLINILSKSSRSIVYLTNDFKQNKF-------IVKQINLGNHGEIRMK-EAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNLDKYLSKKEIYEKDIMKM-VQDVGSGLLYLHTVGIIHRYIQPKNIYYQSNPQ-KFLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVI 2010
            +++L+ +L + S   V+L    +           ++K+  L      R K E  IL    H  I++    +++E K+ +++++   G+L   LSK+ ++ +D +K  + ++   L +LH++GI++R ++P+NI   ++   K     + +  + +E   +    T  ++MAPE+  ++ ++   D WSLGV+
Sbjct:   46 QFELLKVLGQGSFGKVFLVRKVRGRDSGHVYAMKVLKKATLKVRDRQRTKLERNILAHISHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEDDVKFYLAELTLALEHLHSLGIVYRDLKPENILLDADGHIKVTDFGLSKEAIDSEKKTYSFCGT-VEYMAPEVINRRGHSMAADFWSLGVL 236          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: rskn-1 (Putative ribosomal protein S6 kinase alpha-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21734])

HSP 1 Score: 100.908 bits (250), Expect = 1.067e-21
Identity = 85/316 (26.90%), Postives = 147/316 (46.52%), Query Frame = 1
Query: 1387 DSGLLSVRSNNKN-EKSFSKDSIFLTEKYQLINILSKSSRSI-VYLTNDFKQNKFIVKQINLGNHGEI---RMKEAQ---------------------ILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEI-YEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYYQ---SNPQKFLIGNMGQA-ELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIV--CNKYE------PKQAVEEFS---MDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLTQSE 2205
            DS  L   +N     + FS  S  + E+ +LI   +KS RS+    TN F  +  I+++I  G H  +   +MK  +                     +L    H+ +++ F+VY  E  + ++ E    G L DK ++KK +  EK++  ++ ++ + + YLH+  + HR +   NI +     +P    I + G A + + EN + +      QF+APE+  ++ Y+   D+WSLGV+   ++  C  +       P Q ++      + M HP W   S + + LV +ML  DP+ R  A Q L H W+ Q E
Sbjct:  404 DSPALPASANGHEIFRGFSFVSNAVMEERKLI---AKSVRSVPTAKTNPFTDDYEILEKIGNGAHSVVHKCQMKATRRKYAVKIVKKAVFDATEEVDILLRHSHHQFVVKLFDVYEDETAIYMIEELCEGGELLDKLVNKKSLGSEKEVAAIMANLLNAVQYLHSQQVAHRDLTAANILFALKDGDPSSLRIVDFGFAKQSRAENGMLMTPCYTAQFVAPEVLRKQGYDRSCDVWSLGVLLHTMLTGCTPFAMGPNDTPDQILQRVGDGKISMTHPVWDTISDEAKDLVRKMLDVDPNRRVTAKQALQHKWIGQKE 716          

HSP 2 Score: 63.929 bits (154), Expect = 3.508e-10
Identity = 45/192 (23.44%), Postives = 99/192 (51.56%), Query Frame = 1
Query: 1465 KYQLINILSKSSRSIVYLTNDFKQNKF-------IVKQINLGNHGEIRMK-EAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNLDKYLSKKEIYEKDIMKM-VQDVGSGLLYLHTVGIIHRYIQPKNIYYQSNPQ-KFLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVI 2010
            +++L+ +L + S   V+L    +           ++K+  L      R K E  IL    H  I++    +++E K+ +++++   G+L   LSK+ ++ +D +K  + ++   L +LH++GI++R ++P+NI   ++   K     + +  + +E   +    T  ++MAPE+  ++ ++   D WSLGV+
Sbjct:  103 QFELLKVLGQGSFGKVFLVRKVRGRDSGHVYAMKVLKKATLKVRDRQRTKLERNILAHISHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEDDVKFYLAELTLALEHLHSLGIVYRDLKPENILLDADGHIKVTDFGLSKEAIDSEKKTYSFCGT-VEYMAPEVINRRGHSMAADFWSLGVL 293          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: CaMKI (gene:FBgn0016126 transcript:FBtr0333670)

HSP 1 Score: 104.76 bits (260), Expect = 1.155e-23
Identity = 73/268 (27.24%), Postives = 128/268 (47.76%), Query Frame = 1
Query: 1450 IFLTEKYQLINILSKSSRSIVYL--TNDFKQNKFIVKQIN---LGNHGEIRMKEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYYQS--NPQKFLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNK---YEPKQA-----VEEFSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLTQSE 2205
            + + EKY L  +L   + S V L  + D     F VK I+   L    E    E ++L    H NI+Q  E Y  + KV +VME    G L D+ + K    EKD   +++ +   + Y+H  G++HR ++P+N+ Y S  +  K +I + G ++++   ++     T   ++APE+  QK Y + VD+WS+GVI+  ++C     Y+   A     + +   +   P W   S   +  +  ++      R+   Q L H W++ +E
Sbjct:   25 VSIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKGKEESLENEIRVLRRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSKMEDSGIMATACGT-PGYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWISGNE 291          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: CaMKI (gene:FBgn0016126 transcript:FBtr0089067)

HSP 1 Score: 96.2857 bits (238), Expect = 9.195e-21
Identity = 56/206 (27.18%), Postives = 103/206 (50.00%), Query Frame = 1
Query: 1621 HRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYYQS--NPQKFLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNK---YEPKQA-----VEEFSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLTQSE 2205
            H NI+Q  E Y  + KV +VME    G L D+ + K    EKD   +++ +   + Y+H  G++HR ++P+N+ Y S  +  K +I + G ++++   ++     T   ++APE+  QK Y + VD+WS+GVI+  ++C     Y+   A     + +   +   P W   S   +  +  ++      R+   Q L H W++ +E
Sbjct:  102 HPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSKMEDSGIMATACGT-PGYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWISGNE 306          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: CaMKI (gene:FBgn0016126 transcript:FBtr0089065)

HSP 1 Score: 96.2857 bits (238), Expect = 9.195e-21
Identity = 56/206 (27.18%), Postives = 103/206 (50.00%), Query Frame = 1
Query: 1621 HRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYYQS--NPQKFLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNK---YEPKQA-----VEEFSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLTQSE 2205
            H NI+Q  E Y  + KV +VME    G L D+ + K    EKD   +++ +   + Y+H  G++HR ++P+N+ Y S  +  K +I + G ++++   ++     T   ++APE+  QK Y + VD+WS+GVI+  ++C     Y+   A     + +   +   P W   S   +  +  ++      R+   Q L H W++ +E
Sbjct:  102 HPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSKMEDSGIMATACGT-PGYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWISGNE 306          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: CaMKI (gene:FBgn0016126 transcript:FBtr0089069)

HSP 1 Score: 96.2857 bits (238), Expect = 9.195e-21
Identity = 56/206 (27.18%), Postives = 103/206 (50.00%), Query Frame = 1
Query: 1621 HRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYYQS--NPQKFLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNK---YEPKQA-----VEEFSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLTQSE 2205
            H NI+Q  E Y  + KV +VME    G L D+ + K    EKD   +++ +   + Y+H  G++HR ++P+N+ Y S  +  K +I + G ++++   ++     T   ++APE+  QK Y + VD+WS+GVI+  ++C     Y+   A     + +   +   P W   S   +  +  ++      R+   Q L H W++ +E
Sbjct:  102 HPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSKMEDSGIMATACGT-PGYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWISGNE 306          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: S6kII (gene:FBgn0262866 transcript:FBtr0333715)

HSP 1 Score: 90.5077 bits (223), Expect = 2.633e-18
Identity = 59/221 (26.70%), Postives = 108/221 (48.87%), Query Frame = 1
Query: 1591 KEAQILMS-CDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYYQS---NPQKFLIGNMGQA-ELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEPKQAVEEFS------------MDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLTQ 2199
            +E +I++   +H NI+  + VY       +VME    G L D+ L+  ++ E +   +++ + S + YLH  G++HR ++P N+ Y S    P+   + ++G A +L+ +N + +       F+APE+  ++ Y+   DIWSLGV+   I+ +   P  +    S            +D     W   S   + L+ +ML   P +R  A ++L H WL +
Sbjct:  617 EEVEIMLRYGNHPNIVTLYSVYEDAGSAYLVMELLKGGELLDRILAVGQMCESEASAVLRTIASAVAYLHEHGVVHRDLKPSNMIYASMRQTPETLKLCDLGFAKQLRADNGLLMTPCYTANFVAPEVLKRQGYDLACDIWSLGVLL-YIMLSGRTPFASTPNDSPDVILKRIGSGQIDFTSSRWALISVPAKELLRQMLHIVPENRPTAARILEHDWLRE 836          

HSP 2 Score: 66.6254 bits (161), Expect = 7.823e-11
Identity = 54/249 (21.69%), Postives = 118/249 (47.39%), Query Frame = 1
Query: 1465 KYQLINILSKSSRSIVYLTNDFKQNKF-------IVKQINLGNHGEIR-MKEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNLDKYLSKKEIY-EKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYYQSNPQKFLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGV-----ITGNIVCNKYEPKQAVEE-FSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNA 2166
            +++L+ +L + S   V+L                ++K+  L     +R   E +IL    H  I++    +++  K+ +++++   G+L   LSK+ ++ E+D+   + ++   + +LHT+GII+R ++P+NI    +    L  + G ++   +           ++MAPE+  +K ++   D WS GV     +TGN+  +    ++ + +     +  P   N S + Q L+  + + +P +R  A
Sbjct:  198 QFELLRVLGEGSFGKVFLVRKIIGKDAGTLYAMKVLKKATLKVKDRVRSTNERKILADVGHAFIVRLHYAFQTPGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALAMNHLHTLGIIYRDLKPENILLDEHGHIALT-DFGLSKQPLDGSKTYSFCGTVEYMAPEIVNRKGHDFAADWWSFGVLMYEMLTGNLPFHGQTRQETMNQILRSKLGMPE--NLSPEAQSLLRALFKRNPQNRLGA 443          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: camk1a (calcium/calmodulin-dependent protein kinase Ia [Source:ZFIN;Acc:ZDB-GENE-131120-147])

HSP 1 Score: 110.923 bits (276), Expect = 8.588e-26
Identity = 68/277 (24.55%), Postives = 134/277 (48.38%), Query Frame = 1
Query: 1417 NKNEKSFSKDSIFLTEKYQLINILSKSSRSIVYLTNDFKQNKFIV-----KQINLGNHGEIRMKEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYYQSNPQK--FLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEP---------KQAVEEFSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLT 2196
             ++E  + K +  + E Y    +L   + S V+L  + K  + +      K+   G    I   E  +L    H NI+   +++ S+  + +VM+    G L D+ + K    E+D  K+++ +   + YLH +GI+HR ++P+N+ Y S  +    +I + G ++++    +         ++APE+  QK Y++ VD WS+GVI+  ++C  Y P          + + +   +   P W + S   +  ++ +++ DPS R+   Q L HPW++
Sbjct:    4 GEDENGWKKKTTDIKENYDFKEVLGTGAFSEVFLAEEKKTQRLVAIKCIPKKALEGKENSIE-NEIAVLHRIKHENIVSLEDIFESQSHLYLVMQLVSGGELFDRIVEKGFYTERDASKLIRQILDAVKYLHDMGIVHRDLKPENLLYYSMEEDSNIMISDFGLSKIEDSGSVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVISYILLCG-YPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFISHLMEKDPSLRYTCEQALLHPWIS 278          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: camk1a (calcium/calmodulin-dependent protein kinase Ia [Source:ZFIN;Acc:ZDB-GENE-131120-147])

HSP 1 Score: 110.538 bits (275), Expect = 1.469e-25
Identity = 68/277 (24.55%), Postives = 134/277 (48.38%), Query Frame = 1
Query: 1417 NKNEKSFSKDSIFLTEKYQLINILSKSSRSIVYLTNDFKQNKFIV-----KQINLGNHGEIRMKEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYYQSNPQK--FLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEP---------KQAVEEFSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLT 2196
             ++E  + K +  + E Y    +L   + S V+L  + K  + +      K+   G    I   E  +L    H NI+   +++ S+  + +VM+    G L D+ + K    E+D  K+++ +   + YLH +GI+HR ++P+N+ Y S  +    +I + G ++++    +         ++APE+  QK Y++ VD WS+GVI+  ++C  Y P          + + +   +   P W + S   +  ++ +++ DPS R+   Q L HPW++
Sbjct:    4 GEDENGWKKKTTDIKENYDFKEVLGTGAFSEVFLAEEKKTQRLVAIKCIPKKALEGKENSIE-NEIAVLHRIKHENIVSLEDIFESQSHLYLVMQLVSGGELFDRIVEKGFYTERDASKLIRQILDAVKYLHDMGIVHRDLKPENLLYYSMEEDSNIMISDFGLSKIEDSGSVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVISYILLCG-YPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFISHLMEKDPSLRYTCEQALLHPWIS 278          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: camk1a (calcium/calmodulin-dependent protein kinase Ia [Source:ZFIN;Acc:ZDB-GENE-131120-147])

HSP 1 Score: 110.538 bits (275), Expect = 1.469e-25
Identity = 68/277 (24.55%), Postives = 134/277 (48.38%), Query Frame = 1
Query: 1417 NKNEKSFSKDSIFLTEKYQLINILSKSSRSIVYLTNDFKQNKFIV-----KQINLGNHGEIRMKEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYYQSNPQK--FLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEP---------KQAVEEFSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLT 2196
             ++E  + K +  + E Y    +L   + S V+L  + K  + +      K+   G    I   E  +L    H NI+   +++ S+  + +VM+    G L D+ + K    E+D  K+++ +   + YLH +GI+HR ++P+N+ Y S  +    +I + G ++++    +         ++APE+  QK Y++ VD WS+GVI+  ++C  Y P          + + +   +   P W + S   +  ++ +++ DPS R+   Q L HPW++
Sbjct:    4 GEDENGWKKKTTDIKENYDFKEVLGTGAFSEVFLAEEKKTQRLVAIKCIPKKALEGKENSIE-NEIAVLHRIKHENIVSLEDIFESQSHLYLVMQLVSGGELFDRIVEKGFYTERDASKLIRQILDAVKYLHDMGIVHRDLKPENLLYYSMEEDSNIMISDFGLSKIEDSGSVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVISYILLCG-YPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFISHLMEKDPSLRYTCEQALLHPWIS 278          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: pnck (pregnancy up-regulated nonubiquitous CaM kinase [Source:ZFIN;Acc:ZDB-GENE-081105-127])

HSP 1 Score: 108.227 bits (269), Expect = 2.940e-25
Identity = 59/213 (27.70%), Postives = 111/213 (52.11%), Query Frame = 1
Query: 1594 EAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYYQS--NPQKFLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEP---------KQAVEEFSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLT 2196
            E  +L   +H NI+   E + +  K+ +VM     G L ++ L +    EKD  +++  V   + YLH +G++HR ++P+N+ +++     K +I + G ++++ +  +     T   ++APEL  QK Y ++VD+W++GVIT  ++C  Y P          + + +   +   P W + S   +  +  +LQ DP+ RFN  Q   HPW++
Sbjct:   63 EVAVLRRINHENIVSLEETFETPTKLYLVMTLLTGGELLNRILERGSYTEKDASRVIYQVLQAVKYLHQLGVVHRDLKPENLIFETPLEDSKIVISDFGLSKMEEQGALSTACGTPA-YVAPELLQQKTYGKEVDLWAIGVITFILLCG-YPPFYDDNDTQLYKLIIKAEYEFDSPYWNDISDSAKDFIVHLLQKDPAKRFNCEQASQHPWIS 273          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: camk1gb (calcium/calmodulin-dependent protein kinase IGb [Source:ZFIN;Acc:ZDB-GENE-040426-1694])

