Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta

Overview
NameRetinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta
Smed IDSMED30005215
Length (bp)710
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta (SMED30005215) t-SNE clustered cells

Violin plots show distribution of expression levels for Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta (SMED30005215) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta (SMED30005215) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta (SMED30005215) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005215

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30005215h1SMcG0008244 SmedASXL_010111SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30005215h1SMcG0008244 OX_Smed_1.0.21209ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. Ensembl Human
Match: PDE6D (phosphodiesterase 6D [Source:HGNC Symbol;Acc:HGNC:8788])

HSP 1 Score: 222.246 bits (565), Expect = 8.165e-74
Identity = 102/131 (77.86%), Postives = 118/131 (90.08%), Query Frame = 1
Query:  118 ILQGFSLNWMNLRDAGSGKILWQGSDDLSRPGKEHEARVPKKILKCKAISRELNFSSKEKMENFRLEQKVLFKGQKLEEWYFDFGFVIPGSTNTWQSVIEAAPESQMMSANVLSGNIVIETYFYDGGVLIS 510
            IL+GF LNWMNLRDA +GKILWQG++DLS PG EHEARVPKKILKCKA+SRELNFSS E+ME FRLEQKV FKGQ LEEW+F+FGFVIP STNTWQS+IEAAPESQMM A+VL+GN++IET F+D  +L+S
Sbjct:   11 ILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRELNFSSTEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPASVLTGNVIIETKFFDDDLLVS 141          
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. Ensembl Human
Match: PDE6D (phosphodiesterase 6D [Source:HGNC Symbol;Acc:HGNC:8788])

HSP 1 Score: 182.956 bits (463), Expect = 5.704e-59
Identity = 86/104 (82.69%), Postives = 95/104 (91.35%), Query Frame = 1
Query:  145 MNLRDAGSGKILWQGSDDLSRPGKEHEARVPKKILKCKAISRELNFSSKEKMENFRLEQKVLFKGQKLEEWYFDFGFVIPGSTNTWQSVIEAAPESQMMSANVL 456
            MNLRDA +GKILWQG++DLS PG EHEARVPKKILKCKA+SRELNFSS E+ME FRLEQKV FKGQ LEEW+F+FGFVIP STNTWQS+IEAAPESQMM A+VL
Sbjct:    1 MNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRELNFSSTEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPASVL 104          
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. Ensembl Human
Match: PDE6D (phosphodiesterase 6D [Source:HGNC Symbol;Acc:HGNC:8788])

HSP 1 Score: 135.576 bits (340), Expect = 2.033e-40
Identity = 64/78 (82.05%), Postives = 70/78 (89.74%), Query Frame = 1
Query:  118 ILQGFSLNWMNLRDAGSGKILWQGSDDLSRPGKEHEARVPKKILKCKAISRELNFSSKEKMENFRLEQKVLFKGQKLE 351
            IL+GF LNWMNLRDA +GKILWQG++DLS PG EHEARVPKKILKCKA+SRELNFSS E+ME FRLEQKV FKGQ LE
Sbjct:   11 ILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRELNFSSTEQMEKFRLEQKVYFKGQCLE 88          
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. Ensembl Human
Match: UNC119 (unc-119 lipid binding chaperone [Source:HGNC Symbol;Acc:HGNC:12565])

HSP 1 Score: 46.595 bits (109), Expect = 3.323e-6
Identity = 22/69 (31.88%), Postives = 40/69 (57.97%), Query Frame = 1
Query:  244 ILKCKAISRELNFSSKEK-MENFRLEQKVLFKGQKLEEWYFDFGFVIPGSTNTWQSVIEAAPESQMMSA 447
             L+ + +   + F+  +K + NFR+ ++  F+ Q L+ + F FGF IP S NT + + +  P S+ +SA
Sbjct:   42 FLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELSA 110          
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. Ensembl Celegans
Match: pdl-1 (Phosphodiesterase delta-like protein [Source:UniProtKB/Swiss-Prot;Acc:Q18268])

HSP 1 Score: 203.756 bits (517), Expect = 8.272e-67
Identity = 88/133 (66.17%), Postives = 111/133 (83.46%), Query Frame = 1
Query:  112 ESILQGFSLNWMNLRDAGSGKILWQGSDDLSRPGKEHEARVPKKILKCKAISRELNFSSKEKMENFRLEQKVLFKGQKLEEWYFDFGFVIPGSTNTWQSVIEAAPESQMMSANVLSGNIVIETYFYDGGVLIS 510
            ESIL GF LNWMNLRDA +GK+LWQ ++D++ P +EH+A VPK +LKC+ +SRE+NF+S  K+E FRLEQ+V  KG  +EEWYFDFGFVIP STNTWQ++IEAAPESQM   +VLSGN+V+ET FYDG +L+S
Sbjct:   18 ESILAGFKLNWMNLRDAETGKVLWQSTEDMADPKREHKAHVPKNLLKCRTVSREINFTSSVKIEKFRLEQRVYLKGTIIEEWYFDFGFVIPDSTNTWQNMIEAAPESQMFPPSVLSGNVVVETLFYDGDLLVS 150          
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. Ensembl Fly
Match: PrBP (gene:FBgn0032059 transcript:FBtr0079750)

