cilia- and flagella-associated protein 47

Overview
Namecilia- and flagella-associated protein 47
Smed IDSMED30005211
Uniprot Best hitCilia- and flagella-associated protein 47 OS=Homo sapiens OX=9606 GN=CFAP47 PE=2 SV=5 (E=8.16912e-166)
Length (bp)10075
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of cilia- and flagella-associated protein 47 (SMED30005211) t-SNE clustered cells

Violin plots show distribution of expression levels for cilia- and flagella-associated protein 47 (SMED30005211) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of cilia- and flagella-associated protein 47 (SMED30005211) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for cilia- and flagella-associated protein 47 (SMED30005211) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005211

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30005211SMESG000060264.1 SmedASXL_039334SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30005211SMESG000060264.1 SmedASXL_018444SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30005211SMESG000060264.1 dd_Smed_v4_8294_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30005211SMESG000060264.1 dd_Smed_v4_8294_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30005211SMESG000060264.1 dd_Smed_v4_8294_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30005211SMESG000060264.1 dd_Smed_v4_8294_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30005211SMESG000060264.1 dd_Smed_v6_8294_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30005211SMESG000060264.1 SMESG000078142.1 OX_Smed_1.0.15566ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30005211SMESG000060264.1 dd_Smed_v4_17692_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30005211SMESG000060264.1 dd_Smed_v4_17692_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005211SMESG000060264.1 dd_Smed_v4_8294_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30005211SMESG000060264.1 dd_Smed_v4_8294_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30005211SMESG000060264.1 dd_Smed_v4_8294_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30005211SMESG000060264.1 dd_Smed_v4_8294_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of cilia- and flagella-associated protein 47 vs. Ensembl Human
Match: CFAP47 (cilia and flagella associated protein 47 [Source:HGNC Symbol;Acc:HGNC:26708])

HSP 1 Score: 717.227 bits (1850), Expect = 0.000e+0
Identity = 529/1717 (30.81%), Postives = 841/1717 (48.98%), Query Frame = 2
Query: 5024 QRWFTMHGWAGNLHPINVPVSFRSSLQKRFGFSQTSTKEKISNTENIENTGLKNDSRDLYDMILYLTGRQIPGINTTVVLPTHPIE-RSCHIYIQHATLIAFIENQGGQLAQIKPEHLMDLPEYELWHSV--GCPGLPNSDMKP-----VQYDSNSFEKISKKAWTVVLLQILKVFILIKVTYSSYRHALQILHGKEPIPEIQLAATVSNCYSLNERILLAWLNYLYEAYRHVCWPGNSNPDIGTTSSTPVSRWIINFDNDFMDSLILATAIGAYIPFMIERHFKYMYPNPQNPEQCLHNALKIVSALKDIGLEFDIQAIDIVDPNPVMMIXXXXXXXXXXXXYIPKSEIVFTGSLHEQITKQIQISNPTSKPLSYECIIIGNDNCDFALP-KGNVVNLSGKASIKWPIVFKSRFIRSAEVTVMFVGRKTGFSIPTNLIFSVKTKIMSINPSKVEKIVGKCYIMKKINLKIISPYNKSGNFSVKLIESSE--GNLKSIKETSNEFKQTETSFIKPAIAKKATLDA-------IKTTNKLRAFFSHCETVFINENKSGSLELFYLPFHLGIKRCTIIFSNDSIGEFVHSVEASAELPEPIIITPNDDKPKSGVWVS--RAEAANRGLEGNEKTIYWKCEVGSFIQETLSIPINNIYKEYALHTAAQLHLSSQEVSRRQXXXXXXXXXXXXXXXXXXXXXXDDHDFVNSNKQIKKKADTKYSNKGKFINFEVESDSSFYTTPLIV--QIPDPLMHLGNDSTKNNAIQTPSTIDIPIKFHASTAGVYPCNLVIKGPDDVRLFRIECTVTPEGNLSQIYFKIPLQEVLAQNIPIVNKTKQDWPLKATITGTSAAFSGPDFIMAKALSVSQYPLQFKPVKEGKVNAKLTLFNEADGSEHVFELYGEGESPLALESLYFECTVGENITKTLQIPNLTRKKHFFTVESDLDWMIVGDDTISILPGRNCSYDIAINPKRSGKYTGILAF-------VSGKKTVIEYDSDGDEIVDVYNDETVNSA-NKSCEIY------RIWYSLVVHVSPGAPQGIFDVKCNCLEKVVLEIPINNPSEDMELKFEAAISGANLTGNSEITVNSLSTESYLLTFTPSFIGNFDGRLIFFNDIVGEFWYKLNLTADSPIEKFIPPVKCELGKWCLVEIPLKNIDNENKLVMYPEISNPECFSILIGDLELFDQDKQCFSIAPRTEHVLSVRFTPCEIGSGTHLCFLVMKSKLLGDQKFILTGCGMPPNPSDIIGVSSEAGSNMTFLIPFHNPLLEPVLIDIRITE-EHQS--VLDKYRIGSVNLDKDFKEMETSVFXXXXXXXXXXXXESKQSIEIPISFAPQEMRKYDAICCVVMKRKNGEPL-ISDEDFNDLILPNSDNITPFDKKQLRWLFPIKGVPETLVSLNVFTTPLVQGPLRIETKEHLEFNL----WGLPPPVTREDFVTKSVKSAPATINDGNELKPIDRFLQDFTTELRVITVENGDAMDTATLNEYVHLFLMKQSKQLDTGVTVLTYEIRMRPLKKFRLNSEIIITSLTGGVWRFPIRFVAHDCDPDDEITIEAIGLNKPVSTRFYLNSTTYNELPFKAYFLKGGDPDFTVSPESGILPPIQSFSKFQISGLEFVVTWQPKTYSRSKGARLVIETEMMEWVYKFVGISPQYVVP-DTRSIIQSNWDSDMXXXXXXXXXXXXXFLKQNIEMLSTAVSSPVKGAPLL 10039
            Q WF++ GW    H  ++P + R  + K   +S TS  +K S   +         ++ +YD++L+L+G+  PGIN++  LP    E R   +++QH++L+ F+  QGG ++ + PE L++  +Y+ W  +      +P S   P     +  + + FE  SK+AWT V LQI KV +L +V      +   I    +  P++      SN YS +ERILL+W+N  YE  RHV W  N + D+      P  RWI+NFD D  D L+ AT +GAY PF+IE HF  MY  P++PE+ LHN L IV+ L +I  + +IQA DI DPNP++M++  + ++  LP Y+PK  + F  +LH+ +  +I + N +S+ L Y   I+G D  DF+L  KGNVV +S +  I   + F SRFIR AE +++ + +         + F++K K++      + K    CY  +++ + + +P++ +G+FSV L+ESS    +   + E+    K  +      +   +   D+       IK+T  +R FF    TV +    + SLEL +LPF++ ++ C II SN  IG+ ++  E     P P    P +    S V+ S  R E  N+        +Y KC+    +   L +P+ N  KE AL  AAQ  +SS E  RR +TGTL SSS+ +    +   + +       +K ++K     Y+        EV     FY    I    IP+P +        + A  +  ++ +P++F    +G YPC +++K   DVR + +E  V  E   ++  F+ P  E L QNIPI N+T   W  + TI G    F GP  +      + +YPL FKP+ E  +  KL L NE DG EH+F++ G G+ P ALE +  EC VG    K + +P+ T     F V +DL  ++ G+  I++ P +   Y I + P + G   G + F          K    E D+D D+ +   +  T  S+     + Y      R WY+L +H +PG P  I ++ C  L+   +EIP++NP +D  L  E  ++ A L G++EI ++ L    Y++ ++P+  G  D  +IF  ++  EFWY L LT + P    +P ++C+LGK     IPL N  +E  L +    SNPE F + I         K    I+P +   L V F P  +G   H   +        + KF L+G G+ P P D   +++  G   T +IPF NP +E VLIDI +T  EH    V+D      +     F+    S         + + L  K +I+I + F PQ M+ +  +  + M + NG+   I + D  D+   +   I   + + + W++PI G+P+     +       Q   R E K  +  N     + L P +T    + K  +++     D NE+  I  F  +   E         +AM +  L   V L+++++S  +        + +   P K  R +  + I  +T G+W+FPI  +A + D D  I IE +GL K       L S T N  PF A+FL G D +F V P++G L P      F  +G    V ++PK Y R   A LVI+TE M W Y+  G++P  V P + ++ I +   +           R  NF+++N +++ T VSS +KGAPL+
Sbjct: 1541 QTWFSLFGWPEGPHSFSIPETIRRDVYKMQFYSSTSPPQKFSRQNDFSKY-----NKTIYDVLLHLSGKMPPGINSSQSLPVDNHEKRVIQLHLQHSSLLDFLNAQGGCISHVLPEFLLEPEDYKRWIEIMSSTNTMPVSSCTPKKKCSIVIEMSKFEAWSKRAWTDVFLQIYKVLVLSRVVPYCSNNMPPIC--VQNTPKVNPCFASSNIYSDSERILLSWMNINYENTRHVIW-KNCHKDV-----IPSERWIVNFDKDLSDGLVFATQLGAYCPFLIESHFINMYTRPKSPEEYLHNCLIIVNTLYEIDFDVEIQATDICDPNPILMLMLCVYMYERLPTYLPKKVVSFECTLHDTVLNKILLKNSSSRNLVYNARIVGRDAADFSLSQKGNVVTISPRNEINVTLKFTSRFIRPAEASLLLISKPKNAVRGITMTFALKGKVLDFKAIDIIKCESPCYQFQEVTVNVKNPFHTAGDFSVILVESSTFVSSPTKLTESRQYPKHDDDMSSSGSDTDQGCSDSPNVLHTSIKSTF-IREFFCSMHTVHLGVKGTSSLELRFLPFNMHVRYCVIILSNKKIGQLIYVAEGKGMTPLPSSCLPMNTS-SSPVYYSTTREEGPNKKY----PVLYLKCKPYQILYVDLKLPMTNEAKEKALAFAAQQQMSSIEYERRLITGTLESSSIRVAIALLGLTKIETLMLFRISK-LRKPKTVSYTT-------EVSLPKYFYIPEKISIPWIPEPQV-----IKLSKAKASDGSVPLPLQFLPLQSGRYPCKILLKSRYDVRAYYVEGIVNEEQPEAKFEFETPAFEALTQNIPIKNQTNDKWTFQVTIEG--EWFYGPVDLHVGPDEIVEYPLTFKPIFECVITGKLILQNEVDGREHIFDIKGVGKKPSALEHITVECQVGNVTQKHITLPHFTNTALTFKVTADLP-IVWGNPQITVYPYKEILYLIHVRPWKRGILKGTITFSTTRRCTTRRKHDDYEEDTDQDQALSCLDSITEQSSILDDADTYGNFNNLRFWYNLEIHSTPGPPIEIMEMTCIALDSTCIEIPLSNP-KDRGLHLEVQLTSAALNGDNEIILSPLQCTKYIVWYSPATTGYSDESIIFQPEMAEEFWYLLKLTIELPKPTTMPEIQCDLGKHVTQIIPLVNCTHET-LKLQVTNSNPENFVLDIN-------RKSQLIISPHSTTELPVLFYPSALGRADHQACINFYCTQFTEWKFYLSGVGLFPQPLDTERITTRIGLQSTIVIPFKNPTMEDVLIDIILTSVEHPRNLVMDHCWDSFIYESSAFRFSSPS-------EIQGIALPPKGNIDISLLFIPQIMKLHKTMVIIEMTKANGKYWPIDNFDELDIKFKSIVGIDSEEIQAIHWIYPIVGLPQAPPPKSPPVVIQCQSRKRAEEKVEIILNAGFFGFSLTPDLTEVLVIPK--RNSHNFCEDPNEIPKIHEFEYEIQFE--------SEAMKSK-LESCVALYMIEKSYDIMAKRITFIFNLVFTPKKPLRSHITLKIECVTEGIWKFPIMLIATEPDTDAVIDIEGVGLFKESVFELRLKSQTRNPEPFTAHFLPGSDLEFFVKPQAGELLP------FNTNGTLITVGFKPKMYCRKYKATLVIQTEEMYWKYEINGLTPTTVPPKNAKAKIDATHKTH-----DNMPVRPHNFVRENTKLIRTGVSSTIKGAPLV 3184          