HSP 1 Score: 109.383 bits (272), Expect = 6.832e-25
Identity = 76/278 (27.34%), Postives = 136/278 (48.92%), Query Frame = 1
Query: 1420 KNEKSFSKDSIFLTEKYQLINILSKSSRSIVYLTNDFKQNK-FIVKQINLGNHGEIRMK-EAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYYQSNPQ--KFLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEP---KQAVEEFSMDMQ------HPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLTQSENR 2211
            + E  + K +  + + +  +++L   + S V++  + K  K F +K +   N  +I ++ E  +L    H N++   + Y S     +VM+    G L D+ L +    E D   +++ V   + YLH  GI+HR ++P+N+ Y S  +  K +I + G ++++ +N +         ++APE+  QK Y++ VD WS+GVIT  ++C  Y P   +     FS  M+       P W + S   +  +  M+Q +P  RFN  Q L HPW+     R
Sbjct:    5 EGEYEWKKSTDNIQDVFDFMDVLGSGAFSEVFMVKERKTGKLFAMKCVKKKNKRDINLENEIAVLRKIKHENVVCLEDFYESRTHYYLVMQLVSGGELFDRILDRGMYSEMDASSVIRQVLEAVSYLHNNGIVHRDLKPENLLYYSPDENSKIMISDFGLSKME-DNGVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVITYILLCG-YPPFYEETETRLFSKIMKGQYEFDSPFWDDISESAKDFIRNMMQKNPKMRFNTEQALRHPWIIGKTAR 280          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: mlh3 (mutL homolog 3 [Source:Xenbase;Acc:XB-GENE-991852])

HSP 1 Score: 105.531 bits (262), Expect = 4.433e-24
Identity = 65/229 (28.38%), Postives = 116/229 (50.66%), Query Frame = 1
Query: 1594 EAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYYQSNPQ--KFLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEP---------KQAVEEFSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLTQSENREMIQEDLFREM 2244
            E  +L    H NI+   ++Y S     +VM+    G L D+ L +    EKD   +++ V S + YLH  GI+HR ++P+N+ Y +  +  K +I + G ++++ EN I         ++APE+  QK Y++ VD WS+GVIT  ++C  Y P          + + E + + + P W + S   +  ++ +L+ D   R+N  + L HPW+        +  D++R +
Sbjct:   80 EIAVLKRIKHENIVTLEDIYESSSHFYLVMQLVSGGELFDRILERGVYTEKDASNVIRQVLSAVKYLHDNGIVHRDLKPENLLYLTPDENSKIMITDFGLSKME-ENGIMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVITYILLCG-YPPFYEETESRLFEKIREGAYEFESPFWDDISKSAKDFISCLLEKDSKKRYNCEKALKHPWIA---GNTALHRDIYRSV 303          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: foxf2 (forkhead box F2 [Source:Xenbase;Acc:XB-GENE-484646])

HSP 1 Score: 103.605 bits (257), Expect = 1.398e-23
Identity = 70/261 (26.82%), Postives = 124/261 (47.51%), Query Frame = 1
Query: 1456 LTEKYQLINILSKSSRSIVY-LTNDFKQNKFIVKQINLGNHGEIRMKEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYYQS-NPQKFL-IGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEP----------KQAVEEFSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLT 2196
            L   Y+L + L + + S+VY       Q  + VK +      +I   E  +L+   H NII+  E++ +  ++ +V+E    G L D+ + K    E+D    V+ +   + YLH  GI+HR ++P+N+ Y +  P   L I + G +++  + +          + APE+     Y  +VD+WS+G+IT  ++C  +EP           + +     D   P W + S + + LV +++  DP  R    Q L HPW+T
Sbjct:   20 LAHYYELESELGRGATSVVYRCRQKGTQRPYAVKMLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAPLKIADFGLSKIVDDQVTMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCG-FEPFYDERGDQYMFKRILNCDYDFVSPWWDDVSLNAKDLVKKLIVFDPKKRLTTQQALQHPWVT 279          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: foxf2 (forkhead box F2 [Source:Xenbase;Acc:XB-GENE-484646])

HSP 1 Score: 104.375 bits (259), Expect = 2.157e-23
Identity = 70/261 (26.82%), Postives = 124/261 (47.51%), Query Frame = 1
Query: 1456 LTEKYQLINILSKSSRSIVY-LTNDFKQNKFIVKQINLGNHGEIRMKEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYYQS-NPQKFL-IGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEP----------KQAVEEFSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLT 2196
            L   Y+L + L + + S+VY       Q  + VK +      +I   E  +L+   H NII+  E++ +  ++ +V+E    G L D+ + K    E+D    V+ +   + YLH  GI+HR ++P+N+ Y +  P   L I + G +++  + +          + APE+     Y  +VD+WS+G+IT  ++C  +EP           + +     D   P W + S + + LV +++  DP  R    Q L HPW+T
Sbjct:   28 LAHYYELESELGRGATSVVYRCRQKGTQRPYAVKMLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAPLKIADFGLSKIVDDQVTMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCG-FEPFYDERGDQYMFKRILNCDYDFVSPWWDDVSLNAKDLVKKLIVFDPKKRLTTQQALQHPWVT 287          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: foxf2 (forkhead box F2 [Source:Xenbase;Acc:XB-GENE-484646])

HSP 1 Score: 104.375 bits (259), Expect = 2.223e-23
Identity = 70/261 (26.82%), Postives = 124/261 (47.51%), Query Frame = 1
Query: 1456 LTEKYQLINILSKSSRSIVY-LTNDFKQNKFIVKQINLGNHGEIRMKEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYYQS-NPQKFL-IGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEP----------KQAVEEFSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLT 2196
            L   Y+L + L + + S+VY       Q  + VK +      +I   E  +L+   H NII+  E++ +  ++ +V+E    G L D+ + K    E+D    V+ +   + YLH  GI+HR ++P+N+ Y +  P   L I + G +++  + +          + APE+     Y  +VD+WS+G+IT  ++C  +EP           + +     D   P W + S + + LV +++  DP  R    Q L HPW+T
Sbjct:   32 LAHYYELESELGRGATSVVYRCRQKGTQRPYAVKMLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAPLKIADFGLSKIVDDQVTMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCG-FEPFYDERGDQYMFKRILNCDYDFVSPWWDDVSLNAKDLVKKLIVFDPKKRLTTQQALQHPWVT 291          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: foxf2 (forkhead box F2 [Source:Xenbase;Acc:XB-GENE-484646])

HSP 1 Score: 104.76 bits (260), Expect = 2.612e-23
Identity = 70/261 (26.82%), Postives = 124/261 (47.51%), Query Frame = 1
Query: 1456 LTEKYQLINILSKSSRSIVY-LTNDFKQNKFIVKQINLGNHGEIRMKEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYYQS-NPQKFL-IGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEP----------KQAVEEFSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLT 2196
            L   Y+L + L + + S+VY       Q  + VK +      +I   E  +L+   H NII+  E++ +  ++ +V+E    G L D+ + K    E+D    V+ +   + YLH  GI+HR ++P+N+ Y +  P   L I + G +++  + +          + APE+     Y  +VD+WS+G+IT  ++C  +EP           + +     D   P W + S + + LV +++  DP  R    Q L HPW+T
Sbjct:   19 LAHYYELESELGRGATSVVYRCRQKGTQRPYAVKMLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAPLKIADFGLSKIVDDQVTMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCG-FEPFYDERGDQYMFKRILNCDYDFVSPWWDDVSLNAKDLVKKLIVFDPKKRLTTQQALQHPWVT 278          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Pskh1 (protein serine kinase H1 [Source:MGI Symbol;Acc:MGI:3528383])

HSP 1 Score: 109.768 bits (273), Expect = 4.588e-25
Identity = 75/264 (28.41%), Postives = 131/264 (49.62%), Query Frame = 1
Query: 1456 LTEKYQLINILSKSSRS-IVYLTNDFKQNKFIVKQINLG--NHGEIRMKEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNI--YYQSNPQKFLIGNMGQAEL--KTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEP----------KQAVEEFSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWL 2193
            +T KY +  ++ + S S +V + +   +  + +K I        E+   E ++L    H NIIQ  EV+ ++ +V +VME    G L D+ ++K    E+D  +++Q V  G+ YLH +GI HR ++P+N+  Y+     K +I + G A    K ++ +        +++APE+  +K Y   VD+W+LGVI   I+ +   P          +Q +      +  P W + S+  +  +  +L  DP  R  ALQ L HPW+
Sbjct:   94 VTAKYDIKALIGRGSFSRVVRVEHRATRQPYAIKMIETKYREGREVCESELRVLRRVRHANIIQLVEVFETQERVYMVMELATGGELFDRIIAKGSFTERDATRVLQMVLDGVRYLHALGITHRDLKPENLLYYHPGTDSKIIITDFGLASARKKGDDCLMKTTCGTPEYIAPEVLVRKPYTNSVDMWALGVI-AYILLSGTMPFEDDNRTRLYRQILRGKYSYLGEP-WPSVSNLAKDFIDRLLTVDPGARMTALQALRHPWV 355          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Camk1 (calcium/calmodulin-dependent protein kinase I [Source:MGI Symbol;Acc:MGI:1098535])

HSP 1 Score: 107.071 bits (266), Expect = 2.003e-24
Identity = 68/260 (26.15%), Postives = 121/260 (46.54%), Query Frame = 1
Query: 1468 YQLINILSKSSRSIVYLTNDFKQNKF-----IVKQINLGNHGEIRMKEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYYQS--NPQKFLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEP---------KQAVEEFSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLT 2196
            Y   ++L   + S V L  D +  K      I K+   G  G +   E  +L    H NI+   ++Y S   + ++M+    G L D+ + K    E+D  +++  V   + YLH +GI+HR ++P+N+ Y S     K +I + G ++++    +         ++APE+  QK Y++ VD WS+GVI   ++C  Y P          + + +   +   P W + S   +  +  +++ DP  RF   Q L HPW+ 
Sbjct:   20 YDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKKALEGKEGSME-NEIAVLHKIKHPNIVALDDIYESGGHLYLIMQLVSGGELFDRIVEKGFYTERDASRLIFQVLDAVKYLHDLGIVHRDLKPENLLYYSLDEDSKIMISDFGLSKMEDPGSVLSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCG-YPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIA 277          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Dclk2 (doublecortin-like kinase 2 [Source:MGI Symbol;Acc:MGI:1918012])

HSP 1 Score: 110.153 bits (274), Expect = 2.157e-24
Identity = 85/315 (26.98%), Postives = 148/315 (46.98%), Query Frame = 1
Query: 1330 HGRLEANTNTKDKAIQCTFDSGLLSVRSNNKNEKSFSKDSIFLTEKYQLINILSKSSRSIVYLTND-FKQNKFIVKQIN----LGNHGEIRMKEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIY---YQSNPQKFLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEPKQAVEEFSMDM-----------QHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLTQSENRE 2214
             GR  +N N   +  +C    G+    + N+  +SF      L EKY++  ++   + ++V    D +   +F +K I+     G    I   E  IL    H NII   E   +   + +VME    G+L D   S  +  E+D   MV ++ + L YLH++ I+HR I+P+N+    Y    +   +G+ G A +  E  ++    T T ++APE+  +  Y  KVD+W+ GVIT  ++C  + P ++      D+             P W N +   + L+++MLQ +   R  A ++L HPW++   ++E
Sbjct:  372 QGRSSSNVNGGPELDRCLSPEGV----NGNRCSESFP-----LLEKYRIGKVIGDGNFAVVKECVDRYTGKEFALKIIDKAKCCGKEHLIE-NEVSILRRVKHPNIIMLVEEMETATDLFLVMELVKGGDLFDAITSSTKYTERDGSAMVYNLANALRYLHSLSIVHRDIKPENLLVCEYPDGTKSLKLGDFGLATV-VEGPLYTVCGTPT-YVAPEIIAETGYGLKVDVWAAGVITYILLCG-FPPFRSENNLQEDLFDQILAGKLEFPAPYWDNITDSAKELISQMLQVNVEARCTAGEILSHPWVSDDASQE 673          

HSP 2 Score: 65.0846 bits (157), Expect = 2.421e-10
Identity = 59/239 (24.69%), Postives = 108/239 (45.19%), Query Frame = 1
Query:   34 QTHKMNERSKIIKLLINGNDQYKGKIISITKNRFVNFNEFLDQLT--LYFKSFLPNGIRRVYRYGNFQMVHRLEELENYGCYICCSHERLKKMAYDSNFIDKAIFSQTEKRNFFNNKIERNSLINSIVPNYKIFREIEESREMNQRKIKENISPKLIKIVFSD-KPQDIFKIFINRNLEISLNECLWKISNNLNRKTHKHDKIKIFTVSGREITNMPDLYINRSPILAFTNSMMMYPQD 741
            Q     +++K  +   NG+  +KG + +I+ +RF +F+  L +LT  L     LP G+R +Y     + V  L+EL     Y+C S+E  +K+ Y  N             N+  N I+  +     V + K   E++ES++         I PKL+ ++ S  KP+   +I +N+    S  + L  I+  +  K       ++ T+ G+++T + D + +    +A       Y QD
Sbjct:   63 QALSSEKKAKKARFYRNGDRYFKGLVFAISNDRFRSFDALLIELTRSLSDNVNLPQGVRTIYTIDGSRKVTSLDELLEGESYVCASNEPFRKVDYTKNV----------NPNWSVN-IKGGTTRTLAVASAK--SEVKESKDF--------IKPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITEAI--KLDSGVVKRLCTLDGKQVTCLQDFFGDDDVFIACGPEKYRYAQD 278          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Dclk2 (doublecortin-like kinase 2 [Source:MGI Symbol;Acc:MGI:1918012])

HSP 1 Score: 109.768 bits (273), Expect = 2.932e-24
Identity = 85/315 (26.98%), Postives = 148/315 (46.98%), Query Frame = 1
Query: 1330 HGRLEANTNTKDKAIQCTFDSGLLSVRSNNKNEKSFSKDSIFLTEKYQLINILSKSSRSIVYLTND-FKQNKFIVKQIN----LGNHGEIRMKEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIY---YQSNPQKFLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEPKQAVEEFSMDM-----------QHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLTQSENRE 2214
             GR  +N N   +  +C    G+    + N+  +SF      L EKY++  ++   + ++V    D +   +F +K I+     G    I   E  IL    H NII   E   +   + +VME    G+L D   S  +  E+D   MV ++ + L YLH++ I+HR I+P+N+    Y    +   +G+ G A +  E  ++    T T ++APE+  +  Y  KVD+W+ GVIT  ++C  + P ++      D+             P W N +   + L+++MLQ +   R  A ++L HPW++   ++E
Sbjct:  355 QGRSSSNVNGGPELDRCLSPEGV----NGNRCSESFP-----LLEKYRIGKVIGDGNFAVVKECVDRYTGKEFALKIIDKAKCCGKEHLIE-NEVSILRRVKHPNIIMLVEEMETATDLFLVMELVKGGDLFDAITSSTKYTERDGSAMVYNLANALRYLHSLSIVHRDIKPENLLVCEYPDGTKSLKLGDFGLATV-VEGPLYTVCGTPT-YVAPEIIAETGYGLKVDVWAAGVITYILLCG-FPPFRSENNLQEDLFDQILAGKLEFPAPYWDNITDSAKELISQMLQVNVEARCTAGEILSHPWVSDDASQE 656          

