Band 4.1-like protein 5

Overview
NameBand 4.1-like protein 5
Smed IDSMED30005213
Length (bp)2460
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Band 4.1-like protein 5 (SMED30005213) t-SNE clustered cells

Violin plots show distribution of expression levels for Band 4.1-like protein 5 (SMED30005213) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Band 4.1-like protein 5 (SMED30005213) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Band 4.1-like protein 5 (SMED30005213) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005213

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30005213SMESG000007133.1 dd_Smed_v4_4114_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30005213SMESG000007133.1 dd_Smed_v4_4114_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005213SMESG000007133.1 dd_Smed_v4_4114_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30005213SMESG000007133.1 dd_Smed_v4_4114_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005213SMESG000007133.1 dd_Smed_v4_4114_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Band 4.1-like protein 5 vs. Ensembl Human
Match: EPB41L5 (erythrocyte membrane protein band 4.1 like 5 [Source:HGNC Symbol;Acc:HGNC:19819])

HSP 1 Score: 281.567 bits (719), Expect = 4.624e-85
Identity = 150/321 (46.73%), Postives = 208/321 (64.80%), Query Frame = 2
Query:  239 LECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNG-DVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQ 1198
            + C++  LDGTD +  L K+A GQ+L D   + +++ +  +YFGL++ D   + HWLD  K ++KQ++IG P+ L  RVKF+SS+P + L +E TRYLFV QLK  + SG+L C   D A ++AA +LQ ELGDYD  EHSP  +S+FRF P   QTEE+EL+I  K+   + R   P+ A+  +L K + L  YGVD H +K ++  DY LGLTP+G+L++EG  KIGLF W  +T+L FKK++  +VV  V+ DD G + EHTFVF+     ACK +WK  VEHHAF+RL G  +  +      RL SRF  S  TEYQ
Sbjct:   43 ITCRVSLLDGTDVSVDLPKKAKGQELFDQIMYHLDLIES-DYFGLRFMDSAQVAHWLDGTKSIKKQVKIGSPYCLHLRVKFYSSEP-NNLREELTRYLFVLQLKQDILSGKLDCP-FDTAVQLAAYNLQAELGDYDLAEHSPELVSEFRFVP--IQTEEMELAIFEKWK--EYRGQTPAQAETNYLNKAKWLEMYGVDMHVVKARDGNDYSLGLTPTGVLVFEGDTKIGLFFWPKITRLDFKKNKLTLVV--VEDDDQGKEQEHTFVFRLDHPKACKHLWKCAVEHHAFFRLRGPVQKSSHRSGFIRLGSRFRYSGKTEYQ 354          
BLAST of Band 4.1-like protein 5 vs. Ensembl Human
Match: EPB41L5 (erythrocyte membrane protein band 4.1 like 5 [Source:HGNC Symbol;Acc:HGNC:19819])

HSP 1 Score: 281.567 bits (719), Expect = 4.624e-85
Identity = 150/321 (46.73%), Postives = 208/321 (64.80%), Query Frame = 2
Query:  239 LECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNG-DVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQ 1198
            + C++  LDGTD +  L K+A GQ+L D   + +++ +  +YFGL++ D   + HWLD  K ++KQ++IG P+ L  RVKF+SS+P + L +E TRYLFV QLK  + SG+L C   D A ++AA +LQ ELGDYD  EHSP  +S+FRF P   QTEE+EL+I  K+   + R   P+ A+  +L K + L  YGVD H +K ++  DY LGLTP+G+L++EG  KIGLF W  +T+L FKK++  +VV  V+ DD G + EHTFVF+     ACK +WK  VEHHAF+RL G  +  +      RL SRF  S  TEYQ
Sbjct:   43 ITCRVSLLDGTDVSVDLPKKAKGQELFDQIMYHLDLIES-DYFGLRFMDSAQVAHWLDGTKSIKKQVKIGSPYCLHLRVKFYSSEP-NNLREELTRYLFVLQLKQDILSGKLDCP-FDTAVQLAAYNLQAELGDYDLAEHSPELVSEFRFVP--IQTEEMELAIFEKWK--EYRGQTPAQAETNYLNKAKWLEMYGVDMHVVKARDGNDYSLGLTPTGVLVFEGDTKIGLFFWPKITRLDFKKNKLTLVV--VEDDDQGKEQEHTFVFRLDHPKACKHLWKCAVEHHAFFRLRGPVQKSSHRSGFIRLGSRFRYSGKTEYQ 354          
BLAST of Band 4.1-like protein 5 vs. Ensembl Human
Match: EPB41L5 (erythrocyte membrane protein band 4.1 like 5 [Source:HGNC Symbol;Acc:HGNC:19819])

HSP 1 Score: 284.263 bits (726), Expect = 3.290e-84
Identity = 150/321 (46.73%), Postives = 208/321 (64.80%), Query Frame = 2
Query:  239 LECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNG-DVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQ 1198
            + C++  LDGTD +  L K+A GQ+L D   + +++  + +YFGL++ D   + HWLD  K ++KQ++IG P+ L  RVKF+SS+P + L +E TRYLFV QLK  + SG+L C   D A ++AA +LQ ELGDYD  EHSP  +S+FRF P   QTEE+EL+I  K+   + R   P+ A+  +L K + L  YGVD H +K ++  DY LGLTP+G+L++EG  KIGLF W  +T+L FKK++  +VV  V+ DD G + EHTFVF+     ACK +WK  VEHHAF+RL G  +  +      RL SRF  S  TEYQ
Sbjct:   43 ITCRVSLLDGTDVSVDLPKKAKGQELFDQIMYHLDL-IESDYFGLRFMDSAQVAHWLDGTKSIKKQVKIGSPYCLHLRVKFYSSEP-NNLREELTRYLFVLQLKQDILSGKLDCP-FDTAVQLAAYNLQAELGDYDLAEHSPELVSEFRFVP--IQTEEMELAIFEKWK--EYRGQTPAQAETNYLNKAKWLEMYGVDMHVVKARDGNDYSLGLTPTGVLVFEGDTKIGLFFWPKITRLDFKKNKLTLVV--VEDDDQGKEQEHTFVFRLDHPKACKHLWKCAVEHHAFFRLRGPVQKSSHRSGFIRLGSRFRYSGKTEYQ 354          
BLAST of Band 4.1-like protein 5 vs. Ensembl Human
Match: EPB41L5 (erythrocyte membrane protein band 4.1 like 5 [Source:HGNC Symbol;Acc:HGNC:19819])

HSP 1 Score: 285.034 bits (728), Expect = 4.778e-84
Identity = 150/321 (46.73%), Postives = 208/321 (64.80%), Query Frame = 2
Query:  239 LECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNG-DVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQ 1198
            + C++  LDGTD +  L K+A GQ+L D   + +++  + +YFGL++ D   + HWLD  K ++KQ++IG P+ L  RVKF+SS+P + L +E TRYLFV QLK  + SG+L C   D A ++AA +LQ ELGDYD  EHSP  +S+FRF P   QTEE+EL+I  K+   + R   P+ A+  +L K + L  YGVD H +K ++  DY LGLTP+G+L++EG  KIGLF W  +T+L FKK++  +VV  V+ DD G + EHTFVF+     ACK +WK  VEHHAF+RL G  +  +      RL SRF  S  TEYQ
Sbjct:   43 ITCRVSLLDGTDVSVDLPKKAKGQELFDQIMYHLDL-IESDYFGLRFMDSAQVAHWLDGTKSIKKQVKIGSPYCLHLRVKFYSSEP-NNLREELTRYLFVLQLKQDILSGKLDCP-FDTAVQLAAYNLQAELGDYDLAEHSPELVSEFRFVP--IQTEEMELAIFEKWK--EYRGQTPAQAETNYLNKAKWLEMYGVDMHVVKARDGNDYSLGLTPTGVLVFEGDTKIGLFFWPKITRLDFKKNKLTLVV--VEDDDQGKEQEHTFVFRLDHPKACKHLWKCAVEHHAFFRLRGPVQKSSHRSGFIRLGSRFRYSGKTEYQ 354          
BLAST of Band 4.1-like protein 5 vs. Ensembl Human
Match: EPB41L5 (erythrocyte membrane protein band 4.1 like 5 [Source:HGNC Symbol;Acc:HGNC:19819])

HSP 1 Score: 285.034 bits (728), Expect = 5.242e-84
Identity = 150/321 (46.73%), Postives = 208/321 (64.80%), Query Frame = 2
Query:  239 LECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNG-DVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQ 1198
            + C++  LDGTD +  L K+A GQ+L D   + +++  + +YFGL++ D   + HWLD  K ++KQ++IG P+ L  RVKF+SS+P + L +E TRYLFV QLK  + SG+L C   D A ++AA +LQ ELGDYD  EHSP  +S+FRF P   QTEE+EL+I  K+   + R   P+ A+  +L K + L  YGVD H +K ++  DY LGLTP+G+L++EG  KIGLF W  +T+L FKK++  +VV  V+ DD G + EHTFVF+     ACK +WK  VEHHAF+RL G  +  +      RL SRF  S  TEYQ
Sbjct:   43 ITCRVSLLDGTDVSVDLPKKAKGQELFDQIMYHLDL-IESDYFGLRFMDSAQVAHWLDGTKSIKKQVKIGSPYCLHLRVKFYSSEP-NNLREELTRYLFVLQLKQDILSGKLDCP-FDTAVQLAAYNLQAELGDYDLAEHSPELVSEFRFVP--IQTEEMELAIFEKWK--EYRGQTPAQAETNYLNKAKWLEMYGVDMHVVKARDGNDYSLGLTPTGVLVFEGDTKIGLFFWPKITRLDFKKNKLTLVV--VEDDDQGKEQEHTFVFRLDHPKACKHLWKCAVEHHAFFRLRGPVQKSSHRSGFIRLGSRFRYSGKTEYQ 354          
BLAST of Band 4.1-like protein 5 vs. Ensembl Celegans
Match: frm-2 (FERM domain (Protein4.1-ezrin-radixin-moesin) family [Source:UniProtKB/TrEMBL;Acc:Q9GP93])

HSP 1 Score: 277.715 bits (709), Expect = 3.566e-83
Identity = 154/356 (43.26%), Postives = 217/356 (60.96%), Query Frame = 2
Query:  239 LECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVV-QDVQPDDNGDVE-HTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQMAVKXXXXXXXXXXXXXXXAPSLRLAPRASFERN 1300
            ++CK++ LDG      + + A+G +L +  F+ +++ ++++YFGLQYTD  N+ HWLD  KKV KQ+ IGPPFTLRFRVKFF+S+P S L +E TRY F  Q+K  + SG L+C  + +A E+AA +LQ ELGDY+   H+  FIS+FRF PE  Q E++E+ I+ ++     R   P+ A+  +L K R +  YGVD H ++GK+   Y LGLTP G+L+++G  KIGLF W  + KL FK  +  +VV +D    +NG ++ HTFVF      A K  WK  +E HAF+RL+       +  Q FRL S F     TEY+   K     S R+S +F R PS R  PR S   N
Sbjct:   51 VQCKVLLLDGAHLNIVVPRNAVGSELYEEVFYSLDL-EERDYFGLQYTDPFNVQHWLDPTKKVAKQVAIGPPFTLRFRVKFFTSEPSSNLKEELTRYQFFLQIKQDISSGRLQCPHQ-LAIELAAFALQSELGDYNPELHTALFISEFRFHPE--QDEKMEVEILERYKAC--RGQTPAQAELNYLNKARWIEMYGVDMHIVEGKDGNTYRLGLTPQGMLVFDGPQKIGLFLWEKLQKLDFKNKKITLVVEEDADQSNNGQIQLHTFVFHLTSEKAAKHFWKCAIEQHAFFRLKSRPIQANRKIQFFRLGSTFKYRGRTEYETIHKEGARLSRRQSCSFERRPSQRYGPRQSHVTN 400          
BLAST of Band 4.1-like protein 5 vs. Ensembl Celegans
Match: frm-2 (FERM domain (Protein4.1-ezrin-radixin-moesin) family [Source:UniProtKB/TrEMBL;Acc:Q9GP93])

HSP 1 Score: 277.33 bits (708), Expect = 3.897e-83
Identity = 153/356 (42.98%), Postives = 218/356 (61.24%), Query Frame = 2
Query:  239 LECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVV-QDVQPDDNGDVE-HTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQMAVKXXXXXXXXXXXXXXXAPSLRLAPRASFERN 1300
            ++CK++ LDG      + + A+G +L +  F+ +++ ++++YFGLQYTD  N+ HWLD  KKV KQ+ IGPPFTLRFRVKFF+S+P S L +E TRY F  Q+K  + SG L+C  + +A E+AA +LQ ELGDY+   H+  FIS+FRF PE  Q E++E+ I+ ++   + +   P+ A+  +L K R +  YGVD H ++GK+   Y LGLTP G+L+++G  KIGLF W  + KL FK  +  +VV +D    +NG ++ HTFVF      A K  WK  +E HAF+RL+       +  Q FRL S F     TEY+   K     S R+S +F R PS R  PR S   N
Sbjct:   35 VQCKVLLLDGAHLNIVVPRNAVGSELYEEVFYSLDL-EERDYFGLQYTDPFNVQHWLDPTKKVAKQVAIGPPFTLRFRVKFFTSEPSSNLKEELTRYQFFLQIKQDISSGRLQCPHQ-LAIELAAFALQSELGDYNPELHTALFISEFRFHPE--QDEKMEVEILERYKACRGQT--PAQAELNYLNKARWIEMYGVDMHIVEGKDGNTYRLGLTPQGMLVFDGPQKIGLFLWEKLQKLDFKNKKITLVVEEDADQSNNGQIQLHTFVFHLTSEKAAKHFWKCAIEQHAFFRLKSRPIQANRKIQFFRLGSTFKYRGRTEYETIHKEGARLSRRQSCSFERRPSQRYGPRQSHVTN 384          
BLAST of Band 4.1-like protein 5 vs. Ensembl Celegans
Match: frm-2 (FERM domain (Protein4.1-ezrin-radixin-moesin) family [Source:UniProtKB/TrEMBL;Acc:Q9GP93])

HSP 1 Score: 277.33 bits (708), Expect = 3.897e-83
Identity = 153/356 (42.98%), Postives = 218/356 (61.24%), Query Frame = 2
Query:  239 LECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVV-QDVQPDDNGDVE-HTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQMAVKXXXXXXXXXXXXXXXAPSLRLAPRASFERN 1300
            ++CK++ LDG      + + A+G +L +  F+ +++ ++++YFGLQYTD  N+ HWLD  KKV KQ+ IGPPFTLRFRVKFF+S+P S L +E TRY F  Q+K  + SG L+C  + +A E+AA +LQ ELGDY+   H+  FIS+FRF PE  Q E++E+ I+ ++   + +   P+ A+  +L K R +  YGVD H ++GK+   Y LGLTP G+L+++G  KIGLF W  + KL FK  +  +VV +D    +NG ++ HTFVF      A K  WK  +E HAF+RL+       +  Q FRL S F     TEY+   K     S R+S +F R PS R  PR S   N
Sbjct:   35 VQCKVLLLDGAHLNIVVPRNAVGSELYEEVFYSLDL-EERDYFGLQYTDPFNVQHWLDPTKKVAKQVAIGPPFTLRFRVKFFTSEPSSNLKEELTRYQFFLQIKQDISSGRLQCPHQ-LAIELAAFALQSELGDYNPELHTALFISEFRFHPE--QDEKMEVEILERYKACRGQT--PAQAELNYLNKARWIEMYGVDMHIVEGKDGNTYRLGLTPQGMLVFDGPQKIGLFLWEKLQKLDFKNKKITLVVEEDADQSNNGQIQLHTFVFHLTSEKAAKHFWKCAIEQHAFFRLKSRPIQANRKIQFFRLGSTFKYRGRTEYETIHKEGARLSRRQSCSFERRPSQRYGPRQSHVTN 384          
BLAST of Band 4.1-like protein 5 vs. Ensembl Celegans
Match: frm-2 (FERM domain (Protein4.1-ezrin-radixin-moesin) family [Source:UniProtKB/TrEMBL;Acc:Q9GP93])