HSP 1 Score: 182.57 bits (462), Expect = 1.720e-58
Identity = 84/133 (63.16%), Postives = 105/133 (78.95%), Query Frame = 1
Query:  112 ESILQGFSLNWMNLRDAGSGKILWQGSDDLSRPGKEHEARVPKKILKCKAISRELNFSSKEKMENFRLEQKVLFKGQKLEEWYFDFGFVIPGSTNTWQSVIEAAPESQMMSANVLSGNIVIETYFYDGGVLIS 510
            + I +GF +N+M LRDA SGKI+WQ + D S P +EHEARVP KIL  +A+SRE+NFS+ E MENFRL+QKVLFKG+ +EEW+F+ GFV   +TNTWQS IEAAPESQMM A VL+GN+ I+T FYD   LI+
Sbjct:   10 DRIQKGFQINYMILRDADSGKIIWQENKDFSAPDQEHEARVPVKILDMRAVSREINFSTIESMENFRLDQKVLFKGRIMEEWFFEMGFVGANTTNTWQSTIEAAPESQMMPAKVLNGNVTIQTSFYDNETLIT 142          
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. Ensembl Zebrafish
Match: pde6d (phosphodiesterase 6D, cGMP-specific, rod, delta [Source:ZFIN;Acc:ZDB-GENE-040718-463])

HSP 1 Score: 221.09 bits (562), Expect = 1.949e-73
Identity = 102/131 (77.86%), Postives = 117/131 (89.31%), Query Frame = 1
Query:  118 ILQGFSLNWMNLRDAGSGKILWQGSDDLSRPGKEHEARVPKKILKCKAISRELNFSSKEKMENFRLEQKVLFKGQKLEEWYFDFGFVIPGSTNTWQSVIEAAPESQMMSANVLSGNIVIETYFYDGGVLIS 510
            IL+GF LNWMNLRDA +GK+LWQG++DLS PG EHEARVPKKILKCKA+SRELNFSS EK+E FRLEQKV FKGQ LEEW+F+FGFVIP STNTWQS+IEAAPESQMM ANVL+GN+VIET F+D  + +S
Sbjct:   11 ILKGFKLNWMNLRDAETGKVLWQGTEDLSLPGVEHEARVPKKILKCKAVSRELNFSSVEKLEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPANVLTGNVVIETKFFDDDLHVS 141          
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. Ensembl Zebrafish
Match: pde6d (phosphodiesterase 6D, cGMP-specific, rod, delta [Source:ZFIN;Acc:ZDB-GENE-040718-463])

HSP 1 Score: 211.846 bits (538), Expect = 5.920e-70
Identity = 98/127 (77.17%), Postives = 112/127 (88.19%), Query Frame = 1
Query:  130 FSLNWMNLRDAGSGKILWQGSDDLSRPGKEHEARVPKKILKCKAISRELNFSSKEKMENFRLEQKVLFKGQKLEEWYFDFGFVIPGSTNTWQSVIEAAPESQMMSANVLSGNIVIETYFYDGGVLIS 510
            F  NWMNLRDA +GK+LWQG++DLS PG EHEARVPKKILKCKA+SRELNFSS EK+E FRLEQKV FKGQ LEEW+F+FGFVIP STNTWQS+IEAAPESQMM ANVL+GN+VIET F+D  + +S
Sbjct:    8 FPENWMNLRDAETGKVLWQGTEDLSLPGVEHEARVPKKILKCKAVSRELNFSSVEKLEKFRLEQKVFFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPANVLTGNVVIETKFFDDDLHVS 134          
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. Ensembl Zebrafish
Match: pde6d (phosphodiesterase 6D, cGMP-specific, rod, delta [Source:ZFIN;Acc:ZDB-GENE-040718-463])

HSP 1 Score: 211.46 bits (537), Expect = 8.772e-70
Identity = 98/127 (77.17%), Postives = 112/127 (88.19%), Query Frame = 1
Query:  130 FSLNWMNLRDAGSGKILWQGSDDLSRPGKEHEARVPKKILKCKAISRELNFSSKEKMENFRLEQKVLFKGQKLEEWYFDFGFVIPGSTNTWQSVIEAAPESQMMSANVLSGNIVIETYFYDGGVLIS 510
            F  NWMNLRDA +GK+LWQG++DLS PG EHEARVPKKILKCKA+SRELNFSS EK+E FRLEQKV FKGQ LEEW+F+FGFVIP STNTWQS+IEAAPESQMM ANVL+GN+VIET F+D  + +S
Sbjct:    8 FPENWMNLRDAETGKVLWQGTEDLSLPGVEHEARVPKKILKCKAVSRELNFSSVEKLEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPANVLTGNVVIETKFFDDDLHVS 134          
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. Ensembl Zebrafish
Match: pde6d (phosphodiesterase 6D, cGMP-specific, rod, delta [Source:ZFIN;Acc:ZDB-GENE-040718-463])

HSP 1 Score: 122.094 bits (305), Expect = 3.657e-35
Identity = 63/99 (63.64%), Postives = 70/99 (70.71%), Query Frame = 1
Query:  118 ILQGFSLNWMNLRDAGSGKILWQGSDDLSRPGKEHEA---------------------RVPKKILKCKAISRELNFSSKEKMENFRLEQKVLFKGQKLE 351
            IL+GF LNWMNLRDA +GK+LWQG++DLS PG EHEA                     RVPKKILKCKA+SRELNFSS EK+E FRLEQKV FKGQ LE
Sbjct:   11 ILKGFKLNWMNLRDAETGKVLWQGTEDLSLPGVEHEALFSDVSVRSRADRFHFFFSLSRVPKKILKCKAVSRELNFSSVEKLEKFRLEQKVYFKGQCLE 109          
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. Ensembl Zebrafish
Match: unc119a (unc-119 homolog a (C. elegans) [Source:ZFIN;Acc:ZDB-GENE-090930-2])

HSP 1 Score: 47.3654 bits (111), Expect = 1.417e-6
Identity = 23/75 (30.67%), Postives = 41/75 (54.67%), Query Frame = 1
Query:  244 ILKCKAISRELNFS-SKEKMENFRLEQKVLFKGQKLEEWYFDFGFVIPGSTNTWQSVIEAAPESQMMSANVLSGN 465
             L+ + +   + F+     + NFR+ ++  F+GQ L+ + F+FGF IP S NT + + E  P S+ +  +  SG 
Sbjct:   41 FLRLRQVGATVEFTVGDSPINNFRMIERHYFRGQLLKSFDFEFGFCIPSSKNTCEHIYEFPPLSEDIKTSTGSGT 115          
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. Ensembl Xenopus
Match: cd3e (CD3e molecule [Source:Xenbase;Acc:XB-GENE-919749])