HSP 2 Score: 65.4698 bits (158), Expect = 1.951e-10
Identity = 59/239 (24.69%), Postives = 108/239 (45.19%), Query Frame = 1
Query:   34 QTHKMNERSKIIKLLINGNDQYKGKIISITKNRFVNFNEFLDQLT--LYFKSFLPNGIRRVYRYGNFQMVHRLEELENYGCYICCSHERLKKMAYDSNFIDKAIFSQTEKRNFFNNKIERNSLINSIVPNYKIFREIEESREMNQRKIKENISPKLIKIVFSD-KPQDIFKIFINRNLEISLNECLWKISNNLNRKTHKHDKIKIFTVSGREITNMPDLYINRSPILAFTNSMMMYPQD 741
            Q     +++K  +   NG+  +KG + +I+ +RF +F+  L +LT  L     LP G+R +Y     + V  L+EL     Y+C S+E  +K+ Y  N             N+  N I+  +     V + K   E++ES++         I PKL+ ++ S  KP+   +I +N+    S  + L  I+  +  K       ++ T+ G+++T + D + +    +A       Y QD
Sbjct:   63 QALSSEKKAKKARFYRNGDRYFKGLVFAISNDRFRSFDALLIELTRSLSDNVNLPQGVRTIYTIDGSRKVTSLDELLEGESYVCASNEPFRKVDYTKNV----------NPNWSVN-IKGGTTRTLAVASAK--SEVKESKDF--------IKPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITEAI--KLDSGVVKRLCTLDGKQVTCLQDFFGDDDVFIACGPEKYRYAQD 278          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Dclk2 (doublecortin-like kinase 2 [Source:MGI Symbol;Acc:MGI:1918012])

HSP 1 Score: 109.768 bits (273), Expect = 2.964e-24
Identity = 85/315 (26.98%), Postives = 148/315 (46.98%), Query Frame = 1
Query: 1330 HGRLEANTNTKDKAIQCTFDSGLLSVRSNNKNEKSFSKDSIFLTEKYQLINILSKSSRSIVYLTND-FKQNKFIVKQIN----LGNHGEIRMKEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIY---YQSNPQKFLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEPKQAVEEFSMDM-----------QHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLTQSENRE 2214
             GR  +N N   +  +C    G+    + N+  +SF      L EKY++  ++   + ++V    D +   +F +K I+     G    I   E  IL    H NII   E   +   + +VME    G+L D   S  +  E+D   MV ++ + L YLH++ I+HR I+P+N+    Y    +   +G+ G A +  E  ++    T T ++APE+  +  Y  KVD+W+ GVIT  ++C  + P ++      D+             P W N +   + L+++MLQ +   R  A ++L HPW++   ++E
Sbjct:  356 QGRSSSNVNGGPELDRCLSPEGV----NGNRCSESFP-----LLEKYRIGKVIGDGNFAVVKECVDRYTGKEFALKIIDKAKCCGKEHLIE-NEVSILRRVKHPNIIMLVEEMETATDLFLVMELVKGGDLFDAITSSTKYTERDGSAMVYNLANALRYLHSLSIVHRDIKPENLLVCEYPDGTKSLKLGDFGLATV-VEGPLYTVCGTPT-YVAPEIIAETGYGLKVDVWAAGVITYILLCG-FPPFRSENNLQEDLFDQILAGKLEFPAPYWDNITDSAKELISQMLQVNVEARCTAGEILSHPWVSDDASQE 657          

HSP 2 Score: 65.4698 bits (158), Expect = 1.920e-10
Identity = 59/239 (24.69%), Postives = 108/239 (45.19%), Query Frame = 1
Query:   34 QTHKMNERSKIIKLLINGNDQYKGKIISITKNRFVNFNEFLDQLT--LYFKSFLPNGIRRVYRYGNFQMVHRLEELENYGCYICCSHERLKKMAYDSNFIDKAIFSQTEKRNFFNNKIERNSLINSIVPNYKIFREIEESREMNQRKIKENISPKLIKIVFSD-KPQDIFKIFINRNLEISLNECLWKISNNLNRKTHKHDKIKIFTVSGREITNMPDLYINRSPILAFTNSMMMYPQD 741
            Q     +++K  +   NG+  +KG + +I+ +RF +F+  L +LT  L     LP G+R +Y     + V  L+EL     Y+C S+E  +K+ Y  N             N+  N I+  +     V + K   E++ES++         I PKL+ ++ S  KP+   +I +N+    S  + L  I+  +  K       ++ T+ G+++T + D + +    +A       Y QD
Sbjct:   63 QALSSEKKAKKARFYRNGDRYFKGLVFAISNDRFRSFDALLIELTRSLSDNVNLPQGVRTIYTIDGSRKVTSLDELLEGESYVCASNEPFRKVDYTKNV----------NPNWSVN-IKGGTTRTLAVASAK--SEVKESKDF--------IKPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITEAI--KLDSGVVKRLCTLDGKQVTCLQDFFGDDDVFIACGPEKYRYAQD 278          
BLAST of Protein kinase domain-containing protein vs. UniProt
Match: sp|P25323|MYLKA_DICDI (Myosin light chain kinase A OS=Dictyostelium discoideum OX=44689 GN=mlkA PE=1 SV=2)

HSP 1 Score: 108.612 bits (270), Expect = 1.180e-24
Identity = 83/289 (28.72%), Postives = 141/289 (48.79%), Query Frame = 1
Query: 1468 YQLINILSKSSRSIVYLT-NDFKQNKFIVKQIN---LGNHGEIRMK-EAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYYQS--NPQKFLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEP---------KQAVEEFSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLTQSENREMIQEDLFREMESFTRQQIDTTIV 2283
            Y+    L + + SIVYL  N   + ++ +K IN   LG   E  +K E  IL   +H NII   E++ +  K+ +VME    G L DK + K    E D   +V+ + S + YLH + I+HR ++P+N+  +S  N  +  I + G +++  + L+         ++APE+     Y+++VD+WS+GVIT  ++C  + P          + + E + +     W   S + +  + ++L  D S R NA   L HPWL  + +   I     +E     RQ+  T +V
Sbjct:    8 YEFKEELGRGAFSIVYLGENKQTKQRYAIKVINKSELGKDYEKNLKMEVDILKKVNHPNIIALKELFDTPEKLYLVMELVTGGELFDKIVEKGSYSEADAANLVKKIVSAVGYLHGLNIVHRDLKPENLLLKSKENHLEVAIADFGLSKIIGQTLVMQTACGTPSYVAPEVLNATGYDKEVDMWSIGVITYILLCG-FPPFYGDTVPEIFEQIMEANYEFPEEYWGGISKEAKDFIGKLLVVDVSKRLNATNALNHPWLKSNNSNNTIDTVKMKEY-IVERQKTQTKLV 294          
BLAST of Protein kinase domain-containing protein vs. UniProt
Match: sp|Q0V7M1|KPSH1_BOVIN (Serine/threonine-protein kinase H1 OS=Bos taurus OX=9913 GN=PSKH1 PE=2 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 1.831e-24
Identity = 72/262 (27.48%), Postives = 128/262 (48.85%), Query Frame = 1
Query: 1456 LTEKYQLINILSKSSRS-IVYLTNDFKQNKFIVKQINLG--NHGEIRMKEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNI--YYQSNPQKFLIGNMG--QAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVC--------NKYEPKQAVEEFSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWL 2193
            +T KY +  ++ + S S +V + +   +  + +K I        E+   E ++L    H NIIQ  EV+ ++ +V +VME    G L D+ ++K    E+D  +++Q V  G+ YLH +GI HR ++P+N+  Y+     K +I + G   A  K ++ +        +++APE+  +K Y   VD+W+LGVI   ++         N+    + +           W + S+  +  +  +L  DP  R  ALQ L HPW+
Sbjct:   94 VTAKYDIKALIGRGSFSRVVRVEHRATRQPYAIKMIETKYREGREVCESELRVLRRVRHANIIQLVEVFETQERVYMVMELATGGELFDRIIAKGSFTERDATRVLQMVLDGVRYLHALGITHRDLKPENLLYYHPGTDSKIIITDFGLASARKKGDDCLMKTTCGTPEYIAPEVLVRKPYTNSVDMWALGVIAYILLSGTMPFEDDNRTRLYRQILRGKYSYSGEPWPSVSNLAKDFIDRLLTVDPGARMTALQALRHPWV 355          
BLAST of Protein kinase domain-containing protein vs. UniProt
Match: sp|D2I3C6|DCLK2_AILME (Serine/threonine-protein kinase DCLK2 OS=Ailuropoda melanoleuca OX=9646 GN=DCLK2 PE=3 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 1.942e-24
Identity = 90/315 (28.57%), Postives = 147/315 (46.67%), Query Frame = 1
Query: 1330 HGRLEANTNTKDKAIQCTFDSGLLSVRSNNKNEKSFSKDSIFLTEKYQLINILSKSSRSIVYLTNDFKQNK-FIVKQIN----LGNHGEIRMKEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIY---YQSNPQKFLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEPKQAVEEFSMDM-----------QHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLTQSENRE 2214
            HGR  +N N   +  +C      LS    N N  S   +S  L EKY++  ++   + ++V    D    K F +K I+     G    I   E  IL    H NII   E   +  ++ +VME    G+L D   S  +  E+D   MV ++ + L YLH + I+HR I+P+N+    Y    +   +G+ G A +  E  ++    T T ++APE+  +  Y  KVDIW+ GVIT  ++C  + P ++      D+             P W N +   + L+++MLQ +   R  A ++L HPW++   ++E
Sbjct:  374 HGRSSSNVNGGPELARC------LSPEGVNGNRCS---ESSTLLEKYKIGKVIGDGNFAVVKECMDRSTGKEFALKIIDKAKCCGKEHLIE-NEVSILRRVKHPNIIMLVEEMETATELFLVMELVKGGDLFDAITSSTKYTERDGSAMVYNLANALRYLHGLSIVHRDIKPENLLVCEYPDGTKSLKLGDFGLATV-VEGPLYTVCGTPT-YVAPEIIAETGYGLKVDIWAAGVITYILLCG-FPPFRSENNLQEDLFDQILAGKLEFPAPYWDNITDSAKELISQMLQVNVEARCTAGEILSHPWVSDDASQE 675          

HSP 2 Score: 68.1662 bits (165), Expect = 2.422e-10
Identity = 56/239 (23.43%), Postives = 106/239 (44.35%), Query Frame = 1
Query:   34 QTHKMNERSKIIKLLINGNDQYKGKIISITKNRFVNFNEFLDQLT--LYFKSFLPNGIRRVYRYGNFQMVHRLEELENYGCYICCSHERLKKMAYDSNFIDKAIFSQTEKRNFFNNKIERNSLINSIVPNYKIFREIEESREMNQRKIKENISPKLIKIVFSD-KPQDIFKIFINRNLEISLNECLWKISNNLNRKTHKHDKIKIFTVSGREITNMPDLYINRSPILAFTNSMMMYPQD 741
            Q     +++K  +   NG+  +KG + +I+ +RF +F+  L +LT  L     LP G+R +Y     + V  L+EL     Y+C S+E  +K+ Y  N             N+  N   +     ++     +  E++ES++         I PKL+ ++ S  KP+   +I +N+    S  + L  I+  +  K       ++ T+ G+++T + D + +    +A       Y QD
Sbjct:   63 QALSSEKKAKKARFYRNGDRYFKGLVFAISSDRFRSFDALLMELTRSLSDNVNLPQGVRTIYTIDGSRKVTSLDELLEGESYVCASNEPFRKVDYTKNI----------NPNWSVNI--KGGTARALAAPSSVKSEVKESKDF--------IKPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITEAI--KLDSGVVKRLCTLDGKQVTCLQDFFGDDDVFIACGPEKFRYAQD 279          
BLAST of Protein kinase domain-containing protein vs. UniProt
Match: sp|Q8N568|DCLK2_HUMAN (Serine/threonine-protein kinase DCLK2 OS=Homo sapiens OX=9606 GN=DCLK2 PE=1 SV=4)

HSP 1 Score: 112.849 bits (281), Expect = 2.332e-24
Identity = 90/315 (28.57%), Postives = 147/315 (46.67%), Query Frame = 1
Query: 1330 HGRLEANTNTKDKAIQCTFDSGLLSVRSNNKNEKSFSKDSIFLTEKYQLINILSKSSRSIVYLTNDFKQNK-FIVKQIN----LGNHGEIRMKEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIY---YQSNPQKFLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEPKQAVEEFSMDM-----------QHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLTQSENRE 2214
            HGR  +N N   +  +C    G+      N N  S   +S  L EKY++  ++   + ++V    D    K F +K I+     G    I   E  IL    H NII   E   +  ++ +VME    G+L D   S  +  E+D   MV ++ + L YLH + I+HR I+P+N+    Y    +   +G+ G A +  E  ++    T T ++APE+  +  Y  KVDIW+ GVIT  ++C  + P ++      D+             P W N +   + L+++MLQ +   R  A Q+L HPW++   ++E
Sbjct:  357 HGRSSSNVNGGPELDRCISPEGV------NGNRCS---ESSTLLEKYKIGKVIGDGNFAVVKECIDRSTGKEFALKIIDKAKCCGKEHLIE-NEVSILRRVKHPNIIMLVEEMETATELFLVMELVKGGDLFDAITSSTKYTERDGSAMVYNLANALRYLHGLSIVHRDIKPENLLVCEYPDGTKSLKLGDFGLATV-VEGPLYTVCGTPT-YVAPEIIAETGYGLKVDIWAAGVITYILLCG-FPPFRSENNLQEDLFDQILAGKLEFPAPYWDNITDSAKELISQMLQVNVEARCTAGQILSHPWVSDDASQE 658          

HSP 2 Score: 67.3958 bits (163), Expect = 3.488e-10
Identity = 56/239 (23.43%), Postives = 106/239 (44.35%), Query Frame = 1
Query:   34 QTHKMNERSKIIKLLINGNDQYKGKIISITKNRFVNFNEFLDQLT--LYFKSFLPNGIRRVYRYGNFQMVHRLEELENYGCYICCSHERLKKMAYDSNFIDKAIFSQTEKRNFFNNKIERNSLINSIVPNYKIFREIEESREMNQRKIKENISPKLIKIVFSD-KPQDIFKIFINRNLEISLNECLWKISNNLNRKTHKHDKIKIFTVSGREITNMPDLYINRSPILAFTNSMMMYPQD 741
            Q     +++K  +   NG+  +KG + +I+ +RF +F+  L +LT  L     LP G+R +Y     + V  L+EL     Y+C S+E  +K+ Y  N             N+  N   +     ++     +  E++ES++         I PKL+ ++ S  KP+   +I +N+    S  + L  I+  +  K       ++ T+ G+++T + D + +    +A       Y QD
Sbjct:   63 QALSSEKKAKKARFYRNGDRYFKGLVFAISSDRFRSFDALLIELTRSLSDNVNLPQGVRTIYTIDGSRKVTSLDELLEGESYVCASNEPFRKVDYTKNI----------NPNWSVNI--KGGTSRALAAASSVKSEVKESKDF--------IKPKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITEAI--KLDSGVVKRLCTLDGKQVTCLQDFFGDDDVFIACGPEKFRYAQD 279          
BLAST of Protein kinase domain-containing protein vs. UniProt
Match: sp|P11801|KPSH1_HUMAN (Serine/threonine-protein kinase H1 OS=Homo sapiens OX=9606 GN=PSKH1 PE=1 SV=4)