HSP 1 Score: 277.33 bits (708), Expect = 3.897e-83
Identity = 153/356 (42.98%), Postives = 218/356 (61.24%), Query Frame = 2
Query:  239 LECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVV-QDVQPDDNGDVE-HTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQMAVKXXXXXXXXXXXXXXXAPSLRLAPRASFERN 1300
            ++CK++ LDG      + + A+G +L +  F+ +++ ++++YFGLQYTD  N+ HWLD  KKV KQ+ IGPPFTLRFRVKFF+S+P S L +E TRY F  Q+K  + SG L+C  + +A E+AA +LQ ELGDY+   H+  FIS+FRF PE  Q E++E+ I+ ++   + +   P+ A+  +L K R +  YGVD H ++GK+   Y LGLTP G+L+++G  KIGLF W  + KL FK  +  +VV +D    +NG ++ HTFVF      A K  WK  +E HAF+RL+       +  Q FRL S F     TEY+   K     S R+S +F R PS R  PR S   N
Sbjct:   35 VQCKVLLLDGAHLNIVVPRNAVGSELYEEVFYSLDL-EERDYFGLQYTDPFNVQHWLDPTKKVAKQVAIGPPFTLRFRVKFFTSEPSSNLKEELTRYQFFLQIKQDISSGRLQCPHQ-LAIELAAFALQSELGDYNPELHTALFISEFRFHPE--QDEKMEVEILERYKACRGQT--PAQAELNYLNKARWIEMYGVDMHIVEGKDGNTYRLGLTPQGMLVFDGPQKIGLFLWEKLQKLDFKNKKITLVVEEDADQSNNGQIQLHTFVFHLTSEKAAKHFWKCAIEQHAFFRLKSRPIQANRKIQFFRLGSTFKYRGRTEYETIHKEGARLSRRQSCSFERRPSQRYGPRQSHVTN 384          
BLAST of Band 4.1-like protein 5 vs. Ensembl Celegans
Match: ptp-1 (Tyrosine-protein phosphatase 1 [Source:UniProtKB/Swiss-Prot;Acc:P28191])

HSP 1 Score: 174.096 bits (440), Expect = 1.629e-44
Identity = 111/331 (33.53%), Postives = 176/331 (53.17%), Query Frame = 2
Query:  239 LECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNIN----HWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPA-----FISQFRFFPE--SQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNGDVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQ 1198
            + C +  LD T + F +EK +LG  L +  F+ +E+  +K+YFGL +    N +     WLD  K +RKQ+ I PP+ L FRVKF+  DP ++L DE+TR+ F QQ++  L  G L C++  +A  +A+  +Q E+GD++E  H  +     +  QF   P+  S +  EL    I +          P  A++ FL+  R L  YG+D ++    N     +G+   GI ++   IK+  + W  + KLSFKK +F+V+V     +++G  E   +F       CK +WK C+E H F+RL+   K P +  ++F   S+F  S  TEYQ
Sbjct:   29 IRCTVTFLDSTSYHFEIEKNSLGIVLLEKVFNYLEI-IEKDYFGLVFIAVDNSSAQQKKWLDPSKNLRKQM-ICPPYHLFFRVKFYVRDP-NRLRDEFTRFQFYQQVRQNLEEGRLPCNEGSLAL-LASYVVQAEVGDFEEKTHGMSRTCLCYKIQFATLPDDFSDRVAELHQLHIGQ---------TPDVAEQNFLDHARRLEMYGMDVYDGVDANHLPIEIGVGAVGIKVFHEGIKMNEYAWVRIRKLSFKKKQFQVLVA----NEDGVSETIMIFNIMSAKICKLLWKCCIEQHTFFRLKTPPKTPQR--KVFNFGSKFRYSGRTEYQ 340          
BLAST of Band 4.1-like protein 5 vs. Ensembl Fly
Match: yrt (gene:FBgn0004049 transcript:FBtr0114375)

HSP 1 Score: 298.13 bits (762), Expect = 9.402e-89
Identity = 150/321 (46.73%), Postives = 214/321 (66.67%), Query Frame = 2
Query:  239 LECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNG-DVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQ 1198
            ++C+++ LD TD +  L K+ALG  L +  F+ +++  +K+YFGLQ+ D  ++ HWLD  K ++KQ++IGPP+T R +VKF+SS+P + L +E TRYLF  QLK  L  G L C + D A E+ AL+LQ ELGDYD  EHS A +S+FRF PE  QTE+LE++I+ ++     R + P+ A+  FL K + L  YGVD H + GK+  +Y LGLTP+GIL++E   KIGLF W  ++KL FKK +  ++V  ++ DD G + EHTFVF+ ++  ACK +WK  VEHH F+RL    K P+  Q  FR+ SRF  S  TE+Q
Sbjct:   58 IDCRVILLDNTDLSIELSKKALGSFLYEQVFYALDI-IEKDYFGLQFMDANHVKHWLDPTKPIKKQVKIGPPYTFRLKVKFYSSEP-NTLREELTRYLFFLQLKQDLLEGRLDCPE-DKATELCALALQSELGDYDNQEHSAATVSEFRFVPE--QTEDLEIAILDEYKTC--RGLTPAQAETAFLNKAKWLDMYGVDMHTVLGKDGCEYHLGLTPTGILVFERDQKIGLFFWPKISKLDFKKKKLTLIV--IEDDDEGREQEHTFVFRLYNEKACKHLWKCAVEHHTFFRLRAPVKGPSARQNFFRMGSRFRYSGRTEFQ 369          
BLAST of Band 4.1-like protein 5 vs. Ensembl Fly
Match: yrt (gene:FBgn0004049 transcript:FBtr0114374)

HSP 1 Score: 300.056 bits (767), Expect = 3.160e-88
Identity = 150/321 (46.73%), Postives = 214/321 (66.67%), Query Frame = 2
Query:  239 LECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNG-DVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQ 1198
            ++C+++ LD TD +  L K+ALG  L +  F+ +++  +K+YFGLQ+ D  ++ HWLD  K ++KQ++IGPP+T R +VKF+SS+P + L +E TRYLF  QLK  L  G L C + D A E+ AL+LQ ELGDYD  EHS A +S+FRF PE  QTE+LE++I+ ++     R + P+ A+  FL K + L  YGVD H + GK+  +Y LGLTP+GIL++E   KIGLF W  ++KL FKK +  ++V  ++ DD G + EHTFVF+ ++  ACK +WK  VEHH F+RL    K P+  Q  FR+ SRF  S  TE+Q
Sbjct:   58 IDCRVILLDNTDLSIELSKKALGSFLYEQVFYALDI-IEKDYFGLQFMDANHVKHWLDPTKPIKKQVKIGPPYTFRLKVKFYSSEP-NTLREELTRYLFFLQLKQDLLEGRLDCPE-DKATELCALALQSELGDYDNQEHSAATVSEFRFVPE--QTEDLEIAILDEYKTC--RGLTPAQAETAFLNKAKWLDMYGVDMHTVLGKDGCEYHLGLTPTGILVFERDQKIGLFFWPKISKLDFKKKKLTLIV--IEDDDEGREQEHTFVFRLYNEKACKHLWKCAVEHHTFFRLRAPVKGPSARQNFFRMGSRFRYSGRTEFQ 369          
BLAST of Band 4.1-like protein 5 vs. Ensembl Fly
Match: yrt (gene:FBgn0004049 transcript:FBtr0114376)

HSP 1 Score: 299.671 bits (766), Expect = 3.315e-88
Identity = 150/321 (46.73%), Postives = 214/321 (66.67%), Query Frame = 2
Query:  239 LECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNG-DVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQ 1198
            ++C+++ LD TD +  L K+ALG  L +  F+ +++  +K+YFGLQ+ D  ++ HWLD  K ++KQ++IGPP+T R +VKF+SS+P + L +E TRYLF  QLK  L  G L C + D A E+ AL+LQ ELGDYD  EHS A +S+FRF PE  QTE+LE++I+ ++     R + P+ A+  FL K + L  YGVD H + GK+  +Y LGLTP+GIL++E   KIGLF W  ++KL FKK +  ++V  ++ DD G + EHTFVF+ ++  ACK +WK  VEHH F+RL    K P+  Q  FR+ SRF  S  TE+Q
Sbjct:   58 IDCRVILLDNTDLSIELSKKALGSFLYEQVFYALDI-IEKDYFGLQFMDANHVKHWLDPTKPIKKQVKIGPPYTFRLKVKFYSSEP-NTLREELTRYLFFLQLKQDLLEGRLDCPE-DKATELCALALQSELGDYDNQEHSAATVSEFRFVPE--QTEDLEIAILDEYKTC--RGLTPAQAETAFLNKAKWLDMYGVDMHTVLGKDGCEYHLGLTPTGILVFERDQKIGLFFWPKISKLDFKKKKLTLIV--IEDDDEGREQEHTFVFRLYNEKACKHLWKCAVEHHTFFRLRAPVKGPSARQNFFRMGSRFRYSGRTEFQ 369          
BLAST of Band 4.1-like protein 5 vs. Ensembl Fly
Match: yrt (gene:FBgn0004049 transcript:FBtr0082793)

HSP 1 Score: 300.056 bits (767), Expect = 5.276e-88
Identity = 150/321 (46.73%), Postives = 214/321 (66.67%), Query Frame = 2
Query:  239 LECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNG-DVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQ 1198
            ++C+++ LD TD +  L K+ALG  L +  F+ +++  +K+YFGLQ+ D  ++ HWLD  K ++KQ++IGPP+T R +VKF+SS+P + L +E TRYLF  QLK  L  G L C + D A E+ AL+LQ ELGDYD  EHS A +S+FRF PE  QTE+LE++I+ ++     R + P+ A+  FL K + L  YGVD H + GK+  +Y LGLTP+GIL++E   KIGLF W  ++KL FKK +  ++V  ++ DD G + EHTFVF+ ++  ACK +WK  VEHH F+RL    K P+  Q  FR+ SRF  S  TE+Q
Sbjct:   58 IDCRVILLDNTDLSIELSKKALGSFLYEQVFYALDI-IEKDYFGLQFMDANHVKHWLDPTKPIKKQVKIGPPYTFRLKVKFYSSEP-NTLREELTRYLFFLQLKQDLLEGRLDCPE-DKATELCALALQSELGDYDNQEHSAATVSEFRFVPE--QTEDLEIAILDEYKTC--RGLTPAQAETAFLNKAKWLDMYGVDMHTVLGKDGCEYHLGLTPTGILVFERDQKIGLFFWPKISKLDFKKKKLTLIV--IEDDDEGREQEHTFVFRLYNEKACKHLWKCAVEHHTFFRLRAPVKGPSARQNFFRMGSRFRYSGRTEFQ 369          
BLAST of Band 4.1-like protein 5 vs. Ensembl Fly
Match: CG34347 (gene:FBgn0085376 transcript:FBtr0334566)

HSP 1 Score: 188.348 bits (477), Expect = 7.674e-49
Identity = 111/317 (35.02%), Postives = 175/317 (55.21%), Query Frame = 2
Query:  239 LECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEI-GPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNGDVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQ-----IFRLKSRF 1171
            +  +I  LD T+F   ++    GQ L D  F ++ +  + +YFG++Y D++N  HWLD   ++ +QL+    P+ L F VKF+++DPC +L +E TRY    Q+K  +  G L     ++AAE+ A  +Q ELGDYD+  HS  ++S+FR  P   Q+ ELE  +      LK   + PS+A+  +L+K +    YGVD H + G++  +Y LGLTPSGI++   +  +  + W  + K+ +K   F + + D           T+ F++    ACK +W+ CVEHHAF+R   VR  P    Q     +F+L SRF
Sbjct:   11 MSVRINLLDETEFIHEIKDDLPGQALLDVVFARLNL-IETSYFGIRYIDEENQTHWLDPASRISRQLKPKSDPYDLYFGVKFYAADPC-KLLEEITRYQLFLQVKQDVLQGRLPVA-FELAAELGAFVVQSELGDYDQRRHSKGYVSEFRLLPN--QSNELETRVSELHQQLK--GMSPSSAELNYLDKVKWHDMYGVDLHPVLGEDSVEYFLGLTPSGIVVLRNKTTVAHYYWPRIAKVYYKGRYFMLRISDKNLS-------TYGFETPRKSACKHLWRCCVEHHAFFRQ--VRVAPLPSSQSHAADLFQLGSRF 311          
BLAST of Band 4.1-like protein 5 vs. Ensembl Zebrafish
Match: epb41l5 (erythrocyte membrane protein band 4.1 like 5 [Source:ZFIN;Acc:ZDB-GENE-030616-450])

HSP 1 Score: 275.789 bits (704), Expect = 1.218e-83
Identity = 145/327 (44.34%), Postives = 209/327 (63.91%), Query Frame = 2
Query:  239 LECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKD-RNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVV-----QDVQPDDNG-DVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQ 1198
            + C++  LDGTD +  L K+A G +L +   + ++V + K+YFGL++ D   + HWLD+ K ++KQ++IGPP+ L  RVKF+SS+P + LH+E TRYLFV QLK  + SG+L C   D   E+A+ +LQ ELGDYD  EH    +S+FRF P   QTE++E++I   +N  K+ R   P+ A+  +L K + L  YGVD H +K ++  +Y LGLTP+G+L++EG+ KIGLF W  +T+L FKK +  +VV     Q +Q  + G + EHTFVF+     ACK +WK  VEHHAF+RL G  +  +      R+ SRF  S  TEYQ
Sbjct:   43 ITCRVSLLDGTDVSVDLPKKAKGAELFEQIMYHLDVVE-KDYFGLRFMDSAQVPHWLDVTKSIKKQVKIGPPYCLHMRVKFYSSEP-NNLHEELTRYLFVLQLKQDILSGKLECP-FDTTVELASYALQAELGDYDPAEHGLDLVSEFRFIP--NQTEDMEVAI---YNAWKECRGQTPAQAEINYLNKAKWLEMYGVDMHMVKARDGNEYSLGLTPTGVLVFEGETKIGLFFWPKITRLDFKKCKLTLVVVEDDEQVMQETEEGKEQEHTFVFRMDHPKACKHLWKCAVEHHAFFRLRGPVQKSSARSGFIRMGSRFRYSGKTEYQ 361          
BLAST of Band 4.1-like protein 5 vs. Ensembl Zebrafish
Match: epb41l5 (erythrocyte membrane protein band 4.1 like 5 [Source:ZFIN;Acc:ZDB-GENE-030616-450])

HSP 1 Score: 275.404 bits (703), Expect = 1.370e-83
Identity = 145/327 (44.34%), Postives = 209/327 (63.91%), Query Frame = 2
Query:  239 LECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKD-RNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVV-----QDVQPDDNG-DVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQ 1198
            + C++  LDGTD +  L K+A G +L +   + ++V + K+YFGL++ D   + HWLD+ K ++KQ++IGPP+ L  RVKF+SS+P + LH+E TRYLFV QLK  + SG+L C   D   E+A+ +LQ ELGDYD  EH    +S+FRF P   QTE++E++I   +N  K+ R   P+ A+  +L K + L  YGVD H +K ++  +Y LGLTP+G+L++EG+ KIGLF W  +T+L FKK +  +VV     Q +Q  + G + EHTFVF+     ACK +WK  VEHHAF+RL G  +  +      R+ SRF  S  TEYQ
Sbjct:   43 ITCRVSLLDGTDVSVDLPKKAKGAELFEQIMYHLDVVE-KDYFGLRFMDSAQVPHWLDVTKSIKKQVKIGPPYCLHMRVKFYSSEP-NNLHEELTRYLFVLQLKQDILSGKLECP-FDTTVELASYALQAELGDYDPAEHGLDLVSEFRFIP--NQTEDMEVAI---YNAWKECRGQTPAQAEINYLNKAKWLEMYGVDMHMVKARDGNEYSLGLTPTGVLVFEGETKIGLFFWPKITRLDFKKCKLTLVVVEDDEQVMQETEEGKEQEHTFVFRMDHPKACKHLWKCAVEHHAFFRLRGPVQKSSARSGFIRMGSRFRYSGKTEYQ 361          
BLAST of Band 4.1-like protein 5 vs. Ensembl Zebrafish
Match: epb41l5 (erythrocyte membrane protein band 4.1 like 5 [Source:ZFIN;Acc:ZDB-GENE-030616-450])

HSP 1 Score: 281.952 bits (720), Expect = 9.656e-83
Identity = 145/322 (45.03%), Postives = 209/322 (64.91%), Query Frame = 2
Query:  239 LECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKD-RNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNG-DVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQ 1198
            + C++  LDGTD +  L K+A G +L +   + ++V + K+YFGL++ D   + HWLD+ K ++KQ++IGPP+ L  RVKF+SS+P + LH+E TRYLFV QLK  + SG+L C   D   E+A+ +LQ ELGDYD  EH    +S+FRF P   QTE++E++I   +N  K+ R   P+ A+  +L K + L  YGVD H +K ++  +Y LGLTP+G+L++EG+ KIGLF W  +T+L FKK +  +VV  V+ D+ G + EHTFVF+     ACK +WK  VEHHAF+RL G  +  +      R+ SRF  S  TEYQ
Sbjct:   43 ITCRVSLLDGTDVSVDLPKKAKGAELFEQIMYHLDVVE-KDYFGLRFMDSAQVPHWLDVTKSIKKQVKIGPPYCLHMRVKFYSSEP-NNLHEELTRYLFVLQLKQDILSGKLECP-FDTTVELASYALQAELGDYDPAEHGLDLVSEFRFIP--NQTEDMEVAI---YNAWKECRGQTPAQAEINYLNKAKWLEMYGVDMHMVKARDGNEYSLGLTPTGVLVFEGETKIGLFFWPKITRLDFKKCKLTLVV--VEDDEQGKEQEHTFVFRMDHPKACKHLWKCAVEHHAFFRLRGPVQKSSARSGFIRMGSRFRYSGKTEYQ 354          
BLAST of Band 4.1-like protein 5 vs. Ensembl Zebrafish
Match: epb41l5 (erythrocyte membrane protein band 4.1 like 5 [Source:ZFIN;Acc:ZDB-GENE-030616-450])