HSP 1 Score: 222.246 bits (565), Expect = 7.005e-74
Identity = 103/134 (76.87%), Postives = 118/134 (88.06%), Query Frame = 1
Query:  109 TESILQGFSLNWMNLRDAGSGKILWQGSDDLSRPGKEHEARVPKKILKCKAISRELNFSSKEKMENFRLEQKVLFKGQKLEEWYFDFGFVIPGSTNTWQSVIEAAPESQMMSANVLSGNIVIETYFYDGGVLIS 510
             + IL+GF LNWMNLRDA +GKILWQG++DLS PG EHEARVPKKILKCKA+SRELNFSS E+ME FRLEQKV FKGQ LEEW+F+FGFVIP S NTWQS+IEAAPESQMM ANVL+GN+VIET F+D  +L+S
Sbjct:    7 AKQILKGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRELNFSSAEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSMNTWQSLIEAAPESQMMPANVLTGNVVIETKFFDDDLLVS 140          
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. Ensembl Xenopus
Match: cd3e (CD3e molecule [Source:Xenbase;Acc:XB-GENE-919749])

HSP 1 Score: 213.386 bits (542), Expect = 4.902e-70
Identity = 98/124 (79.03%), Postives = 111/124 (89.52%), Query Frame = 1
Query:  139 NWMNLRDAGSGKILWQGSDDLSRPGKEHEARVPKKILKCKAISRELNFSSKEKMENFRLEQKVLFKGQKLEEWYFDFGFVIPGSTNTWQSVIEAAPESQMMSANVLSGNIVIETYFYDGGVLIS 510
            NWMNLRDA +GKILWQG++DLS PG EHEARVPKKILKCKA+SRELNFSS E+ME FRLEQKV FKGQ LEEW+F+FGFVIP S NTWQS+IEAAPESQMM ANVL+GN+VIET F+D  +L+S
Sbjct:   38 NWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRELNFSSAEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSMNTWQSLIEAAPESQMMPANVLTGNVVIETKFFDDDLLVS 161          
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. Ensembl Xenopus
Match: cd3e (CD3e molecule [Source:Xenbase;Acc:XB-GENE-919749])

HSP 1 Score: 212.231 bits (539), Expect = 5.271e-70
Identity = 98/124 (79.03%), Postives = 111/124 (89.52%), Query Frame = 1
Query:  139 NWMNLRDAGSGKILWQGSDDLSRPGKEHEARVPKKILKCKAISRELNFSSKEKMENFRLEQKVLFKGQKLEEWYFDFGFVIPGSTNTWQSVIEAAPESQMMSANVLSGNIVIETYFYDGGVLIS 510
            NWMNLRDA +GKILWQG++DLS PG EHEARVPKKILKCKA+SRELNFSS E+ME FRLEQKV FKGQ LEEW+F+FGFVIP S NTWQS+IEAAPESQMM ANVL+GN+VIET F+D  +L+S
Sbjct:    6 NWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRELNFSSAEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSMNTWQSLIEAAPESQMMPANVLTGNVVIETKFFDDDLLVS 129          
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. Ensembl Mouse
Match: Pde6d (phosphodiesterase 6D, cGMP-specific, rod, delta [Source:MGI Symbol;Acc:MGI:1270843])

HSP 1 Score: 222.246 bits (565), Expect = 6.253e-74
Identity = 102/131 (77.86%), Postives = 118/131 (90.08%), Query Frame = 1
Query:  118 ILQGFSLNWMNLRDAGSGKILWQGSDDLSRPGKEHEARVPKKILKCKAISRELNFSSKEKMENFRLEQKVLFKGQKLEEWYFDFGFVIPGSTNTWQSVIEAAPESQMMSANVLSGNIVIETYFYDGGVLIS 510
            IL+GF LNWMNLRDA +GKILWQG++DLS PG EHEARVPKKILKCKA+SRELNFSS E+ME FRLEQKV FKGQ LEEW+F+FGFVIP STNTWQS+IEAAPESQMM A+VL+GN++IET F+D  +L+S
Sbjct:   11 ILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRELNFSSAEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPASVLTGNVIIETKFFDDDLLVS 141          
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. Ensembl Mouse
Match: Pde6d (phosphodiesterase 6D, cGMP-specific, rod, delta [Source:MGI Symbol;Acc:MGI:1270843])

HSP 1 Score: 198.749 bits (504), Expect = 4.417e-65
Identity = 93/114 (81.58%), Postives = 104/114 (91.23%), Query Frame = 1
Query:  118 ILQGFSLNWMNLRDAGSGKILWQGSDDLSRPGKEHEARVPKKILKCKAISRELNFSSKEKMENFRLEQKVLFKGQKLEEWYFDFGFVIPGSTNTWQSVIEAAPESQMMSANVLS 459
            IL+GF LNWMNLRDA +GKILWQG++DLS PG EHEARVPKKILKCKA+SRELNFSS E+ME FRLEQKV FKGQ LEEW+F+FGFVIP STNTWQS+IEAAPESQMM A+VL+
Sbjct:   11 ILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRELNFSSAEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPASVLT 124          
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. Ensembl Mouse
Match: Pde6d (phosphodiesterase 6D, cGMP-specific, rod, delta [Source:MGI Symbol;Acc:MGI:1270843])