HSP 2 Score: 582.408 bits (1500), Expect = 1.701e-166
Identity = 430/1543 (27.87%), Postives = 751/1543 (48.67%), Query Frame = 2
Query:    2 MENSIDIFGVRITPNVINFRNCEINGSYIRVVNVQNIGNKNVTVRFYSPQSKDFSMICKMHEKIISSGLSHLCSLKYTMEVEERSVDRLIVTVDGQVHEIPIFIYPSAPDLQIDRIINFGTVVMANKVVTQQANITNEGLKIGEFKLLYSGSRPLNIVPNEGIVYQQSSIPIQIEYVTHEAHKINEKCLVIFEGQDPFEIDIKGDVVKRSLELLDINSDERKLIQCIKFPYTYYGSDKSEVSLLFNNSPEKIQFVAVLEEDAVGQESGSHITM-TAAGINPKECTNPL-----TSLITMYPNQGNLGPYERIPVLFRFSPRWISPKQAFKKTLEPPLQQTFAVFIKIQIXXXXXXXXXXXXXXKDDTLT----RSQKLEVAITGTAAPVLIEMKPNSI-DFGECLENEEKTEKLLFYNRSSILSSLIDFPREAHFLISPNQIRVGPNEQVEISVTFCPKQYGNFNTKQVVKVLSYVKDEENPFLEYEQTIYEQILQLTGSCVAISKSVAPKYCNGLDPLVTNKVGYLAEANFSNLGFKPHNGPATAYITTDAFATGGPQGSRLFKCTDANLHPYSNRTAFVAFPNDRAESIRPSEQNKEFRTILKRIKRYNYIDPDYAYDDEEMRKIRHHQDSYQTMIRRQHSLKKIVKLNSKFKAFE-NDINLGIIPGNGLYPPKLTTDQINTDKIEVFKDNKNFKLLSTKDL-KQSEKVINITKLGTFNAIPTTAQEKEHCSVVLTPQQLHQIIIGPNTINFGDVCVRSISNRDINVVNNLNQFIHVSVVIDCKELRQSSPLSQVIPAKTKSSFPLVFESTKKGKFQRNLSYTINGYYQNHVIVLANVVVNQXXXXXXXXXXXXXXIYPPETGIRNTITMTNPLNCATEFLWEPVFNSTNGIAFSIRPKEGVVEAFSKLDCEVVFHPSFMAPSEGDFILRI-PGNEEGSVETSSQDTLNTDTPTISNGDKSNITMKCIAILGNIHVAFQSRRVMFGNIPINMSSSRTATLLNTGGKHAYYRIVPDDLYEEYPGMTIHPLKGSIPVGGQAELTIKYHPVALSKFDCSIPIVIRGWKELDLKMSGNIIIPQVEILQKRLEFGGVPVGSEKSLDLTLINKSQCRANIEFDFIKQKDFTILTVGQCGNDKALSKDNYKCLITLKPLQE---FQCQLIFTPNEVASYEFPLSVKVNQIEIMVQGAGRGQTAXXXXXXXXXXXXPVRIETVSSSIVTSDRNSILAANLIR--NVSATATRQPINLSNNSFKF----HFFSISEAKSHSKQLIVFNTLEAEVEICLKFNSAN--WKYGTEKTTLKNLSKSRLIPFKFSCESEPIPNNDDYLICLSSLGEAIKIDIKFEPDHPGHYNGEVFVFINNNFEQIFQRIL-LTGLLESPELMCYPEHLTFIPSPLKTEVSLDFKLLAINFETKTFIRINLPLLTKPGTSEEYQPFQFVLSTSNEIQPISENSRVTEIRGTLSFCSDVPINVRSFMEVLTYSGVSK---SISLSATADNCQLTWQNFFNIHQSEYHIVC--DEGKHLEGT-DGI 4534
            M++S     +R+ P  + F +      Y   + V NI   N  +RF  P    F ++    +K ++SGL     ++Y  + +E + DRL+++++ +  EIP+     +  L+I+ ++NFGT+V  +KV +++  ITN G   G FK  Y G  P+ I P  GIV  +SS+ I++++   +   ++E+ +VI +GQ    + IK  VV++ +ELL ++SD R  ++CI F   ++GS K + + ++NNSPE I +VA++++DAVG+E G+ I   T   +N       +     T +I+  PN+G L PY++  + F F+P+ ++     KK + P  +Q +A+F++ +     S    +     DD  T    R QK+E+A+TGT  PVL++  P  + +F  C   E    + +  N+  +L     F + A+F I P + ++     V++  +F P Q G F  KQ+++++  V +E+   L   ++ +   L     C A +K V  K+  G+ P + N  G     + +    K  N    A + +    T   +      C +        +   +AFPNDRA +IR  + +K FR I  ++ R+NY++ D+AY   E ++ + H++ Y   ++   S++   K   + + +  +D ++G+ PG+GL  P L+  +I  +        +  +LL+T+ +  Q E+ +    L    + P+T QEK  CS++LTP+Q+HQ+I+GP+ +NFG++CV S +   ++V+N L   + + +  D +EL++++  S VI   + +   +VF+S   GKF ++ ++T+N     H++V+A VV       +   L+     +  +T  R T+ + N  NC  +F W+PV N+  GIAFSI P +G VEA+S L+CEV +   F +P EG+FIL +  GN                           + +KC+A LG   V     R++F N P  +++ R A L N G  HAY+++    L    P + I P +G +P GG   L I   P    KFD    + IR    +DL++ G+  I  VEI      F G  +G  + +   + NK   RA +EF+    KDF   ++      +         + +L+ L+E    +C + F+P EV   EF + V++N  E                              + +  ++S  ++     LIR   V ATA + P+NLS+  F F    H  + +   + ++ L+++N  +  V   L  ++    +K GT               FKFS  +  +  N+ Y            + I F P+ PG Y  ++ + +  N+  +  +IL LTG ++SPEL+  P  + F P PL     +D  +L  N+   + + + +P + +    EE  P   V      + P S +    ++   LSF S  P+   SF   L +    K   S+ ++ATA+NC LT   +  IH  + +I+   D+ ++L+ T DG+
Sbjct:   31 MDSSGRDMQLRVIPAEVKFLDTMAGRVYRLPITVHNICRWNQKIRFKEPVKPQFKLMLTSLDKELASGLQMTAMVEYHPDKDEDTFDRLLISIENKTTEIPLIGLIPSCQLEIESVVNFGTLVANSKVYSKEITITNHGKAPGIFKAEYHGQLPILIFPTSGIVDAKSSMVIKVDFCADQPRIVDEEAIVILQGQPEMLLSIKAHVVEQIIELLSMSSDRR--LECIHFGPVFFGSSKIKHARVYNNSPEPINWVAIIQDDAVGEELGTDIQQRTDIALNNLTYIRKIKNIDTTIIISCLPNEGTLQPYQKTVITFCFTPKLMA---VGKKDIGPSYRQDYALFLRFE-----SVGSKDGFLRDDDYKTIKSERFQKVELALTGTGLPVLLQFDPGPVLNFKPCFMGERSEIQCIIKNQCELLPVTYHFKKTANFEIDPEKGKITGGGMVDVMCSFVPHQLGVFKVKQMIEIIGLVAEEDLQSLSV-KSFHHVYLAFNSICKASTKKVVMKFDPGILPSIRNPTGKFVVKDLA----KRKNYAPVAMLQSAMTRTHNHRS-----CEEP------VKDMLLAFPNDRAATIRSKDHHKHFRPIFTKVPRFNYVNHDFAYTTFEKQQKKLHENYYAMYLKYLRSVRLQKKQAERERMYSYDDTDIGLEPGSGLKSPSLSEAEIEEELSSAANSIRANRLLTTRGIASQEEESVRRKVLKGLKSEPSTPQEKHDCSLMLTPKQIHQVIVGPSVLNFGNICVNSPNTHLLHVINMLPMHVLLQLDTDLEELQKTNQFSYVILPTSSTYISMVFDSPTIGKFWKSFTFTVNNVPSGHILVVA-VVQPVTLELSSNELVLRPRGFFMKTCFRGTVRLYNRQNCCAQFQWQPV-NTGRGIAFSICPAKGTVEAYSSLECEVTWQQGFSSPEEGEFILHVFQGNA--------------------------LKLKCVAHLGRTKVLLLQPRILFSNCPQGLTTWRKAILQNVGQNHAYFKVCSQSL---LPIINIIPSQGIVPFGGITVLNISCKPTVAEKFDTRAKVSIRHANVIDLRIGGSAEIADVEINPDVFNFSGAYIGGTQIIPFVIKNKGITRARVEFNL---KDFPDFSMDLKDKSEEFKDPAVPYIYSLE-LEENTSLECSITFSPKEVTVVEFIIQVQINFFE---------------------------SSKLYTKYLSSSPSNPKTVPLIRPCYVQATALQSPLNLSSTKFVFEIPLHEMNPNNKVTKTQNLVLYNITKHHVTWTLDLSNTGKLFKDGT---------------FKFSVLNGILRPNEKY-----------NVSISFCPNRPGTYTADIPMLL--NYIPVCYKILHLTGEVKSPELLFDPPFIFFTPVPLDITTVMDINILPQNYFRNSTLCVQIPTV-RLLDGEEIHPLS-VKFPKGRVIPGSHSGINNKLTCHLSFKSSKPV---SFFTNLLFCDDRKNWFSLPVTATAENCILTIYPYMAIHLDKQNIILKNDKDEYLKKTRDGV 1452          
BLAST of cilia- and flagella-associated protein 47 vs. Ensembl Human
Match: CFAP47 (cilia and flagella associated protein 47 [Source:HGNC Symbol;Acc:HGNC:26708])