HSP 1 Score: 279.256 bits (713), Expect = 9.771e-82
Identity = 145/327 (44.34%), Postives = 209/327 (63.91%), Query Frame = 2
Query:  239 LECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKD-RNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVV-----QDVQPDDNG-DVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQ 1198
            + C++  LDGTD +  L K+A G +L +   + ++V + K+YFGL++ D   + HWLD+ K ++KQ++IGPP+ L  RVKF+SS+P + LH+E TRYLFV QLK  + SG+L C   D   E+A+ +LQ ELGDYD  EH    +S+FRF P   QTE++E++I   +N  K+ R   P+ A+  +L K + L  YGVD H +K ++  +Y LGLTP+G+L++EG+ KIGLF W  +T+L FKK +  +VV     Q +Q  + G + EHTFVF+     ACK +WK  VEHHAF+RL G  +  +      R+ SRF  S  TEYQ
Sbjct:   43 ITCRVSLLDGTDVSVDLPKKAKGAELFEQIMYHLDVVE-KDYFGLRFMDSAQVPHWLDVTKSIKKQVKIGPPYCLHMRVKFYSSEP-NNLHEELTRYLFVLQLKQDILSGKLECP-FDTTVELASYALQAELGDYDPAEHGLDLVSEFRFIP--NQTEDMEVAI---YNAWKECRGQTPAQAEINYLNKAKWLEMYGVDMHMVKARDGNEYSLGLTPTGVLVFEGETKIGLFFWPKITRLDFKKCKLTLVVVEDDEQVMQETEEGKEQEHTFVFRMDHPKACKHLWKCAVEHHAFFRLRGPVQKSSARSGFIRMGSRFRYSGKTEYQ 361          
BLAST of Band 4.1-like protein 5 vs. Ensembl Zebrafish
Match: epb41l5 (erythrocyte membrane protein band 4.1 like 5 [Source:ZFIN;Acc:ZDB-GENE-030616-450])

HSP 1 Score: 279.256 bits (713), Expect = 1.294e-81
Identity = 145/327 (44.34%), Postives = 209/327 (63.91%), Query Frame = 2
Query:  239 LECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKD-RNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVV-----QDVQPDDNG-DVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQ 1198
            + C++  LDGTD +  L K+A G +L +   + ++V + K+YFGL++ D   + HWLD+ K ++KQ++IGPP+ L  RVKF+SS+P + LH+E TRYLFV QLK  + SG+L C   D   E+A+ +LQ ELGDYD  EH    +S+FRF P   QTE++E++I   +N  K+ R   P+ A+  +L K + L  YGVD H +K ++  +Y LGLTP+G+L++EG+ KIGLF W  +T+L FKK +  +VV     Q +Q  + G + EHTFVF+     ACK +WK  VEHHAF+RL G  +  +      R+ SRF  S  TEYQ
Sbjct:   43 ITCRVSLLDGTDVSVDLPKKAKGAELFEQIMYHLDVVE-KDYFGLRFMDSAQVPHWLDVTKSIKKQVKIGPPYCLHMRVKFYSSEP-NNLHEELTRYLFVLQLKQDILSGKLECP-FDTTVELASYALQAELGDYDPAEHGLDLVSEFRFIP--NQTEDMEVAI---YNAWKECRGQTPAQAEINYLNKAKWLEMYGVDMHMVKARDGNEYSLGLTPTGVLVFEGETKIGLFFWPKITRLDFKKCKLTLVVVEDDEQVMQETEEGKEQEHTFVFRMDHPKACKHLWKCAVEHHAFFRLRGPVQKSSARSGFIRMGSRFRYSGKTEYQ 361          
BLAST of Band 4.1-like protein 5 vs. Ensembl Xenopus
Match: ptpn4 (protein tyrosine phosphatase, non-receptor type 4 (megakaryocyte) [Source:NCBI gene;Acc:100036600])

HSP 1 Score: 202.986 bits (515), Expect = 5.854e-57
Identity = 120/334 (35.93%), Postives = 187/334 (55.99%), Query Frame = 2
Query:  206 SEMQTRLKDTDLECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNIN-HWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNGDVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTK--FQQIFRLKSRFYASFHTEYQ 1198
            SE     +  ++ C ++ LD T   F + K + GQ L D  F  +++ + ++YFGLQ  D    N  WLD  K +RKQL+ G P  L FRVKFF SDP S+L +EYTRY +  Q+K  + +G L C   + AA +A+ + Q ELGDY+  EH P +++++ + PE     E E++ + +    + R + P+ A+  +L   RTL  YGV+ H  + +++ + ++G+   GILIY+ +++I  FPW  + K+SFK  +F + ++    +     E    F   +  ACK +WK+CVEHH F+RL+    PP K  F   F L S+F     TE Q
Sbjct:   18 SEQARDRQSAEVVCNVLLLDNTIQAFHVNKHSHGQVLLDSVFKFLDLTE-RDYFGLQLADDSCDNPRWLDPNKPIRKQLKRGSPHNLNFRVKFFVSDP-SKLQEEYTRYQYFLQIKQDVLTGRLPCP-YNTAALLASYAAQSELGDYNHSEHLPGYLAEYSYVPEQPLDFEKEIAKLHQ----QHRGLSPAEAEFSYLNAARTLELYGVELHYARDQSNNEILIGVMSGGILIYKNRVRINTFPWLKIVKISFKCKQFFIQLRKELLEYR---ETVLGFNMVNYRACKNLWKACVEHHTFFRLDSP-LPPQKNFFAHYFTLGSKFRYCGRTEVQ 340          
BLAST of Band 4.1-like protein 5 vs. Ensembl Xenopus
Match: nme7 (NME/NM23 family member 7 [Source:Xenbase;Acc:XB-GENE-987403])

HSP 1 Score: 200.675 bits (509), Expect = 1.373e-56
Identity = 113/253 (44.66%), Postives = 157/253 (62.06%), Query Frame = 2
Query:  443 IGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNG-DVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQ 1198
            IGPP+TL F++K++SS+P + L +E+TRY+   Q+ L      L+C   + A E+AAL LQ ELG+ +  EH+P  +S+FRF     QTE +EL I  K+   + +   P+ A+  +L K + L  YGVD H +KG++  DY LGLTP+GILI+EG  KIGLF W  +TK+ FKKS  K+ ++ V+ D+ G + EHTFVF+  +   CK +WK  VEHHAF+RL              RL SRF  S  TEYQ
Sbjct:   51 IGPPYTLHFQIKYYSSEP-NNLREEFTRYVSHTQICLFF-FFRLKCP-YETAVELAALCLQAELGECEHPEHTPELVSEFRFI--QNQTEAMELDIFHKWTDCRGKT--PAQAELCYLNKAKWLEMYGVDMHLVKGRDGCDYALGLTPTGILIFEGSTKIGLFFWPKITKMDFKKS--KLTLEVVEDDEQGREQEHTFVFRLDNSKVCKHLWKCAVEHHAFFRLRTPANNKPNRSDFIRLGSRFRFSGRTEYQ 294          
BLAST of Band 4.1-like protein 5 vs. Ensembl Xenopus
Match: epb41l4a (erythrocyte membrane protein band 4.1 like 4A [Source:NCBI gene;Acc:448757])

HSP 1 Score: 205.682 bits (522), Expect = 6.242e-56
Identity = 116/332 (34.94%), Postives = 191/332 (57.53%), Query Frame = 2
Query:  245 CKIVHLDGTDFTFFLEKRAL-----GQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKV---RKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVV--QDVQPDDNGDVEHTFVFQSFDIVACKQMWKSCVEHHAFYRL--EGVRKPPTKFQQIFRLKSRFYASFHTEYQMA 1204
            C+++ LD +      +++ +     G  + DY F  + + +  +YFGL+Y D+ +  +WLD  K +   R  +  GPP+TL F VKF++ DPC +L +E TRY F  Q+K  +  G L C   ++AA++ A ++Q ELGDYD  +H   ++S++RF P+  Q E+LE +I      L  +  +P+ A+  +L   ++L  YGVD H + G+N+ +Y LGLTP G+ +Y+ + ++G + W  +TKL FK+++F+V V  +D         E +F F++ + V+CK +WK CVEHH F+R+          K  ++  L SR   S  T YQM+
Sbjct:   13 CEVLLLDESKLPLTCQQQGVKKSTKGSVVLDYVFRHLNLVE-IDYFGLRYCDRNHQTYWLDPMKTISEHRDLISTGPPYTLYFGVKFYAEDPC-KLKEEITRYQFFLQVKQDVLQGRLPCP-FNIAAQLGAYAIQSELGDYDPFKHVTGYVSEYRFVPD--QKEDLEEAIEKIHKTLMGQ--VPAVAESNYLGVAKSLEMYGVDLHPVYGENNSEYFLGLTPVGLFVYKNKKQVGKYYWPRITKLHFKETQFEVRVLGKDC-------TETSFFFETRNKVSCKSLWKCCVEHHTFFRIPENDSSTLSRKLSKLGSLGSRHRYSGRTAYQMS 330          
BLAST of Band 4.1-like protein 5 vs. Ensembl Xenopus
Match: epb41l4a (erythrocyte membrane protein band 4.1 like 4A [Source:NCBI gene;Acc:448757])

HSP 1 Score: 204.912 bits (520), Expect = 1.291e-55
Identity = 116/332 (34.94%), Postives = 191/332 (57.53%), Query Frame = 2
Query:  245 CKIVHLDGTDFTFFLEKRAL-----GQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKV---RKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVV--QDVQPDDNGDVEHTFVFQSFDIVACKQMWKSCVEHHAFYRL--EGVRKPPTKFQQIFRLKSRFYASFHTEYQMA 1204
            C+++ LD +      +++ +     G  + DY F  + + +  +YFGL+Y D+ +  +WLD  K +   R  +  GPP+TL F VKF++ DPC +L +E TRY F  Q+K  +  G L C   ++AA++ A ++Q ELGDYD  +H   ++S++RF P+  Q E+LE +I      L  +  +P+ A+  +L   ++L  YGVD H + G+N+ +Y LGLTP G+ +Y+ + ++G + W  +TKL FK+++F+V V  +D         E +F F++ + V+CK +WK CVEHH F+R+          K  ++  L SR   S  T YQM+
Sbjct:   13 CEVLLLDESKLPLTCQQQGVKKSTKGSVVLDYVFRHLNLVE-IDYFGLRYCDRNHQTYWLDPMKTISEHRDLISTGPPYTLYFGVKFYAEDPC-KLKEEITRYQFFLQVKQDVLQGRLPCPF-NIAAQLGAYAIQSELGDYDPFKHVTGYVSEYRFVPD--QKEDLEEAIEKIHKTLMGQ--VPAVAESNYLGVAKSLEMYGVDLHPVYGENNSEYFLGLTPVGLFVYKNKKQVGKYYWPRITKLHFKETQFEVRVLGKDC-------TETSFFFETRNKVSCKSLWKCCVEHHTFFRIPENDSSTLSRKLSKLGSLGSRHRYSGRTAYQMS 330          
BLAST of Band 4.1-like protein 5 vs. Ensembl Xenopus
Match: epb41l4a (erythrocyte membrane protein band 4.1 like 4A [Source:NCBI gene;Acc:448757])

HSP 1 Score: 203.756 bits (517), Expect = 1.504e-55
Identity = 115/329 (34.95%), Postives = 189/329 (57.45%), Query Frame = 2
Query:  245 CKIVHLDGTDFTFFLEKRAL-----GQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKV--RKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNGDVEHTFVFQSFDIVACKQMWKSCVEHHAFYRL--EGVRKPPTKFQQIFRLKSRFYASFHTEYQMA 1204
            C+++ LD +      +++ +     G  + DY F  + + +  +YFGL+Y D+ +  +WLD  K +   + L  GPP+TL F VKF++ DPC +L +E TRY F  Q+K  +  G L C   ++AA++ A ++Q ELGDYD  +H   ++S++RF P+  Q E+LE +I      L  +  +P+ A+  +L   ++L  YGVD H + G+N+ +Y LGLTP G+ +Y+ + ++G + W  +TKL FK+++F+V V           E +F F++ + V+CK +WK CVEHH F+R+          K  ++  L SR   S  T YQM+
Sbjct:   13 CEVLLLDESKLPLTCQQQGVKKSTKGSVVLDYVFRHLNLVEI-DYFGLRYCDRNHQTYWLDPMKTISEHRDLITGPPYTLYFGVKFYAEDPC-KLKEEITRYQFFLQVKQDVLQGRLPCPF-NIAAQLGAYAIQSELGDYDPFKHVTGYVSEYRFVPD--QKEDLEEAIEKIHKTLMGQ--VPAVAESNYLGVAKSLEMYGVDLHPVYGENNSEYFLGLTPVGLFVYKNKKQVGKYYWPRITKLHFKETQFEVRVL-----GKDCTETSFFFETRNKVSCKSLWKCCVEHHTFFRIPENDSSTLSRKLSKLGSLGSRHRYSGRTAYQMS 329          
BLAST of Band 4.1-like protein 5 vs. Ensembl Mouse
Match: Epb41l5 (erythrocyte membrane protein band 4.1 like 5 [Source:MGI Symbol;Acc:MGI:103006])

HSP 1 Score: 283.878 bits (725), Expect = 3.811e-86
Identity = 150/321 (46.73%), Postives = 209/321 (65.11%), Query Frame = 2
Query:  239 LECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNG-DVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQ 1198
            + C++  LDGTD +  L K+A GQ+L D   + +++ +  +YFGL++ D   + HWLD  K ++KQ++IG P+ L  RVKF+SS+P + L +E TRYLFV QLK  + SG+L C   D A ++AA +LQ ELGDYD  EHSP  +S+FRF P   QTEE+EL+I  K+   + R   P+ A+  +L K + L  YGVD H +K ++  DY LGLTP+G+L++EG+ KIGLF W  +T+L FKK++  +VV  V+ DD G + EHTFVF+     ACK +WK  VEHHAF+RL G  +  +      RL SRF  S  TEYQ
Sbjct:   43 ITCRVSLLDGTDVSVDLPKKAKGQELFDQIMYHLDLIES-DYFGLRFMDSAQVAHWLDGTKSIKKQVKIGSPYCLHLRVKFYSSEP-NNLREELTRYLFVLQLKQDILSGKLECP-FDTAVQLAAYNLQAELGDYDLAEHSPELVSEFRFVP--IQTEEMELAIFEKWK--EYRGQTPAQAETNYLNKAKWLEMYGVDMHVVKARDGNDYSLGLTPTGVLVFEGETKIGLFFWPKITRLDFKKNKLTLVV--VEDDDQGKEQEHTFVFRLDHPKACKHLWKCAVEHHAFFRLRGPVQKSSHRSGFIRLGSRFRYSGKTEYQ 354          
BLAST of Band 4.1-like protein 5 vs. Ensembl Mouse
Match: Epb41l5 (erythrocyte membrane protein band 4.1 like 5 [Source:MGI Symbol;Acc:MGI:103006])

HSP 1 Score: 283.878 bits (725), Expect = 3.811e-86
Identity = 150/321 (46.73%), Postives = 209/321 (65.11%), Query Frame = 2
Query:  239 LECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNG-DVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQ 1198
            + C++  LDGTD +  L K+A GQ+L D   + +++ +  +YFGL++ D   + HWLD  K ++KQ++IG P+ L  RVKF+SS+P + L +E TRYLFV QLK  + SG+L C   D A ++AA +LQ ELGDYD  EHSP  +S+FRF P   QTEE+EL+I  K+   + R   P+ A+  +L K + L  YGVD H +K ++  DY LGLTP+G+L++EG+ KIGLF W  +T+L FKK++  +VV  V+ DD G + EHTFVF+     ACK +WK  VEHHAF+RL G  +  +      RL SRF  S  TEYQ
Sbjct:   43 ITCRVSLLDGTDVSVDLPKKAKGQELFDQIMYHLDLIES-DYFGLRFMDSAQVAHWLDGTKSIKKQVKIGSPYCLHLRVKFYSSEP-NNLREELTRYLFVLQLKQDILSGKLECP-FDTAVQLAAYNLQAELGDYDLAEHSPELVSEFRFVP--IQTEEMELAIFEKWK--EYRGQTPAQAETNYLNKAKWLEMYGVDMHVVKARDGNDYSLGLTPTGVLVFEGETKIGLFFWPKITRLDFKKNKLTLVV--VEDDDQGKEQEHTFVFRLDHPKACKHLWKCAVEHHAFFRLRGPVQKSSHRSGFIRLGSRFRYSGKTEYQ 354          
BLAST of Band 4.1-like protein 5 vs. Ensembl Mouse
Match: Epb41l5 (erythrocyte membrane protein band 4.1 like 5 [Source:MGI Symbol;Acc:MGI:103006])