HSP 1 Score: 63.929 bits (154), Expect = 2.547e-13
Identity = 28/37 (75.68%), Postives = 32/37 (86.49%), Query Frame = 1
Query:  118 ILQGFSLNWMNLRDAGSGKILWQGSDDLSRPGKEHEA 228
            IL+GF LNWMNLRDA +GKILWQG++DLS PG EHE 
Sbjct:   11 ILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEG 47          
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. UniProt/SwissProt
Match: sp|O43924|PDE6D_HUMAN (Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta OS=Homo sapiens OX=9606 GN=PDE6D PE=1 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 3.921e-73
Identity = 102/131 (77.86%), Postives = 118/131 (90.08%), Query Frame = 1
Query:  118 ILQGFSLNWMNLRDAGSGKILWQGSDDLSRPGKEHEARVPKKILKCKAISRELNFSSKEKMENFRLEQKVLFKGQKLEEWYFDFGFVIPGSTNTWQSVIEAAPESQMMSANVLSGNIVIETYFYDGGVLIS 510
            IL+GF LNWMNLRDA +GKILWQG++DLS PG EHEARVPKKILKCKA+SRELNFSS E+ME FRLEQKV FKGQ LEEW+F+FGFVIP STNTWQS+IEAAPESQMM A+VL+GN++IET F+D  +L+S
Sbjct:   11 ILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRELNFSSTEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPASVLTGNVIIETKFFDDDLLVS 141          
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. UniProt/SwissProt
Match: sp|Q9XT54|PDE6D_CANLF (Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta OS=Canis lupus familiaris OX=9615 GN=PDE6D PE=2 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 4.141e-73
Identity = 102/131 (77.86%), Postives = 118/131 (90.08%), Query Frame = 1
Query:  118 ILQGFSLNWMNLRDAGSGKILWQGSDDLSRPGKEHEARVPKKILKCKAISRELNFSSKEKMENFRLEQKVLFKGQKLEEWYFDFGFVIPGSTNTWQSVIEAAPESQMMSANVLSGNIVIETYFYDGGVLIS 510
            IL+GF LNWMNLRDA +GKILWQG++DLS PG EHEARVPKKILKCKA+SRELNFSS E+ME FRLEQKV FKGQ LEEW+F+FGFVIP STNTWQS+IEAAPESQMM A+VL+GN++IET F+D  +L+S
Sbjct:   11 ILKGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRELNFSSAEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPASVLTGNVIIETKFFDDDLLVS 141          
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. UniProt/SwissProt
Match: sp|Q95142|PDE6D_BOVIN (Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta OS=Bos taurus OX=9913 GN=PDE6D PE=1 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 4.233e-73
Identity = 102/131 (77.86%), Postives = 118/131 (90.08%), Query Frame = 1
Query:  118 ILQGFSLNWMNLRDAGSGKILWQGSDDLSRPGKEHEARVPKKILKCKAISRELNFSSKEKMENFRLEQKVLFKGQKLEEWYFDFGFVIPGSTNTWQSVIEAAPESQMMSANVLSGNIVIETYFYDGGVLIS 510
            IL+GF LNWMNLRDA +GKILWQG++DLS PG EHEARVPKKILKCKA+SRELNFSS E+ME FRLEQKV FKGQ LEEW+F+FGFVIP STNTWQS+IEAAPESQMM A+VL+GN++IET F+D  +L+S
Sbjct:   11 ILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRELNFSSAEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPASVLTGNVIIETKFFDDDLLVS 141          
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. UniProt/SwissProt
Match: sp|O55057|PDE6D_MOUSE (Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta OS=Mus musculus OX=10090 GN=Pde6d PE=1 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 4.374e-73
Identity = 102/131 (77.86%), Postives = 118/131 (90.08%), Query Frame = 1
Query:  118 ILQGFSLNWMNLRDAGSGKILWQGSDDLSRPGKEHEARVPKKILKCKAISRELNFSSKEKMENFRLEQKVLFKGQKLEEWYFDFGFVIPGSTNTWQSVIEAAPESQMMSANVLSGNIVIETYFYDGGVLIS 510
            IL+GF LNWMNLRDA +GKILWQG++DLS PG EHEARVPKKILKCKA+SRELNFSS E+ME FRLEQKV FKGQ LEEW+F+FGFVIP STNTWQS+IEAAPESQMM A+VL+GN++IET F+D  +L+S
Sbjct:   11 ILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRELNFSSAEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPASVLTGNVIIETKFFDDDLLVS 141          
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. UniProt/SwissProt
Match: sp|Q18268|PDL1_CAEEL (Phosphodiesterase delta-like protein OS=Caenorhabditis elegans OX=6239 GN=pdl-1 PE=1 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 1.052e-65
Identity = 88/133 (66.17%), Postives = 111/133 (83.46%), Query Frame = 1
Query:  112 ESILQGFSLNWMNLRDAGSGKILWQGSDDLSRPGKEHEARVPKKILKCKAISRELNFSSKEKMENFRLEQKVLFKGQKLEEWYFDFGFVIPGSTNTWQSVIEAAPESQMMSANVLSGNIVIETYFYDGGVLIS 510
            ESIL GF LNWMNLRDA +GK+LWQ ++D++ P +EH+A VPK +LKC+ +SRE+NF+S  K+E FRLEQ+V  KG  +EEWYFDFGFVIP STNTWQ++IEAAPESQM   +VLSGN+V+ET FYDG +L+S
Sbjct:   18 ESILAGFKLNWMNLRDAETGKVLWQSTEDMADPKREHKAHVPKNLLKCRTVSREINFTSSVKIEKFRLEQRVYLKGTIIEEWYFDFGFVIPDSTNTWQNMIEAAPESQMFPPSVLSGNVVVETLFYDGDLLVS 150          
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. TrEMBL
Match: A0A1S3JTL5 (Phosphodiesterase delta-like protein OS=Lingula unguis OX=7574 GN=LOC106175839 PE=3 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 3.602e-76
Identity = 110/136 (80.88%), Postives = 121/136 (88.97%), Query Frame = 1
Query:  103 SNTESILQGFSLNWMNLRDAGSGKILWQGSDDLSRPGKEHEARVPKKILKCKAISRELNFSSKEKMENFRLEQKVLFKGQKLEEWYFDFGFVIPGSTNTWQSVIEAAPESQMMSANVLSGNIVIETYFYDGGVLIS 510
            S  E IL+GF LNWMNLRDA SGKILWQ SDDLS P KEHEARVPKKILKCKA+SRELNFSS E ME FRLEQKV+FK + LEEWYF+FGFVIPGSTNTWQS+IEAAPESQMM ANVL+GN++IETYFYDG +L+S
Sbjct:    3 SRAEDILKGFKLNWMNLRDAESGKILWQSSDDLSMPEKEHEARVPKKILKCKAVSRELNFSSTEAMEKFRLEQKVMFKNRCLEEWYFEFGFVIPGSTNTWQSIIEAAPESQMMPANVLNGNVMIETYFYDGDLLVS 138          
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. TrEMBL
Match: C3ZYY6 (Phosphodiesterase delta-like protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_288962 PE=3 SV=1)