HSP 1 Score: 449.129 bits (1154), Expect = 8.287e-134
Identity = 278/933 (29.80%), Postives = 496/933 (53.16%), Query Frame = 2
Query:    2 MENSIDIFGVRITPNVINFRNCEINGSYIRVVNVQNIGNKNVTVRFYSPQSKDFSMICKMHEKIISSGLSHLCSLKYTMEVEERSVDRLIVTVDGQVHEIPIFIYPSAPDLQIDRIINFGTVVMANKVVTQQANITNEGLKIGEFKLLYSGSRPLNIVPNEGIVYQQSSIPIQIEYVTHEAHKINEKCLVIFEGQDPFEIDIKGDVVKRSLELLDINSDERKLIQCIKFPYTYYGSDKSEVSLLFNNSPEKIQFVAVLEEDAVGQESGSHITM-TAAGINPKECTNPL-----TSLITMYPNQGNLGPYERIPVLFRFSPRWISPKQAFKKTLEPPLQQTFAVFIKIQIXXXXXXXXXXXXXXKDDTLT----RSQKLEVAITGTAAPVLIEMKPNSI-DFGECLENEEKTEKLLFYNRSSILSSLIDFPREAHFLISPNQIRVGPNEQVEISVTFCPKQYGNFNTKQVVKVLSYVKDEENPFLEYEQTIYEQILQLTGSCVAISKSVAPKYCNGLDPLVTNKVGYLAEANFSNLGFKPHNGPATAYITTDAFATGGPQGSRLFKCTDANLHPYSNRTAFVAFPNDRAESIRPSEQNKEFRTILKRIKRYNYIDPDYAYDDEEMRKIRHHQDSYQTMIRRQHSLKKIVKLNSKFKAFE-NDINLGIIPGNGLYPPKLTTDQINTDKIEVFKDNKNFKLLSTKDL-KQSEKVINITKLGTFNAIPTTAQEKEHCSVVLTPQQLHQIIIGPNTINFGDVCVRSISNRDINVVNNLNQFIHVSVVIDCKELRQSSPLSQVIPAKTKSSFPLVFESTKKGKFQRNLSYTINGYYQNHVIVLANVVVNQXXXXXXXXXXXXXXIYPPETGIRNTITMTNPLNCATEFLWEPVFNSTNGIAFSIRPKEGVVEAFSKLDCEVVFHPSFMAPSEGDFILRI 2761
            M++S     +R+ P  + F +      Y   + V NI   N  +RF  P    F ++    +K ++SGL     ++Y  + +E + DRL+++++ +  EIP+     +  L+I+ ++NFGT+V  +KV +++  ITN G   G FK  Y G  P+ I P  GIV  +SS+ I++++   +   ++E+ +VI +GQ    + IK  VV++ +ELL ++SD R  ++CI F   ++GS K + + ++NNSPE I +VA++++DAVG+E G+ I   T   +N       +     T +I+  PN+G L PY++  + F F+P+ ++     KK + P  +Q +A+F++ +     S    +     DD  T    R QK+E+A+TGT  PVL++  P  + +F  C   E    + +  N+  +L     F + A+F I P + ++     V++  +F P Q G F  KQ+++++  V +E+   L   ++ +   L     C A +K V  K+  G+ P + N  G     + +    K  N    A + +    T   +      C +        +   +AFPNDRA +IR  + +K FR I  ++ R+NY++ D+AY   E ++ + H++ Y   ++   S++   K   + + +  +D ++G+ PG+GL  P L+  +I  +        +  +LL+T+ +  Q E+ +    L    + P+T QEK  CS++LTP+Q+HQ+I+GP+ +NFG++CV S +   ++V+N L   + + +  D +EL++++  S VI   + +   +VF+S   GKF ++ ++T+N     H++V+A VV       +   L+     +  +T  R T+ + N  NC  +F W+PV N+  GIAFSI P +G VEA+S L+CEV +   F +P EG+FIL +
Sbjct:   31 MDSSGRDMQLRVIPAEVKFLDTMAGRVYRLPITVHNICRWNQKIRFKEPVKPQFKLMLTSLDKELASGLQMTAMVEYHPDKDEDTFDRLLISIENKTTEIPLIGLIPSCQLEIESVVNFGTLVANSKVYSKEITITNHGKAPGIFKAEYHGQLPILIFPTSGIVDAKSSMVIKVDFCADQPRIVDEEAIVILQGQPEMLLSIKAHVVEQIIELLSMSSDRR--LECIHFGPVFFGSSKIKHARVYNNSPEPINWVAIIQDDAVGEELGTDIQQRTDIALNNLTYIRKIKNIDTTIIISCLPNEGTLQPYQKTVITFCFTPKLMA---VGKKDIGPSYRQDYALFLRFE-----SVGSKDGFLRDDDYKTIKSERFQKVELALTGTGLPVLLQFDPGPVLNFKPCFMGERSEIQCIIKNQCELLPVTYHFKKTANFEIDPEKGKITGGGMVDVMCSFVPHQLGVFKVKQMIEIIGLVAEEDLQSLSV-KSFHHVYLAFNSICKASTKKVVMKFDPGILPSIRNPTGKFVVKDLA----KRKNYAPVAMLQSAMTRTHNHRS-----CEEP------VKDMLLAFPNDRAATIRSKDHHKHFRPIFTKVPRFNYVNHDFAYTTFEKQQKKLHENYYAMYLKYLRSVRLQKKQAERERMYSYDDTDIGLEPGSGLKSPSLSEAEIEEELSSAANSIRANRLLTTRGIASQEEESVRRKVLKGLKSEPSTPQEKHDCSLMLTPKQIHQVIVGPSVLNFGNICVNSPNTHLLHVINMLPMHVLLQLDTDLEELQKTNQFSYVILPTSSTYISMVFDSPTIGKFWKSFTFTVNNVPSGHILVVA-VVQPVTLELSSNELVLRPRGFFMKTCFRGTVRLYNRQNCCAQFQWQPV-NTGRGIAFSICPAKGTVEAYSSLECEVTWQQGFSSPEEGEFILHV 935          
BLAST of cilia- and flagella-associated protein 47 vs. Ensembl Human
Match: CFAP47 (cilia and flagella associated protein 47 [Source:HGNC Symbol;Acc:HGNC:26708])

HSP 1 Score: 332.028 bits (850), Expect = 3.403e-96
Identity = 213/747 (28.51%), Postives = 387/747 (51.81%), Query Frame = 2
Query:    2 MENSIDIFGVRITPNVINFRNCEINGSYIRVVNVQNIGNKNVTVRFYSPQSKDFSMICKMHEKIISSGLSHLCSLKYTMEVEERSVDRLIVTVDGQVHEIPIFIYPSAPDLQIDRIINFGTVVMANKVVTQQANITNEGLKIGEFKLLYSGSRPLNIVPNEGIVYQQSSIPIQIEYVTHEAHKINEKCLVIFEGQDPFEIDIKGDVVKRSLELLDINSDERKLIQCIKFPYTYYGSDKSEVSLLFNNSPEKIQFVAVLEEDAVGQESGSHITM-TAAGINPKECTNPL-----TSLITMYPNQGNLGPYERIPVLFRFSPRWISPKQAFKKTLEPPLQQTFAVFIKIQIXXXXXXXXXXXXXXKDDTLT----RSQKLEVAITGTAAPVLIEMKPNSI-DFGECLENEEKTEKLLFYNRSSILSSLIDFPREAHFLISPNQIRVGPNEQVEISVTFCPKQYGNFNTKQVVKVLSYVKDEENPFLEYEQTIYEQILQLTGSCVAISKSVAPKYCNGLDPLVTNKVGYLAEANFSNLGFKPHNGPATAYITTDAFATGGPQGSRLFKCTDANLHPYSNRTAFVAFPNDRAESIRPSEQNKEFRTILKRIKRYNYIDPDYAYDDEEMRKIRHHQDSYQTMIRRQHSLKKIVKLNSKFKAFE-NDINLGIIPGNGLYPPKLTTDQINTDKIEVFKDNKNFKLLSTKDL-KQSEKVINITKLGTFNAIPTTAQEKEHCSVVLTPQQLHQIII 2203
            M++S     +R+ P  + F +      Y   + V NI   N  +RF  P    F ++    +K ++SGL     ++Y  + +E + DRL+++++ +  EIP+     +  L+I+ ++NFGT+V  +KV +++  ITN G   G FK  Y G  P+ I P  GIV  +SS+ I++++   +   ++E+ +VI +GQ    + IK  VV++ +ELL ++SD R  ++CI F   ++GS K + + ++NNSPE I +VA++++DAVG+E G+ I   T   +N       +     T +I+  PN+G L PY++  + F F+P+ ++     KK + P  +Q +A+F++ +     S    +     DD  T    R QK+E+A+TGT  PVL++  P  + +F  C   E    + +  N+  +L     F + A+F I P + ++     V++  +F P Q G F  KQ+++++  V +E+   L   ++ +   L     C A +K V  K+  G+ P + N  G     + +    K  N    A + +    T   +      C +        +   +AFPNDRA +IR  + +K FR I  ++ R+NY++ D+AY   E ++ + H++ Y   ++   S++   K   + + +  +D ++G+ PG+GL  P L+  +I  +        +  +LL+T+ +  Q E+ +    L    + P+T QEK  CS++LTP+Q+HQ+I+
Sbjct:   31 MDSSGRDMQLRVIPAEVKFLDTMAGRVYRLPITVHNICRWNQKIRFKEPVKPQFKLMLTSLDKELASGLQMTAMVEYHPDKDEDTFDRLLISIENKTTEIPLIGLIPSCQLEIESVVNFGTLVANSKVYSKEITITNHGKAPGIFKAEYHGQLPILIFPTSGIVDAKSSMVIKVDFCADQPRIVDEEAIVILQGQPEMLLSIKAHVVEQIIELLSMSSDRR--LECIHFGPVFFGSSKIKHARVYNNSPEPINWVAIIQDDAVGEELGTDIQQRTDIALNNLTYIRKIKNIDTTIIISCLPNEGTLQPYQKTVITFCFTPKLMA---VGKKDIGPSYRQDYALFLRFE-----SVGSKDGFLRDDDYKTIKSERFQKVELALTGTGLPVLLQFDPGPVLNFKPCFMGERSEIQCIIKNQCELLPVTYHFKKTANFEIDPEKGKITGGGMVDVMCSFVPHQLGVFKVKQMIEIIGLVAEEDLQSLSV-KSFHHVYLAFNSICKASTKKVVMKFDPGILPSIRNPTGKFVVKDLA----KRKNYAPVAMLQSAMTRTHNHRS-----CEEP------VKDMLLAFPNDRAATIRSKDHHKHFRPIFTKVPRFNYVNHDFAYTTFEKQQKKLHENYYAMYLKYLRSVRLQKKQAERERMYSYDDTDIGLEPGSGLKSPSLSEAEIEEELSSAANSIRANRLLTTRGIASQEEESVRRKVLKGLKSEPSTPQEKHDCSLMLTPKQIHQVIV 751          
BLAST of cilia- and flagella-associated protein 47 vs. Ensembl Human
Match: CFAP47 (cilia and flagella associated protein 47 [Source:HGNC Symbol;Acc:HGNC:26708])