HSP 1 Score: 286.574 bits (732), Expect = 9.018e-85
Identity = 150/321 (46.73%), Postives = 209/321 (65.11%), Query Frame = 2
Query:  239 LECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNG-DVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQ 1198
            + C++  LDGTD +  L K+A GQ+L D   + +++ +  +YFGL++ D   + HWLD  K ++KQ++IG P+ L  RVKF+SS+P + L +E TRYLFV QLK  + SG+L C   D A ++AA +LQ ELGDYD  EHSP  +S+FRF P   QTEE+EL+I  K+   + R   P+ A+  +L K + L  YGVD H +K ++  DY LGLTP+G+L++EG+ KIGLF W  +T+L FKK++  +VV  V+ DD G + EHTFVF+     ACK +WK  VEHHAF+RL G  +  +      RL SRF  S  TEYQ
Sbjct:   43 ITCRVSLLDGTDVSVDLPKKAKGQELFDQIMYHLDLIE-SDYFGLRFMDSAQVAHWLDGTKSIKKQVKIGSPYCLHLRVKFYSSEP-NNLREELTRYLFVLQLKQDILSGKLECP-FDTAVQLAAYNLQAELGDYDLAEHSPELVSEFRFVP--IQTEEMELAIFEKWK--EYRGQTPAQAETNYLNKAKWLEMYGVDMHVVKARDGNDYSLGLTPTGVLVFEGETKIGLFFWPKITRLDFKKNKLTLVV--VEDDDQGKEQEHTFVFRLDHPKACKHLWKCAVEHHAFFRLRGPVQKSSHRSGFIRLGSRFRYSGKTEYQ 354          
BLAST of Band 4.1-like protein 5 vs. Ensembl Mouse
Match: Epb41l5 (erythrocyte membrane protein band 4.1 like 5 [Source:MGI Symbol;Acc:MGI:103006])

HSP 1 Score: 286.574 bits (732), Expect = 1.193e-84
Identity = 150/321 (46.73%), Postives = 209/321 (65.11%), Query Frame = 2
Query:  239 LECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNG-DVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQ 1198
            + C++  LDGTD +  L K+A GQ+L D   + +++ +  +YFGL++ D   + HWLD  K ++KQ++IG P+ L  RVKF+SS+P + L +E TRYLFV QLK  + SG+L C   D A ++AA +LQ ELGDYD  EHSP  +S+FRF P   QTEE+EL+I  K+   + R   P+ A+  +L K + L  YGVD H +K ++  DY LGLTP+G+L++EG+ KIGLF W  +T+L FKK++  +VV  V+ DD G + EHTFVF+     ACK +WK  VEHHAF+RL G  +  +      RL SRF  S  TEYQ
Sbjct:   43 ITCRVSLLDGTDVSVDLPKKAKGQELFDQIMYHLDLIE-SDYFGLRFMDSAQVAHWLDGTKSIKKQVKIGSPYCLHLRVKFYSSEP-NNLREELTRYLFVLQLKQDILSGKLECP-FDTAVQLAAYNLQAELGDYDLAEHSPELVSEFRFVP--IQTEEMELAIFEKWK--EYRGQTPAQAETNYLNKAKWLEMYGVDMHVVKARDGNDYSLGLTPTGVLVFEGETKIGLFFWPKITRLDFKKNKLTLVV--VEDDDQGKEQEHTFVFRLDHPKACKHLWKCAVEHHAFFRLRGPVQKSSHRSGFIRLGSRFRYSGKTEYQ 354          
BLAST of Band 4.1-like protein 5 vs. Ensembl Mouse
Match: Epb41l4b (erythrocyte membrane protein band 4.1 like 4b [Source:MGI Symbol;Acc:MGI:1859149])

HSP 1 Score: 269.24 bits (687), Expect = 2.482e-80
Identity = 142/321 (44.24%), Postives = 204/321 (63.55%), Query Frame = 2
Query:  239 LECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNG-DVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQ 1198
            L C++  LDGT+ +  L K A GQ L D   + +++ +  +YFGLQ+ D   + HWLD  K ++KQ+++GP + L FRVK++SS+P + L +E+TRYLFV QL+  + SG+L+C   + A E+AAL LQ ELG+ +  EH+P  +S+FRF P   QTE +E  I  ++   + ++  P+ A+  +L K + L  YGVD H ++G++  +Y LGLTP+GILI+EG  KIGLF W  +TK+ FKKS+  +VV  V+ DD G + EHTFVF+      CK +WK  VEHHAF+RL       +      RL SRF  S  TEYQ
Sbjct:   85 LYCRVFLLDGTEVSVDLPKHAKGQDLFDQIVYHLDLVE-TDYFGLQFLDSAQVTHWLDHAKPIKKQMKVGPAYALHFRVKYYSSEP-NNLREEFTRYLFVLQLRHDILSGKLKCP-YETAVELAALCLQAELGECELPEHTPELVSEFRFIP--NQTEAMEFDIFQRWKEYRGKS--PAQAELSYLNKAKWLEMYGVDMHVVRGRDGCEYSLGLTPTGILIFEGANKIGLFFWPKITKMDFKKSKLTLVV--VEDDDQGREQEHTFVFRLDSARTCKHLWKCAVEHHAFFRLRTPSNSKSARSDFIRLGSRFRFSGRTEYQ 396          
BLAST of Band 4.1-like protein 5 vs. UniProt/SwissProt
Match: sp|Q58CU2|E41L5_BOVIN (Band 4.1-like protein 5 OS=Bos taurus OX=9913 GN=EPB41L5 PE=2 SV=1)

HSP 1 Score: 283.108 bits (723), Expect = 4.617e-85
Identity = 150/321 (46.73%), Postives = 209/321 (65.11%), Query Frame = 2
Query:  239 LECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNG-DVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQ 1198
            + C++  LDGTD +  L K+A GQ+L D   + +++ +  +YFGL++ D   + HWLD  K ++KQ++IG P+ L  RVKF+SS+P + L +E TRYLFV QLK  + SG+L C   D A ++AA +LQ ELGDYD  EHSP  +S+FRF P   QTEE+EL+I  K+   + R   P+ A+  +L K + L  YGVD H +K ++  DY LGLTP+G+L++EG+ KIGLF W  +T+L FKK++  +VV  V+ DD G + EHTFVF+     ACK +WK  VEHHAF+RL G  +  +      RL SRF  S  TEYQ
Sbjct:   43 ITCRVSLLDGTDVSVDLPKKAKGQELFDQIMYHLDLIES-DYFGLRFMDSAQVAHWLDGTKSIKKQVKIGSPYCLHLRVKFYSSEP-NNLREELTRYLFVLQLKQDILSGKLECP-FDTAVQLAAYNLQAELGDYDLAEHSPELVSEFRFVP--IQTEEMELAIFEKWK--EYRGQTPAQAETNYLNKAKWLEMYGVDMHVVKARDGNDYSLGLTPTGVLVFEGETKIGLFFWPKITRLDFKKNKLTLVV--VEDDDQGKEQEHTFVFRLDHPKACKHLWKCAVEHHAFFRLRGPVQKNSHRSGFIRLGSRFRYSGKTEYQ 354          
BLAST of Band 4.1-like protein 5 vs. UniProt/SwissProt
Match: sp|Q8BGS1|E41L5_MOUSE (Band 4.1-like protein 5 OS=Mus musculus OX=10090 GN=Epb41l5 PE=1 SV=1)

HSP 1 Score: 286.574 bits (732), Expect = 6.308e-84
Identity = 150/321 (46.73%), Postives = 209/321 (65.11%), Query Frame = 2
Query:  239 LECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNG-DVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQ 1198
            + C++  LDGTD +  L K+A GQ+L D   + +++ +  +YFGL++ D   + HWLD  K ++KQ++IG P+ L  RVKF+SS+P + L +E TRYLFV QLK  + SG+L C   D A ++AA +LQ ELGDYD  EHSP  +S+FRF P   QTEE+EL+I  K+   + R   P+ A+  +L K + L  YGVD H +K ++  DY LGLTP+G+L++EG+ KIGLF W  +T+L FKK++  +VV  V+ DD G + EHTFVF+     ACK +WK  VEHHAF+RL G  +  +      RL SRF  S  TEYQ
Sbjct:   43 ITCRVSLLDGTDVSVDLPKKAKGQELFDQIMYHLDLIE-SDYFGLRFMDSAQVAHWLDGTKSIKKQVKIGSPYCLHLRVKFYSSEP-NNLREELTRYLFVLQLKQDILSGKLECP-FDTAVQLAAYNLQAELGDYDLAEHSPELVSEFRFVP--IQTEEMELAIFEKWK--EYRGQTPAQAETNYLNKAKWLEMYGVDMHVVKARDGNDYSLGLTPTGVLVFEGETKIGLFFWPKITRLDFKKNKLTLVV--VEDDDQGKEQEHTFVFRLDHPKACKHLWKCAVEHHAFFRLRGPVQKSSHRSGFIRLGSRFRYSGKTEYQ 354          
BLAST of Band 4.1-like protein 5 vs. UniProt/SwissProt
Match: sp|Q5FVG2|E41L5_RAT (Band 4.1-like protein 5 OS=Rattus norvegicus OX=10116 GN=Epb41l5 PE=2 SV=2)

HSP 1 Score: 286.574 bits (732), Expect = 6.439e-84
Identity = 150/321 (46.73%), Postives = 209/321 (65.11%), Query Frame = 2
Query:  239 LECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNG-DVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQ 1198
            + C++  LDGTD +  L K+A GQ+L D   + +++ +  +YFGL++ D   + HWLD  K ++KQ++IG P+ L  RVKF+SS+P + L +E TRYLFV QLK  + SG+L C   D A ++AA +LQ ELGDYD  EHSP  +S+FRF P   QTEE+EL+I  K+   + R   P+ A+  +L K + L  YGVD H +K ++  DY LGLTP+G+L++EG+ KIGLF W  +T+L FKK++  +VV  V+ DD G + EHTFVF+     ACK +WK  VEHHAF+RL G  +  +      RL SRF  S  TEYQ
Sbjct:   43 ITCRVSLLDGTDVSVDLPKKAKGQELFDQIMYHLDLIE-SDYFGLRFMDSAQVAHWLDGTKSIKKQVKIGSPYCLHLRVKFYSSEP-NNLREELTRYLFVLQLKQDILSGKLECP-FDTAVQLAAYNLQAELGDYDLAEHSPELVSEFRFVP--TQTEEMELAIFEKWK--EYRGQTPAQAETNYLNKAKWLEMYGVDMHVVKARDGNDYSLGLTPTGVLVFEGETKIGLFFWPKITRLDFKKNKLTLVV--VEDDDQGKEQEHTFVFRLDHPKACKHLWKCAVEHHAFFRLRGPVQKGSHRSGFIRLGSRFRYSGKTEYQ 354          
BLAST of Band 4.1-like protein 5 vs. UniProt/SwissProt
Match: sp|Q9MYU8|E41L5_CANLF (Band 4.1-like protein 5 OS=Canis lupus familiaris OX=9615 GN=EPB41L5 PE=2 SV=1)

HSP 1 Score: 280.026 bits (715), Expect = 7.193e-84
Identity = 149/321 (46.42%), Postives = 208/321 (64.80%), Query Frame = 2
Query:  239 LECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNG-DVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQ 1198
            + C++  LDGTD +  L K+A GQ+L D   + +++ +  +YFGL++ D   + HWLD  K ++KQ++IG P+ L  RVKF+SS+P + L +E TRYLFV QLK  + SG+L C   D A ++AA +LQ ELGDYD  EHSP  +S+FRF P   QTEE+EL+I  K+   + R   P+ A+  +L K + L  YGVD H +K ++  DY LGLTP+G+L++EG+ KIGLF W  +T+L FKK++  +VV  V+ D  G + EHTFVF+     ACK +WK  VEHHAF+RL G  +  +      RL SRF  S  TEYQ
Sbjct:   43 ITCRVSLLDGTDVSVDLPKKAKGQELFDQIMYHLDLIES-DYFGLRFMDSAQVAHWLDGTKSIKKQVKIGSPYCLHLRVKFYSSEP-NNLREELTRYLFVLQLKQDILSGKLECP-FDTAVQLAAYNLQAELGDYDLAEHSPELVSEFRFVP--IQTEEMELAIFEKWK--EYRGQTPAQAETNYLNKAKWLEMYGVDMHVVKARDGNDYSLGLTPTGVLVFEGETKIGLFFWPKITRLDFKKNKLTLVV--VEDDVQGKEQEHTFVFRLDHPKACKHLWKCAVEHHAFFRLRGPVQKSSHRSGFIRLGSRFRYSGKTEYQ 354          
BLAST of Band 4.1-like protein 5 vs. UniProt/SwissProt
Match: sp|Q9HCM4|E41L5_HUMAN (Band 4.1-like protein 5 OS=Homo sapiens OX=9606 GN=EPB41L5 PE=1 SV=3)

HSP 1 Score: 285.034 bits (728), Expect = 2.517e-83
Identity = 150/321 (46.73%), Postives = 208/321 (64.80%), Query Frame = 2
Query:  239 LECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNG-DVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQ 1198
            + C++  LDGTD +  L K+A GQ+L D   + +++  + +YFGL++ D   + HWLD  K ++KQ++IG P+ L  RVKF+SS+P + L +E TRYLFV QLK  + SG+L C   D A ++AA +LQ ELGDYD  EHSP  +S+FRF P   QTEE+EL+I  K+   + R   P+ A+  +L K + L  YGVD H +K ++  DY LGLTP+G+L++EG  KIGLF W  +T+L FKK++  +VV  V+ DD G + EHTFVF+     ACK +WK  VEHHAF+RL G  +  +      RL SRF  S  TEYQ
Sbjct:   43 ITCRVSLLDGTDVSVDLPKKAKGQELFDQIMYHLDL-IESDYFGLRFMDSAQVAHWLDGTKSIKKQVKIGSPYCLHLRVKFYSSEP-NNLREELTRYLFVLQLKQDILSGKLDCP-FDTAVQLAAYNLQAELGDYDLAEHSPELVSEFRFVP--IQTEEMELAIFEKWK--EYRGQTPAQAETNYLNKAKWLEMYGVDMHVVKARDGNDYSLGLTPTGVLVFEGDTKIGLFFWPKITRLDFKKNKLTLVV--VEDDDQGKEQEHTFVFRLDHPKACKHLWKCAVEHHAFFRLRGPVQKSSHRSGFIRLGSRFRYSGKTEYQ 354          
BLAST of Band 4.1-like protein 5 vs. TrEMBL
Match: A0A0R3TVN5 (FERM domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS11882 PE=4 SV=1)

HSP 1 Score: 353.599 bits (906), Expect = 8.068e-110
Identity = 169/329 (51.37%), Postives = 227/329 (69.00%), Query Frame = 2
Query:  218 TRLKDTDLECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNGDVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQMA 1204
            ++ K  DLEC + ++DG+  TFFL K A G KL D  F  I +ND++ YFGL+  DK  +  W+D  K +RKQ  +GPP+    RVKFFS++P  +L DEYTRYLFV QL+  L  G L+C D  + AE+AA  LQGE G YD+ +H+PAF+S   F+P  +QTE LEL+I+ ++  L+ R   P  AD+ FL++ R LP+YGVD H +KGK++++Y LGLTP+GIL+YE + KIGLF W+ + KL     + K+VV +        +EHTFVF   D+ ACK +WKS VEHHAF+RL+G+ KPPTK QQ FRLKSRFYASF TE+Q+A
Sbjct:   35 SKKKSNDLECVVEYIDGSCTTFFLPKNAEGSKLYDLAFAFIGLNDEREYFGLRIDDK--LKPWVDPTKPIRKQCRVGPPYRFLMRVKFFSAEP-QKLRDEYTRYLFVLQLRKQLEQGTLQCTDDQVLAELAAFLLQGEFGAYDQRQHTPAFVSTIPFYPHDRQTETLELAILQEYKKLRSREWTPEEADRIFLDRVRFLPNYGVDMHTVKGKDNENYTLGLTPTGILVYEDEEKIGLFVWSMILKLDMHGKKLKLVVAEENEQARKVMEHTFVFVLPDVRACKHLWKSAVEHHAFFRLKGIPKPPTKLQQFFRLKSRFYASFRTEHQLA 360          
BLAST of Band 4.1-like protein 5 vs. TrEMBL
Match: A0A564Y1E6 (FERM domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS1766 PE=4 SV=1)