HSP 1 Score: 230.72 bits (587), Expect = 5.696e-74
Identity = 108/136 (79.41%), Postives = 120/136 (88.24%), Query Frame = 1
Query:  103 SNTESILQGFSLNWMNLRDAGSGKILWQGSDDLSRPGKEHEARVPKKILKCKAISRELNFSSKEKMENFRLEQKVLFKGQKLEEWYFDFGFVIPGSTNTWQSVIEAAPESQMMSANVLSGNIVIETYFYDGGVLIS 510
            S  E IL GF LNWMNLRDA SGKILWQGS+DLS PG EHEARVPKKILKC+A+SRE+NFSS E+ME FRLEQKVLFKG+ LEEWYF+FGFVIP STNTWQS+IEAAPE+QMM ANVLSGN+VIET FYD  +L+S
Sbjct:    3 SRAEDILNGFKLNWMNLRDADSGKILWQGSEDLSVPGTEHEARVPKKILKCRAVSREINFSSIEQMERFRLEQKVLFKGRVLEEWYFEFGFVIPNSTNTWQSIIEAAPENQMMPANVLSGNVVIETNFYDKDLLVS 138          
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. TrEMBL
Match: A0A0F7VHB0 (Csa-cGMP gated channel delta (Fragment) OS=Cupiennius salei OX=6928 GN=Csa-cGMP gated channel delta PE=2 SV=1)

HSP 1 Score: 230.72 bits (587), Expect = 6.798e-74
Identity = 105/136 (77.21%), Postives = 121/136 (88.97%), Query Frame = 1
Query:  103 SNTESILQGFSLNWMNLRDAGSGKILWQGSDDLSRPGKEHEARVPKKILKCKAISRELNFSSKEKMENFRLEQKVLFKGQKLEEWYFDFGFVIPGSTNTWQSVIEAAPESQMMSANVLSGNIVIETYFYDGGVLIS 510
            S  E ILQGF LNWMNLRDA SGK+LWQGSDDLS+P  EHEARVPKKIL+C+A+SRE+NFSS E ME FRLEQ+VLFKG+ LEEW+FDFGFVIP STNTWQS+IEAAPESQMM ANVL+GN++IET F+DG +L+S
Sbjct:    7 SKAEDILQGFKLNWMNLRDADSGKVLWQGSDDLSKPDIEHEARVPKKILRCRAVSREINFSSVEPMEKFRLEQRVLFKGRCLEEWFFDFGFVIPNSTNTWQSLIEAAPESQMMPANVLNGNVIIETKFFDGDLLVS 142          
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. TrEMBL
Match: A0A433U4W4 (Phosphodiesterase delta-like protein OS=Elysia chlorotica OX=188477 GN=EGW08_003411 PE=3 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 7.011e-74
Identity = 105/137 (76.64%), Postives = 121/137 (88.32%), Query Frame = 1
Query:  103 SNTESILQGFSLNWMNLRDAGSGKILWQGSDDLSRPGKEHEARVPKKILKCKAISRELNFSSKEKMENFRLEQKVLFKGQKLEEWYFDFGFVIPGSTNTWQSVIEAAPESQMMSANVLSGNIVIETYFYDGGVLISI 513
            S  E I++GF LNWMNLRDA SGK+LWQ SDDLS P KEHEARVPKK+LKC+A+SRE+NFSSKE M+ FRLEQ+VLFKG+ LEEWYFDFGFVIPGSTNTWQS+IEAAPESQMM ANVL+GN+VIET FYD  + +S+
Sbjct:    3 SKPEDIMKGFKLNWMNLRDADSGKVLWQSSDDLSIPEKEHEARVPKKVLKCRAVSREINFSSKEPMDKFRLEQRVLFKGKCLEEWYFDFGFVIPGSTNTWQSLIEAAPESQMMPANVLNGNVVIETRFYDEDMCVSV 139          
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. TrEMBL
Match: A0A4Y2PAS8 (Probable cGMP 3',5'-cyclic phosphodiesterase subunit delta OS=Araneus ventricosus OX=182803 GN=Pde6d_0 PE=3 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 7.736e-74
Identity = 105/136 (77.21%), Postives = 121/136 (88.97%), Query Frame = 1
Query:  103 SNTESILQGFSLNWMNLRDAGSGKILWQGSDDLSRPGKEHEARVPKKILKCKAISRELNFSSKEKMENFRLEQKVLFKGQKLEEWYFDFGFVIPGSTNTWQSVIEAAPESQMMSANVLSGNIVIETYFYDGGVLIS 510
            S  E ILQGF LNWMNLRDA SGK+LWQGS+DLS+P  EHEARVPKKIL+C+A+SRE+NFSS E ME FRLEQ+VLFKG+ LEEW+FDFGFVIP STNTWQS+IEAAPESQMM ANVL+GN++IET FYDG +L+S
Sbjct:    3 SKAEDILQGFKLNWMNLRDADSGKVLWQGSEDLSKPDVEHEARVPKKILRCRAVSREINFSSVEPMEKFRLEQRVLFKGRCLEEWFFDFGFVIPNSTNTWQSLIEAAPESQMMPANVLNGNVIIETKFYDGDLLVS 138          
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. Ensembl Cavefish
Match: pde6d (phosphodiesterase 6D, cGMP-specific, rod, delta [Source:ZFIN;Acc:ZDB-GENE-040718-463])