HSP 1 Score: 198.749 bits (504), Expect = 2.388e-53
Identity = 116/325 (35.69%), Postives = 177/325 (54.46%), Query Frame = 2
Query: 5024 QRWFTMHGWAGNLHPINVPVSFRSSLQKRFGFSQTSTKEKISNTENIENTGLKNDSRDLYDMILYLTGRQIPGINTTVVLPTHPIE-RSCHIYIQHATLIAFIENQGGQLAQIKPEHLMDLPEYELWHSV--GCPGLPNSDMKP-----VQYDSNSFEKISKKAWTVVLLQILKVFILIKVTYSSYRHALQILHGKEPIPEIQLAATVSNCYSLNERILLAWLNYLYEAYRHVCWPGNSNPDIGTTSSTPVSRWIINFDNDFMDSLILATAIGAYIPFMIERHFKYMYPNPQNPEQCLHNALKIVSALKDIGLEFDIQAIDIVDP 5974
            Q WF++ GW    H  ++P + R  + K   +S TS  +K S   +         ++ +YD++L+L+G+  PGIN++  LP    E R   +++QH++L+ F+  QGG ++ + PE L++  +Y+ W  +      +P S   P     +  + + FE  SK+AWT V LQI KV +L +V      +   I    +  P++      SN YS +ERILL+W+N  YE  RHV W  N + D+      P  RWI+NFD D  D L+ AT +GAY PF+IE HF  MY  P++PE+ LHN L IV+ L +I  + +IQ    V P
Sbjct:  116 QTWFSLFGWPEGPHSFSIPETIRRDVYKMQFYSSTSPPQKFSRQNDFSKY-----NKTIYDVLLHLSGKMPPGINSSQSLPVDNHEKRVIQLHLQHSSLLDFLNAQGGCISHVLPEFLLEPEDYKRWIEIMSSTNTMPVSSCTPKKKCSIVIEMSKFEAWSKRAWTDVFLQIYKVLVLSRVVPYCSNNMPPIC--VQNTPKVNPCFASSNIYSDSERILLSWMNINYENTRHVIW-KNCHKDV-----IPSERWIVNFDKDLSDGLVFATQLGAYCPFLIESHFINMYTRPKSPEEYLHNCLIIVNTLYEIDFDVEIQVCLRVFP 427          
BLAST of cilia- and flagella-associated protein 47 vs. Ensembl Human
Match: HYDIN (HYDIN axonemal central pair apparatus protein [Source:HGNC Symbol;Acc:HGNC:19368])

HSP 1 Score: 63.929 bits (154), Expect = 7.498e-9
Identity = 104/496 (20.97%), Postives = 176/496 (35.48%), Query Frame = 2
Query: 7325 IKGPDDVRLFRIECTVTPEGNLSQIYFKIPLQEVLAQNIPIVNKTKQDWPLKATITGTSAAFSGPDFIMAKALSVSQ-YPLQFKPVK---EGKVNAKLTLFNEADGSEHVFELYGEGESPLALESLYFECTVGENITKTLQIPNLTRKKHFFTV--------ESDLDWMIVGDDTISILPGRNCSYDIAINPKRSGKYTGILAFVSGKKTVIEYDSDGDEIVDVYNDETVNSANKSCEIYRIWYSLVVHVSPGAPQGIFDVKCNCLEKVVLEIPINNPSEDMELKFEAAISGANLTGNSEITVNSLSTESYLLTFTPSFIGNFDGRLIFFNDIVGEFWYKLNLTADSPIEKFIPPVKCELGKWCLVEIPLKNIDNENKLVMYPEISNPECFSILIGDLELFDQDKQCFSIAP----RTEHVLSVRFTPCEIGSGTHLCFLVMKSKLLGDQKFI-LTGCGMPPNPSDIIGVSSEAGSNMTFLIPFHNPLLEPVLIDI 8761
            I+G   + L      V P      + F   ++    Q I + N+T Q W L     G    + GP+FI  +A   ++ Y + ++P     E + +     F   DG+  ++ L+G  E P A+ ++Y E       T+ L I N   K   F V        + DL   + G D I +L G    Y +     + G Y   +                     ++ +E  N          ++Y++   V P       ++     +     I + NP     + F       ++   S+  V + S  ++   F P   G   GRL   N  +G + Y+L L A   + +     +  LG   ++ +   N   +         +   C +    D   F  +K   + AP     TE  + V F P  +G    +  L   S L G +  I L G  +PP P     +     +  + +IPF N     V   I
Sbjct: 4611 IQGGSPLSLTLSGVCVGPPAVKEVVNFTCQVRSKHTQTILLSNRTNQTWNLHPIFEGEH--WEGPEFITLEAHQQNKPYEITYRPRTMNLENRKHQGTLFFPLPDGTGWLYALHGTSELPKAVANIYREVPCKTPYTELLPITNWLNKPQRFRVIVEILKPEKPDLSITMKGLDYIDVLSGSKKDYKLNFFSHKEGTYAAKV---------------------IFRNEVTNEF--------LYYNVSFRVIPSGIIKTIEMVTPVRQVASASIKLENPL-PYSVTFSTECRMPDIALPSQFVVPANSEGTFSFEFQPLKAGETFGRLTLHNTDLGYYQYELYLKATPALPEKPVHFQTVLGSSQIILVKFINYTRQR--------TEYYCRT----DCTDFHAEK-LINAAPGGQGGTEASVEVLFEPSHLGETKGILIL---SSLAGGEYIIPLFGMALPPKPQGPFSIR----AGYSIIIPFKNVFYHMVTFSI 5054          
BLAST of cilia- and flagella-associated protein 47 vs. Ensembl Zebrafish
Match: hydin (HYDIN axonemal central pair apparatus protein [Source:ZFIN;Acc:ZDB-GENE-050419-219])

HSP 1 Score: 53.5286 bits (127), Expect = 7.808e-6
Identity = 97/474 (20.46%), Postives = 179/474 (37.76%), Query Frame = 2
Query: 7325 IKGPDDVRLFRIECTVTPEGNLSQIYFKIPLQEVLAQNIPIVNKTKQDWPLKATITGTSAAFSGPDFIMAKALSVSQYPLQFKPV---KEGKVNAKLTLFNEADGSEHVFELYGEGESPLALESLYFECTVGENITKTLQIPNLTRKKHFFTVESDLDWMIVGDDTISILPGRNCSY-DIAINPKRSGKYTGILAFVSGKKTVIEYDSDGDEIVDVYNDETVNSANKSCEIYRIWYSLVVHVSPGAPQGIFDVKCNCLEKVVLEIPINNPSEDMELKFEAAISGANLTGNSEITVNSLSTESYLLTFTPSFIGNFDGRLIFFNDIVGEFWYKLNLTA-DSPIEK---FIPPVKCELGKWCLVEIPLKNIDNENKLVMYPEISNPECFSILIGDLELFDQDKQCFSIAPR---TEHVLSVRFTPCEIGSGTHLCFLVMKSKLLGDQKFILTGCGMPPNPSDIIGVSSEAGSNMTF 8713
            ++G   ++L      + P      + F   ++    Q++ +  +  Q W LK  I G    +SGP  ++ +    + Y + +KP+    +G+ +     F+  DGS  ++ L G  E P A  ++  E       T+T+ + N   +   F    +L      DDT+S+       Y D+     +S K    L+F + K+ +  +               V   N++   Y  +      V+PG  + I ++     +     + + NP   +++ F A     ++    +  V + S  S    + P   G    RL+ +   +G F+Y L + A  +P EK   F  P    LG               + +  +   S  +   I   D   F  +K   + A     TE  ++V F PC +G       L + S   G+  F L G   PP     + +S  +  ++ F
Sbjct: 4298 VEGGKSLKLTLTGSCIVPPVAPEVVNFACQVRSQCTQSLALPIRINQQWTLKCVIEGEH--WSGPPTLLTEPTQQNTYEITYKPLVMTTDGEKHEGSVFFSFPDGSGILYILQGTAEPPKAEGTITEEIKCKTLHTQTVTVHNWLPRPQRFRAVRELIKPDRSDDTVSL---EGLEYVDVPAQDAKSYK----LSFFTYKEGLYSFK--------------VTFKNETTGEYLFYNLNFKAVAPGVIRTI-EMATRVRQITSASVEVENPL-PVDVSFTAECQNTDVYVPPQFLVPAHSVVSLTFEYQPLCEGESTARLVLYAAELGHFFYDLKMKALSAPNEKPLYFTAP----LG------------SKHSGIAKFTNFSRVKTEYICKTDSPSFTVEKSIKAAAGNQTGTEISMAVHFEPCLVGDIQSR--LTISSDSGGEFVFPLYGTCTPPKAQGPLSISLGSSVSIAF 4728          
BLAST of cilia- and flagella-associated protein 47 vs. Ensembl Xenopus
Match: ENSXETT00000023157.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:2:103337683:103350501:1 gene:ENSXETG00000016441.1 transcript:ENSXETT00000023157.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 195.667 bits (496), Expect = 3.785e-54
Identity = 109/322 (33.85%), Postives = 163/322 (50.62%), Query Frame = 2
Query: 4991 WDYDADVLLIIQRWFTMHGWAGNLHPINVPVSFRSSLQKRFGFSQTSTKEKISNTENIENTGLKNDSRDLYDMILYLTGRQIPGINTTVVLPTHPIERSCHIYIQHATLIAFIENQGGQLAQIKPEHLMDLPEYELWHSVGCPGLPNSDMKPVQYDSNSFEKISKKAWTVVLLQILKVFILIKVTYSSYRHALQILHGKEPIPEIQLAATVSNCYSLNERILLAWLNYLYEAYRHVCWPGNSNPDIGTTSSTPVSRWIINFDNDFMDSLILATAIGAYIPFMIERHFKYMYPNPQNPEQCLHNALKIVSALKDIGLEFDIQA 5956
            W +  +V+  ++ WF++ GW    +PI +P S               ++ K++ T N     L   ++ +YDM+LYL+G+ +PGI  +  LP++P ER   ++ QHAT + F+ NQG  L  IKPE L +  +YE W  V                         + W ++L ++ +     K + + Y          E +P+I      SN YS +ERILL WLN  YE  R   W      DI      P +RWIINFD D +D L+LA  + +Y PF+I  HF +MY NP++PE+CLHN L +VSA + I L+ D+Q 
Sbjct:   64 WLFFQNVMSSVRTWFSLFGWPSGCNPITIPQSISVC-----KMHMKKSEGKVAKTIN-----LGKQTKTIYDMLLYLSGQMLPGITASQSLPSNPTERVLQLHWQHATFLTFLRNQGASLPYIKPEFLFEPLDYERWLQV-------------------------QVWVLILSRVSQ-----KKSDADY--------VSETMPKINSEPLSSNIYSPSERILLTWLNINYEKMRKTVWKDCQKGDI------PPTRWIINFDRDLLDGLVLAAQMASYCPFLISTHFTFMYTNPESPEECLHNCLILVSAFRLINLDIDVQV 331          
BLAST of cilia- and flagella-associated protein 47 vs. Ensembl Mouse
Match: Cfap47 (cilia and flagella associated protein 47 [Source:MGI Symbol;Acc:MGI:3781475])