HSP 1 Score: 348.206 bits (892), Expect = 9.808e-108
Identity = 167/329 (50.76%), Postives = 226/329 (68.69%), Query Frame = 2
Query:  218 TRLKDTDLECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNGDVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQMA 1204
            ++ K TDLE  + ++DGT  TFFL K A G KL D  F  I +ND++ YFGL+  DK  +  W+D  K +R+Q  + PP+    RVKFFS++P  +L DEYTRYLFV QL+  L  G L+C D  +AAE+AA  LQGE G YD  +H+PAF+S   F+P  +QTE LEL+I+ ++  L+ R   P  AD+ FL++ R LP+YGVD H +KGK++++Y LGLTP+GIL+YE + KIGLF W+ + KL     + K+VV +        +EHTFVF   D+ +CK +WKS VEHHAF+RL+G+ KPP+K QQ FRLKSRFYASF TE+Q+A
Sbjct:   35 SKKKSTDLESVVEYIDGTCTTFFLPKNAEGSKLYDLAFAFIGLNDEREYFGLRIDDK--LKPWVDPTKPIRRQCRVSPPYRFLMRVKFFSAEP-QKLRDEYTRYLFVLQLRKQLERGTLQCTDNQVAAELAAFLLQGEFGAYDPRQHTPAFVSTIPFYPHDRQTETLELAILQEYKKLRSREWTPEEADRIFLDRVRFLPNYGVDMHTVKGKDNENYTLGLTPTGILVYEDKEKIGLFVWSMILKLDMHGKKLKLVVAEENEQARKVMEHTFVFVLPDVRSCKHLWKSAVEHHAFFRLKGIPKPPSKLQQFFRLKSRFYASFRTEHQLA 360          
BLAST of Band 4.1-like protein 5 vs. TrEMBL
Match: A0A564Y191 (FERM domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS1766 PE=4 SV=1)

HSP 1 Score: 348.206 bits (892), Expect = 1.190e-107
Identity = 167/329 (50.76%), Postives = 226/329 (68.69%), Query Frame = 2
Query:  218 TRLKDTDLECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNGDVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQMA 1204
            ++ K TDLE  + ++DGT  TFFL K A G KL D  F  I +ND++ YFGL+  DK  +  W+D  K +R+Q  + PP+    RVKFFS++P  +L DEYTRYLFV QL+  L  G L+C D  +AAE+AA  LQGE G YD  +H+PAF+S   F+P  +QTE LEL+I+ ++  L+ R   P  AD+ FL++ R LP+YGVD H +KGK++++Y LGLTP+GIL+YE + KIGLF W+ + KL     + K+VV +        +EHTFVF   D+ +CK +WKS VEHHAF+RL+G+ KPP+K QQ FRLKSRFYASF TE+Q+A
Sbjct:   35 SKKKSTDLESVVEYIDGTCTTFFLPKNAEGSKLYDLAFAFIGLNDEREYFGLRIDDK--LKPWVDPTKPIRRQCRVSPPYRFLMRVKFFSAEP-QKLRDEYTRYLFVLQLRKQLERGTLQCTDNQVAAELAAFLLQGEFGAYDPRQHTPAFVSTIPFYPHDRQTETLELAILQEYKKLRSREWTPEEADRIFLDRVRFLPNYGVDMHTVKGKDNENYTLGLTPTGILVYEDKEKIGLFVWSMILKLDMHGKKLKLVVAEENEQARKVMEHTFVFVLPDVRSCKHLWKSAVEHHAFFRLKGIPKPPSKLQQFFRLKSRFYASFRTEHQLA 360          
BLAST of Band 4.1-like protein 5 vs. TrEMBL
Match: A0A3P6TKK1 (FERM domain-containing protein (Fragment) OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS3517 PE=4 SV=1)

HSP 1 Score: 332.798 bits (852), Expect = 3.801e-103
Identity = 164/327 (50.15%), Postives = 221/327 (67.58%), Query Frame = 2
Query:  221 RLKDTDLECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNGDVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQM 1201
            R K++DLEC++  LDGT+ TF+L K A+  KL ++ F  I +ND++ YF LQ  +K  I  WLD  K ++KQ+   PP     RVKFFS +P  QL D+Y RYLFV QL+  + +G+L+C D  +AA++AAL LQGELG++++ EH+P FIS F F PE + TE  ++++  ++  L  RN+ PS  D+ +LEK R+LPDYGVD H ++GK+ K Y LGLTPSGIL+YEG  KIGLF W+ + KL  K  + K+VV D    +   VE+TFVF   D  ACK +WKS +E H F+RL    KPPTK QQ FRLKSRFY SF  E+Q+
Sbjct:   30 RNKNSDLECRVHFLDGTNQTFYLPKNAVASKLFEFAFAHIGLNDEREYFALQMINKIKI--WLDPTKPLKKQVFGSPPHVFYMRVKFFSMNP-HQLRDDYARYLFVLQLRDEMLTGKLQCPDDQIAAQMAALLLQGELGNFNKDEHTPEFISTFHFLPEERHTEMFDIAVQQEYANLARRNLTPSETDRLYLEKVRSLPDYGVDMHKVQGKDKKVYYLGLTPSGILVYEGSNKIGLFIWSKILKLEMKGKKLKLVVADEDETNRKVVEYTFVFVLPDATACKHLWKSAIEQHTFFRLRDTVKPPTKLQQFFRLKSRFYTSFRPEFQL 353          
BLAST of Band 4.1-like protein 5 vs. TrEMBL
Match: A0A5K3FI28 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 333.954 bits (855), Expect = 3.369e-102
Identity = 162/329 (49.24%), Postives = 222/329 (67.48%), Query Frame = 2
Query:  218 TRLKDTDLECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNGDVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQMA 1204
            T+ K +D EC + ++DG+  TFF+ K + G  L +  F  I +ND++ YF L++ DK  +  W+D  K++RKQ  +GPP+     VKFFS +P  +L DEYTRYLFV QL+  L  G L+C D  +AAE+AA  LQGE G +D  +H+P F+S   F+P  +QTE LEL+I+ ++  LK R   P  AD+ FL++ R LP+YGVD H +KGK+D++Y LGLTP+GIL+YE   KIGLF W+ + KL     + K+VV +   +    +EHTFVF   D+ ACK +WK  VEHHAF+RL+G  KPP+K QQ FRLKSRFYASF TE+Q+A
Sbjct:   35 TKQKPSDNECVVEYIDGSCTTFFIPKNSEGSMLIELAFAFIGLNDEREYFSLRFDDK--LKSWVDPTKQIRKQSRVGPPYRFHMCVKFFSVEP-QKLRDEYTRYLFVLQLRKQLEKGTLQCPDDQVAAELAAYLLQGEFGPFDPRQHTPVFVSTLPFYPPDRQTETLELAILHEYKKLKTREWTPEDADRMFLDRVRFLPNYGVDMHVVKGKDDENYTLGLTPTGILVYEDDKKIGLFVWSMILKLDMHGKKLKLVVAEENEEARKVMEHTFVFVLPDVRACKHLWKCAVEHHAFFRLKGNPKPPSKLQQFFRLKSRFYASFRTEHQLA 360          
BLAST of Band 4.1-like protein 5 vs. Ensembl Cavefish
Match: epb41l4b (erythrocyte membrane protein band 4.1 like 4B [Source:ZFIN;Acc:ZDB-GENE-100921-92])

HSP 1 Score: 271.552 bits (693), Expect = 1.081e-81
Identity = 145/321 (45.17%), Postives = 206/321 (64.17%), Query Frame = 2
Query:  239 LECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNG-DVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQ 1198
            + C++  LD ++ +  L K + GQ L D   + +++ +  +YFGLQ+ D + + HWLD  K ++KQ+  GPP+ L F+VKF+SS+P + LH+E+TRYLFV QL+  + +G+L+C   D++ E+ A  LQ ELGD D +EHSP  +S+FRF P  +QTE +E  I  K+   + R + PS A+  FL KC+ L  YGVD H +KG++  DY LGLTP+GIL++E   KIGLF W  +T+L FKK+R  +VV  V+ D+ G + EHTFVFQ      CKQ+WK  VE H+F+RL    +  T      RL SRF  S  TEYQ
Sbjct:   64 ITCRVQLLDLSEVSVELPKHSKGQDLFDQIMYHLDLVE-ADYFGLQFMDPEQVMHWLDATKPIKKQIRYGPPYKLYFKVKFYSSEP-NNLHEEFTRYLFVLQLRQDIMTGKLKCP-YDVSVELGAYCLQSELGDCDPLEHSPLLVSEFRFCP--KQTEIMEADIYRKWA--ESRGMSPSQAELNFLNKCKWLEMYGVDMHYVKGRDGGDYALGLTPTGILVFERSSKIGLFFWPKITRLDFKKNRLTLVV--VEDDEQGHEQEHTFVFQLSSSRVCKQLWKCAVESHSFFRLRQPTQNKTNRNDFTRLGSRFRFSGRTEYQ 375          
BLAST of Band 4.1-like protein 5 vs. Ensembl Cavefish
Match: epb41l5 (erythrocyte membrane protein band 4.1 like 5 [Source:ZFIN;Acc:ZDB-GENE-030616-450])

HSP 1 Score: 273.092 bits (697), Expect = 9.717e-80
Identity = 143/322 (44.41%), Postives = 204/322 (63.35%), Query Frame = 2
Query:  239 LECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKD-RNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNG-DVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQ 1198
            + C++  LDGTD +  L K+A G++L D   + +++ + K+YFGL++ D   + HWLD+ K ++KQ++IGPP+ L  RVKF+SS+P + LH+E TR+              L C   D A E+AA SLQ ELGDYD  EH+   +S+FRF PE  QTEE+EL+I   +N  K+ R   P+ A+  +L K + L  YGVD H +K ++  +Y LGLTP+G+L++EG+ KIGLF W  +T+L FKKS+  +VV  V+ D+ G + EHTFVF+     ACK +WK  VEHHAF+RL G  +  +      R+ SRF  S  TEYQ
Sbjct:   43 ITCRVSLLDGTDVSVDLPKKAKGEELFDQIMYHLDIVE-KDYFGLRFMDSAQVPHWLDVTKSIKKQVKIGPPYCLHMRVKFYSSEP-NNLHEELTRFTNYFYNFFFFPEFRLECAF-DTAVELAAFSLQAELGDYDPAEHALDLVSEFRFVPE--QTEEVELAI---YNAWKECRGQSPAQAEINYLNKAKWLEMYGVDMHMVKARDGNEYSLGLTPTGVLVFEGETKIGLFFWPKITRLDFKKSKLTLVV--VEDDEQGKEQEHTFVFRMDHPKACKHLWKCAVEHHAFFRLRGPVQNSSARSGFIRMGSRFRYSGKTEYQ 354          
BLAST of Band 4.1-like protein 5 vs. Ensembl Cavefish
Match: ptpn4a (protein tyrosine phosphatase non-receptor type 4a [Source:ZFIN;Acc:ZDB-GENE-030616-449])

HSP 1 Score: 208.379 bits (529), Expect = 6.693e-56
Identity = 124/334 (37.13%), Postives = 187/334 (55.99%), Query Frame = 2
Query:  206 SEMQTRLKDTDLECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTD-KKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNGDVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTK--FQQIFRLKSRFYASFHTEYQ 1198
            SE+    + T++ C IV LD T   F + K   GQ L D  F  +E+ + ++YFGL   D   +   WLD  K +RKQL+ G P  L FRVKFF SDP S+L +EYTRY +  Q+K  + SG L C   + AA +A+ ++Q ELGDY E E+ P ++S + F P   Q  E E++   +    +   + P+ ++  +L   RTL  YGV+ H  + +++ + ++G+  +GI+IY+ +++I  FPW  + K+SFK  +F +    ++ D N   E    F   +  ACK +WK+CVEHH F+RL+    PP K  F   F L S+F     TE Q
Sbjct:   18 SELARDRQHTEVVCNIVLLDNTVQPFKVNKHDQGQVLLDTVFKHLELTE-RDYFGLHLADDSSDCPRWLDPNKPIRKQLKRGSPHHLNFRVKFFVSDP-SKLQEEYTRYQYFLQIKQDILSGRLPCP-HNTAALLASYTVQSELGDYSEAENPPGYLSGYCFIPNQPQGFEKEVAKHHQ----QHSGLSPAESEFNYLNTARTLEHYGVELHYARDQSNTEILIGVMSAGIVIYKNRVRINCFPWLKIVKISFKCKQFFI---QLRKDANETRETLLGFNMVNYRACKNLWKTCVEHHTFFRLDQ-PVPPQKNFFAHYFSLGSKFRYCGRTEAQ 340          
BLAST of Band 4.1-like protein 5 vs. Ensembl Cavefish
Match: ptpn4b (protein tyrosine phosphatase non-receptor type 4b [Source:ZFIN;Acc:ZDB-GENE-030131-6259])

HSP 1 Score: 203.371 bits (516), Expect = 4.937e-54
Identity = 120/339 (35.40%), Postives = 189/339 (55.75%), Query Frame = 2
Query:  194 DYVDSEMQTRLKDTDLECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINH-WLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNGDVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTK---FQQIFRLKSRFYASFHTEYQ 1198
            D  +SE+    +     C ++ LD T   F + K+  GQ L D  F  +++ + ++YFGLQ TD+ + N  WLD  K +RKQL+   P  L FRVKFF S+P S+L +EYTRYL+  QLK  + SG L C  ++ AA +A+ ++Q ELGDY + EH P ++S+F F P   +  E E++ + +    +   + P+ A+  +L    +L  YGV+ H  + +   +  +G+  +GI IY+ ++++  FPW  + K+SFK  +F +    ++ + +   E    F   +  ACK +WK+CVEHH F+RLE  R  P +   F   F L S+F     TE Q
Sbjct:   30 DVGESEVARDRQSAQGVCIVLLLDNTVQAFRVNKQEQGQALLDIVFEHLQLTE-RDYFGLQLTDETSENQRWLDPNKPIRKQLKRVAPNNLSFRVKFFVSEP-SKLQEEYTRYLYFLQLKQDILSGRLPCP-QNAAALLASYAIQAELGDYSQSEHLPGYLSEFSFIPNPPEDFEKEVAKLHQ----QHNGLSPAQAEFNYLSAASSLDLYGVELHYARDQTTAEVYIGVMSAGISIYKNRVRVSHFPWVKIVKISFKSKQFFI---QLRKESSKSRESLLGFSMMNYRACKNVWKACVEHHTFFRLE--RPAPQQKSFFAHYFTLGSKFRYCGRTEAQ 356          
BLAST of Band 4.1-like protein 5 vs. Ensembl Cavefish
Match: epb41l4a (erythrocyte membrane protein band 4.1 like 4A [Source:NCBI gene;Acc:103031303])

HSP 1 Score: 198.749 bits (504), Expect = 7.578e-54
Identity = 117/330 (35.45%), Postives = 188/330 (56.97%), Query Frame = 2
Query:  245 CKIVHLDGTDFTFFLEKRAL-----GQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQ---LEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNGDVEHTFVFQSFDIVACKQMWKSCVEHHAFYRL-EGVRKPPT-KFQQIFRLKSRFYASFHTEYQMA 1204
            C+++ LD T  T   +++ +     G  + DY F  + + +  +YFGL+Y D+ +  +WLD  K + +    +  GPP+TL F VKF++ DPC +L +E TRY F  Q+K  +  G L C   +++ ++AAL++Q ELGDYD   H   ++S++RF P+  Q E+LE +I      L  +   PS A+  +L   + L  YGVD H + G+   +Y LGLTP G+++Y+ + ++G + W  +TK+ FK+++F++ V  +  D N   E +F F++    ACK +WK CVEHH F+R+ E      T K  ++  L SR   S  T  QM 
Sbjct:   13 CEVLLLDETKLTLTSQQQGIKKSTKGSVVLDYVFSHVNLAEI-DYFGLRYCDRSHQTYWLDPTKTLAEHKDLITTGPPYTLYFGVKFYTEDPC-KLKEEITRYQFFLQVKQDVLQGRLPCAF-NISTQMAALAIQSELGDYDPYRHVSGYVSEYRFVPD--QKEDLEEAIEQIHKTLMGQT--PSEAENNYLSIAKGLEMYGVDLHPVFGEKQSEYFLGLTPVGVVVYKNKTQVGKYFWPRITKVFFKETQFELRV--LGKDCN---ETSFFFEAPSKTACKNLWKCCVEHHTFFRMPENDSSTLTRKLSKLGSLGSRHRYSGKTAMQMG 330          
BLAST of Band 4.1-like protein 5 vs. Ensembl Sea Lamprey
Match: epb41l5 (erythrocyte membrane protein band 4.1 like 5 [Source:ZFIN;Acc:ZDB-GENE-030616-450])