HSP 1 Score: 110.153 bits (274), Expect = 2.720e-24
Identity = 72/262 (27.48%), Postives = 128/262 (48.85%), Query Frame = 1
Query: 1456 LTEKYQLINILSKSSRS-IVYLTNDFKQNKFIVKQINLG--NHGEIRMKEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNI--YYQSNPQKFLIGNMG--QAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVC--------NKYEPKQAVEEFSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWL 2193
            +T KY +  ++ + S S +V + +   +  + +K I        E+   E ++L    H NIIQ  EV+ ++ +V +VME    G L D+ ++K    E+D  +++Q V  G+ YLH +GI HR ++P+N+  Y+     K +I + G   A  K ++ +        +++APE+  +K Y   VD+W+LGVI   ++         N+    + +           W + S+  +  +  +L  DP  R  ALQ L HPW+
Sbjct:   94 VTAKYDIKALIGRGSFSRVVRVEHRATRQPYAIKMIETKYREGREVCESELRVLRRVRHANIIQLVEVFETQERVYMVMELATGGELFDRIIAKGSFTERDATRVLQMVLDGVRYLHALGITHRDLKPENLLYYHPGTDSKIIITDFGLASARKKGDDCLMKTTCGTPEYIAPEVLVRKPYTNSVDMWALGVIAYILLSGTMPFEDDNRTRLYRQILRGKYSYSGEPWPSVSNLAKDFIDRLLTVDPGARMTALQALRHPWV 355          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|9707756 (tr|A0A0L0T198|A0A0L0T198_ALLM3 CAMK protein kinase OS=Allomyces macrogynus (strain ATCC 38327) OX=578462 GN=AMAG_13031 PE=4 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 3.433e-27
Identity = 90/294 (30.61%), Postives = 150/294 (51.02%), Query Frame = 1
Query: 1438 SKDSIFLTEKYQLINILSKSSRSIVYLTNDFKQNK-FIVKQINLGNHGEIRM----KEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNLDKYLS-KKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYYQS----NPQKFLIGNMGQAELKTENLIFIENWTQTQ-FMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEPKQAVEEF-------SMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLTQSENREMIQEDLFREMESFTRQQ 2265
            + D   L E+Y L + L K +   V L  D    + F  K I+    G   M    +E +I+    HR+++Q  EVY +  K+ IVMEY   G L K +     I EKDI  +++ + S + YLH  GI+HR I+P+NI   +    +P    + + G A   T     +EN   T  +MAPE+     Y+++ DIWS+G++ G ++  KY  K+A +E        ++++ H  W + S   + L+ +MLQ DP+ R  A +++ HPW+T     ++  + +   M+S+  +Q
Sbjct:   53 ADDEAGLEERYDLGSKLGKGAFGTVRLVTDRATREVFACKTIHKKMRGGASMDQIAREVEIMKRIRHRHVVQLREVYETPQKIYIVMEYCNGGELVKKVQLTNSIEEKDIKLVIKRLASVIGYLHDHGIVHRDIKPENILLSTSDPNDPYNIKVSDFGLAAF-TGGGKLMENVCGTPTYMAPEVVAGLGYSQQCDIWSIGIMCG-LLLAKYT-KKAEQELREMIVTGTINVHHAIWAHCSPSAKNLLEKMLQVDPAQRIAAKEIVYHPWIT---GEKLESQTVLEMMKSYRAEQ 340          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|9726131 (tr|A0A0L0T4R2|A0A0L0T4R2_ALLM3 CAMK protein kinase OS=Allomyces macrogynus (strain ATCC 38327) OX=578462 GN=AMAG_14078 PE=4 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 6.988e-27
Identity = 90/294 (30.61%), Postives = 150/294 (51.02%), Query Frame = 1
Query: 1438 SKDSIFLTEKYQLINILSKSSRSIVYLTNDFKQNK-FIVKQINLGNHGEIRM----KEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNLDKYLS-KKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYYQS----NPQKFLIGNMGQAELKTENLIFIENWTQTQ-FMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEPKQAVEEF-------SMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLTQSENREMIQEDLFREMESFTRQQ 2265
            + D   L E+Y L + L K +   V L  D    + F  K I+    G   M    +E +I+    HR+++Q  EVY +  K+ IVMEY   G L K +     I EKDI  +++ + S + YLH  GI+HR I+P+NI   +    +P    + + G A   T     +EN   T  +MAPE+     Y+++ DIWS+G++ G ++  KY  K+A +E        ++++ H  W + S   + L+ +MLQ DP+ R  A +++ HPW+T     ++  + +   M+S+  +Q
Sbjct:   53 ADDKSGLEERYDLGSKLGKGAFGTVRLVTDRATREVFACKTIHKKMRGGASMDQIAREVEIMKRIRHRHVVQLREVYETPQKIYIVMEYCNGGELVKKVQLTNSIEEKDIKLVIKRLASVIGYLHDHGIVHRDIKPENILLSTSDPNDPYNIKVSDFGLAAF-TGGGKLMENVCGTPTYMAPEVVAGLGYSQQCDIWSIGIMCG-LLLAKYT-KRAEQELREMIVTGTINVHHAIWAHCSPSAKNLLEKMLQVDPAQRIAAKEIVYHPWIT---GEKLESQTVLEMMKSYRAEQ 340          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|11778793 (tr|A0A1Y2HQ64|A0A1Y2HQ64_9FUNG Kinase-like domain-containing protein OS=Catenaria anguillulae PL171 OX=765915 GN=BCR44DRAFT_116162 PE=4 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 2.444e-26
Identity = 84/292 (28.77%), Postives = 147/292 (50.34%), Query Frame = 1
Query: 1438 SKDSIFLTEKYQLINILSKSSRSIVYLTND-FKQNKFIVKQINLGNHGEIRM----KEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNLDKYLSK-KEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYYQ----SNPQKFLIGNMGQAELKTENLIFIENWTQTQ-FMAPELTYQKEYNEKVDIWSLGVITGNIVCN-----KYEPKQAVEEFSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLTQSENREMIQEDLFREMESFTRQQ 2265
            ++D   L  +Y + + L K +   V L  D   +  F  K I+  +     +    +E +I+    HR+++Q  EVY +  KV IVMEY   G L K + K   I E D+  +++ + S + YLH +GI+HR I+P+NI       ++P    + + G A       + +EN   T  +MAPE+     Y+++ DIWS+GV+   ++CN     ++  +  ++   +DM H  W +     + L+ +MLQ DP+ R  A ++L HPW+T     ++  + +   M S+  +Q
Sbjct:   60 AEDKAGLHSRYDMGSKLGKGAFGTVRLVTDKATREVFACKSIHKRSKNGASIDQIGREVEIMKKIRHRHVVQLREVYETPQKVYIVMEYCNGGELVKKVQKNGSIDETDLKLVIKRLASVIGYLHDLGIVHRDIKPENILLSTQDPADPYNIKVSDFGLAAFSGGGKL-MENVCGTPLYMAPEVLAGLGYSQQCDIWSIGVMMALLLCNYTRAAEHGLRDMIQRGQVDMSHELWADCPPSAKNLIEKMLQVDPAQRIAAKEILLHPWIT---GDKLESQTVLEMMRSYRAEQ 347          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|175209889 (tr|A0A099YU29|A0A099YU29_TINGU Serine/threonine-protein kinase DCLK3 (Fragment) OS=Tinamus guttatus OX=94827 GN=N309_09491 PE=3 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 3.321e-26
Identity = 78/256 (30.47%), Postives = 131/256 (51.17%), Query Frame = 1
Query: 1546 IVKQINLGNHGEIRMKEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYYQSNPQK---FLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVC----------NKYEPKQAVEEFSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLTQS--ENREMIQEDLFREMESFTRQQ 2265
            IV +  L    E+   E  I+ S  H NI+   EVY +E ++ +++EY P G+L D  +   +  E D   M+ D+   L+Y+H+  I+HR ++P+N+  Q N  K     + + G A+  T+  IF    T T ++APE+  +K Y  +VD+W+ GVI   ++C          ++ E  Q ++    +   P W N S+  + L+T +L  DP  R+ A QVL HPW+  +   N   +Q ++ + +E   R Q
Sbjct:   52 IVDKSKLKGKEEMMESEILIIRSLSHPNIVSLIEVYETEAEIYLILEYVPGGDLFDAIIESVKFTEHDAAVMISDLCEALVYIHSKNIVHRDLKPENLLVQHNADKSTTLKLADFGLAKQVTKP-IFTVCGTPT-YVAPEILAEKGYGLEVDMWAAGVILYILLCGFPPFRSQDRDQEELFQIIQLGHYEFLSPYWDNISAAAKDLITRLLIVDPQKRYTARQVLQHPWIRTAGKTNSRNLQREVTKNIERHFRMQ 305          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|173315667 (tr|A0A093GJK8|A0A093GJK8_DRYPU Serine/threonine-protein kinase DCLK3 (Fragment) OS=Dryobates pubescens OX=118200 GN=N307_13898 PE=3 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 4.542e-26
Identity = 73/222 (32.88%), Postives = 121/222 (54.50%), Query Frame = 1
Query: 1576 GEIRMKEAQILM--SCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYYQSNPQK---FLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVC----------NKYEPKQAVEEFSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWL 2193
            G+  M E++IL+  S  H NI+   EVY +E ++ +++EY P G+L D  +   +  E D   M+ D+   L+Y+H+  I+HR ++P+N+  Q N  K     + + G A+L T+  IF    T T ++APE+  +K Y  +VD+W+ GVI   ++C          ++ E  Q ++    +   P W N S+  + L+T +L  DP  R+ A QVL HPW+
Sbjct:   60 GKEDMMESEILIIRSLSHPNIVSLIEVYETEAEIYLILEYVPGGDLFDAIIESVKFTEHDAAVMITDLCEALVYIHSKNIVHRDLKPENLLVQHNADKSTTLKLADFGLAKLVTKP-IFTVCGTPT-YVAPEILAEKGYGLEVDMWAAGVILYILLCGFPPFRSQERDQEELFQIIQLGHYEFLSPYWDNISAAAKDLITRLLIVDPQKRYTARQVLQHPWI 279          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: pnck (calcium/calmodulin-dependent protein kinase type 1B-like [Source:NCBI gene;Acc:103046554])

HSP 1 Score: 118.627 bits (296), Expect = 9.540e-29
Identity = 78/261 (29.89%), Postives = 130/261 (49.81%), Query Frame = 1
Query: 1468 YQLINILSKSSRSIVYLTNDFKQNKFI----VKQINLGNHGEIRMKEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYYQS--NPQKFLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEP----------KQAVE-EFSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLT 2196
            Y+L   L + S S V +    K +K +    +++  L     +   E  +L    H NII   E + +  K+ +VM     G L D+ L +    EKD  +++  V   + YLH +GI+HR ++P+N+ Y++     K +I + G ++++ +  +     T   ++APEL  QK Y + VD+W+LGVI+  ++C  Y P          KQ ++ EF  D   P W + S   +  +  +LQ DP  RFN  Q L HPW++
Sbjct:   18 YELREKLGEGSFSEVRVAQHRKTHKLVAVKCIRKRALKGKESMLENEIAVLRRIKHENIISLEETFETPTKLYLVMTLVTGGELLDRILERGSYTEKDASRVILQVLEAVKYLHQLGIVHRDLKPENLLYETPLEDSKIVISDFGLSKMEEQGALSTACGTPA-YVAPELLQQKTYGKGVDLWALGVISFILLCG-YPPFYDENDTQLYKQIIKAEFEFD--SPYWDDISDSAKDFIVHLLQKDPERRFNCEQALQHPWIS 274          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: pnck (calcium/calmodulin-dependent protein kinase type 1B-like [Source:NCBI gene;Acc:103046554])

HSP 1 Score: 118.627 bits (296), Expect = 9.540e-29
Identity = 78/261 (29.89%), Postives = 130/261 (49.81%), Query Frame = 1
Query: 1468 YQLINILSKSSRSIVYLTNDFKQNKFI----VKQINLGNHGEIRMKEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYYQS--NPQKFLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEP----------KQAVE-EFSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLT 2196
            Y+L   L + S S V +    K +K +    +++  L     +   E  +L    H NII   E + +  K+ +VM     G L D+ L +    EKD  +++  V   + YLH +GI+HR ++P+N+ Y++     K +I + G ++++ +  +     T   ++APEL  QK Y + VD+W+LGVI+  ++C  Y P          KQ ++ EF  D   P W + S   +  +  +LQ DP  RFN  Q L HPW++
Sbjct:   18 YELREKLGEGSFSEVRVAQHRKTHKLVAVKCIRKRALKGKESMLENEIAVLRRIKHENIISLEETFETPTKLYLVMTLVTGGELLDRILERGSYTEKDASRVILQVLEAVKYLHQLGIVHRDLKPENLLYETPLEDSKIVISDFGLSKMEEQGALSTACGTPA-YVAPELLQQKTYGKGVDLWALGVISFILLCG-YPPFYDENDTQLYKQIIKAEFEFD--SPYWDDISDSAKDFIVHLLQKDPERRFNCEQALQHPWIS 274          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-27e6.1 (serine/threonine-protein kinase H1-like [Source:NCBI gene;Acc:103038196])

HSP 1 Score: 114.005 bits (284), Expect = 1.480e-26
Identity = 81/298 (27.18%), Postives = 143/298 (47.99%), Query Frame = 1
Query: 1387 DSGLLSVRSNNKNEKSFSKD-SIFLTEKYQLINILSKSSRS-IVYLTNDFKQNKFIVKQINL-GNHG-EIRMKEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKN-IYYQSNP-QKFLIGNMGQA--ELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCN------KYEPK--QAVEEFSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWL----TQSENREM 2217
            D      R  NK E  F       +T +Y +  ++ + S S +V + +   +  F +K + + GN G E+   E  +L    H NII+  EV+++  +V +V+E    G L ++ +++    E+D  + +  V SGL YLH++GI+HR ++P+N +YY   P  + +I + G A    K  +          +++APE+   + Y   VD+W+LGVI+  ++        +  P+  +A+   S       W + S+  +  +  +L   P  R  A Q L HPWL    + S NR +
Sbjct:   60 DGAAARNRQANKAEVKFRTTFDPRVTARYDIKALIGRGSFSHVVRVEHRHTRQPFAIKLLEVRGNEGRELCRTELGVLRRVRHANIIRLEEVFQTPDRVYLVLELATGGELLERVVARGSFTERDATRALIMVSSGLRYLHSLGIVHRDLKPENLLYYHPGPDSRLIITDFGLACWSSKRHDWALRTLCGTPEYLAPEMVGGRPYGSAVDMWALGVISYILLSGSMPFDQRSRPRLFRAILRGSYSFHCEPWSSVSNQAKDFIERLLSLSPEQRMTAQQALAHPWLVGMASDSSNRSL 357          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: pskh1 (protein serine kinase H1 [Source:NCBI gene;Acc:103031964])

HSP 1 Score: 110.923 bits (276), Expect = 1.527e-25
Identity = 77/281 (27.40%), Postives = 137/281 (48.75%), Query Frame = 1
Query: 1417 NKNEKSFSKDSIFLTEKYQLINILSKSSRS-IVYLTNDFKQNKFIVKQINLGNHGEIRMKEAQ--------ILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNI--YYQSNPQKFLIGNMGQAEL--KTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVC--------NKYEPKQAVEEFSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWL 2193
            NK  K  +K    +T KY++  ++ + S S +V + +   +  + +K I      E R +E +        +L    H NIIQ  EV+ +  +V +VME    G L D+ +++    E+D  +++Q V  G+ YLHT+GI HR ++P+N+  Y+     K +I + G A    K +  +        +++APE+  +K Y   VD+W+LGVI+  ++         N+    + + +         W + S+  +  +  +L  DPS+R  A Q L HPW+
Sbjct:   83 NKVAKYRAKFDPRVTAKYEIKALIGRGSFSRVVRVEHKSTRQPYAIKMI------ETRYREGREVCESELCVLRRVRHTNIIQLMEVFETAERVYMVMELATGGELFDRIIARGSFTERDATRVLQMVLDGVKYLHTLGITHRDLKPENLLYYHPGADSKIMITDFGLASTRKKGDECMMKTTCGTPEYIAPEILVRKPYTNAVDMWALGVISYILLSGTMPFEDDNRMRLYRQILKGKYSFSGEPWPSVSNLAKDFIDRVLNVDPSERLTAGQALKHPWI 357          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: pskh1 (protein serine kinase H1 [Source:NCBI gene;Acc:103031964])