HSP 1 Score: 714.916 bits (1844), Expect = 0.000e+0
Identity = 527/1742 (30.25%), Postives = 864/1742 (49.60%), Query Frame = 2
Query: 4991 WDYDADVLLIIQRWFTMHGWAGNLHPINVPVSFRSSLQKRFGFSQTSTKEKISNTENIENTGLKNDSRDLYDMILYLTGRQIPGINTTVVLPTHPIERSCHIYIQHATLIAFIENQGGQLAQIKPEHLMDLPEYELWHSV--GCPGLPNSDMK---PVQYDSNSFEKISKKAWTVVLLQILKVFILIKVTYSSYRHALQILHGKEPIPEIQLAATVSNCYSLNERILLAWLNYLYEAYRHVCWPGNSNPDIGTTSSTPVSRWIINFDNDFMDSLILATAIGAYIPFMIERHFKYMYPNPQNPEQCLHNALKIVSALKDIGLEFDIQAIDIVDPNPVMMIXXXXXXXXXXXXYIPKSEIVFTGSLHEQITKQIQISNPTSKPLSYECIIIGNDNCDFALPK-GNVVNLSGKASIKWPIVFKSRFIRSAEVTVMFVGR-KTGFSIPTNLIFSVKTKIMSINPSKVEKIVGKCYIMKKINLKIISPYNKSGNFSVKLIESSE--------GNLKSIKETSNEFKQTETSFIKPAIAKKATLDAIKTTNKLRAFFSHCETVFINENKSGSLELFYLPFHLGIKRCTIIFSNDSIGEFVHSVEASAELPEPIIITPNDDKPKSGVWVSRAEAANRGLEGNEKTIYWKCEVGSFIQETLSIPINNIYKEYALHTAAQLHLSSQEVSRRQXXXXXXXXXXXXXXXXXXXXXXDDHDFVNSNKQIKKKADTKYSNKGKFINFEVESDSSFYTTPLIVQIPDPL-MHLGNDSTKNNAI------QTP---------STIDIPIKFHASTAGVYPCNLVIKGPDDVRLFRIECTVTPEGNLSQIYFKIPLQEVLAQNIPIVNKTKQDWPLKATITGTSAAFSGPDFIMAKALSVSQYPLQFKPVKEGKVNAKLTLFNEADGSEHVFELYGEGESPLALESLYFECTVGENITKTLQIPNLTRKKHFFTVESDLDWMIVGDDTISILPGRNCSYDIAINPKRSGKYTGILAFVSGKKTVIEYDSDGDEIVDVYNDETVNS---------ANKSCEIYRIWYSLVVHVSPGAPQGIFDVKCNCLEKVVLEIPINNPSEDMELKFEAAISGANLTGNSEITVNSLSTESYLLTFTPSFIGNFDGRLIFFNDIVGEFWYKLNLTADSPIEKFIPPVKCELGKWCLVEIPLKNIDNENKLVMYPEISNPECFSILIGDLELFDQDKQCFSIAPRTEHVLSVRFTPCEIGSGTHLCFLVMKSKLLGDQKFILTGCGMPPNPSDIIGVSSEAGSNMTFLIPFHNPLLEPVLIDIRITEEHQSVLDKYRIGSVNLDKDFKEM--ETSVFX-XXXXXXXXXXXESKQSIEIPISFAPQEMRKYDAICCVVMKRKNGEPLISDEDFNDLILPNSD--NITPFDKKQLRWLFPIKGVPETLVSLNVFTTPLVQGPLRI------ETKEHLEFNLWG-----LPPPVTREDFVTKSVKSAPATINDGNELKPIDRFLQDFTTELRVITVENGDAMDTATLNEYVHLFLMKQSKQLDTGVTVLTYEIRMRPLKKFRLNSEIIITSLTGGVWRFPIRFVAHDCDPDDEITIEAIGLNKPVSTRFYLNSTTYNELPFKAYFLKGGDPDFTVSPESGILPPIQSFSKFQISGLEFVVTWQPKTYSRSKGARLVIETEMMEWVYKFVGISPQYVVPDTRSIIQSNWDSDMXXXXXXXX-XXXXXFLKQNIEMLSTAVSSPVKGAPLLPK 10045
            +DY   V+   Q WF++ GW    H +++P + R  +QK   +S +S  +K S   +         ++ +YD+IL+L+G+  PGIN    LP   +ER   +++QHA+L+ FI  QGG ++ + PE L++  +Y  W  +         S +K    V  D ++FE  SK+AWT V LQI KV IL +VT      ++ ILHG E   +I      SN YS +ERILL+WLN  YE+ R   W  N        S  P  RWI+NFD+D +D L+ AT + AY PF+IE +F  MY  P+ PEQ LHN L I+++L++IG + +IQAIDI DPNPV+M++  + L+  LP Y+PK  + F+ +L++ +  QI + NP+ K L Y   I+G D  +F L + GNVV +  K  I   + F SRF+  AE T++ + R K G    T L F++K +I +     V K    CY  K++ + + +P+   G+F V L+ES+          +   +    +  + ++ +  + +   +  L     +N +R FF    T+ +    S S++++YLPF + ++ C II SN  IG+ ++ +E    +P P    P +  P S +  S +   ++     +  +Y  C+    +   L IP+ N  KE AL  AAQ  +S+ E  RR ++GTL SS++      +   + +     N +K +KK     Y+ +       + +  +      I QIP+P   H+ +   K   +      Q P          T+ IP++F    +G YPC L++    DVR++ +E  V  E   +++ FK P  + L QNIPI N++K+       I G    F GP  +        QYPL FKP+ E ++  KLTL NE DG  H+ E+ G G  P+AL+ +  +C VG+   K++ +PN T+    F V SDL  ++ G+  I+I P  +  Y + + P + G + G + F    +   E   + D   D  + ET +          + +  +  +IWY L +  SPG P  I ++ C  LE   +EIPI+N S++  +  +  ++ + L G  E+T+  L + +Y++ ++P+  G  +  +IF  ++  EFWY L LT + P  K IP ++C+LGK  +  +PL N  +E  L +    SNP  F I +         K    + P +   LSV F P  +G   H   +        + KF L G G+ P P ++  V++  G   + ++ F NP  E V +D+ +T + Q          + +D+ +K    E + F+   L+    + +  K +++IP+ F P  M  Y  +  V MKR N +  + D +F++L         +   + + + W++PI G+P+          P    P+ I      + +E +E ++ G      P P   E  V        +   D +    ++   ++F  E   I  E+ D    + L+ +V L+L ++   + + +  L + +   P K FR N  + +  +T G+W+FPI  +A + + +D I I  IGL K   T F L S T    PF A+FL G D +F V P+SG LPP      F   G+  +V ++P+ YS+   A LVI+T+ + W+Y+  G++     P ++S+       D            ++NF+++N ++ STAVSS VKGAPL  K
Sbjct: 1516 FDYFQKVVNAAQTWFSLFGWPEGPHSLSIPETIRRDVQKIQFYSTSSPPKKFSRQSDFSKY-----NKTIYDVILHLSGKLPPGINAGQSLPVDNVERVMQLHLQHASLLDFITAQGGCISHVLPEFLLEPKDYMKWLEITTATKSTALSTLKGNYSVNIDMDNFEAWSKRAWTDVFLQIYKVTILSRVT-PHCTSSMPILHG-ENKSKISPCFASSNIYSDSERILLSWLNTNYESQRTSIWKNNK-------SDVPPGRWIVNFDSDLLDGLVFATQLAAYCPFLIETYFINMYTKPKRPEQYLHNCLIIINSLREIGFDLNIQAIDICDPNPVLMLMLCVYLYERLPTYLPKKVVPFSCTLYDVVVGQILLKNPSLKNLVYTATIVGRDANNFCLAQTGNVVTIGPKNHIVLVVKFVSRFLHPAEATLLLISRPKCGIGGST-LAFALKGEIRNFKAIDVIKCKAPCYQWKEVTVNVKNPFPSGGDFHVILVESTTLMYLPAQVTDSSKVSVMPDHMRSSDYAADQSSSHAENGLRTSIKSNFIREFFCSSTTLSLRPKTSSSIDVYYLPFDMHVRYCAIILSNKDIGDLIYIIEGRGLIPLPSNFLPLE--PPSPIDYSTSLEEDK----EDPILYLNCKPHQILDMDLKIPLTNEAKEKALAFAAQQQMSTLEYERRAISGTLESSTIRAAVALLGLTKIECLLLFNMSK-LKKPKSILYTTE-----LSLPAHFNIPRKIYIPQIPEPPDFHMQSLQIKPQIVSGERPFQKPLPSIQAALEGTVSIPLRFAPLGSGRYPCKLLLLSRHDVRVYLLEGIVNEEVPEAELLFKTPAFQPLTQNIPIKNESKKLSKFHVKIEG--EWFHGPPILHVGPGETIQYPLTFKPILECEIMGKLTLQNEVDGMAHIVEIDGIGTKPIALDHIIIDCKVGKVTDKSIIVPNYTKSLLTFKVTSDLS-IVWGNSFITIEPDDSIPYTLHVCPWKRGTFKGAIMFFVKSRDEEESQEETDTEKDFSSQETPSDQSTIIFEEYSEEKVKALKIWYHLEIRSSPGPPVDIIELHCIALETTCIEIPISN-SKNQPVCLDVKLTCSALNGPVEMTLAPLESVTYIVWYSPATTGYKEESIIFQPEMGEEFWYLLKLTTELPKPKEIPEMQCDLGKKIIQTLPLYNPTHET-LELRIRNSNPINFVIELNR-------KLPLVLLPHSTTELSVYFHPSGLGRHGHETCINFYCTQFKEWKFYLFGVGLYPRPIELKRVTTILGLQASVMVHFRNPTSEDVSVDLILTNKEQP-------KGLAIDQCWKTFLHENAAFRFSSLRRTHGIIVPPKGNLDIPVLFIPSTMTLYKTMVIVKMKRTNKKNWLID-NFDELSAETKRYMGVGYGEIQAIHWMYPIIGLPQA--------PPPKSSPVIIRCQANKQREEKVEVSMLGSFFNTHPKPDMTEFLVFPKRNVYKSIYEDVD----VNSKRREFEYE---IEFESEDV--KSNLDSFVTLYLFRKHFNVKSEIISLIFNVIFTPRKPFRANVTLNVECITEGIWKFPITLIATEPEVEDVINIHGIGLFKTSETEFRLTSQTRYYEPFVAHFLPGSDQEFFVKPQSGELPP------FYTKGIVIIVGFKPRMYSKKYQATLVIQTDEIYWLYEINGLA-----PSSKSLTHVTAKVDATSKIYDCMPPIQRNFIRENAKLRSTAVSSTVKGAPLFKK 3182          