HSP 1 Score: 271.552 bits (693), Expect = 9.349e-84
Identity = 152/339 (44.84%), Postives = 215/339 (63.42%), Query Frame = 2
Query:  293 KRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKD-RNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNG-DVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQMAVKXXXXXXXXXXXXXXXAPSLRLAPRASFERNE 1303
            K+A+GQ L D   + +++ +  +YFGLQ+ D   ++HWLD  K +RKQ++IGPP+    RVKF+SS+P + LH+E TRYLFV QLK  + SG+L C   + A ++A  SLQ ELGD D +EH+PA +S+FRF P   Q+EE+E +I+ K+   KD R   P+ A+  +L K + L  YGVD H++KG++  +Y LGLTP+G+L++EG+ KIGLF W  +T+L FK+++  +VV  V+ DD   + EHTFVF+     ACK +WK  VEHHAF+RL G  K         R+ SRF  S  TE+Q A K +    T         PS R   RASF++ E
Sbjct:    1 KKAVGQDLFDQVMYHLDILE-VDYFGLQFMDSAQVSHWLDHTKNIRKQVKIGPPYCFHMRVKFYSSEP-NNLHEELTRYLFVLQLKQDILSGKLECPF-ETAVQLATYSLQAELGDCDPVEHNPALVSEFRFIP--SQSEEMEEAILEKW---KDCRGQTPAQAELNYLNKAKWLEMYGVDMHSVKGRDGNEYSLGLTPTGVLVFEGENKIGLFFWPKITRLDFKRTKLTLVV--VEDDDQAKEQEHTFVFRLDHPKACKHLWKCAVEHHAFFRLRGPSKTNADPSSFIRMGSRFRFSGRTEFQ-ATKVSKARRTSSFERR---PSKRYTRRASFQKAE 325          
BLAST of Band 4.1-like protein 5 vs. Ensembl Sea Lamprey
Match: epb41l5 (erythrocyte membrane protein band 4.1 like 5 [Source:ZFIN;Acc:ZDB-GENE-030616-450])

HSP 1 Score: 270.396 bits (690), Expect = 2.066e-83
Identity = 153/340 (45.00%), Postives = 219/340 (64.41%), Query Frame = 2
Query:  293 KRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKD-RNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNG-DVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQMAVKXXXXXXXXXXXXXXXAPSLRLAPRASFERNEL 1306
            K+A+GQ L D   + +++ +  +YFGLQ+ D   ++HWLD  K +RKQ++IGPP+    RVKF+SS+P + LH+E TRYLFV QLK  + SG+L C   + A ++A  SLQ ELGD D +EH+PA +S+FRF P   Q+EE+E +I+ K+   KD R   P+ A+  +L K + L  YGVD H++KG++  +Y LGLTP+G+L++EG+ KIGLF W  +T+L FK+++  +VV  V+ DD   + EHTFVF+     ACK +WK  VEHHAF+RL G  K         R+ SRF  S  TE+Q        +  RR+S+F R PS R   RASF++  +
Sbjct:    1 KKAVGQDLFDQVMYHLDILE-VDYFGLQFMDSAQVSHWLDHTKNIRKQVKIGPPYCFHMRVKFYSSEP-NNLHEELTRYLFVLQLKQDILSGKLECP-FETAVQLATYSLQAELGDCDPVEHNPALVSEFRFIP--SQSEEMEEAILEKW---KDCRGQTPAQAELNYLNKAKWLEMYGVDMHSVKGRDGNEYSLGLTPTGVLVFEGENKIGLFFWPKITRLDFKRTKLTLVV--VEDDDQAKEQEHTFVFRLDHPKACKHLWKCAVEHHAFFRLRGPSKTNADPSSFIRMGSRFRFSGRTEFQAT----KVSKARRTSSFERRPSKRYTRRASFQKGNV 326          
BLAST of Band 4.1-like protein 5 vs. Ensembl Sea Lamprey
Match: epb41l5 (erythrocyte membrane protein band 4.1 like 5 [Source:ZFIN;Acc:ZDB-GENE-030616-450])

HSP 1 Score: 270.011 bits (689), Expect = 3.029e-83
Identity = 153/337 (45.40%), Postives = 218/337 (64.69%), Query Frame = 2
Query:  293 KRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKD-RNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNG-DVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQMAVKXXXXXXXXXXXXXXXAPSLRLAPRASFER 1297
            K+A+GQ L D   + +++ +  +YFGLQ+ D   ++HWLD  K +RKQ++IGPP+    RVKF+SS+P + LH+E TRYLFV QLK  + SG+L C   + A ++A  SLQ ELGD D +EH+PA +S+FRF P   Q+EE+E +I+ K+   KD R   P+ A+  +L K + L  YGVD H++KG++  +Y LGLTP+G+L++EG+ KIGLF W  +T+L FK+++  +VV  V+ DD   + EHTFVF+     ACK +WK  VEHHAF+RL G  K         R+ SRF  S  TE+Q        +  RR+S+F R PS R   RASF++
Sbjct:    1 KKAVGQDLFDQVMYHLDILE-VDYFGLQFMDSAQVSHWLDHTKNIRKQVKIGPPYCFHMRVKFYSSEP-NNLHEELTRYLFVLQLKQDILSGKLECP-FETAVQLATYSLQAELGDCDPVEHNPALVSEFRFIPS--QSEEMEEAILEKW---KDCRGQTPAQAELNYLNKAKWLEMYGVDMHSVKGRDGNEYSLGLTPTGVLVFEGENKIGLFFWPKITRLDFKRTKLTLVV--VEDDDQAKEQEHTFVFRLDHPKACKHLWKCAVEHHAFFRLRGPSKTNADPSSFIRMGSRFRFSGRTEFQAT----KVSKARRTSSFERRPSKRYTRRASFQK 323          
BLAST of Band 4.1-like protein 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002204.1 (pep scaffold:Pmarinus_7.0:GL477123:87549:93162:-1 gene:ENSPMAG00000001991.1 transcript:ENSPMAT00000002204.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 198.364 bits (503), Expect = 1.798e-58
Identity = 104/227 (45.81%), Postives = 146/227 (64.32%), Query Frame = 2
Query:  521 TRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNG-DVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQ 1198
            +RYLFV QLK  + SG+L C   D+A ++A +SLQ E+GD D  EH+ A +S+FRF P   QTE++E+++   +     R  +PS A+  +L + + L  YGVD H +KG++  DY LGLTP+GIL++EG+ KIGLF W  +T+L FK+ R  +VV  V+ D+ G + EH FVF+     ACK +WK  VEHHAF+RL G  +   + Q   R+ SRF  S  TEYQ
Sbjct:    1 SRYLFVLQLKQDILSGKLECP-FDIAVQLAGISLQAEIGDCDPEEHTAALVSEFRFVP--GQTEDMEMAVFDTWKSC--RGQMPSQAEINYLNRAKWLEMYGVDMHAVKGRDANDYTLGLTPTGILVFEGKTKIGLFFWPKITRLDFKRDRLTLVV--VEDDEQGKENEHKFVFRMDHPKACKHLWKCAVEHHAFFRLRGPTQNAKERQDFIRMGSRFRYSGRTEYQ 220          
BLAST of Band 4.1-like protein 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001312.1 (pep scaffold:Pmarinus_7.0:GL477231:34421:73675:-1 gene:ENSPMAG00000001156.1 transcript:ENSPMAT00000001312.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 187.193 bits (474), Expect = 2.104e-49
Identity = 114/334 (34.13%), Postives = 174/334 (52.10%), Query Frame = 2
Query:  206 SEMQTRLKDTDLECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKN-INHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNGDVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTK--FQQIFRLKSRFYASFHTEYQ 1198
            SE+      T+  C I  LD T  T    K   G+ L D  F  +++ +  +YFGLQ+ D       WLD  K +RKQ++   P+   FRVKFF +DP S+L +EYTRY +  QL+  +    L C   + AA +A+  +Q ELGDY E EH P ++S  RF P      E E++ + K ++     + P+ A+  +L   + +  YGV+ H  + +++ + ++G+T  G+ +Y   ++I  FPW  + K+ FK   F V ++  Q   N   E+   F   +  ACK +WK+CVEHH F+R+     PP      Q F L S+F  S  TE Q
Sbjct:   18 SELARDRHRTEALCHINLLDNTAITLRANKSEAGKALLDAVFAHLDLAE-TDYFGLQFADDSTETPRWLDPTKPLRKQIKRSSPYIFNFRVKFFVTDP-SKLQEEYTRYHYFLQLRNDILEARLPCP-HNTAALLASYIVQSELGDYSETEHLPGYLSDLRFLPRQGLDFEKEVAKLHKQHV----GMTPADAEFNYLNVAKNVEFYGVELHYARDQSNVEIMVGVTAGGVNVYNNGVRISNFPWIKIVKIFFKLKHFFVQLRKEQ---NETRENIIGFNLGNYRACKTLWKACVEHHTFFRMARPASPPHLGFLAQYFSLGSKFRYSGRTEMQ 341          
BLAST of Band 4.1-like protein 5 vs. Ensembl Nematostella
Match: EDO32045 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW61])

HSP 1 Score: 199.904 bits (507), Expect = 3.924e-58
Identity = 108/292 (36.99%), Postives = 174/292 (59.59%), Query Frame = 2
Query:  233 TDLECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNGDVEHTFVFQSFDIVACKQMWKSCVEHHAFYR 1108
            T+  C IV LD ++F   + K   G ++ +  F  + + + ++YFGL++ +K   + WLD  K V KQL+ GPP+ + F VKF+++DP ++LH+E TRYLF  Q+K  +  G   C+       I++  L  ELGD+D   ++P ++S+FRF P  +QTE+LE  I      L    ++PS A+  +L+K + L  YGVD H +KG++  +Y + L P+G+++Y  +  +G + W  +TK+ FK  +F + VQ  +     D E+ +VF   +  ACK +WK CVEHHAF+R
Sbjct:    9 TEFFCHIVLLDESEFPIEITKSTKGFEVLEKVFDHLNLLE-RDYFGLRFIEKNTQSRWLDPMKSVTKQLKAGPPYLMYFCVKFYAADP-NKLHEELTRYLFFLQVKRDIFQGSAPCE-IHADTLISSFILLAELGDFDYQSYTPGYVSEFRFVP--KQTEDLEEKISDCHKRL--IGVVPSVAEYMYLDKAKWLEMYGVDLHLVKGEDGVEYFVALKPAGVVVYHNKTAVGTYLWQKITKIDFKGKKFSLNVQGKE-----DREYVYVFYLPNKSACKHLWKCCVEHHAFFR 288          
BLAST of Band 4.1-like protein 5 vs. Ensembl Nematostella
Match: EDO42892 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S031])

HSP 1 Score: 192.971 bits (489), Expect = 2.357e-55
Identity = 109/302 (36.09%), Postives = 173/302 (57.28%), Query Frame = 2
Query:  293 KRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNGDVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQ 1198
            K++ GQ+L D     +++ + K+YFGLQ+ D   + HWLD  KK++KQ++IGPP+TL FRVKF++++P  +L +E TRY F  Q+K  +   +L    +  A ++AA SLQ +LGDYD   H   ++++F+FF    +  + + +  +K  L K  N  P+  +  FL   + +  YGV+ H++  ++  +Y LGLTP GIL+   + K+GL  W  + K++FKK  +   + DVQ +      H++++      A K +WK  VEHH F+RL      P +     R  SRF  S  TEYQ
Sbjct:    1 KKSKGQELIDLVMKNLDLVE-KDYFGLQFMDTHQVGHWLDPTKKIKKQVKIGPPYTLHFRVKFYAAEP-HELGEELTRYHFFLQVKQDIARNKLEVPQR-TAVDLAAYSLQSQLGDYDAELHGDDYMAEFKFFLTKIENWKFKFARSTKL-LCKGLN--PAECEVNFLRIVKGMDFYGVNLHSVVDQHKIEYELGLTPRGILVAREKKKVGLHYWPRIAKMTFKKKNY---LLDVQEEVGDRQVHSYIYTLSSAQAAKHLWKCAVEHHTFFRLVKPANKPKRTSSFLRFGSRFRYSGRTEYQ 293          
BLAST of Band 4.1-like protein 5 vs. Ensembl Nematostella
Match: EDO34391 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPH7])

HSP 1 Score: 182.956 bits (463), Expect = 4.420e-52
Identity = 113/294 (38.44%), Postives = 163/294 (55.44%), Query Frame = 2
Query:  230 DTDLECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLE-IGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNGDVEHTFVFQSFDIVACKQMWKSCVEHHAFYR 1108
            D +   KI  LD T+ T    + A GQ + D     +++ + K+YFGL+Y D     HWLD+ K V KQ++ + PPF L FRVKF++ DP   +H+E TRY    Q+K  +  G L C   ++A E+ A  +Q ELGDYD  +    ++S+FR  P  +Q+E+LE  I      L  +  +PS A+K FL+K ++L  YGVD H  K +++    LGLTP+GI I     K+  F W  + K S++   F V V         D +  + F+  D +ACK +WK  VEHHAFYR
Sbjct:   11 DAEFVVKISLLDDTELTCEFRRDAKGQTVFDTVCKALDLVE-KDYFGLRYVDDSKQRHWLDLSKSVIKQMKSLKPPFKLFFRVKFYALDP-GLIHEEITRYQCFLQIKRDILHGRLLCSYNELA-ELGAYIVQAELGDYDPEDQEDNYVSEFRIVP--KQSEKLENKIADIHRSLSGQ--VPSVAEKNFLDKVKSLDMYGVDPHPCKDQDNVQLYLGLTPTGIAIIRDGKKVSGFEWAQIIKCSYEGKVFYVQVH------KDDRKANYGFRLPDPLACKHLWKCAVEHHAFYR 291          
BLAST of Band 4.1-like protein 5 vs. Ensembl Nematostella
Match: EDO44823 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUW8])

HSP 1 Score: 192.2 bits (487), Expect = 5.346e-51
Identity = 114/327 (34.86%), Postives = 175/327 (53.52%), Query Frame = 2
Query:  239 LECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNIN-------HWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNGDVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQ 1198
            + C +  LD ++F   ++K A G  L +  F  +++ + K+YFGLQY      N        WL   K +RKQ +  PP+   F V+FF SDP S+L ++ TRY F  Q+K  + +G L C   D AAE+++  LQ ELGDYD   H   ++S+FRF P+     E   +   K ++ +     P+ A+  FLE  +TL  YGVD H  K  +  D  LG++  G+ +Y  + KI  FPW+ + K+ FK+ RF +    ++PD N   ++   FQ     +CK +WK CVE+H+FYR      P    +++ R+ S++     TEYQ
Sbjct:   35 IRCVVELLDDSEFIIDVDKNAKGTVLLNEVFRHLDIQE-KHYFGLQYVSDSPDNMVGGAKEQWLQDDKIIRKQKKGTPPYIFYFCVRFFVSDP-SKLVEDLTRYYFYLQIKRDILTGRLPCL-YDTAAELSSYILQAELGDYDPKLHLDGYVSEFRFIPDQTDDFEERAAEFHKHHIGQ----TPADAEFNFLEVAKTLDLYGVDLHCAKDHDGTDLFLGVSALGLTVYHNKCKINFFPWSKIVKVCFKRKRFFI---QIRPDWNEWTDNIIGFQMLTYRSCKNLWKVCVEYHSFYR---THYPKATEKRVLRMGSKYRYKGKTEYQ 348          
BLAST of Band 4.1-like protein 5 vs. Ensembl Nematostella
Match: EDO33626 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRN5])

HSP 1 Score: 173.326 bits (438), Expect = 1.816e-44
Identity = 109/319 (34.17%), Postives = 167/319 (52.35%), Query Frame = 2
Query:  248 KIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQL-EIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNGDVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQM 1201
            K+  LD +   F +E +  G  L    +  + + D++ YFGL Y DK +   WLD  K ++KQ+ EIG     RF VKF+++DP + L +EYTRYLF  Q+K  L +G L+C +   AA +A+  +QGELGD+D +   P +++ F+FFPE     E  +S   K    + R++ P+  D   L+  R L  YGV  +  K K++ D  L     GI++++   KI    W  + KLSFK+ RF +    + P+  G  +    FQ     ACK  WK  +  HAF+R    + PP    ++F   S +  S  T+ Q+
Sbjct:   26 KVCMLDDSVVKFDIEPKVKGDILYKQVYEYLNL-DEREYFGLSYYDKSDNLFWLDQLKPIKKQVKEIGK-VLFRFCVKFYTADP-AMLQEEYTRYLFALQVKKDLVNGGLKCSES-TAALLASYVVQGELGDFDTLSCRPGYLADFQFFPEQTVDSEARISDFHK----QHRSLSPTDCDYNLLDVARRLEMYGVILYPAKDKDNVDLELAAANMGIIVFQSGSKINTLSWAKIRKLSFKRKRFLI---KLHPEIFGHYKDVVEFQMASRNACKSFWKVAISTHAFFRQSESQSPPRHRPRVFSRGSSYRFSGRTQKQI 333          
BLAST of Band 4.1-like protein 5 vs. Ensembl Medaka
Match: epb41l5 (erythrocyte membrane protein band 4.1 like 5 [Source:NCBI gene;Acc:111946734])