HSP 1 Score: 224.942 bits (572), Expect = 1.086e-74
Identity = 104/131 (79.39%), Postives = 118/131 (90.08%), Query Frame = 1
Query:  118 ILQGFSLNWMNLRDAGSGKILWQGSDDLSRPGKEHEARVPKKILKCKAISRELNFSSKEKMENFRLEQKVLFKGQKLEEWYFDFGFVIPGSTNTWQSVIEAAPESQMMSANVLSGNIVIETYFYDGGVLIS 510
            IL+GF LNWMNLRDA +GK+LWQG++DLS PG EHEARVPKKILKCKA+SRELNFSS EK+E FRLEQKVLFKGQ LEEW+F+FGFVIP STNTWQS+IEAAPESQMM ANVL+GN+VIET FYD  + +S
Sbjct:   40 ILKGFKLNWMNLRDAETGKVLWQGTEDLSVPGVEHEARVPKKILKCKAVSRELNFSSSEKLEKFRLEQKVLFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPANVLTGNVVIETKFYDDELHVS 170          
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. Ensembl Cavefish
Match: pde6d (phosphodiesterase 6D, cGMP-specific, rod, delta [Source:ZFIN;Acc:ZDB-GENE-040718-463])

HSP 1 Score: 142.51 bits (358), Expect = 8.024e-43
Identity = 72/123 (58.54%), Postives = 90/123 (73.17%), Query Frame = 1
Query:  118 ILQGFSLNWMNLRDAGSGKILWQGSDDLSRPGKEHEARVPKKILKCKAISRELNFSSKEKMENFRLEQKVLFKGQKLEEWYFDFGFVIPGSTNTWQSVIEAAPESQMMSANVLSGNIVIETYF 486
            IL+GF LNWMNLRDA +GK+LWQG++DLS PG EHEARVPKKILKCKA+SRELNFSS EK+E FRLEQKVLFKGQ LE W  D  F+     +++ SV++    +   +  +L    +I+ Y 
Sbjct:   11 ILKGFKLNWMNLRDAETGKVLWQGTEDLSVPGVEHEARVPKKILKCKAVSRELNFSSSEKLEKFRLEQKVLFKGQCLEGW--DHYFL--SCIHSYLSVLQIIHYTLFSTQFILQFLQLIKKYL 129          
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. Ensembl Cavefish
Match: UNC119 (unc-119 lipid binding chaperone [Source:HGNC Symbol;Acc:HGNC:12565])

HSP 1 Score: 45.4394 bits (106), Expect = 6.071e-6
Identity = 21/65 (32.31%), Postives = 38/65 (58.46%), Query Frame = 1
Query:  244 ILKCKAISRELNFSSKE-KMENFRLEQKVLFKGQKLEEWYFDFGFVIPGSTNTWQSVIEAAPESQ 435
             L+ + +   + F+  +  + NFR+ ++  F+GQ L+ + F+FGF IP S NT + + E  P S+
Sbjct:   39 FLRLRQVGATVEFTVGDIPINNFRMIERHYFRGQLLKSFDFEFGFCIPSSKNTCEHIYEFPPLSE 103          
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. Ensembl Nematostella
Match: EDO37484 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFK7])

HSP 1 Score: 227.254 bits (578), Expect = 2.073e-76
Identity = 106/138 (76.81%), Postives = 121/138 (87.68%), Query Frame = 1
Query:   97 SMSNTESILQGFSLNWMNLRDAGSGKILWQGSDDLSRPGKEHEARVPKKILKCKAISRELNFSSKEKMENFRLEQKVLFKGQKLEEWYFDFGFVIPGSTNTWQSVIEAAPESQMMSANVLSGNIVIETYFYDGGVLIS 510
            S   +E IL GF LNWMNLRDA +GK+LWQGS+DLS PG EHEARVPKKILKCKA+SRE+NFSS E+M  FRLEQKVLFKG+ LEEWYF+FGFVIP STNTWQS+IEAAPESQMM ANVL+GN+VIET F+DG +L+S
Sbjct:    3 SKERSEKILGGFKLNWMNLRDADTGKVLWQGSEDLSLPGVEHEARVPKKILKCKAVSREVNFSSAEEMHKFRLEQKVLFKGKCLEEWYFEFGFVIPSSTNTWQSLIEAAPESQMMPANVLNGNVVIETKFFDGDLLVS 140          
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. Ensembl Medaka
Match: pde6d (phosphodiesterase 6D [Source:NCBI gene;Acc:101159089])