HSP 1 Score: 110.923 bits (276), Expect = 1.527e-25
Identity = 77/281 (27.40%), Postives = 137/281 (48.75%), Query Frame = 1
Query: 1417 NKNEKSFSKDSIFLTEKYQLINILSKSSRS-IVYLTNDFKQNKFIVKQINLGNHGEIRMKEAQ--------ILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNI--YYQSNPQKFLIGNMGQAEL--KTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVC--------NKYEPKQAVEEFSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWL 2193
            NK  K  +K    +T KY++  ++ + S S +V + +   +  + +K I      E R +E +        +L    H NIIQ  EV+ +  +V +VME    G L D+ +++    E+D  +++Q V  G+ YLHT+GI HR ++P+N+  Y+     K +I + G A    K +  +        +++APE+  +K Y   VD+W+LGVI+  ++         N+    + + +         W + S+  +  +  +L  DPS+R  A Q L HPW+
Sbjct:   83 NKVAKYRAKFDPRVTAKYEIKALIGRGSFSRVVRVEHKSTRQPYAIKMI------ETRYREGREVCESELCVLRRVRHTNIIQLMEVFETAERVYMVMELATGGELFDRIIARGSFTERDATRVLQMVLDGVKYLHTLGITHRDLKPENLLYYHPGADSKIMITDFGLASTRKKGDECMMKTTCGTPEYIAPEILVRKPYTNAVDMWALGVISYILLSGTMPFEDDNRMRLYRQILKGKYSFSGEPWPSVSNLAKDFIDRVLNVDPSERLTAGQALKHPWI 357          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: RPS6KA3 (ribosomal protein S6 kinase A3 [Source:HGNC Symbol;Acc:HGNC:10432])

HSP 1 Score: 103.605 bits (257), Expect = 8.671e-25
Identity = 68/219 (31.05%), Postives = 105/219 (47.95%), Query Frame = 1
Query: 1591 KEAQILMS-CDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYY---QSNPQKFLIGNMGQA-ELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYE--------PKQAVEEFSMD---MQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLT 2196
            +E +IL+    H N+I   +VY     V +V E    G L DK L +K   E++   ++Q +   + YLH+ G++HR ++P NI Y     NP+   I + G A +L+ EN + +       F+APE+  ++ Y+   DIWSLGV+   ++             P   +         +   NW   S   + LV +ML  DP  RF A QVL HPW+ 
Sbjct:   53 EEIEILLRYGQHPNVITLKDVYDDGKSVYLVTELMKGGELLDKILRQKFFSEREASAVLQTIARTVEYLHSQGVVHRDLKPSNILYVDESGNPESLRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDAACDIWSLGVLLYTMLAGHTPFANGPDDTPGVILTRIGSGRFLLSGGNWDTVSEAAKDLVKKMLHVDPHQRFTAAQVLRHPWIA 271          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008748.1 (pep scaffold:Pmarinus_7.0:GL476577:591:63029:-1 gene:ENSPMAG00000007907.1 transcript:ENSPMAT00000008748.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 86.2705 bits (212), Expect = 2.190e-18
Identity = 65/267 (24.34%), Postives = 123/267 (46.07%), Query Frame = 1
Query: 1456 LTEKYQLINILSKSSRSIVY------LTNDFKQNKFIVKQINLGNHGEIRMKEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNLDKYLSKKEIY-EKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYYQSNPQKFLI--GNMGQA-ELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEP---------KQAVEEFSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLTQ 2199
             T++YQL   L K + S+V          +F       K+++  +H ++  +EA+I     H NI++  E    E    +V +    G L + +  +E Y E D    +Q +   + + H  GI+HR ++P+N+   S  +   +   + G A E++ +   +        +++PE+  +  Y + VD+W+ GVI   I+   Y P          Q ++  + D   P W   +++ + L+ +ML  +P+ R  A + L HPW+ Q
Sbjct:   10 FTDEYQLYEELGKGAFSVVRRCVKVSTGQEFAAKIINTKKLSARDHQKLE-REARICRLLKHSNIVRLHESIAEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVHHCHQHGIVHRDLKPENLLLASKMKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKDPYGKPVDMWACGVIL-YILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTAEAKNLINQMLTINPAKRITAAEALKHPWICQ 274          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003135.1 (pep scaffold:Pmarinus_7.0:GL491838:799:5626:1 gene:ENSPMAG00000002863.1 transcript:ENSPMAT00000003135.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.8037 bits (203), Expect = 6.632e-18
Identity = 53/218 (24.31%), Postives = 104/218 (47.71%), Query Frame = 1
Query: 1594 EAQILMSCDHRNIIQCFEVYRSE----IKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYYQS--NPQKFLIGNMGQAELKTENLIFIENWTQTQFM---APELTYQKEYNEKVDIWSLGVITGNIVCNKYEP---------KQAVEEFSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPW 2190
            E  +L    H NII   ++Y ++    + +++V+     G L D+ + +    E+D   +++ V   + +LH  G++HR ++P+N+ Y S  +  K +I + G ++++    +         ++   APE+  QK Y   VD WS+GVI+  ++C  Y P            + +   +   P W + S   +  +  +++ D ++RF   Q L HPW
Sbjct:   39 EVCVLSRIKHENIIALEDIYETDSHLYLIMQLVLLLIRGGELFDRIVERGFYTERDASALIRQVLRAVSHLHGQGVVHRDLKPENLLYYSAEDDSKIMISDFGLSKVEAPGSVMSTACGTPGYVACEAPEVLAQKPYTRAVDCWSIGVISYILLCG-YPPFYDEVDSRLFDQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDVAERFTCEQALQHPW 255          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008094.1 (pep scaffold:Pmarinus_7.0:GL476440:650454:662026:-1 gene:ENSPMAG00000007311.1 transcript:ENSPMAT00000008094.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.9593 bits (206), Expect = 7.786e-18
Identity = 57/220 (25.91%), Postives = 107/220 (48.64%), Query Frame = 1
Query: 1612 SCDHRNIIQCFEVY----RSEIKVEIVMEYFPEGNLDKYLSKK---EIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYYQSN-PQKFL-IGNMGQAELKTE-NLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEP-------------KQAVEEFSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLTQS 2202
            +C H  +++  +VY    + +  + IVME    G L   + ++      E++   +++D+G  +  LH + I HR ++P+N+ Y S  P   L + + G A+  T  N +    +T   F APE+    +Y++  D+WSLGVI   ++C  + P             K+ +     +  +P W + S + + L+  +L+ DP+ R    + + HPW+ QS
Sbjct:   24 TCPH--VVRIVDVYENLHQGKRCLLIVMEIMLGGELFSRIQERGDQAFTEREASGIMRDIGQAVQSLHAMNIAHRDVKPENLLYTSKKPNALLKLTDFGFAKETTRCNSLATPCYTPYYFAAPEVLGSVKYDKSCDMWSLGVIMYILLCG-FPPFYSNHGLAISPGMKKRIRMGQYEFPNPEWADVSEEAKQLIRHLLKTDPTARMTITEFMNHPWINQS 240          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010548.1 (pep scaffold:Pmarinus_7.0:GL477749:266235:284843:-1 gene:ENSPMAG00000009555.1 transcript:ENSPMAT00000010548.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.5001 bits (210), Expect = 1.975e-17
Identity = 68/253 (26.88%), Postives = 113/253 (44.66%), Query Frame = 1
Query: 1540 KFIVKQINLGNHGEIRMKEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYYQSNPQK---FLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEPKQAVEE-----------FSMDMQHPNWINWSSD---CQMLVTEMLQNDPSDRFNALQVLCHPWLTQSENREMIQEDLFREM 2244
            K I K   +G    +R + A       H N+++  E   S     +V+E    G+L D         E+    MV D+   L YLH   I+HR ++P+N+  Q N        + ++G A ++    I+    T T ++APE+  +  Y  +VD+W+ GVIT  ++C  + P +++E               +   P W + S      + LV+ +L  D + R+ A Q L HPW+  S+       DL RE+
Sbjct:  400 KIIDKAKLVGREEMLRSEVALTTRLGQHPNVVRLVEAMESPSDAYLVLERVRGGDLFDAITESVRFTERHAAAMVADLCRALQYLHANNIVHRDVKPENLLVQRNADGGTTLKLADLGLA-MEVTGPIYTVCGTPT-YVAPEILAETGYGLEVDMWAAGVITYILLCG-FPPFRSLERDQEELFEIIQLGEYEFLSPYWDHISDGHEAAKDLVSRLLVVDTARRYTARQALHHPWV--SDGGAGDHTDLHREV 647          

HSP 2 Score: 53.5286 bits (127), Expect = 1.421e-7
Identity = 51/227 (22.47%), Postives = 96/227 (42.29%), Query Frame = 1
Query:   55 RSKIIKLLINGNDQYKGKIISITKNRFVNFNEFLDQLTLYFKSFLPNGIRRVYR-YGNFQMVHRLEELENYGCYICCSHERLKKMAYDSNFIDKAIFSQTEKRNFFNNKIERNSLINSIVPNYKIFREIEESREMNQRKIKENISPKLIKIV-----FSDKPQDIFKIFINRNLEISLNECLWKISNNLNRKTHKHDKI-KIFTVSGREITNMPDLYINRSPILAFT 714
            R K+++   NG+  ++ + + IT +R+V++ E L  L+      LP G+RR+Y   G   +   ++ L +   Y+C S E  + +                 ++F  NK  + S  N+      I   +++    N  +  EN  P   K++         P+    + +NR    S  E L  IS  L     + + + +++T+ GRE  ++ D +      LA T
Sbjct:    2 RPKVVRFYRNGDRYFRARTLHITPHRYVSWPELLADLSRAVP--LPYGVRRLYTPLGGSPVAGSVDALRDGEAYVCASFEPFRSV-----------------KDFSRNKQPQLSY-NATCGASTIC--LDKGVRQNFLRRPENYVPARPKVITVVRVGGRGPRRRITLLLNRRAAQSFEELLGDISEALGLPRWRTNHVRRLYTLRGREARSVSDFFRGDDVFLAAT 206          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: CMK2 (Calmodulin-dependent protein kinase; may play a role in stress response, many CA++/calmodulan dependent phosphorylation substrates demonstrated in vitro, amino acid sequence similar to mammalian Cam Kinase II; CMK2 has a paralog, CMK1, that arose from the whole genome duplication [Source:SGD;Acc:S000005376])

HSP 1 Score: 106.301 bits (264), Expect = 8.827e-25
Identity = 70/243 (28.81%), Postives = 127/243 (52.26%), Query Frame = 1
Query: 1519 TNDFKQNKFIVKQINLGNHGEIRM--KEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYY--QSNPQKFLIGNMGQA-ELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEP--KQAVEEF---------SMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLT 2196
            TN+    K ++K+   GN+ +++M  +E  IL    H NI+   + + S+ K  IV +    G L D+ LS+ +  E D ++++  +   + Y+H+  ++HR ++P+N+ Y  +S     +I + G A +LK E  +  +      ++APE+  Q  + +  DIWS+GVIT  ++C  Y P   ++VE F          +    P W N S D +  + + L+ +P+DR  A ++L  PW+T
Sbjct:   69 TNEDVAIKILLKKALQGNNVQLQMLYEELSILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIIVQILGAVEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGEEDLIYKAAGSLGYVAPEVLTQDGHGKPCDIWSIGVITYTLLCG-YSPFIAESVEGFMEECTASRYPVTFHMPYWDNISIDVKRFILKALRLNPADRPTATELLDDPWIT 310          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: CMK1 (Calmodulin-dependent protein kinase; may play a role in stress response, many Ca++/calmodulin dependent phosphorylation substrates demonstrated in vitro, amino acid sequence similar to mammalian Cam Kinase II; CMK1 has a paralog, CMK2, that arose from the whole genome duplication [Source:SGD;Acc:S000001910])

HSP 1 Score: 97.4413 bits (241), Expect = 7.100e-22
Identity = 63/239 (26.36%), Postives = 121/239 (50.63%), Query Frame = 1
Query: 1540 KFIVKQINLGNHGEIRM--KEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYY--QSNPQKFLIGNMGQAE-LKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEPKQA-----------VEEFSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLTQSE 2205
            K ++K+   GN  ++     E  IL    H NI+   + + S+ K  I+ +    G L D+ L K +  E+D ++++ ++ S + Y+H+  I+HR ++P+N+ Y  +S+    ++ + G A+ LK++  +  +      ++APE+  Q  + +  DIWS+GVIT  ++C  Y   +A             E+ +    P W + S+  +  + + L  DPS R  A ++L  PW+  +E
Sbjct:   66 KILIKKALKGNKVQLEALYDELDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEEDAVRILVEILSAVKYMHSQNIVHRDLKPENLLYIDKSDESPLVVADFGIAKRLKSDEELLYKPAGSLGYVAPEVLTQDGHGKPCDIWSIGVITYTLLCG-YSAFRAERVQDFLDECTTGEYPVKFHRPYWDSVSNKAKQFILKALNLDPSKRPTAAELLEDPWIICTE 303          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: HSL1 (Nim1p-related protein kinase; septin-binding kinase that localizes to the bud neck septin ring and regulates the morphogenesis checkpoint; phosphorylates Hsl7p and cooperates with Elm1p to recruit Hsl7p to the mother-bud neck, as a prerequisite for the subsequent recruitment, phosphorylation, and degradation of Swe1p; autophosphorylation enhances interactions with Hsl7p [Source:SGD;Acc:S000001584])

HSP 1 Score: 85.8853 bits (211), Expect = 1.349e-17
Identity = 55/209 (26.32%), Postives = 107/209 (51.20%), Query Frame = 1
Query: 1591 KEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNLDKYL-SKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYYQSNPQKFLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEY-NEKVDIWSLGVI-----TGNIVCNKYEPKQAVEEF-SMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWL 2193
            +E  I+    H N++  FEV+ ++ ++ +V+EY   G L  YL SK ++ E++ +   + +  G+ Y H+  I HR ++P+N+      ++  I + G A L+  N +   +     + +PE+   + Y     D+WS G++     TG++  N    K+ + +  S   Q P+  N SS+ + L++++L  DP  R    ++L HP +
Sbjct:  163 REIVIMKLISHTNVMALFEVWENKSELYLVLEYVDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNRRIKIADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPS--NLSSEARDLISKILVIDPEKRITTQEILKHPLI 369          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: DUN1 (Cell-cycle checkpoint S/T protein kinase; required for transient G2/M arrest after DNA damage, damage-induced transcription, and nuclear-to-cytoplasmic redistribution of Rnr2p-Rnr4p after genotoxic stress and iron deprivation; phosphorylates repair protein Rad55p, transcriptional repressor Sml1p, superoxide dismutase, and ribonucleotide reductase inhibitors Crt1p and Dif1p; functions in the Mec1p pathway to regulate dNTP pools and telomere length; postreplicative repair role [Source:SGD;Acc:S000002259])

HSP 1 Score: 84.3445 bits (207), Expect = 1.670e-17
Identity = 65/250 (26.00%), Postives = 112/250 (44.80%), Query Frame = 1
Query: 1591 KEAQILMSCDHRNIIQCFEVY-----RSEIKVEIVMEYFPEGNLDKYLSKKEIYEKDIMK-MVQDVGSGLLYLHTVGIIHRYIQPKNIYY----QSNPQKFLIGNMGQAELK-------------TENLIFIENWTQT-QFMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEP----------KQAVEEFSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLTQSENREMIQEDLFR 2238
            +E  ILM   H NI+   + +     +S+I+  +V+E   +G L + + +K    +D  K + + + +GL YLH   IIHR I+P+NI      + NP +  +G   + E+              T  + F      T  ++APE+  +K Y  KVD+WS GVI    +C  + P          K+ + +       P W         L++ +L  +P +R+N  + L HPW    + +  +  +L R
Sbjct:  247 EETNILMRVQHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLRQDESKALFKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENPSQVQLGPWDEDEIDIQVKIADFGLAKFTGEMQFTNTLCGTPSYVAPEVLTKKGYTSKVDLWSAGVILYVCLCG-FPPFSDQLGPPSLKEQILQAKYAFYSPYWDKIDDSVLHLISNLLVLNPDERYNIDEALNHPWFNDIQQQSSVSLELQR 495          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: IPL1 (Aurora kinase of chromosomal passenger complex; mediates release of mono-oriented kinetochores from microtubules in meiosis I, and kinetochore release from SPB clusters at meiotic exit; helps maintain condensed chromosomes during anaphase; required for SPB cohesion and prevention of multipolar spindle formation; promotes telomerase release at G2/M; Iocalizes to nuclear foci that diffuse upon DNA replication stress; required for inhibition of karyopherin Pse1p upon SAC arrest [Source:SGD;Acc:S000006130])