HSP 2 Score: 559.296 bits (1440), Expect = 1.492e-159
Identity = 367/1177 (31.18%), Postives = 610/1177 (51.83%), Query Frame = 2
Query:   29 VRITPNVINFRNCEINGSYIRVVNVQNIGNKNVTVRFYSPQSKDFSMICKMHEKIISSGLSHLCSLKYTMEVEERSVDRLIVTVDGQVHEIPIFIYPSAPDLQIDRIINFGTVVMANKVVTQQANITNEGLKIGEFKLLYSGSRPLNIVPNEGIVYQQSSIPIQIEYVTHEAHKINEKCLVIFEGQDPFEIDIKGDVVKRSLELLDINSDERKLIQCIKFPYTYYGSDKSEVSLLFNNSPEKIQFVAVLEEDAVGQESGSHI-TMTAAGINPKECTNP-----LTSLITMYPNQGNLGPYERIPVLFRFSPRWISPKQAFKKTLEPPLQQTFAVFIKIQIXXXXXXXXXXXXXXKDDT-----LTRSQKLEVAITGTAAPVLIEMKPN-SIDFGECLENEEKTEKLLFYNRSSILSSLIDFPREAHFLISPNQIRVGPNEQVEISVTFCPKQYGNFNTKQVVKVLSYVKDEENPFLEYEQTIYEQILQLTGSCVAISKSVAPKYCNGLDPLVTNKVGYLAEANFSNLGFKPHNGPATAYITTDAFATGGPQGSRLFKCTDANLHPYSNRTAFVAFPNDRAESIRPSEQNKEFRTILKRIKRYNYIDPDYAYDDEEMRKIRHHQDSYQTMIR--RQHSLKKIVKLNSKFKAFENDINLGIIPGNGLYPPKLTTDQINTDKIEVFKDN--KNFKLLSTKDLKQSEKVINITKLGT-FNAIPTTAQEKEHCSVVLTPQQLHQIIIGPNTINFGDVCVRSISNRDINVVNNLNQFIHVSVVIDCKELRQSSPLSQVIPAKTKSSFPLVFESTKKGKFQRNLSYTINGYYQNHVIVLANVVVNQXXXXXXXXXXXXXXIYPPETGIRNTITMTNPLNCATEFLWEPVFNSTNGIAFSIRPKEGVVEAFSKLDCEVVFHPSFMAPSEGDFILRIPGNEEGSVETSSQDTLNTDTPTISNGDKSNITMKCIAILGNIHVAFQSRRVMFGNIPINMSSSRTATLLNTGGKHAYYRIVPDDLYEEYPGMTIHPLKGSIPVGGQAELTIKYHPVALSKFDCSIPIVIRGWKELDLKMSGNIIIPQVEILQKRLEFGGVPVGSEKSLDLTLINKSQCRANIEFDFIKQKDFTILTVGQCGNDKALSKDNYKCLITLKPLQEFQCQLIFTPNEVASYEFPLSVKVNQIE 3508
            +R+ P V+ F++      Y   + V N+G  N  +RF  P    F ++    +K ++SGL     ++Y     E   D + ++V  +V +IP+F       L+I  +++FGT+V  +KV  ++  I N G   G+FK  Y G  P+ I P+ GIV  ++S+ I++++   +A  +NE   V  +G     ++IK  VV++ +EL  +NS ERKL +CI+F   ++G+ K E +LL+NNSPE I +VA++++D VG+E G++I   T   IN     N      +T  ++  PN+G L PY++I + F FSP+ +      KK + P  +Q +A+F++           S+    +DD        R QK+E+A+TG+  PV+++  P  S+ F  C   E      +  N+S  L  +  F + AHF + P + ++       +  +F P Q G F  KQV++++  V D+    L  +  +Y   L  + +C A ++ V  K   G+ PL++N   +    +       P   P  A + + A            K  D  L   S + A +AFPNDRA SIR  + ++ FRTI  +I RY+Y DPDY Y D E  + + H+D Y   I   R   L+K  +   KF    N++++G++P +GL  P L+  +I  +     K +  K  +LLSTK +   E      K+     + PTT QEK+ CS VLTP+Q+HQ+I+GP+ +NFG++CV+S +   +++VN L  +I + + +D +EL+++   S VIP  + +   +VFES+  GKF ++ ++ IN     H++V+A ++  +LELS++ ++L   S +  +T  R T+ + N LNC  +F W+PV  +  GIAF+I P +G V+ +  L+CEV + P F +P +G+F+L++ G                          + +T+KCIA +G+  V F   R++F N    +++ R A L N G  HAY+++    L      + I P +G IP GG   L I   P    KFD    + I     +DL++ G++ IP VEIL     F G  VG+ + +   + N+   RA +EF+  +   F +   G  G  K + +  Y   I ++     +C + F+P EVA+Y+F   V +N  +
Sbjct:   22 LRVNPLVLKFQDAVSGKVYRLPLTVHNLGRWNQKIRFQEPSKPQFKLLLTSLDKELASGLQMTAMVEYHPNKNEDMSDHIFISVGNKVLDIPLFGLIPVCQLEIVPVVDFGTLVANSKVHCKEITIINRGKAPGKFKAEYQGQLPIVISPSSGIVKAKTSMVIKVDFCADQAQIVNEMARVSLQGCPETFLNIKVRVVEQIIELFHMNS-ERKL-ECIRFGSVFFGTSKLEHALLYNNSPESINWVAIMQDDCVGEELGTNIHQRTDIAINNISYLNKIKKIDMTDFMSCVPNEGTLLPYQKIVITFCFSPKLVVDT---KKDVGPSHRQDYALFVRFD------SVGSKDGFLRDDNSNTMKSNRLQKVELALTGSGLPVILQFDPGKSLTFAPCHMGEHSDILCIVKNQSISLPVMYHFKKTAHFKMDPERGKIDEGCIQNVICSFVPHQIGVFKVKQVIEIIGPVADDNLRSLSMKPFLYIH-LNFSSTCKAFTRKVGVKINPGISPLISNPTRHFVAKDSEKKDDLP---PVAAMLQSTA-----------TKLHDHCLKDESTKNALIAFPNDRATSIRSGDHHEHFRTIFTKIPRYDYTDPDYEYTDLEKLERKAHRDYYTNYINNLRTIRLRKEAQRERKFPV--NEVDIGMLPLSGLKSPPLSQSEIEEEIPPSLKASSLKANRLLSTKKIASRESECLQRKITRGLKSKPTTHQEKQECSKVLTPKQIHQVIVGPSVLNFGNICVKSTNTHLLHIVNMLPMYILIQLDVDFEELQKTKQFSYVIPPTSSTYISMVFESSTSGKFWKSFTFKINNIPGGHILVMAAILPVKLELSSNEIVLRPQS-FLLKTCFRGTVRLYNHLNCPAQFGWKPV-TTLRGIAFTICPAQGTVDPYCSLECEVTWQPGFSSPDKGEFLLQVSGG-------------------------NTLTLKCIAHVGHTKVTFLEPRILFSNCSQGLTTWRKAILHNIGQNHAYFKVCDQSLLST---INIVPSEGIIPFGGITVLNISCTPSVAEKFDTRAKVAIHHANVIDLRIGGSVEIPDVEILPSTFNFSGTYVGTTEIIPFIIKNRGVTRARVEFNLKEFPLFAMDFKGNAGECKNV-EGPYMYAIEVEEGTSAECGITFSPVEVATYDFSFPVLINSFK 1139          
BLAST of cilia- and flagella-associated protein 47 vs. Ensembl Mouse
Match: Cfap47 (cilia and flagella associated protein 47 [Source:MGI Symbol;Acc:MGI:3781475])