HSP 1 Score: 288.115 bits (736), Expect = 4.584e-85
Identity = 150/322 (46.58%), Postives = 213/322 (66.15%), Query Frame = 2
Query:  239 LECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKD-RNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNG-DVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQ 1198
            + C++  LDGTD +  L K+A G++L +   + +++ + K+YFGL++ D   + HWLD+ K ++KQ++IGPP+ L  RVKF+SS+P + LH+E TRYLFV QLK  + SG+L C   D A E+ A SLQ ELGDYD +EH+   +S+FRF P+  QTEELE +I S +   KD R   P+ A+  +L K + L  YGVD H +K ++  +Y LGLTP+G+L++EGQ KIGLF W  +T+L F+KS+  +VV  V+ D+ G + EHTFVF+     ACK +WK  VEHHAF+RL G  +  +      R+ SRF  S  TEYQ
Sbjct:   43 ITCRVSLLDGTDVSVDLPKKAKGEELFEQIMYHLDIVE-KDYFGLRFMDYAQVPHWLDVTKSIKKQVKIGPPYCLHMRVKFYSSEP-NNLHEELTRYLFVLQLKQDVLSGKLECP-FDTAVELGAFSLQAELGDYDPLEHNLDLVSEFRFIPD--QTEELERAIYSAW---KDCRGQTPAQAEINYLNKAKWLEMYGVDMHMVKARDGNEYSLGLTPTGVLVFEGQTKIGLFFWPKITRLDFRKSKLTLVV--VEDDEQGKEQEHTFVFRMDHPKACKHLWKCAVEHHAFFRLRGPVEKNSARSGFIRMGSRFRYSGKTEYQ 354          
BLAST of Band 4.1-like protein 5 vs. Ensembl Medaka
Match: epb41l4b (band 4.1-like protein 4B [Source:NCBI gene;Acc:101169231])

HSP 1 Score: 264.618 bits (675), Expect = 4.442e-79
Identity = 143/323 (44.27%), Postives = 207/323 (64.09%), Query Frame = 2
Query:  233 TDLECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNG-DVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQ 1198
            + + C+++ LDG D    L  +A GQ+L D   + +++ +  +YFGLQ+ D   ++HWLD+ K ++KQ+  G    L FRVKF+SS+P + L +E+TRYLFV QL+  + SG+L+C   D++ E+AA  LQ ELGD D +EH+   +S+FRF P  +Q+E +E  I+S++  L+ ++  PS A+  FL KC+ L  YG+D H +KG++  +Y LGLTP+GIL++E   KIGLF W  +T+L FKKSR  +VV  V+ D+ G + EHTFVFQ     +CK +WK  VE HAF+RL       T      RL SRF  S  TEYQ
Sbjct:   66 SSITCRVLLLDGRDLVVDLPSKAKGQELFDQIMYYLDLIE-TDYFGLQFMDTDQVSHWLDLSKPIKKQIHDGQQNRLFFRVKFYSSEP-NNLREEFTRYLFVLQLRQDILSGKLKCP-YDVSVELAAYCLQSELGDCDPLEHTLELVSEFRFTP--KQSETMEADILSRWLQLRGKS--PSQAEIDFLNKCKWLELYGMDMHLVKGRDGGEYALGLTPTGILVFEDSNKIGLFFWPKITRLDFKKSRLTLVV--VEDDEQGREQEHTFVFQLASAKSCKHLWKCAVESHAFFRLRQPATSTTSRSDFTRLGSRFRFSGKTEYQ 379          
BLAST of Band 4.1-like protein 5 vs. Ensembl Medaka
Match: ptpn4a (protein tyrosine phosphatase non-receptor type 4 [Source:NCBI gene;Acc:101171899])

HSP 1 Score: 199.904 bits (507), Expect = 7.785e-53
Identity = 115/334 (34.43%), Postives = 187/334 (55.99%), Query Frame = 2
Query:  206 SEMQTRLKDTDLECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTD-KKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNGDVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTK--FQQIFRLKSRFYASFHTEYQ 1198
            +E++   + T + C ++ LD +   F + K   GQ L D  F  +E+ + ++YFGL   D   +   WLD  K +RKQL+ G P +L FRVKFF +DP S+L +EYTRY +  Q+K  + +G L C + + AA +A+ ++Q ELGDY+E EHS  ++S++ F P   Q    E+S   +    +   + P+ A+  +L   RTL  YGV+ H  + + + + ++G+  +G+++Y+ +++  LF W  + K+SFK  +F +    ++ +     E    F   +  ACK +WK+CVEHH F+RLE    PP K  F   F L S++     TE Q
Sbjct:   18 TELERDRQHTQVVCNVLLLDNSVQAFRVSKSDHGQVLLDAVFRHLELTE-RDYFGLHVADDASDAPRWLDPNKPIRKQLKRGSPHSLSFRVKFFVTDP-SKLQEEYTRYQYFLQIKQDILTGRLPCPN-NTAALLASYAVQSELGDYNEAEHSSGYLSEYCFIPAPPQDFHKEVSKHHQ----QHSGLTPAQAEFNYLNTARTLELYGVELHYARDQRNAEILMGVMSAGVVVYQNRVRKNLFQWLKIVKISFKSKQFFI---QLRREATETRETLLGFNMVNYRACKNLWKACVEHHTFFRLEQ-PIPPQKNFFAHYFSLGSKYRYCGRTEVQ 340          
BLAST of Band 4.1-like protein 5 vs. Ensembl Medaka
Match: epb41l3b (erythrocyte membrane protein band 4.1 like 3 [Source:NCBI gene;Acc:101175596])

HSP 1 Score: 194.512 bits (493), Expect = 3.861e-52
Identity = 115/320 (35.94%), Postives = 177/320 (55.31%), Query Frame = 2
Query:  239 LECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNGDVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQ 1198
            ++CK+  LDG+D+T  +EKRA GQ L       + + + K+YFG+ Y D +N  +WLD  K+++KQ+  GP +   F VKF+  DP SQL ++ TRY    QL+  + SG L C        + + ++Q ELGDYD  E +  ++S+ R  P   QT+ELE  ++      K   + P+ A+  FLE  + L  YGVD H+ K     + +LG+  SG+LIY  +++I  F W  + K+S+K++ F +    ++P +    E T  F+  +  A K++WK CVEHH F+RL     P  KF     L S+F  S  T+ Q
Sbjct:   82 MQCKVALLDGSDYTVDVEKRAKGQILFSKICEHLNLLE-KDYFGITYRDIENQKNWLDPSKELKKQIRNGP-WNFAFNVKFYPPDP-SQLSEDITRYYLCLQLRDDVVSGRLPCSFATHTV-LGSYTVQSELGDYDPEEMASDYVSELRLAP--NQTKELEEKVMELHKTYK--GMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDKLRINRFAWPKILKISYKRNNFYI---KIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLVSPEAPQKKF---LSLGSKFRYSGRTQAQ 387          
BLAST of Band 4.1-like protein 5 vs. Ensembl Medaka
Match: epb41l3b (erythrocyte membrane protein band 4.1 like 3 [Source:NCBI gene;Acc:101175596])

HSP 1 Score: 194.512 bits (493), Expect = 4.278e-52
Identity = 115/320 (35.94%), Postives = 177/320 (55.31%), Query Frame = 2
Query:  239 LECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNGDVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQ 1198
            ++CK+  LDG+D+T  +EKRA GQ L       + + + K+YFG+ Y D +N  +WLD  K+++KQ+  GP +   F VKF+  DP SQL ++ TRY    QL+  + SG L C        + + ++Q ELGDYD  E +  ++S+ R  P   QT+ELE  ++      K   + P+ A+  FLE  + L  YGVD H+ K     + +LG+  SG+LIY  +++I  F W  + K+S+K++ F +    ++P +    E T  F+  +  A K++WK CVEHH F+RL     P  KF     L S+F  S  T+ Q
Sbjct:   82 MQCKVALLDGSDYTVDVEKRAKGQILFSKICEHLNLLE-KDYFGITYRDIENQKNWLDPSKELKKQIRNGP-WNFAFNVKFYPPDP-SQLSEDITRYYLCLQLRDDVVSGRLPCSFATHTV-LGSYTVQSELGDYDPEEMASDYVSELRLAP--NQTKELEEKVMELHKTYK--GMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDKLRINRFAWPKILKISYKRNNFYI---KIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLVSPEAPQKKF---LSLGSKFRYSGRTQAQ 387          
BLAST of Band 4.1-like protein 5 vs. Planmine SMEST
Match: SMESG000007133.1 (SMESG000007133.1)

HSP 1 Score: 959.133 bits (2478), Expect = 0.000e+0
Identity = 563/564 (99.82%), Postives = 563/564 (99.82%), Query Frame = 2
Query:  194 DYVDSEMQTRLKDTDLECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNGDVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQMAVKXXXXXXXXXXXXXXXAPSLRLAPRASFERNELXXXXXXXXXXXXXXXXXXNAAVQKXXXXXXXXXXXXXXXXXXVDTNYRPLSSPTKVNIAANMQQRNTPRSLGPSSIVVSHAIRKQVXXXXXXXXXXXXIVAKPQVKPKPTNIPIVQKPNNARPNLNHGNQRXXXXXXXXXXXXXXXXXXXXXXXXXXVAKRTVNVNHAPTLQQRSSRPVTSKQSFNPRNSNNE 1885
            DYVDSEMQTRLKDTDLECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELEL IISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNGDVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQMAVKSTFGTSTRRSSTFTRAPSLRLAPRASFERNELERRKVQQRNRERVREENKNAAVQKMTSMGASGSGASTPSSAGVDTNYRPLSSPTKVNIAANMQQRNTPRSLGPSSIVVSHAIRKQVSEESTSSESSESIVAKPQVKPKPTNIPIVQKPNNARPNLNHGNQRNNISSQSDSSDSSDDDNDGDNSPPPPVAKRTVNVNHAPTLQQRSSRPVTSKQSFNPRNSNNE
Sbjct:   18 DYVDSEMQTRLKDTDLECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELLIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNGDVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQMAVKSTFGTSTRRSSTFTRAPSLRLAPRASFERNELERRKVQQRNRERVREENKNAAVQKMTSMGASGSGASTPSSAGVDTNYRPLSSPTKVNIAANMQQRNTPRSLGPSSIVVSHAIRKQVSEESTSSESSESIVAKPQVKPKPTNIPIVQKPNNARPNLNHGNQRNNISSQSDSSDSSDDDNDGDNSPPPPVAKRTVNVNHAPTLQQRSSRPVTSKQSFNPRNSNNE 581          
BLAST of Band 4.1-like protein 5 vs. Planmine SMEST
Match: SMESG000007133.1 (SMESG000007133.1)

HSP 1 Score: 955.281 bits (2468), Expect = 0.000e+0
Identity = 541/564 (95.92%), Postives = 542/564 (96.10%), Query Frame = 2
Query:  194 DYVDSEMQTRLKDTDLECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNGDVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQMAVKXXXXXXXXXXXXXXXAPSLRLAPRASFERNELXXXXXXXXXXXXXXXXXXNAAVQKXXXXXXXXXXXXXXXXXXVDTNYRPLSSPTKVNIAANMQQRNTPRSLGPSSIVVSHAIRKQVXXXXXXXXXXXXIVAKPQVKPKPTNIPIVQKPNNARPNLNHGNQRXXXXXXXXXXXXXXXXXXXXXXXXXXVAKRTVNVNHAPTLQQRSSRPVTSKQSFNPRNSNNE 1885
            DYVDSEMQTRLKDTDLECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELEL IISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNGDVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQMAVKSTFGTSTRRSSTFTRAPSLRLAPRASFERNELERRKVQQRNRERVREENKNAAVQKMTSMGASGSGASTPSSAGVDTNYRPLSSPTKVNIAANMQQRNTPRSLGPSSIVVSHAIRKQVSEESTSSESSESIVAKPQVKPKPTNIPIVQKPNNARPNLNHGNQR                     +PPPPVAKRTVNVNHAPTLQQRSSRPVTSKQSFNPRNSNNE
Sbjct:   18 DYVDSEMQTRLKDTDLECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELLIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNGDVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQMAVKSTFGTSTRRSSTFTRAPSLRLAPRASFERNELERRKVQQRNRERVREENKNAAVQKMTSMGASGSGASTPSSAGVDTNYRPLSSPTKVNIAANMQQRNTPRSLGPSSIVVSHAIRKQVSEESTSSESSESIVAKPQVKPKPTNIPIVQKPNNARPNLNHGNQR---------------------NPPPPVAKRTVNVNHAPTLQQRSSRPVTSKQSFNPRNSNNE 560          
BLAST of Band 4.1-like protein 5 vs. Planmine SMEST
Match: SMESG000022143.1 (SMESG000022143.1)

HSP 1 Score: 154.066 bits (388), Expect = 4.052e-38
Identity = 104/325 (32.00%), Postives = 178/325 (54.77%), Query Frame = 2
Query:  236 DLECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKK----NINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDV----------QPDDNGDVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSR 1168
            DL+C++V LDG    F L+K++ G  L D  F  +E+  ++++FGLQY D          WL+  K ++KQL    P+   FRVKF+ ++P SQ+ +EYTRYL   QLK  +    L C+ +DM A + + +LQ ELGDY+  +H   +IS+FRF        EL++S +     +K +N  P+ A++++L     L  YGVD  N    + +   +G +  G  +++ + ++ LF W+++ K+SFKK +  + ++            + + +  + +T+V  S  +  CK +W++CV++H F+R   V+ PP   Q     KS+
Sbjct:   21 DLKCQVVLLDGNVEFFTLQKKSCGHCLLDLIFDTLEL-LERDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNP-SQMKEEYTRYLLFLQLKKDIFDERLHCN-QDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLH----MKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWSSIFKISFKKKKITIQIKSTHFVDQFKNNEESNKSSPLMYTYVLSSSPL--CKTLWQNCVDYHTFFR---VKVPPNNSQIKANTKSK 333          
BLAST of Band 4.1-like protein 5 vs. Planmine SMEST
Match: SMESG000038155.1 (SMESG000038155.1)

HSP 1 Score: 154.451 bits (389), Expect = 4.164e-38
Identity = 98/319 (30.72%), Postives = 169/319 (52.98%), Query Frame = 2
Query:  248 KIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSP-AFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNGDVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTEYQM 1201
            ++  LD +   F +  RA+GQ L +    ++++  + +YF L+Y +K+ ++ WLD  K+V KQ      +  +F +KF++  P + L DEYTRYLF  Q+K  +  G L+C+    A  +A ++ Q E+GD+ E E+    ++S  R     Q  EE  + ++     L  ++  PS AD   L+  R +  YG+  H  +   +    L ++  GI+I++ +IKI +F W  V KLSFK+ RF +    +  +    VE  F+F S +   CK  WK C+EHHAF+R + V++   +  ++    S +  +  T+ Q+
Sbjct:   20 RVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQL-LESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYP-NMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIA-QSEIGDFLEDEYDDYTYLSSLRL--TKQANEEFLMKVMECHRTLVGQS--PSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYI---KLHAEGYDIVE--FIFNSRN--ECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQL 324          
BLAST of Band 4.1-like protein 5 vs. Planmine SMEST
Match: SMESG000022143.1 (SMESG000022143.1)