HSP 1 Score: 221.476 bits (563), Expect = 8.246e-74
Identity = 102/131 (77.86%), Postives = 118/131 (90.08%), Query Frame = 1
Query:  118 ILQGFSLNWMNLRDAGSGKILWQGSDDLSRPGKEHEARVPKKILKCKAISRELNFSSKEKMENFRLEQKVLFKGQKLEEWYFDFGFVIPGSTNTWQSVIEAAPESQMMSANVLSGNIVIETYFYDGGVLIS 510
            IL+GF LNWMNLRDA +GKILWQG++DLS PG EHEARVPKKILKCKA+SRELNFSS EK+E FRLEQKVLFKGQ LEEW+F+FGFVIP STNTWQS+IEAAPESQMM A+VL+GN++IET F+D  + +S
Sbjct:   11 ILKGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRELNFSSTEKLEKFRLEQKVLFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPASVLTGNVIIETKFFDDDLHVS 141          
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. Planmine SMEST
Match: SMESG000020739.1 (SMESG000020739.1)

HSP 1 Score: 302.368 bits (773), Expect = 8.553e-106
Identity = 147/147 (100.00%), Postives = 147/147 (100.00%), Query Frame = 1
Query:  100 MSNTESILQGFSLNWMNLRDAGSGKILWQGSDDLSRPGKEHEARVPKKILKCKAISRELNFSSKEKMENFRLEQKVLFKGQKLEEWYFDFGFVIPGSTNTWQSVIEAAPESQMMSANVLSGNIVIETYFYDGGVLISIWFLIEMQKF 540
            MSNTESILQGFSLNWMNLRDAGSGKILWQGSDDLSRPGKEHEARVPKKILKCKAISRELNFSSKEKMENFRLEQKVLFKGQKLEEWYFDFGFVIPGSTNTWQSVIEAAPESQMMSANVLSGNIVIETYFYDGGVLISIWFLIEMQKF
Sbjct:    1 MSNTESILQGFSLNWMNLRDAGSGKILWQGSDDLSRPGKEHEARVPKKILKCKAISRELNFSSKEKMENFRLEQKVLFKGQKLEEWYFDFGFVIPGSTNTWQSVIEAAPESQMMSANVLSGNIVIETYFYDGGVLISIWFLIEMQKF 147          
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. Planmine SMEST
Match: SMESG000020739.1 (SMESG000020739.1)

HSP 1 Score: 283.493 bits (724), Expect = 2.166e-98
Identity = 136/137 (99.27%), Postives = 137/137 (100.00%), Query Frame = 1
Query:  100 MSNTESILQGFSLNWMNLRDAGSGKILWQGSDDLSRPGKEHEARVPKKILKCKAISRELNFSSKEKMENFRLEQKVLFKGQKLEEWYFDFGFVIPGSTNTWQSVIEAAPESQMMSANVLSGNIVIETYFYDGGVLIS 510
            MSNTESILQGFSLNWMNLRDAGSGKILWQGSDDLSRPGKEHEARVPKKILKCKAISRELNFSSKEKMENFRLEQKVLFKGQKLEEWYFDFGFVIPGSTNTWQSVIEAAPESQMMSANVLSGNIVIETYFYDGGVL+S
Sbjct:    1 MSNTESILQGFSLNWMNLRDAGSGKILWQGSDDLSRPGKEHEARVPKKILKCKAISRELNFSSKEKMENFRLEQKVLFKGQKLEEWYFDFGFVIPGSTNTWQSVIEAAPESQMMSANVLSGNIVIETYFYDGGVLVS 137          
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. Planmine SMEST
Match: SMESG000079942.1 (SMESG000079942.1)

HSP 1 Score: 40.817 bits (94), Expect = 7.519e-7
Identity = 19/23 (82.61%), Postives = 21/23 (91.30%), Query Frame = -1
Query:  633 DNLSYKHKELLQIYRKYVERVLE 701
            +NLSYKHKELLQ+  KYVERVLE
Sbjct:  174 ENLSYKHKELLQMCSKYVERVLE 196          