HSP 1 Score: 466.848 bits (1200), Expect = 2.620e-140
Identity = 299/930 (32.15%), Postives = 501/930 (53.87%), Query Frame = 2
Query:   29 VRITPNVINFRNCEINGSYIRVVNVQNIGNKNVTVRFYSPQSKDFSMICKMHEKIISSGLSHLCSLKYTMEVEERSVDRLIVTVDGQVHEIPIFIYPSAPDLQIDRIINFGTVVMANKVVTQQANITNEGLKIGEFKLLYSGSRPLNIVPNEGIVYQQSSIPIQIEYVTHEAHKINEKCLVIFEGQDPFEIDIKGDVVKRSLELLDINSDERKLIQCIKFPYTYYGSDKSEVSLLFNNSPEKIQFVAVLEEDAVGQESGSHITM-TAAGINPKECTNP-----LTSLITMYPNQGNLGPYERIPVLFRFSPRWISPKQAFKKTLEPPLQQTFAVFIKIQIXXXXXXXXXXXXXXKDDT-----LTRSQKLEVAITGTAAPVLIEMKPN-SIDFGECLENEEKTEKLLFYNRSSILSSLIDFPREAHFLISPNQIRVGPNEQVEISVTFCPKQYGNFNTKQVVKVLSYVKDEENPFLEYEQTIYEQILQLTGSCVAISKSVAPKYCNGLDPLVTNKVGYLAEANFSNLGFKPHNGPATAYITTDAFATGGPQGSRLFKCTDANLHPYSNRTAFVAFPNDRAESIRPSEQNKEFRTILKRIKRYNYIDPDYAYDDEEMRKIRHHQDSYQTMIR--RQHSLKKIVKLNSKFKAFENDINLGIIPGNGLYPPKLTTDQINTDKIEVFKDN--KNFKLLSTKDLKQSEKVINITKLGT-FNAIPTTAQEKEHCSVVLTPQQLHQIIIGPNTINFGDVCVRSISNRDINVVNNLNQFIHVSVVIDCKELRQSSPLSQVIPAKTKSSFPLVFESTKKGKFQRNLSYTINGYYQNHVIVLANVVVNQXXXXXXXXXXXXXXIYPPETGIRNTITMTNPLNCATEFLWEPVFNSTNGIAFSIRPKEGVVEAFSKLDCEVVFHPSFMAPSEGDFILRIPG 2767
            +R+ P V+ F++      Y   + V N+G  N  +RF  P    F ++    +K ++SGL     ++Y     E   D + ++V  +V +IP+F       L+I  +++FGT+V  +KV  ++  I N G   G+FK  Y G  P+ I P+ GIV  ++S+ I++++   +A  +NE   V  +G     ++IK  VV++ +EL  +NS ERKL +CI+F   ++G+ K E +LL+NNSPE I +VA++++D VG+E G++I   T   IN     N      +T  ++  PN+G L PY++I + F FSP+ +      KK + P  +Q +A+F++           S+    +DD        R QK+E+A+TG+  PV+++  P  S+ F  C   E      +  N+S  L  +  F + AHF + P + ++       +  +F P Q G F  KQV++++  V D+    L  +  +Y   L  + +C A ++ V  K   G+ PL++N   +    +       P   P  A + + A            K  D  L   S + A +AFPNDRA SIR  + ++ FRTI  +I RY+Y DPDY Y D E  + + H+D Y   I   R   L+K  +   KF    N++++G++P +GL  P L+  +I  +     K +  K  +LLSTK +   E      K+     + PTT QEK+ CS VLTP+Q+HQ+I+GP+ +NFG++CV+S +   +++VN L  +I + + +D +EL+++   S VIP  + +   +VFES+  GKF ++ ++ IN     H++V+A ++  +LELS++ ++L   S +  +T  R T+ + N LNC  +F W+PV  +  GIAF+I P +G V+ +  L+CEV + P F +P +G+F+L++ G
Sbjct:   22 LRVNPLVLKFQDAVSGKVYRLPLTVHNLGRWNQKIRFQEPSKPQFKLLLTSLDKELASGLQMTAMVEYHPNKNEDMSDHIFISVGNKVLDIPLFGLIPVCQLEIVPVVDFGTLVANSKVHCKEITIINRGKAPGKFKAEYQGQLPIVISPSSGIVKAKTSMVIKVDFCADQAQIVNEMARVSLQGCPETFLNIKVRVVEQIIELFHMNS-ERKL-ECIRFGSVFFGTSKLEHALLYNNSPESINWVAIMQDDCVGEELGTNIHQRTDIAINNISYLNKIKKIDMTDFMSCVPNEGTLLPYQKIVITFCFSPKLVVDT---KKDVGPSHRQDYALFVRFD------SVGSKDGFLRDDNSNTMKSNRLQKVELALTGSGLPVILQFDPGKSLTFAPCHMGEHSDILCIVKNQSISLPVMYHFKKTAHFKMDPERGKIDEGCIQNVICSFVPHQIGVFKVKQVIEIIGPVADDNLRSLSMKPFLYIH-LNFSSTCKAFTRKVGVKINPGISPLISNPTRHFVAKDSEKKDDLP---PVAAMLQSTA-----------TKLHDHCLKDESTKNALIAFPNDRATSIRSGDHHEHFRTIFTKIPRYDYTDPDYEYTDLEKLERKAHRDYYTNYINNLRTIRLRKEAQRERKFPV--NEVDIGMLPLSGLKSPPLSQSEIEEEIPPSLKASSLKANRLLSTKKIASRESECLQRKITRGLKSKPTTHQEKQECSKVLTPKQIHQVIVGPSVLNFGNICVKSTNTHLLHIVNMLPMYILIQLDVDFEELQKTKQFSYVIPPTSSTYISMVFESSTSGKFWKSFTFKINNIPGGHILVMAAILPVKLELSSNEIVLRPQS-FLLKTCFRGTVRLYNHLNCPAQFGWKPV-TTLRGIAFTICPAQGTVDPYCSLECEVTWQPGFSSPDKGEFLLQVSG 921          
BLAST of cilia- and flagella-associated protein 47 vs. Ensembl Mouse
Match: Cfap47 (cilia and flagella associated protein 47 [Source:MGI Symbol;Acc:MGI:3781475])

HSP 1 Score: 218.394 bits (555), Expect = 3.641e-61
Identity = 125/326 (38.34%), Postives = 184/326 (56.44%), Query Frame = 2
Query: 4991 WDYDADVLLIIQRWFTMHGWAGNLHPINVPVSFRSSLQKRFGFSQTSTKEKISNTENIENTGLKNDSRDLYDMILYLTGRQIPGINTTVVLPTHPIERSCHIYIQHATLIAFIENQGGQLAQIKPEHLMDLPEYELWHSV--GCPGLPNSDMK---PVQYDSNSFEKISKKAWTVVLLQILKVFILIKVTYSSYRHALQILHGKEPIPEIQLAATVSNCYSLNERILLAWLNYLYEAYRHVCWPGNSNPDIGTTSSTPVSRWIINFDNDFMDSLILATAIGAYIPFMIERHFKYMYPNPQNPEQCLHNALKIVSALKDIGLEFDIQ 5953
            +DY   V+   Q WF++ GW    H +++P + R  +QK   +S +S  +K S   +         ++ +YD+IL+L+G+  PGIN    LP   +ER   +++QHA+L+ FI  QGG ++ + PE L++  +Y  W  +         S +K    V  D ++FE  SK+AWT V LQI KV IL +VT      ++ ILHG E   +I      SN YS +ERILL+WLN  YE+ R   W  N        S  P  RWI+NFD+D +D L+ AT + AY PF+IE +F  MY  P+ PEQ LHN L I+++L++IG + +IQ
Sbjct:  106 FDYFQKVVNAAQTWFSLFGWPEGPHSLSIPETIRRDVQKIQFYSTSSPPKKFSRQSDFSKY-----NKTIYDVILHLSGKLPPGINAGQSLPVDNVERVMQLHLQHASLLDFITAQGGCISHVLPEFLLEPKDYMKWLEITTATKSTALSTLKGNYSVNIDMDNFEAWSKRAWTDVFLQIYKVTILSRVT-PHCTSSMPILHG-ENKSKISPCFASSNIYSDSERILLSWLNTNYESQRTSIWKNNK-------SDVPPGRWIVNFDSDLLDGLVFATQLAAYCPFLIETYFINMYTKPKRPEQYLHNCLIIINSLREIGFDLNIQ 417          
BLAST of cilia- and flagella-associated protein 47 vs. Ensembl Mouse
Match: Cfap47 (cilia and flagella associated protein 47 [Source:MGI Symbol;Acc:MGI:3781475])

HSP 1 Score: 179.489 bits (454), Expect = 1.821e-48
Identity = 108/350 (30.86%), Postives = 180/350 (51.43%), Query Frame = 2
Query: 7262 TIDIPIKFHASTAGVYPCNLVIKGPDDVRLFRIECTVTPEGNLSQIYFKIPLQEVLAQNIPIVNKTKQDWPLKATITGTSAAFSGPDFIMAKALSVSQYPLQFKPVKEGKVNAKLTLFNEADGSEHVFELYGEGESPLALESLYFECTVGENITKTLQIPNLTRKKHFFTVESDLDWMIVGDDTISILPGRNCSYDIAINPKRSGKYTGILAFVSGKKTVIEYDSDGDEIVDVYNDETVNS---------ANKSCEIYRIWYSLVVHVSPGAPQGIFDVKCNCLEKVVLEIPINNPSEDMELKFEAAISGANLTGNSEITVNSLSTESYLLTFTPSFIGNFDGRLIFFND 8284
            T+ IP++F    +G YPC L++    DVR++ +E  V  E   +++ FK P  + L QNIPI N++K+       I G    F GP  +        QYPL FKP+ E ++  KLTL NE DG  H+ E+ G G  P+AL+ +  +C VG+   K++ +PN T+    F V SDL  ++ G+  I+I P  +  Y + + P + G + G + F    +   E   + D   D  + ET +          + +  +  +IWY L +  SPG P  I ++ C  LE   +EIPI+N S++  +  +  ++ + L G  E+T+  L + +Y++ ++P+  G  + R +   D
Sbjct:    8 TVSIPLRFAPLGSGRYPCKLLLLSRHDVRVYLLEGIVNEEVPEAELLFKTPAFQPLTQNIPIKNESKKLSKFHVKIEG--EWFHGPPILHVGPGETIQYPLTFKPILECEIMGKLTLQNEVDGMAHIVEIDGIGTKPIALDHIIIDCKVGKVTDKSIIVPNYTKSLLTFKVTSDLS-IVWGNSFITIEPDDSIPYTLHVCPWKRGTFKGAIMFFVKSRDEEESQEETDTEKDFSSQETPSDQSTIIFEEYSEEKVKALKIWYHLEIRSSPGPPVDIIELHCIALETTCIEIPISN-SKNQPVCLDVKLTCSALNGPVEMTLAPLESVTYIVWYSPATTGYKEERCVLGLD 353          
BLAST of cilia- and flagella-associated protein 47 vs. Ensembl Mouse
Match: Hydin (HYDIN, axonemal central pair apparatus protein [Source:MGI Symbol;Acc:MGI:2389007])

HSP 1 Score: 70.4774 bits (171), Expect = 5.016e-11
Identity = 110/469 (23.45%), Postives = 178/469 (37.95%), Query Frame = 2
Query: 7397 IYFKIPLQEVLAQNIPIVNKTKQDWPLKATITGTSAAFSGPDFIMAKALSVSQ-YPLQFKPVK---EGKVNAKLTLFNEADGSEHVFELYGEGESPLALESLYFECTVGENITKTLQIPNLTRKKHFFTV--------ESDLDWMIVGDDTISILPGRNCSYDIAINPKRSGKYTGILAFVSGKKTVIEYDSDGDEIVDVYNDETVNSANKSCEIYRIWYSLVVHVSPGAPQGIFDVKCNCLEKVVLEIPINNP-SEDMELKFEAAISGANLTGNSEITVNSLSTESYLLTFTPSFIGNFDGRLIFFNDIVGEFWYKLNLTA-DSPIEKFIPPVKCE--LGKWCLVEIPLKNIDNENKLVMYPEISNPECFSILIGDLELFDQDKQCFSIAP----RTEHVLSVRFTPCEIGSGTHLCFLVMKSKLLGDQKFI-LTGCGMPPNPSDIIGVSSEAGSNMTFLIPFHNPLL 8740
            + F   ++    Q I + N++ Q W L     G    + GP+FI  +A   ++ Y + +KP     E + +     F   DG+  ++ L+G  E P A+ ++Y E       T+ L I N   K   F V        ++DL   + G D I +L G    Y +     + G YT  +                     ++ +E  N          ++Y++   V+P        +     + V   I + NP    +    E  +S  +L     +  NS  T S+   F P   G   GRL   N  +G + Y+L L A  +P EK   PV  +  LG             +++ L  +   +  +       D   F  +K   + AP     TE  + V F P  +G    +  L   S L+G +  I L G  +PP P     +   AG N+  +IPF N  L
Sbjct: 4668 VNFNCQVRSRHTQTILLSNRSNQTWNLHPIFEGEH--WEGPEFITLEAHQQNKPYEITYKPRTMNLENRKHQGTLFFPLPDGTGWLYALHGTAELPKAVANIYREVPCKTPYTELLPISNWLNKPQRFRVIVEILKPEKTDLSVTLKGLDYIDVLSGSKKDYKLNFFSYKEGLYTAKV---------------------IFRNEVTNEF--------LYYTVSFRVTPSGIIKTIQMTSPVRQSVSASIKLENPLPYSVTFSTECKLSDISLPSQFAVPPNSEGTFSF--EFQPLKAGELCGRLTLHNSDLGYYQYELALKALPAPPEK---PVHFQTVLG------------SSQSILAKFTNYTRLKTEYYCKTDCSDFHTEK-VINAAPGAQGGTEVSVEVFFEPSHLGETKGILCL---SSLIGGEYIIPLFGIALPPKPQGPFLI--RAGYNI--IIPFKNVFL 5080          
BLAST of cilia- and flagella-associated protein 47 vs. UniProt
Match: sp|Q6ZTR5|CFA47_HUMAN (Cilia- and flagella-associated protein 47 OS=Homo sapiens OX=9606 GN=CFAP47 PE=2 SV=5)