HSP 1 Score: 81.6481 bits (200), Expect = 4.439e-17
Identity = 59/221 (26.70%), Postives = 109/221 (49.32%), Query Frame = 1
Query: 1591 KEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNLDKYLSKKEIYEKDIMK--MVQDVGSGLLYLHTVGIIHRYIQPKNIYYQSNPQKFLIGNMGQAELKTENLIFI---ENWTQT-----QFMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEPKQAVEE------FSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLTQSE 2205
            +E +I  S +H N+ + +  +  E +V ++MEY   G + K L     +  DI+    +  + + L Y+H   IIHR I+P+NI         LIG     +L       I   EN  +T      +++PE+   +EY+  +D W+LGV+   ++      ++ +++       ++D++ P+  N S D Q L+ ++L+ DP DR     V  HPW+ +++
Sbjct:  151 REVEIQTSLNHPNLTKSYGYFHDEKRVYLLMEYLVNGEMYKLLRLHGPFN-DILASDYIYQIANALDYMHKKNIIHRDIKPENI---------LIGFNNVIKLTDFGWSIINPPENRRKTVCGTIDYLSPEMVESREYDHTIDAWALGVLAFELLTGAPPFEEEMKDTTYKRIAALDIKMPS--NISQDAQDLILKLLKYDPKDRMRLGDVKMHPWILRNK 359          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO36253 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ85])

HSP 1 Score: 107.457 bits (267), Expect = 1.500e-25
Identity = 77/286 (26.92%), Postives = 134/286 (46.85%), Query Frame = 1
Query: 1456 LTEKYQLINILSKSSRSIVYLTNDFKQNK-FIVKQIN---LGNHGEIRMKEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYYQSNPQ--KFLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNK---YEPKQA-----VEEFSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLTQSENREMIQEDLFREMESFTRQQI 2268
            +T+KY L  +L   + S V L  +      F VK I+   L    E    E  IL    H+NII   +++ ++  + +VM+    G L D+ + K    E+D   +VQ +     YLH++GI+HR ++P+N+ Y S  +  K +I + G ++++ +            ++APE+  Q+ Y + VD WS+GVIT  ++C     Y+   A     +     +   P W   S   +  +  +++ DP  R+   Q L HPW+   E        L R++ +   +QI
Sbjct:   13 ITKKYDLREVLGTGAFSEVVLAEEKATGSLFAVKCISKKELKGKEESVENEIAILKKVRHKNIIGLKDIFDNKSHLYLVMDLVQGGELFDRIVEKGNYTEQDASALVQQILEAADYLHSLGIVHRDLKPENLLYYSPDEDSKIMISDFGLSKIEAQGSFMDTACGTPGYVAPEVLKQQPYGKAVDCWSIGVITYILLCGYPPFYDDSDANLFAQIMRAEYEFDSPYWDEISESAKDFIRHLMELDPKLRYTCRQALSHPWICGGEA-------LTRDIHASVSEQI 291          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO35611 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL08])

HSP 1 Score: 105.531 bits (262), Expect = 2.041e-24
Identity = 72/278 (25.90%), Postives = 136/278 (48.92%), Query Frame = 1
Query: 1417 NKNEKSFSKDSIFLTEKYQLINILSKSSRSIVYLTNDFK-QNKFIVKQINLGNHGEIRMKEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNI--YYQSNPQKFLIGNMGQAELK--TENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVC----------NKYEPKQAVEEFSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLTQS 2202
             K EK  ++  I +T++Y++  ++ + S S V     ++ +  + +K + +    +    E  +L    H  +++ +EV+    +V +VME    G L D+ LSK    E+D  +++  V  G+ YLH++GI HR ++P+N+  Y+  N  K +I + G + L+   ++           +MAPE+   K Y   VDIWS+GVIT N++           ++   K    +FS   +   W + +   +  + +++  +P  R  A Q + HPW+  S
Sbjct:   53 TKGEKYKARFDIRVTKEYEIKALIGRGSFSRVVRVEHYQTKQPYAIKMMEIEQGKDEFQSELAVLRRVKHEFVVRLYEVFECRNRVYLVMELATGGVLLDRILSKGFFTERDATRVIYMVLEGVRYLHSLGITHRDLKPENLLYYHPGNDSKIMITDFGLSNLRKHPDDRTMETTCGTPGYMAPEVLLSKPYTNSVDIWSIGVITFNVLSGQMPFADDHRSRLYKKILRGKFSFSGE--PWDDVTDMAKDFINKLIVYEPEMRLTAEQGIKHPWIASS 328          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO44488 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVP7])

HSP 1 Score: 95.1301 bits (235), Expect = 8.099e-22
Identity = 65/213 (30.52%), Postives = 114/213 (53.52%), Query Frame = 1
Query: 1594 EAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNLDKYLSKKEIY-EKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYYQSNP---QKFLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEPKQAVEE---FSMDMQ------HPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWL 2193
            E  IL    H +I++  E Y +  ++ +VME    G+L + + +   Y E     MV+D+ S L YLH   I+HR I+P+N+   + P   +   + + G A ++ ++ +F+   T T ++APE+  +  Y  KVDIW+ GVI+  ++C  + P ++ ++   F + +        P W + SS  + L+  ML  D + R++A QVL HPW+
Sbjct:   47 EISILRRVKHNHIVELIEEYETPREIFLVMELVKGGDLFEAIVEATKYTEVHASHMVRDLASALDYLHCNSIVHRDIKPENLLVLNLPNGRKSLKLADFGLA-MEVKSPMFLVCGTPT-YVAPEILDESGYGLKVDIWAAGVISYILLCG-FPPFRSPDQDELFDLILAGEFEYLSPFWNDISSSAKDLIDHMLVVDANQRYSAKQVLAHPWV 256          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO42432 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1C2])

HSP 1 Score: 98.9821 bits (245), Expect = 1.024e-21
Identity = 78/264 (29.55%), Postives = 130/264 (49.24%), Query Frame = 1
Query: 1456 LTEKYQLINILSKSSRSIVYLTND-FKQNKFIVKQINLGN-HGEIRM--KEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNLDKYLSKKEIYEKDIMK-MVQDVGSGLLYLHTVGIIHRYIQPKN--IYYQSNPQKFL-IGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEPKQA-----------VEEFSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPW 2190
            +T+ Y     L   + +IV    D   Q +F +K I+     G+ +M   E  I+  C H NI++ FE Y S  ++ +VME    G+L   +S    + + + K   +D+   L YLH   I+HR ++P+N  ++ +S+ Q  L + + G A ++    IF    T T ++APE+  +  Y  KVD+W+ GVIT  ++C  + P ++           ++    +   P W   S D + L++ ML  DP+ R  A QVL H W
Sbjct:  242 VTDVYNFGQKLGDGNFAIVRQCKDKITQKEFAIKIIDKRKIRGKEKMIDDEIAIMRRCRHPNIVRLFEDYDSATEIYLVMELIKGGDLFDAISSSVKFTEHVAKSYFRDMCKALAYLHKRKIVHRDLKPENLLVHKRSDGQTHLKLADFGLA-MEVTAPIFTVCGTPT-YVAPEILEENGYGLKVDMWAAGVITYIMLCG-FPPFRSPNRDQDELFDLIQSGEFEFLSPYWDPVSDDAKDLISTMLVVDPTKRATADQVLQHRW 502          

HSP 2 Score: 49.2914 bits (116), Expect = 4.711e-6
Identity = 28/89 (31.46%), Postives = 50/89 (56.18%), Query Frame = 1
Query:   46 MNERSKIIKLLINGNDQYKGKIISITKNRFVNFNEFLDQLTLYFKSFLPNGIRRVYRYGNFQMVHRLEELENYGCYICCSHERLKKMAY 312
            M   SK +    NG D +    ++IT  ++ +F+  L +L++  K+ LP G+R +    N   V  +E+L++   Y+C S+ RLK++AY
Sbjct:    1 MKTTSKTVIFYKNG-DVFSKYPVTITPRKYRSFDILLAELSM--KTELPQGVRYLLDKENGAQVKNIEDLQDGKEYVCASNARLKRLAY 86          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO42276 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1X1])

HSP 1 Score: 95.5153 bits (236), Expect = 2.129e-21
Identity = 72/281 (25.62%), Postives = 130/281 (46.26%), Query Frame = 1
Query: 1468 YQLINILSKSSRSIVYLTNDFKQNK-FIVKQINLGNHGEIRMKEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYY----QSNPQKFLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEPK---------QAVEEFSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLTQSENREMIQEDLFREMESFTRQQ 2265
            Y +   L + + S+V L      NK F VK +      +I   E  IL   +H NII   E++ +   + +V+E    G L D+ + K    EKD    ++ +   + +LH   I+HR ++P+N+ Y    + +P K  I + G +++  + ++         + APE+   + Y+  VD+W++GVI   ++C  +EP          Q + +   D   P W + SS  + LV  ++  D + R  A Q L HPW+     R    E   ++++ F  ++
Sbjct:   18 YDIGKELGRGASSVVKLCRQKGTNKEFAVKIMKKTVDKKIIQTETGILFRINHPNIIHMKELFETHTHLFMVLELVTGGELFDRVVEKGYYCEKDAADAIKMILEAVGHLHKNDIVHRDLKPENLLYANEREDSPLK--IADFGLSKILPQEVMTSTVCGTPGYCAPEVLKGESYDTGVDMWAIGVIAYILLCG-FEPFYDETDQQMFQRILKCDYDFVSPWWDDVSSGAKDLVKRLITGDKNKRLTAKQALDHPWVKGENARREDMERTRKKLKEFNAKR 295          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: camk1gb (calcium/calmodulin-dependent protein kinase type 1D [Source:NCBI gene;Acc:101164726])

HSP 1 Score: 113.235 bits (282), Expect = 3.063e-26
Identity = 78/266 (29.32%), Postives = 131/266 (49.25%), Query Frame = 1
Query: 1456 LTEKYQLINILSKSSRSIVYLTNDFKQNK-FIVKQINLGNHGEIRMK-EAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYY--QSNPQKFLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEP---KQAVEEFSMDMQ------HPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLTQSENR 2211
            + E + L+  L   + S V++  + K  K F +K I      +I ++ E  +L    H N++   ++Y S     ++M+    G L D+ L +    EKD  +++Q V   + YLH  GI+HR ++P+NI Y  Q    K +I + G +++ T+  I         ++APE+  QK Y++ VD WS+GVIT  ++C  Y P   +   + FS  M+       P W + S   +  +  M+Q  PS R++  Q L HPW+     R
Sbjct:   17 IQEIFDLMEELGSGAFSEVFMVRERKTGKKFAMKCIKKKKKRDINLENEMAVLRRIKHENVVGLEDIYESRTHYYLIMQLVSGGELFDRILDRGMYTEKDASRVIQQVLQAVSYLHQNGIVHRDLKPENILYYSQDEDSKIMISDFGLSKM-TDTGIMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVITYILLCG-YPPFYEESETKLFSKIMKAQYEFDSPFWDDISESAKDFIRNMMQKTPSMRYSTEQALRHPWIIGKTAR 280          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: camk1b (calcium/calmodulin-dependent protein kinase type 1 [Source:NCBI gene;Acc:101170017])

HSP 1 Score: 108.612 bits (270), Expect = 6.941e-25
Identity = 76/293 (25.94%), Postives = 140/293 (47.78%), Query Frame = 1
Query: 1387 DSGLLSVRSNNKN------EKSFSKDSIFLTEKYQLINILSKSSRSIVYLTNDFKQNKFIV-----KQINLGNHGEIRMKEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYYQS--NPQKFLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEP---------KQAVEEFSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLT 2196
            +S ++S R NNKN        S+ K +  + E+Y    IL   + S V L  + + +K +      K+   G    I   E  +L    H NI+   +++ S+  + ++M+    G L D+ + K    EKD  K++Q +   + YLH +GI+HR ++P+N+ Y S     K +I + G ++++    +         ++APE+  QK Y++ VD WS+GVI+  ++C  Y P          + + +   +   P W + S   +  +  +++ D + R+   Q L HPW+ 
Sbjct:    7 ESSIVSDR-NNKNMPLGEDSHSWKKRTTDVKEQYDFKEILGTGAFSEVVLAEEKRTHKLVAIKCIPKKALEGKENSIE-NEIAVLHKIKHPNIVSLEDIFESKSHLYLIMQLVSGGELFDRIIEKGFYTEKDASKLIQQILDAVKYLHDMGIVHRDLKPENLLYYSMDEDSKIMISDFGLSKIEGSGSVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVISYILLCG-YPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIVHLMEKDSNTRYTCDQALLHPWIA 296          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: camk1b (calcium/calmodulin-dependent protein kinase type 1 [Source:NCBI gene;Acc:101170017])

HSP 1 Score: 108.227 bits (269), Expect = 8.638e-25
Identity = 73/284 (25.70%), Postives = 134/284 (47.18%), Query Frame = 1
Query: 1414 NNKN------EKSFSKDSIFLTEKYQLINILSKSSRSIVYLTNDFKQNKFIV-----KQINLGNHGEIRMKEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYYQS--NPQKFLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEP---------KQAVEEFSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLT 2196
            NNKN        S+ K +  + E+Y    IL   + S V L  + + +K +      K+   G    I   E  +L    H NI+   +++ S+  + ++M+    G L D+ + K    EKD  K++Q +   + YLH +GI+HR ++P+N+ Y S     K +I + G ++++    +         ++APE+  QK Y++ VD WS+GVI+  ++C  Y P          + + +   +   P W + S   +  +  +++ D + R+   Q L HPW+ 
Sbjct:   10 NNKNMPLGEDSHSWKKRTTDVKEQYDFKEILGTGAFSEVVLAEEKRTHKLVAIKCIPKKALEGKENSIE-NEIAVLHKIKHPNIVSLEDIFESKSHLYLIMQLVSGGELFDRIIEKGFYTEKDASKLIQQILDAVKYLHDMGIVHRDLKPENLLYYSMDEDSKIMISDFGLSKIEGSGSVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVISYILLCG-YPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIVHLMEKDSNTRYTCDQALLHPWIA 291          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000003850.2 (serine/threonine-protein kinase DCLK2 [Source:NCBI gene;Acc:101173659])

HSP 1 Score: 110.923 bits (276), Expect = 1.170e-24
Identity = 69/221 (31.22%), Postives = 111/221 (50.23%), Query Frame = 1
Query: 1594 EAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIY---YQSNPQKFLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCN--KYEPKQAVEE--------FSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLTQSENRE 2214
            E  +L    H +IIQ  EV  +  ++ +VME    G+L D   S  +  E+D   MV ++   + YLH + I+HR I+P+N+    Y    +   +G+ G A +  E  +F    T T ++APE+  +  Y  KVDIW+ GVI   ++C    +  +  V+E          ++   P+W   S   +ML+++MLQ +   RF A +VL HPW+T     E
Sbjct:  474 EVAVLRRVRHPSIIQLIEVDETPSQLFLVMELVKGGDLFDAITSSTKYSERDASAMVYNLAGAVKYLHRMNIVHRDIKPENLLVCEYPDGTKSLKLGDFGLATV-VEGPLFTVCGTPT-YVAPEIIAETGYGLKVDIWAAGVIAYILLCGFPPFRSENNVQEELFDQILRGKLEFPSPDWDTISLPAKMLISQMLQVNVDARFTAEEVLSHPWVTDEAPPE 692          