HSP 2 Score: 30.0314 bits (66), Expect = 7.519e-7
Identity = 16/22 (72.73%), Postives = 18/22 (81.82%), Query Frame = -2
Query:  587 SESWNV--KSLMAKFSRQIRIV 646
            S+  NV  KSLMAKFSRQI+IV
Sbjct:  198 SDYMNVDFKSLMAKFSRQIKIV 219          
The following BLAST results are available for this feature:
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
PDE6D8.165e-7477.86phosphodiesterase 6D [Source:HGNC Symbol;Acc:HGNC:... [more]
PDE6D5.704e-5982.69phosphodiesterase 6D [Source:HGNC Symbol;Acc:HGNC:... [more]
PDE6D2.033e-4082.05phosphodiesterase 6D [Source:HGNC Symbol;Acc:HGNC:... [more]
UNC1193.323e-631.88unc-119 lipid binding chaperone [Source:HGNC Symbo... [more]
back to top
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pdl-18.272e-6766.17Phosphodiesterase delta-like protein [Source:UniP... [more]
back to top
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
PrBP1.720e-5863.16gene:FBgn0032059 transcript:FBtr0079750[more]
back to top
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pde6d1.949e-7377.86phosphodiesterase 6D, cGMP-specific, rod, delta [S... [more]
pde6d5.920e-7077.17phosphodiesterase 6D, cGMP-specific, rod, delta [S... [more]
pde6d8.772e-7077.17phosphodiesterase 6D, cGMP-specific, rod, delta [S... [more]
pde6d3.657e-3563.64phosphodiesterase 6D, cGMP-specific, rod, delta [S... [more]
unc119a1.417e-630.67unc-119 homolog a (C. elegans) [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cd3e7.005e-7476.87CD3e molecule [Source:Xenbase;Acc:XB-GENE-919749][more]
cd3e4.902e-7079.03CD3e molecule [Source:Xenbase;Acc:XB-GENE-919749][more]
cd3e5.271e-7079.03CD3e molecule [Source:Xenbase;Acc:XB-GENE-919749][more]
back to top
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Pde6d6.253e-7477.86phosphodiesterase 6D, cGMP-specific, rod, delta [S... [more]
Pde6d4.417e-6581.58phosphodiesterase 6D, cGMP-specific, rod, delta [S... [more]
Pde6d2.547e-1375.68phosphodiesterase 6D, cGMP-specific, rod, delta [S... [more]
back to top
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O43924|PDE6D_HUMAN3.921e-7377.86Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic ... [more]
sp|Q9XT54|PDE6D_CANLF4.141e-7377.86Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic ... [more]
sp|Q95142|PDE6D_BOVIN4.233e-7377.86Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic ... [more]
sp|O55057|PDE6D_MOUSE4.374e-7377.86Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic ... [more]
sp|Q18268|PDL1_CAEEL1.052e-6566.17Phosphodiesterase delta-like protein OS=Caenorhabd... [more]
back to top
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JTL53.602e-7680.88Phosphodiesterase delta-like protein OS=Lingula un... [more]
C3ZYY65.696e-7479.41Phosphodiesterase delta-like protein OS=Branchiost... [more]
A0A0F7VHB06.798e-7477.21Csa-cGMP gated channel delta (Fragment) OS=Cupienn... [more]
A0A433U4W47.011e-7476.64Phosphodiesterase delta-like protein OS=Elysia chl... [more]
A0A4Y2PAS87.736e-7477.21Probable cGMP 3',5'-cyclic phosphodiesterase subun... [more]
back to top
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pde6d1.086e-7479.39phosphodiesterase 6D, cGMP-specific, rod, delta [S... [more]
pde6d8.024e-4358.54phosphodiesterase 6D, cGMP-specific, rod, delta [S... [more]
UNC1196.071e-632.31unc-119 lipid binding chaperone [Source:HGNC Symbo... [more]
back to top
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO374842.073e-7676.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pde6d8.246e-7477.86phosphodiesterase 6D [Source:NCBI gene;Acc:1011590... [more]
back to top
BLAST of Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000020739.18.553e-106100.00SMESG000020739.1[more]
SMESG000020739.12.166e-9899.27SMESG000020739.1[more]
SMESG000079942.17.519e-782.61SMESG000079942.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005215 ID=SMED30005215|Name=Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta|organism=Schmidtea mediterranea sexual|type=transcript|length=710bp
TTTCAAAACAATAAAATTCTTATGTTTTAATTTATCAATTAAATTATACT
CTAACCTAAACTTTTCTATTTGGTAACTATTATAAATAATTGTATTTCTA
TGTCGAATACAGAAAGCATTTTACAGGGATTTTCTTTAAATTGGATGAAT
TTGAGAGATGCTGGATCAGGAAAAATTTTGTGGCAAGGAAGCGATGATTT
ATCACGCCCAGGTAAAGAACATGAAGCGAGGGTACCCAAAAAAATTTTAA
AGTGCAAAGCAATATCTCGAGAATTAAATTTTTCTTCAAAGGAAAAAATG
GAAAATTTCCGTTTAGAACAAAAAGTTTTGTTCAAAGGTCAAAAGCTTGA
AGAATGGTATTTTGATTTTGGGTTTGTAATTCCCGGATCCACAAACACCT
GGCAATCGGTGATTGAGGCAGCACCAGAAAGTCAAATGATGTCAGCAAAT
GTTCTCAGCGGCAATATCGTTATAGAAACGTATTTCTACGACGGCGGTGT
TCTAATTTCAATTTGGTTTTTAATAGAAATGCAAAAATTTTGAAGTCTGA
CAAAAATCATTTATTTATAAAATCTTTAGTAATTGAAACAATTCTAATTT
GTCGTGAGAATTTCGCCATTAAACTTTTGACATTCCAGGACTCGCTCCAC
ATATTTGCGGTATATTTGTAATAATTCTTTGTGTTTGTACGATAAGTTGT
CTGAAATAAA
back to top

protein sequence of SMED30005215-orf-1

>SMED30005215-orf-1 ID=SMED30005215-orf-1|Name=SMED30005215-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=148bp
MSNTESILQGFSLNWMNLRDAGSGKILWQGSDDLSRPGKEHEARVPKKIL
KCKAISRELNFSSKEKMENFRLEQKVLFKGQKLEEWYFDFGFVIPGSTNT
WQSVIEAAPESQMMSANVLSGNIVIETYFYDGGVLISIWFLIEMQKF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0050953sensory perception of light stimulus
GO:0007601visual perception
GO:0007602phototransduction
GO:0034260negative regulation of GTPase activity
GO:0050896response to stimulus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR037036PDED_dom_sf
IPR017287Rhodop-sen_GMP-Pdiesterase_dsu
IPR008015PDED_dom
IPR014756Ig_E-set
Vocabulary: molecular function
TermDefinition
GO:0005095GTPase inhibitor activity
GO:0005515protein binding
GO:0017137Rab GTPase binding
GO:00475553',5'-cyclic-GMP phosphodiesterase activity
GO:00041143',5'-cyclic-nucleotide phosphodiesterase activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005856cytoskeleton
GO:0016020membrane
GO:0030659cytoplasmic vesicle membrane
GO:0031410cytoplasmic vesicle
GO:0042995cell projection
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008015GMP phosphodiesterase, delta subunitPFAMPF05351GMP_PDE_deltacoord: 6..136
e-value: 3.2E-39
score: 134.5
IPR037036GMP phosphodiesterase, delta subunit superfamilyGENE3DG3DSA:2.70.50.40coord: 1..141
e-value: 1.8E-64
score: 217.9
IPR017287Retinal rod rhodopsin-sensitive cGMP 3', 5'-cyclic phosphodiesterase, delta subunitPANTHERPTHR12976RETINAL ROD RHODOPSIN-SENSITIVE CGMP 3',5'-CYCLIC PHOSPHODIESTERASE DELTA-SUBUNITcoord: 3..133
IPR014756Immunoglobulin E-setSUPERFAMILYSSF81296E set domainscoord: 3..137