HSP 1 Score: 153.68 bits (387), Expect = 4.506e-38
Identity = 104/325 (32.00%), Postives = 178/325 (54.77%), Query Frame = 2
Query:  236 DLECKIVHLDGTDFTFFLEKRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKK----NINHWLDIGKKVRKQLEIGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKDMAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKFNLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSGILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDV----------QPDDNGDVEHTFVFQSFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSR 1168
            DL+C++V LDG    F L+K++ G  L D  F  +E+  ++++FGLQY D          WL+  K ++KQL    P+   FRVKF+ ++P SQ+ +EYTRYL   QLK  +    L C+ +DM A + + +LQ ELGDY+  +H   +IS+FRF        EL++S +     +K +N  P+ A++++L     L  YGVD  N    + +   +G +  G  +++ + ++ LF W+++ K+SFKK +  + ++            + + +  + +T+V  S  +  CK +W++CV++H F+R   V+ PP   Q     KS+
Sbjct:   21 DLKCQVVLLDGNVEFFTLQKKSCGHCLLDLIFDTLEL-LERDFFGLQYKDSHPSSGKYYKWLNGAKSIKKQLTGSQPYIFHFRVKFYPNNP-SQMKEEYTRYLLFLQLKKDIFDERLHCN-QDMVAILGSYALQAELGDYNPQQHKSGYISEFRFVKNQTPVLELKISDLH----MKMKNFSPTKAEREYLNIASELDYYGVDIFNALTLDKEIVQIGPSSLGFSVFKNKKRMHLFLWSSIFKISFKKKKITIQIKSTHFVDQFKNNEESNKSSPLMYTYVLSSSPL--CKTLWQNCVDYHTFFR---VKVPPNNSQIKANTKSK 333          
The following BLAST results are available for this feature:
BLAST of Band 4.1-like protein 5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EPB41L54.624e-8546.73erythrocyte membrane protein band 4.1 like 5 [Sour... [more]
EPB41L54.624e-8546.73erythrocyte membrane protein band 4.1 like 5 [Sour... [more]
EPB41L53.290e-8446.73erythrocyte membrane protein band 4.1 like 5 [Sour... [more]
EPB41L54.778e-8446.73erythrocyte membrane protein band 4.1 like 5 [Sour... [more]
EPB41L55.242e-8446.73erythrocyte membrane protein band 4.1 like 5 [Sour... [more]
back to top
BLAST of Band 4.1-like protein 5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
frm-23.566e-8343.26FERM domain (Protein4.1-ezrin-radixin-moesin) fami... [more]
frm-23.897e-8342.98FERM domain (Protein4.1-ezrin-radixin-moesin) fami... [more]
frm-23.897e-8342.98FERM domain (Protein4.1-ezrin-radixin-moesin) fami... [more]
frm-23.897e-8342.98FERM domain (Protein4.1-ezrin-radixin-moesin) fami... [more]
ptp-11.629e-4433.53Tyrosine-protein phosphatase 1 [Source:UniProtKB/... [more]
back to top
BLAST of Band 4.1-like protein 5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
yrt9.402e-8946.73gene:FBgn0004049 transcript:FBtr0114375[more]
yrt3.160e-8846.73gene:FBgn0004049 transcript:FBtr0114374[more]
yrt3.315e-8846.73gene:FBgn0004049 transcript:FBtr0114376[more]
yrt5.276e-8846.73gene:FBgn0004049 transcript:FBtr0082793[more]
CG343477.674e-4935.02gene:FBgn0085376 transcript:FBtr0334566[more]
back to top
BLAST of Band 4.1-like protein 5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
epb41l51.218e-8344.34erythrocyte membrane protein band 4.1 like 5 [Sour... [more]
epb41l51.370e-8344.34erythrocyte membrane protein band 4.1 like 5 [Sour... [more]
epb41l59.656e-8345.03erythrocyte membrane protein band 4.1 like 5 [Sour... [more]
epb41l59.771e-8244.34erythrocyte membrane protein band 4.1 like 5 [Sour... [more]
epb41l51.294e-8144.34erythrocyte membrane protein band 4.1 like 5 [Sour... [more]
back to top
BLAST of Band 4.1-like protein 5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptpn45.854e-5735.93protein tyrosine phosphatase, non-receptor type 4 ... [more]
nme71.373e-5644.66NME/NM23 family member 7 [Source:Xenbase;Acc:XB-GE... [more]
epb41l4a6.242e-5634.94erythrocyte membrane protein band 4.1 like 4A [Sou... [more]
epb41l4a1.291e-5534.94erythrocyte membrane protein band 4.1 like 4A [Sou... [more]
epb41l4a1.504e-5534.95erythrocyte membrane protein band 4.1 like 4A [Sou... [more]
back to top
BLAST of Band 4.1-like protein 5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Epb41l53.811e-8646.73erythrocyte membrane protein band 4.1 like 5 [Sour... [more]
Epb41l53.811e-8646.73erythrocyte membrane protein band 4.1 like 5 [Sour... [more]
Epb41l59.018e-8546.73erythrocyte membrane protein band 4.1 like 5 [Sour... [more]
Epb41l51.193e-8446.73erythrocyte membrane protein band 4.1 like 5 [Sour... [more]
Epb41l4b2.482e-8044.24erythrocyte membrane protein band 4.1 like 4b [Sou... [more]
back to top
BLAST of Band 4.1-like protein 5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q58CU2|E41L5_BOVIN4.617e-8546.73Band 4.1-like protein 5 OS=Bos taurus OX=9913 GN=E... [more]
sp|Q8BGS1|E41L5_MOUSE6.308e-8446.73Band 4.1-like protein 5 OS=Mus musculus OX=10090 G... [more]
sp|Q5FVG2|E41L5_RAT6.439e-8446.73Band 4.1-like protein 5 OS=Rattus norvegicus OX=10... [more]
sp|Q9MYU8|E41L5_CANLF7.193e-8446.42Band 4.1-like protein 5 OS=Canis lupus familiaris ... [more]
sp|Q9HCM4|E41L5_HUMAN2.517e-8346.73Band 4.1-like protein 5 OS=Homo sapiens OX=9606 GN... [more]
back to top
BLAST of Band 4.1-like protein 5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3TVN58.068e-11051.37FERM domain-containing protein OS=Rodentolepis nan... [more]
A0A564Y1E69.808e-10850.76FERM domain-containing protein OS=Hymenolepis dimi... [more]
A0A564Y1911.190e-10750.76FERM domain-containing protein OS=Hymenolepis dimi... [more]
A0A3P6TKK13.801e-10350.15FERM domain-containing protein (Fragment) OS=Dibot... [more]
A0A5K3FI283.369e-10249.24Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of Band 4.1-like protein 5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
epb41l4b1.081e-8145.17erythrocyte membrane protein band 4.1 like 4B [Sou... [more]
epb41l59.717e-8044.41erythrocyte membrane protein band 4.1 like 5 [Sour... [more]
ptpn4a6.693e-5637.13protein tyrosine phosphatase non-receptor type 4a ... [more]
ptpn4b4.937e-5435.40protein tyrosine phosphatase non-receptor type 4b ... [more]
epb41l4a7.578e-5435.45erythrocyte membrane protein band 4.1 like 4A [Sou... [more]
back to top
BLAST of Band 4.1-like protein 5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
epb41l59.349e-8444.84erythrocyte membrane protein band 4.1 like 5 [Sour... [more]
epb41l52.066e-8345.00erythrocyte membrane protein band 4.1 like 5 [Sour... [more]
epb41l53.029e-8345.40erythrocyte membrane protein band 4.1 like 5 [Sour... [more]
ENSPMAT00000002204.11.798e-5845.81pep scaffold:Pmarinus_7.0:GL477123:87549:93162:-1 ... [more]
ENSPMAT00000001312.12.104e-4934.13pep scaffold:Pmarinus_7.0:GL477231:34421:73675:-1 ... [more]
back to top
BLAST of Band 4.1-like protein 5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Band 4.1-like protein 5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO320453.924e-5836.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428922.357e-5536.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343914.420e-5238.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448235.346e-5134.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO336261.816e-4434.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Band 4.1-like protein 5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
epb41l54.584e-8546.58erythrocyte membrane protein band 4.1 like 5 [Sour... [more]
epb41l4b4.442e-7944.27band 4.1-like protein 4B [Source:NCBI gene;Acc:101... [more]
ptpn4a7.785e-5334.43protein tyrosine phosphatase non-receptor type 4 [... [more]
epb41l3b3.861e-5235.94erythrocyte membrane protein band 4.1 like 3 [Sour... [more]
epb41l3b4.278e-5235.94erythrocyte membrane protein band 4.1 like 3 [Sour... [more]
back to top
BLAST of Band 4.1-like protein 5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000007133.10.000e+099.82SMESG000007133.1[more]
SMESG000007133.10.000e+095.92SMESG000007133.1[more]
SMESG000022143.14.052e-3832.00SMESG000022143.1[more]
SMESG000038155.14.164e-3830.72SMESG000038155.1[more]
SMESG000022143.14.506e-3832.00SMESG000022143.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005213 ID=SMED30005213|Name=Band 4.1-like protein 5|organism=Schmidtea mediterranea sexual|type=transcript|length=2460bp
TCGAATAATTGCAAGAAAGTTTTATTAATCATATGACCTAACCATTAACT
GAGCTTGTTTTAATATTCTAGCTAGATTAAATTTGGTTGGTTGTTTTTAG
CATTGGTTTAAATAATATAAGCTTCCTACTAAAAAAATATTGATGGCTAC
TCTGTTACGACTTTTAACGCGTAGAAAAAAGTCTAATAAAAGAGACTATG
TTGATTCAGAAATGCAAACGCGATTGAAAGACACTGACTTAGAGTGTAAG
ATTGTTCATTTAGATGGAACAGATTTCACGTTTTTCCTCGAAAAACGTGC
ACTGGGACAAAAATTAGAAGATTATACATTTCATCAAATTGAAGTTAATG
ATGATAAAAATTATTTTGGTCTACAGTATACTGATAAGAAAAATATAAAT
CACTGGTTAGATATTGGAAAGAAAGTGAGGAAACAACTAGAAATTGGTCC
ACCATTTACTCTTAGATTTCGAGTGAAATTTTTCAGCAGTGATCCATGCA
GTCAATTGCATGATGAATACACAAGATATTTATTTGTTCAACAACTGAAA
TTATTGTTAAGAAGCGGTGAGCTCCGTTGTGATGACAAGGATATGGCGGC
TGAGATCGCAGCCTTGAGTTTGCAAGGTGAACTGGGAGATTATGATGAAA
TGGAGCACTCTCCTGCTTTTATATCGCAATTTAGATTTTTTCCTGAATCT
CAGCAAACTGAAGAGTTAGAATTGTCGATTATTTCAAAGTTTAACTTGCT
AAAAGATCGGAATATTCTGCCATCAACTGCAGATAAACAATTTTTGGAAA
AATGTCGAACCTTGCCTGACTATGGAGTTGACCAGCATAATATTAAGGGT
AAGAATGATAAAGATTACATCCTCGGCTTAACGCCTAGTGGTATTTTGAT
TTATGAAGGCCAGATAAAGATCGGATTGTTTCCATGGAATAATGTTACTA
AATTATCTTTCAAAAAAAGTCGTTTTAAAGTCGTAGTTCAAGACGTTCAA
CCAGACGATAACGGAGATGTTGAACACACTTTTGTGTTTCAAAGTTTTGA
TATTGTTGCTTGTAAACAAATGTGGAAAAGCTGTGTGGAACACCATGCAT
TTTATCGTCTCGAAGGAGTTCGTAAACCCCCAACCAAATTCCAACAAATA
TTTCGTCTCAAATCCCGTTTCTATGCTAGTTTCCATACTGAATATCAAAT
GGCGGTTAAGTCGACTTTTGGAACAAGTACCAGAAGAAGTTCCACGTTTA
CTAGAGCCCCGAGTTTAAGACTTGCACCGCGAGCAAGTTTTGAGAGAAAT
GAACTTGAAAGAAGAAAGGTTCAACAAAGAAATCGTGAACGTGTCAGAGA
AGAAAATAAAAATGCTGCAGTTCAAAAGATGACTTCAATGGGTGCATCTG
GCAGCGGCGCTTCAACTCCAAGTTCTGCCGGAGTGGACACTAACTACAGA
CCTTTATCAAGTCCAACAAAAGTCAATATTGCGGCAAATATGCAACAAAG
AAACACTCCTCGTTCTTTAGGACCTTCTTCAATTGTTGTTTCCCATGCCA
TTCGTAAACAAGTTTCAGAAGAATCTACAAGTTCCGAATCATCCGAATCT
ATAGTGGCGAAGCCTCAAGTGAAACCCAAACCGACTAACATTCCCATAGT
TCAAAAACCAAACAATGCCAGACCAAATCTCAATCATGGAAATCAGCGCA
ATAACATTTCAAGTCAATCAGATAGTTCAGACTCTTCCGATGATGATAAT
GATGGTGATAATAGTCCACCACCTCCGGTTGCCAAAAGAACAGTAAATGT
TAACCATGCTCCCACACTGCAACAGAGGAGTTCTAGACCTGTTACGTCTA
AACAAAGCTTTAATCCTAGAAATTCTAACAATGAACAGATTATTCAAGTT
TGAATGAGCTATTAATATATTTATATATCACAGATCATGCCACAGTCTTA
TCACAGAAGCAGAACTCTACTAATCAAAAATTTCTAAAAAAAATCAATTT
ACTGTATTTTGTTATTTAAAATTTATTTAATACTCGATAACTTAATTTAA
TATAGTTTGTTTTAGTCATTGAGGAAAATCTTAGTTTATTCGGTGTTTAA
TTGAATTGGTTAGAATAATTTTCGAAAGCGTAAATGTTTGGCATGACAAA
CGAAAGTTTTATAGAACTGTTTGAATTGCATATCATTTCAAAAGTGAAAT
TTTCACAAATGTTTTTTTTGGGTTTATATTTCGTCGAAAATTATCGGATT
TCTGATTTTTTTACATATCATTTTTTTGGAAAGATTTGGTGTTTTGTGTT
TATTACGTGCTGTGTTGGAGAAGCTTTGGTGTTTCTTTTTTATTGCCTTT
TTATTGTGAGTTTGTTTGTATATTTAATATATATTTGATTTTTTAAACAG
TTATGCATTATTATTCAGTGCCATTCGCAAATATATTTTACACATTGAAA
AAAAAAGATC
back to top

protein sequence of SMED30005213-orf-1

>SMED30005213-orf-1 ID=SMED30005213-orf-1|Name=SMED30005213-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=587bp
MATLLRLLTRRKKSNKRDYVDSEMQTRLKDTDLECKIVHLDGTDFTFFLE
KRALGQKLEDYTFHQIEVNDDKNYFGLQYTDKKNINHWLDIGKKVRKQLE
IGPPFTLRFRVKFFSSDPCSQLHDEYTRYLFVQQLKLLLRSGELRCDDKD
MAAEIAALSLQGELGDYDEMEHSPAFISQFRFFPESQQTEELELSIISKF
NLLKDRNILPSTADKQFLEKCRTLPDYGVDQHNIKGKNDKDYILGLTPSG
ILIYEGQIKIGLFPWNNVTKLSFKKSRFKVVVQDVQPDDNGDVEHTFVFQ
SFDIVACKQMWKSCVEHHAFYRLEGVRKPPTKFQQIFRLKSRFYASFHTE
YQMAVKSTFGTSTRRSSTFTRAPSLRLAPRASFERNELERRKVQQRNRER
VREENKNAAVQKMTSMGASGSGASTPSSAGVDTNYRPLSSPTKVNIAANM
QQRNTPRSLGPSSIVVSHAIRKQVSEESTSSESSESIVAKPQVKPKPTNI
PIVQKPNNARPNLNHGNQRNNISSQSDSSDSSDDDNDGDNSPPPPVAKRT
VNVNHAPTLQQRSSRPVTSKQSFNPRNSNNEQIIQV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR035963FERM_2
IPR019749Band_41_domain
IPR018980FERM_PH-like_C
IPR019748FERM_central
IPR011993PH-like_dom_sf
IPR014352FERM/acyl-CoA-bd_prot_sf
IPR018979FERM_N
IPR019747FERM_CS
IPR000299FERM_domain
IPR029071Ubiquitin-like_domsf
Vocabulary: cellular component
TermDefinition
GO:0005856cytoskeleton
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 391..411
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 32..112
e-value: 3.3E-20
score: 73.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 388..432
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 388..407
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 474..586
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 501..529
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 553..586
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 408..432
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 474..488
NoneNo IPR availablePANTHERPTHR232804.1 G PROTEINcoord: 34..571
NoneNo IPR availablePANTHERPTHR23280:SF25LD33734Pcoord: 34..571
NoneNo IPR availableCDDcd17108FERM_F1_EPB41L5_likecoord: 33..114
e-value: 8.56431E-31
score: 112.828
NoneNo IPR availableCDDcd13186FERM_C_NBL4_NBL5coord: 228..322
e-value: 2.01386E-39
score: 137.029
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 225..356
IPR018980FERM, C-terminal PH-like domainSMARTSM01196FERM_C_3coord: 236..329
e-value: 2.3E-30
score: 116.8
IPR018980FERM, C-terminal PH-like domainPFAMPF09380FERM_Ccoord: 237..324
e-value: 5.3E-20
score: 71.6
IPR019749Band 4.1 domainSMARTSM00295B41_5coord: 29..232
e-value: 3.9E-47
score: 172.6
IPR018979FERM, N-terminalPFAMPF09379FERM_Ncoord: 37..99
e-value: 1.7E-8
score: 34.3
IPR019748FERM central domainPFAMPF00373FERM_Mcoord: 121..230
e-value: 1.2E-12
score: 48.3
IPR019748FERM central domainCDDcd14473FERM_B-lobecoord: 127..224
e-value: 1.11627E-19
score: 82.2942
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 227..323
e-value: 3.0E-28
score: 100.0
IPR014352FERM/acyl-CoA-binding protein superfamilyGENE3DG3DSA:1.20.80.10coord: 113..224
e-value: 2.2E-24
score: 88.0
IPR019747FERM conserved sitePROSITEPS00660FERM_1coord: 88..117
IPR000299FERM domainPROSITEPS50057FERM_3coord: 33..325
score: 63.355
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 32..114
IPR035963FERM superfamily, second domainSUPERFAMILYSSF47031Second domain of FERMcoord: 110..227