HSP 2 Score: 71.633 bits (174), Expect = 2.053e-12
Identity = 53/241 (21.99%), Postives = 114/241 (47.30%), Query Frame = 1
Query:   34 QTHKMNERSKIIKLLINGNDQYKGKIISITKNRFVNFNEFLDQLTLYFKS--FLPNGIRRVYRYGNFQMVHRLEELENYGCYICCSHERLKKMAYDSNFID--KAIFSQTEKRNFFNNKIERNSLINSIVPNYKIFREIEESREMNQRKIKENISPKLIKIVFSD-KPQDIFKIFINRNLEISLNECLWKISNNLNRKTHKHDKIKIFTVSGREITNMPDLYINRSPILAFTNSMMMYPQD 741
            Q      R+K ++   NG+  +KG + +++ +RF +++  L +LT        LP G+R +Y     + +  ++EL    CY+C S++  +K+ Y    +   K   S     +  +     ++ +++   +    +E  +SRE   R+ K+ I PKL+ ++ S  KP+   ++ +N+    S ++ L  I+  +  K       +++T+ G+++T + D + +    +A       Y QD
Sbjct:   66 QALTSERRAKKVRFYRNGDRYFKGLVYAVSSDRFRSYDALLMELTRSLADNLHLPQGVRSIYTIDGSKKITSMDELVEGECYVCASNQPFRKVDYTKISVPSWKPGASAGSGSSSSSRTTTASTGVSTSTAS-TASKERSDSRE--SRESKDFIKPKLVTVIRSGVKPRKAVRVLLNKKTAHSFDQVLADITEAI--KLDSGAVKRLYTLDGKQLTCLQDFFGDDDVFMACGPEKFRYAQD 301          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000031333.1 (serine/threonine-protein kinase DCLK2 [Source:NCBI gene;Acc:101173659])

HSP 1 Score: 110.923 bits (276), Expect = 1.170e-24
Identity = 69/221 (31.22%), Postives = 111/221 (50.23%), Query Frame = 1
Query: 1594 EAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIY---YQSNPQKFLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCN--KYEPKQAVEE--------FSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLTQSENRE 2214
            E  +L    H +IIQ  EV  +  ++ +VME    G+L D   S  +  E+D   MV ++   + YLH + I+HR I+P+N+    Y    +   +G+ G A +  E  +F    T T ++APE+  +  Y  KVDIW+ GVI   ++C    +  +  V+E          ++   P+W   S   +ML+++MLQ +   RF A +VL HPW+T     E
Sbjct:  474 EVAVLRRVRHPSIIQLIEVDETPSQLFLVMELVKGGDLFDAITSSTKYSERDASAMVYNLAGAVKYLHRMNIVHRDIKPENLLVCEYPDGTKSLKLGDFGLATV-VEGPLFTVCGTPT-YVAPEIIAETGYGLKVDIWAAGVIAYILLCGFPPFRSENNVQEELFDQILRGKLEFPSPDWDTISLPAKMLISQMLQVNVDARFTAEEVLSHPWVTDEAPPE 692          

HSP 2 Score: 71.633 bits (174), Expect = 2.053e-12
Identity = 53/241 (21.99%), Postives = 114/241 (47.30%), Query Frame = 1
Query:   34 QTHKMNERSKIIKLLINGNDQYKGKIISITKNRFVNFNEFLDQLTLYFKS--FLPNGIRRVYRYGNFQMVHRLEELENYGCYICCSHERLKKMAYDSNFID--KAIFSQTEKRNFFNNKIERNSLINSIVPNYKIFREIEESREMNQRKIKENISPKLIKIVFSD-KPQDIFKIFINRNLEISLNECLWKISNNLNRKTHKHDKIKIFTVSGREITNMPDLYINRSPILAFTNSMMMYPQD 741
            Q      R+K ++   NG+  +KG + +++ +RF +++  L +LT        LP G+R +Y     + +  ++EL    CY+C S++  +K+ Y    +   K   S     +  +     ++ +++   +    +E  +SRE   R+ K+ I PKL+ ++ S  KP+   ++ +N+    S ++ L  I+  +  K       +++T+ G+++T + D + +    +A       Y QD
Sbjct:   66 QALTSERRAKKVRFYRNGDRYFKGLVYAVSSDRFRSYDALLMELTRSLADNLHLPQGVRSIYTIDGSKKITSMDELVEGECYVCASNQPFRKVDYTKISVPSWKPGASAGSGSSSSSRTTTASTGVSTSTAS-TASKERSDSRE--SRESKDFIKPKLVTVIRSGVKPRKAVRVLLNKKTAHSFDQVLADITEAI--KLDSGAVKRLYTLDGKQLTCLQDFFGDDDVFMACGPEKFRYAQD 301          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000063586.1 (SMESG000063586.1)

HSP 1 Score: 1529.23 bits (3958), Expect = 0.000e+0
Identity = 745/746 (99.87%), Postives = 745/746 (99.87%), Query Frame = 1
Query:   46 MNERSKIIKLLINGNDQYKGKIISITKNRFVNFNEFLDQLTLYFKSFLPNGIRRVYRYGNFQMVHRLEELENYGCYICCSHERLKKMAYDSNFIDKAIFSQTEKRNFFNNKIERNSLINSIVPNYKIFREIEESREMNQRKIKENISPKLIKIVFSDKPQDIFKIFINRNLEISLNECLWKISNNLNRKTHKHDKIKIFTVSGREITNMPDLYINRSPILAFTNSMMMYPQDVKAMITSLFPVRHRAERYFAKWLIEEGSENSSVHSIRLKXXXXXXXETIHSKVLSARYLTNRENKIINQINDRKLEMEKLESGRSKDHHQDYADKIQGKDSIKENQTKENLKGVDKCTNMTPRFDHLDKGIQVFSDVRHFWKITEVRPNIAHSMKMTDVSHNSKHSDKVTQFLPRINHFHKGMDIMPNLLHSLTEFHGRLEANTNTKDKAIQCTFDSGLLSVRSNNKNEKSFSKDSIFLTEKYQLINILSKSSRSIVYLTNDFKQNKFIVKQINLGNHGEIRMKEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNLDKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYYQSNPQKFLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEPKQAVEEFSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLTQSENREMIQEDLFREMESFTRQQIDTTIV 2283
            MNERSKIIKLLINGNDQYKGKIISITKNRFVNFNEFLDQLTLYFKSFLPNGIRRVYRYGNFQMVHRLEELENYGCYICCSHERLKKMAYDSNFIDKAIFSQTEKRNFFNNKIERNSLINSIVPNYKIFREIEESREMNQRKIKENISPKLIKIVFSDKPQDIFKIFINRNLEISLNECLWKISNNLNRKTHKHDKIKIFTVSGREITNMPDLYINRSPILAFTNSMMMYPQDVKAMITSLFPVRHRAERYFAKWLIEEGSENSSVHSIRLKSSTSSTSETIHSKVLSARYLTNRENKIINQINDRKLEMEKLESGRSKDHHQDYADKIQGKDSIKENQTKENLKGVDKCTNMTPRFDHLDKGIQVFSDVRHFWKITEVRPNIAHSMKMTDVSHNSKHSDKVTQFLPRINHFHKGMDIMPNLLHSLTEFHGRLEANTNTKDKAIQCTFDSGLLSVRSNNKNEKSFSKDSIFLTEKYQLINILSKSSRSIVYLTNDFKQNKFIVKQINLGNHGEIRMKEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNLDKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYYQSNPQKFLIGNMGQAELKTENLIFIENWTQTQFMAPELTY KEYNEKVDIWSLGVITGNIVCNKYEPKQAVEEFSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLTQSENREMIQEDLFREMESFTRQQIDTTIV
Sbjct:    1 MNERSKIIKLLINGNDQYKGKIISITKNRFVNFNEFLDQLTLYFKSFLPNGIRRVYRYGNFQMVHRLEELENYGCYICCSHERLKKMAYDSNFIDKAIFSQTEKRNFFNNKIERNSLINSIVPNYKIFREIEESREMNQRKIKENISPKLIKIVFSDKPQDIFKIFINRNLEISLNECLWKISNNLNRKTHKHDKIKIFTVSGREITNMPDLYINRSPILAFTNSMMMYPQDVKAMITSLFPVRHRAERYFAKWLIEEGSENSSVHSIRLKSSTSSTSETIHSKVLSARYLTNRENKIINQINDRKLEMEKLESGRSKDHHQDYADKIQGKDSIKENQTKENLKGVDKCTNMTPRFDHLDKGIQVFSDVRHFWKITEVRPNIAHSMKMTDVSHNSKHSDKVTQFLPRINHFHKGMDIMPNLLHSLTEFHGRLEANTNTKDKAIQCTFDSGLLSVRSNNKNEKSFSKDSIFLTEKYQLINILSKSSRSIVYLTNDFKQNKFIVKQINLGNHGEIRMKEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNLDKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYYQSNPQKFLIGNMGQAELKTENLIFIENWTQTQFMAPELTYHKEYNEKVDIWSLGVITGNIVCNKYEPKQAVEEFSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLTQSENREMIQEDLFREMESFTRQQIDTTIV 746          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000042100.1 (SMESG000042100.1)

HSP 1 Score: 112.464 bits (280), Expect = 1.389e-26
Identity = 84/302 (27.81%), Postives = 152/302 (50.33%), Query Frame = 1
Query: 1426 EKSFSKDSI---FLTEKYQLINILSKSSRSIVYLTNDFKQN-KFIVKQINLGNHGEIRMKEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYYQSNPQKFL-IGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEPKQAVEEFSM---------DMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLTQSENREMIQEDLFREMESF--TRQQIDTTI 2280
            E+ + KDSI      + Y+++N +   S   VY     + + KF  K I+   + ++   E  +L+   H NII+ +EVY S   V +V+EY   G L D+ +S+    EKD  + V+++   + YLH   IIHR ++P+N+ Y+S  +  L + + G A++  +++  +       + APE+     Y + VD+WS+GVIT  ++C  YEP    ++  M             P W N S + + +++++L  DP  R  A Q L H W+     +    E+   +++ F  +R+++  +I
Sbjct:    2 EEYWIKDSIKNEPFEKYYEILNKIGNGSTCTVYCCVRKRTDIKFAAKVISKKVNKKLIKSEVGVLLKLTHPNIIRLYEVYESATDVHMVLEYVSGGELFDRIVSRGFYSEKDASRCVREMLQAVSYLHENDIIHRDLKPENLLYESQEESNLKLADFGIAKILEDDVHTMTVCGTPGYCAPEILLGVSYGKPVDLWSIGVITYILLCG-YEPFYNEKDNQMFKNIIKGIYSFSSPWWDNVSLNAKDIISKLLVVDPHKRLTANQALNHVWVKGEGAKTSSLEETQNKLKEFNSSRRKLKASI 302          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000072629.1 (SMESG000072629.1)

HSP 1 Score: 104.76 bits (260), Expect = 1.062e-22
Identity = 68/229 (29.69%), Postives = 120/229 (52.40%), Query Frame = 1
Query: 1546 IVKQINLGNHGEIRMKEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIY--YQSNPQKFLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVC----------NKYEPKQAVEEFSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWL 2193
            I+ +  L +  ++  +E +IL SC+H NI++  E + +  KV +V EY  EG+L D      +  E     M++D+   LLY+H+ GI+HR I+P+N+    ++      + + G A ++ +  +++   T T ++APE+  ++ Y  +VDIW+ GVI   ++C          N+ E  + ++    +   P W   S + + L+  ML  DP  RF  L  LCHPW+
Sbjct:  784 IIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLCSIKNGLINLKLSDFGLA-VEIKEPLYVICGTPT-YVAPEILSEQGYGIEVDIWASGVICYILLCGFPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWI 1010          

HSP 2 Score: 93.2041 bits (230), Expect = 3.599e-19
Identity = 73/291 (25.09%), Postives = 133/291 (45.70%), Query Frame = 1
Query:    4 NFKHIT*NRHQTHKMNERSKIIKLLINGNDQYKGKIISITKNRFVNFNEFLDQLTLYFKSFLPNGIRRVYRYGNFQMVHRLEELENYGCYICCSHERLKKMAYDSNFIDKAIFSQTEKRN-----FFNNKIERNSLINSIVPNYKIF------------------REIEESREMN---QRKIKENIS-------PKLIKIVFSD-KPQDIFKIFINRNLEISLNECLWKISNNLNRKTHKHDKIKIFTVSGREITNMPDLYINRSPILAFTN-SMMMYPQDVKAMITSLFP 771
            +F+ IT + +Q  +   + K +  ++NGN  + GK++SIT NR+   N+ LD LT YF +F+P G+RR+Y    +Q V  +++LE+   YICC  E LK   YD+ + +          N     ++N +   ++  ++I P   +F                   +      MN   +R  K  I+       P+++ I+ +  KP   FKI +N+    S  + L  IS+            +I+ + G+EI    D + +    +A  +    +  ++V+ ++  LFP
Sbjct:   12 SFRDITDDYYQELR---KPKRVLFIVNGNRTFSGKLLSITPNRYFILNDLLDDLTKYFSNFIPTGVRRIYDRNGWQ-VQDIDDLEHRNIYICCGQESLKTYDYDTKYFELLHKGHLHNHNSHIKFYYNPQEYFDNADSTISPQTPLFYRGNRLYPISSTPNTSSSNKPSPRSPMNRLEERTYKPPIAETNMKSKPRILTIIRTGIKPYSFFKILLNKTSSQSYEDLLSDISDAFGSNWKGKSIQRIYNIDGKEIQQTSDFFRSGKYFVAIGDKDPNLNQEEVRNIVAELFP 298          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000072629.1 (SMESG000072629.1)

HSP 1 Score: 104.375 bits (259), Expect = 1.300e-22
Identity = 70/230 (30.43%), Postives = 121/230 (52.61%), Query Frame = 1
Query: 1546 IVKQINLGNHGEIRMKEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIY--YQSNPQKFLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIWSLGVITGNIVCNKYEPKQAVE-------EF----SMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWL 2193
            I+ +  L +  ++  +E +IL SC+H NI++  E + +  KV +V EY  EG+L D      +  E     M++D+   LLY+H+ GI+HR I+P+N+    ++      + + G A ++ +  +++   T T ++APE+  ++ Y  +VDIW+ GVI   ++C  + P ++ E       EF      +   P W   S + + L+  ML  DP  RF  L  LCHPW+
Sbjct:  686 IIDKKRLKDKEDLIEEEIRILKSCEHPNIVKLEEQFETPNKVFLVQEYIKEGDLFDAICENIKFPESQSAVMMRDIFRALLYIHSKGIVHRDIKPENLLCSIKNGLINLKLSDFGLA-VEIKEPLYVICGTPT-YVAPEILSEQGYGIEVDIWASGVICYILLCG-FPPFRSPERNQTELFEFIKAGEFEYIKPYWDEISPESKDLINNMLIVDPLKRFTVLDCLCHPWI 912          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000078937.1 (SMESG000078937.1)

HSP 1 Score: 98.2117 bits (243), Expect = 7.179e-22
Identity = 67/276 (24.28%), Postives = 124/276 (44.93%), Query Frame = 1
Query: 1465 KYQLINILSKSSRSIVYLTNDFKQNKFIV------KQINLGNHGEIRMK-EAQ-----------ILMSCDHRNIIQCFEVYRSEIKVEIVMEYFPEGNL-DKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYYQS--NPQKFLIGNMGQAELKTENLIFIENWTQTQFMAP---ELTYQKEYNEKVDIWSLGVITGNIVC--------NKYEPKQAVEEFSMDMQHPNWINWSSDCQMLVTEMLQNDPSDRFNALQVLCHPWLT 2196
            +YQ   +L   + S V L  D ++  F+       K I   +    + K EAQ           +L    H NI+Q  +V  S+    +VME    G L D+ + K    EKD   +++ V     Y+H  G++HR ++P+N+ Y S  +  K +I + G +++   +           ++AP   E+   + Y ++VD W++GVI   ++C        N  E  + ++E   +   P W   S   +  +  +++ +P  R++  + L HPW++
Sbjct:    9 RYQFKEVLGTGAFSEVRLAEDTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVLRKLKHENIVQLLDVLESDDTYYLVMELVTGGELFDRIVEKGSYTEKDASNLIRQVLEATDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSKMDDADSAMATACGTPGYVAPEVLEVNSGRSYGKEVDCWAVGVIAYILLCGYPPFYDENDQELFRQIKEAQYEFDSPYWDEISDSAKDFIKHLMEKNPKKRYSCKESLAHPWIS 284          
The following BLAST results are available for this feature:
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DCLK23.118e-2528.57doublecortin like kinase 2 [Source:HGNC Symbol;Acc... [more]
DCLK23.637e-2528.57doublecortin like kinase 2 [Source:HGNC Symbol;Acc... [more]
DCLK24.327e-2528.57doublecortin like kinase 2 [Source:HGNC Symbol;Acc... [more]
DCLK24.763e-2528.57doublecortin like kinase 2 [Source:HGNC Symbol;Acc... [more]
DCLK24.856e-2528.57doublecortin like kinase 2 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cmk-12.513e-2529.48Calcium/calmodulin-dependent protein kinase type 1... [more]
rskn-19.120e-2227.53Putative ribosomal protein S6 kinase alpha-1 [Sou... [more]
rskn-19.636e-2226.90Putative ribosomal protein S6 kinase alpha-1 [Sou... [more]
rskn-19.717e-2227.53Putative ribosomal protein S6 kinase alpha-1 [Sou... [more]
rskn-11.067e-2126.90Putative ribosomal protein S6 kinase alpha-1 [Sou... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CaMKI1.155e-2327.24gene:FBgn0016126 transcript:FBtr0333670[more]
CaMKI9.195e-2127.18gene:FBgn0016126 transcript:FBtr0089067[more]
CaMKI9.195e-2127.18gene:FBgn0016126 transcript:FBtr0089065[more]
CaMKI9.195e-2127.18gene:FBgn0016126 transcript:FBtr0089069[more]
S6kII2.633e-1826.70gene:FBgn0262866 transcript:FBtr0333715[more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
camk1a8.588e-2624.55calcium/calmodulin-dependent protein kinase Ia [So... [more]
camk1a1.469e-2524.55calcium/calmodulin-dependent protein kinase Ia [So... [more]
camk1a1.469e-2524.55calcium/calmodulin-dependent protein kinase Ia [So... [more]
pnck2.940e-2527.70pregnancy up-regulated nonubiquitous CaM kinase [S... [more]
camk1gb6.832e-2527.34calcium/calmodulin-dependent protein kinase IGb [S... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mlh34.433e-2428.38mutL homolog 3 [Source:Xenbase;Acc:XB-GENE-991852][more]
foxf21.398e-2326.82forkhead box F2 [Source:Xenbase;Acc:XB-GENE-484646... [more]
foxf22.157e-2326.82forkhead box F2 [Source:Xenbase;Acc:XB-GENE-484646... [more]
foxf22.223e-2326.82forkhead box F2 [Source:Xenbase;Acc:XB-GENE-484646... [more]
foxf22.612e-2326.82forkhead box F2 [Source:Xenbase;Acc:XB-GENE-484646... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pskh14.588e-2528.41protein serine kinase H1 [Source:MGI Symbol;Acc:MG... [more]
Camk12.003e-2426.15calcium/calmodulin-dependent protein kinase I [Sou... [more]
Dclk22.157e-2426.98doublecortin-like kinase 2 [Source:MGI Symbol;Acc:... [more]
Dclk22.932e-2426.98doublecortin-like kinase 2 [Source:MGI Symbol;Acc:... [more]
Dclk22.964e-2426.98doublecortin-like kinase 2 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P25323|MYLKA_DICDI1.180e-2428.72Myosin light chain kinase A OS=Dictyostelium disco... [more]
sp|Q0V7M1|KPSH1_BOVIN1.831e-2427.48Serine/threonine-protein kinase H1 OS=Bos taurus O... [more]
sp|D2I3C6|DCLK2_AILME1.942e-2428.57Serine/threonine-protein kinase DCLK2 OS=Ailuropod... [more]
sp|Q8N568|DCLK2_HUMAN2.332e-2428.57Serine/threonine-protein kinase DCLK2 OS=Homo sapi... [more]
sp|P11801|KPSH1_HUMAN2.720e-2427.48Serine/threonine-protein kinase H1 OS=Homo sapiens... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|97077563.433e-2730.61tr|A0A0L0T198|A0A0L0T198_ALLM3 CAMK protein kinase... [more]
gnl|BL_ORD_ID|97261316.988e-2730.61tr|A0A0L0T4R2|A0A0L0T4R2_ALLM3 CAMK protein kinase... [more]
gnl|BL_ORD_ID|117787932.444e-2628.77tr|A0A1Y2HQ64|A0A1Y2HQ64_9FUNG Kinase-like domain-... [more]
gnl|BL_ORD_ID|1752098893.321e-2630.47tr|A0A099YU29|A0A099YU29_TINGU Serine/threonine-pr... [more]
gnl|BL_ORD_ID|1733156674.542e-2632.88tr|A0A093GJK8|A0A093GJK8_DRYPU Serine/threonine-pr... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pnck9.540e-2929.89calcium/calmodulin-dependent protein kinase type 1... [more]
pnck9.540e-2929.89calcium/calmodulin-dependent protein kinase type 1... [more]
si:ch211-27e6.11.480e-2627.18serine/threonine-protein kinase H1-like [Source:NC... [more]
pskh11.527e-2527.40protein serine kinase H1 [Source:NCBI gene;Acc:103... [more]
pskh11.527e-2527.40protein serine kinase H1 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RPS6KA38.671e-2531.05ribosomal protein S6 kinase A3 [Source:HGNC Symbol... [more]
ENSPMAT00000008748.12.190e-1824.34pep scaffold:Pmarinus_7.0:GL476577:591:63029:-1 ge... [more]
ENSPMAT00000003135.16.632e-1824.31pep scaffold:Pmarinus_7.0:GL491838:799:5626:1 gene... [more]
ENSPMAT00000008094.17.786e-1825.91pep scaffold:Pmarinus_7.0:GL476440:650454:662026:-... [more]
ENSPMAT00000010548.11.975e-1726.88pep scaffold:Pmarinus_7.0:GL477749:266235:284843:-... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CMK28.827e-2528.81Calmodulin-dependent protein kinase; may play a ro... [more]
CMK17.100e-2226.36Calmodulin-dependent protein kinase; may play a ro... [more]
HSL11.349e-1726.32Nim1p-related protein kinase; septin-binding kinas... [more]
DUN11.670e-1726.00Cell-cycle checkpoint S/T protein kinase; required... [more]
IPL14.439e-1726.70Aurora kinase of chromosomal passenger complex; me... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO362531.500e-2526.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356112.041e-2425.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO444888.099e-2230.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424321.024e-2129.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO422762.129e-2125.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
camk1gb3.063e-2629.32calcium/calmodulin-dependent protein kinase type 1... [more]
camk1b6.941e-2525.94calcium/calmodulin-dependent protein kinase type 1... [more]
camk1b8.638e-2525.70calcium/calmodulin-dependent protein kinase type 1... [more]
ENSORLT00000003850.21.170e-2431.22serine/threonine-protein kinase DCLK2 [Source:NCBI... [more]
ENSORLT00000031333.11.170e-2431.22serine/threonine-protein kinase DCLK2 [Source:NCBI... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000063586.10.000e+099.87SMESG000063586.1[more]
SMESG000042100.11.389e-2627.81SMESG000042100.1[more]
SMESG000072629.11.062e-2229.69SMESG000072629.1[more]
SMESG000072629.11.300e-2230.43SMESG000072629.1[more]
SMESG000078937.17.179e-2224.28SMESG000078937.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005222 ID=SMED30005222|Name=Protein kinase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2309bp
GCAAATTTCAAACATATCACATAAAATAGACATCAAACACATAAAATGAA
TGAAAGGTCTAAGATAATAAAGTTGCTGATTAATGGCAATGATCAGTACA
AAGGTAAAATTATCTCGATCACGAAGAACCGGTTTGTCAATTTCAACGAG
TTTCTTGACCAGTTAACACTGTATTTCAAAAGTTTTCTGCCGAACGGAAT
TCGAAGAGTTTATAGATATGGAAACTTTCAAATGGTTCATAGGTTGGAGG
AGCTGGAAAATTACGGATGCTACATTTGTTGCAGTCATGAGAGACTCAAG
AAAATGGCATACGATTCCAATTTCATAGATAAAGCTATCTTTAGTCAGAC
AGAGAAACGAAACTTTTTTAATAATAAAATCGAACGTAATTCTCTCATAA
ACAGTATTGTTCCAAATTACAAAATATTTCGGGAGATTGAGGAATCGAGA
GAAATGAATCAAAGAAAAATAAAAGAAAATATCAGCCCAAAGCTAATAAA
AATTGTGTTTAGTGACAAGCCGCAAGACATTTTCAAGATATTCATCAACA
GAAATCTTGAAATTTCTCTCAACGAATGTCTCTGGAAGATATCCAACAAT
CTCAACAGAAAAACCCACAAACACGATAAAATCAAAATTTTCACGGTTTC
TGGCAGAGAAATTACAAACATGCCTGATCTCTACATTAACCGAAGTCCCA
TTCTAGCATTTACAAATTCAATGATGATGTATCCACAAGATGTTAAAGCC
ATGATCACGAGTCTCTTTCCTGTTCGCCATAGAGCAGAAAGGTATTTTGC
CAAGTGGCTAATCGAGGAAGGATCCGAGAACAGCTCTGTACATTCGATTC
GGTTGAAATCATCAACAAGCAGCACTTCTGAAACCATTCATTCTAAAGTT
CTCTCTGCCAGATATTTAACTAATCGAGAAAATAAAATAATTAATCAAAT
AAATGATAGAAAATTAGAAATGGAAAAGTTAGAAAGCGGTAGGAGCAAGG
ATCATCATCAGGATTATGCGGACAAGATACAAGGGAAAGACTCGATTAAA
GAAAACCAAACTAAGGAGAATCTAAAAGGCGTCGATAAATGTACTAACAT
GACACCCCGTTTCGATCATTTAGACAAAGGAATCCAAGTCTTTTCTGACG
TCAGACATTTCTGGAAGATAACCGAAGTGCGACCAAATATTGCGCATTCC
ATGAAGATGACAGATGTCTCCCACAACTCAAAGCATTCTGACAAAGTCAC
CCAATTTCTGCCTCGTATAAACCATTTCCACAAGGGGATGGATATCATGC
CGAACCTCTTACATTCCCTGACAGAATTCCATGGTAGGCTCGAAGCCAAC
ACAAATACCAAAGACAAAGCCATCCAGTGCACCTTTGACTCTGGTCTATT
ATCAGTTCGATCCAATAACAAAAATGAAAAATCTTTTTCAAAAGATTCCA
TTTTCTTAACGGAGAAATACCAACTAATCAACATTTTATCGAAATCTTCC
CGTTCGATTGTTTACCTAACAAATGACTTTAAACAAAACAAATTTATTGT
CAAACAAATTAATCTAGGAAATCACGGGGAGATTCGAATGAAAGAAGCGC
AAATTCTTATGTCCTGTGACCATCGAAACATTATACAATGTTTTGAGGTG
TATAGAAGTGAAATAAAAGTTGAAATAGTAATGGAATACTTTCCAGAAGG
TAATCTCGATAAATATTTGAGTAAAAAGGAAATATATGAAAAGGATATAA
TGAAAATGGTGCAAGATGTTGGTTCGGGTTTGTTATACTTACATACGGTG
GGAATAATTCACAGATATATACAACCAAAAAATATATACTACCAGTCGAA
TCCTCAGAAATTTCTAATCGGAAACATGGGCCAGGCAGAATTAAAAACTG
AGAATCTTATTTTCATTGAAAATTGGACTCAAACCCAATTTATGGCTCCA
GAACTCACATATCAAAAAGAATACAATGAAAAAGTCGACATTTGGAGCCT
GGGGGTGATAACTGGAAATATCGTGTGCAACAAATATGAACCAAAACAGG
CTGTTGAGGAATTTTCGATGGATATGCAGCACCCGAATTGGATTAATTGG
TCATCTGATTGTCAAATGCTAGTAACGGAAATGCTTCAGAATGATCCATC
AGACAGATTCAATGCCCTCCAGGTTCTTTGCCACCCGTGGTTGACGCAAT
CAGAAAATCGAGAAATGATCCAAGAGGATTTATTCAGAGAAATGGAATCC
TTTACTCGCCAGCAAATTGATACGACAATTGTTTAATGAGATTTCTTTAT
CAGAGATCG
back to top

protein sequence of SMED30005222-orf-1

>SMED30005222-orf-1 ID=SMED30005222-orf-1|Name=SMED30005222-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=747bp
MNERSKIIKLLINGNDQYKGKIISITKNRFVNFNEFLDQLTLYFKSFLPN
GIRRVYRYGNFQMVHRLEELENYGCYICCSHERLKKMAYDSNFIDKAIFS
QTEKRNFFNNKIERNSLINSIVPNYKIFREIEESREMNQRKIKENISPKL
IKIVFSDKPQDIFKIFINRNLEISLNECLWKISNNLNRKTHKHDKIKIFT
VSGREITNMPDLYINRSPILAFTNSMMMYPQDVKAMITSLFPVRHRAERY
FAKWLIEEGSENSSVHSIRLKSSTSSTSETIHSKVLSARYLTNRENKIIN
QINDRKLEMEKLESGRSKDHHQDYADKIQGKDSIKENQTKENLKGVDKCT
NMTPRFDHLDKGIQVFSDVRHFWKITEVRPNIAHSMKMTDVSHNSKHSDK
VTQFLPRINHFHKGMDIMPNLLHSLTEFHGRLEANTNTKDKAIQCTFDSG
LLSVRSNNKNEKSFSKDSIFLTEKYQLINILSKSSRSIVYLTNDFKQNKF
IVKQINLGNHGEIRMKEAQILMSCDHRNIIQCFEVYRSEIKVEIVMEYFP
EGNLDKYLSKKEIYEKDIMKMVQDVGSGLLYLHTVGIIHRYIQPKNIYYQ
SNPQKFLIGNMGQAELKTENLIFIENWTQTQFMAPELTYQKEYNEKVDIW
SLGVITGNIVCNKYEPKQAVEEFSMDMQHPNWINWSSDCQMLVTEMLQND
PSDRFNALQVLCHPWLTQSENREMIQEDLFREMESFTRQQIDTTIV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000421tail
Vocabulary: INTERPRO
TermDefinition
IPR036572Doublecortin_dom_sf
IPR003533Doublecortin_dom
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0035556intracellular signal transduction
GO:0006468protein phosphorylation
GO:0016310phosphorylation
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003533Doublecortin domainSMARTSM00537doub1_11coord: 1..90
e-value: 2.0E-7
score: 40.7
IPR003533Doublecortin domainPFAMPF03607DCXcoord: 25..83
e-value: 4.0E-9
score: 36.4
IPR003533Doublecortin domainPROSITEPS50309DCcoord: 6..90
score: 17.795
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 489..716
e-value: 5.0E-38
score: 131.0
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 475..716
score: 31.071
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 466..745
e-value: 1.8E-47
score: 164.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 312..339
NoneNo IPR availablePANTHERPTHR24347:SF412CALCIUM/CALMODULIN DEPENDENT PROTEIN KINASE Icoord: 456..731
NoneNo IPR availablePANTHERPTHR24347SERINE/THREONINE-PROTEIN KINASEcoord: 456..731
NoneNo IPR availableCDDcd17071DCX1_DCDC2_likecoord: 6..86
e-value: 6.17418E-10
score: 54.1497
IPR036572Doublecortin domain superfamilyGENE3DG3DSA:3.10.20.230coord: 1..106
e-value: 5.7E-20
score: 73.1
IPR036572Doublecortin domain superfamilySUPERFAMILYSSF89837Doublecortin (DC)coord: 4..99
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 467..725