HSP 1 Score: 717.227 bits (1850), Expect = 0.000e+0
Identity = 529/1717 (30.81%), Postives = 841/1717 (48.98%), Query Frame = 2
Query: 5024 QRWFTMHGWAGNLHPINVPVSFRSSLQKRFGFSQTSTKEKISNTENIENTGLKNDSRDLYDMILYLTGRQIPGINTTVVLPTHPIE-RSCHIYIQHATLIAFIENQGGQLAQIKPEHLMDLPEYELWHSV--GCPGLPNSDMKP-----VQYDSNSFEKISKKAWTVVLLQILKVFILIKVTYSSYRHALQILHGKEPIPEIQLAATVSNCYSLNERILLAWLNYLYEAYRHVCWPGNSNPDIGTTSSTPVSRWIINFDNDFMDSLILATAIGAYIPFMIERHFKYMYPNPQNPEQCLHNALKIVSALKDIGLEFDIQAIDIVDPNPVMMIXXXXXXXXXXXXYIPKSEIVFTGSLHEQITKQIQISNPTSKPLSYECIIIGNDNCDFALP-KGNVVNLSGKASIKWPIVFKSRFIRSAEVTVMFVGRKTGFSIPTNLIFSVKTKIMSINPSKVEKIVGKCYIMKKINLKIISPYNKSGNFSVKLIESSE--GNLKSIKETSNEFKQTETSFIKPAIAKKATLDA-------IKTTNKLRAFFSHCETVFINENKSGSLELFYLPFHLGIKRCTIIFSNDSIGEFVHSVEASAELPEPIIITPNDDKPKSGVWVS--RAEAANRGLEGNEKTIYWKCEVGSFIQETLSIPINNIYKEYALHTAAQLHLSSQEVSRRQXXXXXXXXXXXXXXXXXXXXXXDDHDFVNSNKQIKKKADTKYSNKGKFINFEVESDSSFYTTPLIV--QIPDPLMHLGNDSTKNNAIQTPSTIDIPIKFHASTAGVYPCNLVIKGPDDVRLFRIECTVTPEGNLSQIYFKIPLQEVLAQNIPIVNKTKQDWPLKATITGTSAAFSGPDFIMAKALSVSQYPLQFKPVKEGKVNAKLTLFNEADGSEHVFELYGEGESPLALESLYFECTVGENITKTLQIPNLTRKKHFFTVESDLDWMIVGDDTISILPGRNCSYDIAINPKRSGKYTGILAF-------VSGKKTVIEYDSDGDEIVDVYNDETVNSA-NKSCEIY------RIWYSLVVHVSPGAPQGIFDVKCNCLEKVVLEIPINNPSEDMELKFEAAISGANLTGNSEITVNSLSTESYLLTFTPSFIGNFDGRLIFFNDIVGEFWYKLNLTADSPIEKFIPPVKCELGKWCLVEIPLKNIDNENKLVMYPEISNPECFSILIGDLELFDQDKQCFSIAPRTEHVLSVRFTPCEIGSGTHLCFLVMKSKLLGDQKFILTGCGMPPNPSDIIGVSSEAGSNMTFLIPFHNPLLEPVLIDIRITE-EHQS--VLDKYRIGSVNLDKDFKEMETSVFXXXXXXXXXXXXESKQSIEIPISFAPQEMRKYDAICCVVMKRKNGEPL-ISDEDFNDLILPNSDNITPFDKKQLRWLFPIKGVPETLVSLNVFTTPLVQGPLRIETKEHLEFNL----WGLPPPVTREDFVTKSVKSAPATINDGNELKPIDRFLQDFTTELRVITVENGDAMDTATLNEYVHLFLMKQSKQLDTGVTVLTYEIRMRPLKKFRLNSEIIITSLTGGVWRFPIRFVAHDCDPDDEITIEAIGLNKPVSTRFYLNSTTYNELPFKAYFLKGGDPDFTVSPESGILPPIQSFSKFQISGLEFVVTWQPKTYSRSKGARLVIETEMMEWVYKFVGISPQYVVP-DTRSIIQSNWDSDMXXXXXXXXXXXXXFLKQNIEMLSTAVSSPVKGAPLL 10039
            Q WF++ GW    H  ++P + R  + K   +S TS  +K S   +         ++ +YD++L+L+G+  PGIN++  LP    E R   +++QH++L+ F+  QGG ++ + PE L++  +Y+ W  +      +P S   P     +  + + FE  SK+AWT V LQI KV +L +V      +   I    +  P++      SN YS +ERILL+W+N  YE  RHV W  N + D+      P  RWI+NFD D  D L+ AT +GAY PF+IE HF  MY  P++PE+ LHN L IV+ L +I  + +IQA DI DPNP++M++  + ++  LP Y+PK  + F  +LH+ +  +I + N +S+ L Y   I+G D  DF+L  KGNVV +S +  I   + F SRFIR AE +++ + +         + F++K K++      + K    CY  +++ + + +P++ +G+FSV L+ESS    +   + E+    K  +      +   +   D+       IK+T  +R FF    TV +    + SLEL +LPF++ ++ C II SN  IG+ ++  E     P P    P +    S V+ S  R E  N+        +Y KC+    +   L +P+ N  KE AL  AAQ  +SS E  RR +TGTL SSS+ +    +   + +       +K ++K     Y+        EV     FY    I    IP+P +        + A  +  ++ +P++F    +G YPC +++K   DVR + +E  V  E   ++  F+ P  E L QNIPI N+T   W  + TI G    F GP  +      + +YPL FKP+ E  +  KL L NE DG EH+F++ G G+ P ALE +  EC VG    K + +P+ T     F V +DL  ++ G+  I++ P +   Y I + P + G   G + F          K    E D+D D+ +   +  T  S+     + Y      R WY+L +H +PG P  I ++ C  L+   +EIP++NP +D  L  E  ++ A L G++EI ++ L    Y++ ++P+  G  D  +IF  ++  EFWY L LT + P    +P ++C+LGK     IPL N  +E  L +    SNPE F + I         K    I+P +   L V F P  +G   H   +        + KF L+G G+ P P D   +++  G   T +IPF NP +E VLIDI +T  EH    V+D      +     F+    S         + + L  K +I+I + F PQ M+ +  +  + M + NG+   I + D  D+   +   I   + + + W++PI G+P+     +       Q   R E K  +  N     + L P +T    + K  +++     D NE+  I  F  +   E         +AM +  L   V L+++++S  +        + +   P K  R +  + I  +T G+W+FPI  +A + D D  I IE +GL K       L S T N  PF A+FL G D +F V P++G L P      F  +G    V ++PK Y R   A LVI+TE M W Y+  G++P  V P + ++ I +   +           R  NF+++N +++ T VSS +KGAPL+
Sbjct: 1541 QTWFSLFGWPEGPHSFSIPETIRRDVYKMQFYSSTSPPQKFSRQNDFSKY-----NKTIYDVLLHLSGKMPPGINSSQSLPVDNHEKRVIQLHLQHSSLLDFLNAQGGCISHVLPEFLLEPEDYKRWIEIMSSTNTMPVSSCTPKKKCSIVIEMSKFEAWSKRAWTDVFLQIYKVLVLSRVVPYCSNNMPPIC--VQNTPKVNPCFASSNIYSDSERILLSWMNINYENTRHVIW-KNCHKDV-----IPSERWIVNFDKDLSDGLVFATQLGAYCPFLIESHFINMYTRPKSPEEYLHNCLIIVNTLYEIDFDVEIQATDICDPNPILMLMLCVYMYERLPTYLPKKVVSFECTLHDTVLNKILLKNSSSRNLVYNARIVGRDAADFSLSQKGNVVTISPRNEINVTLKFTSRFIRPAEASLLLISKPKNAVRGITMTFALKGKVLDFKAIDIIKCESPCYQFQEVTVNVKNPFHTAGDFSVILVESSTFVSSPTKLTESRQYPKHDDDMSSSGSDTDQGCSDSPNVLHTSIKSTF-IREFFCSMHTVHLGVKGTSSLELRFLPFNMHVRYCVIILSNKKIGQLIYVAEGKGMTPLPSSCLPMNTS-SSPVYYSTTREEGPNKKY----PVLYLKCKPYQILYVDLKLPMTNEAKEKALAFAAQQQMSSIEYERRLITGTLESSSIRVAIALLGLTKIETLMLFRISK-LRKPKTVSYTT-------EVSLPKYFYIPEKISIPWIPEPQV-----IKLSKAKASDGSVPLPLQFLPLQSGRYPCKILLKSRYDVRAYYVEGIVNEEQPEAKFEFETPAFEALTQNIPIKNQTNDKWTFQVTIEG--EWFYGPVDLHVGPDEIVEYPLTFKPIFECVITGKLILQNEVDGREHIFDIKGVGKKPSALEHITVECQVGNVTQKHITLPHFTNTALTFKVTADLP-IVWGNPQITVYPYKEILYLIHVRPWKRGILKGTITFSTTRRCTTRRKHDDYEEDTDQDQALSCLDSITEQSSILDDADTYGNFNNLRFWYNLEIHSTPGPPIEIMEMTCIALDSTCIEIPLSNP-KDRGLHLEVQLTSAALNGDNEIILSPLQCTKYIVWYSPATTGYSDESIIFQPEMAEEFWYLLKLTIELPKPTTMPEIQCDLGKHVTQIIPLVNCTHET-LKLQVTNSNPENFVLDIN-------RKSQLIISPHSTTELPVLFYPSALGRADHQACINFYCTQFTEWKFYLSGVGLFPQPLDTERITTRIGLQSTIVIPFKNPTMEDVLIDIILTSVEHPRNLVMDHCWDSFIYESSAFRFSSPS-------EIQGIALPPKGNIDISLLFIPQIMKLHKTMVIIEMTKANGKYWPIDNFDELDIKFKSIVGIDSEEIQAIHWIYPIVGLPQAPPPKSPPVVIQCQSRKRAEEKVEIILNAGFFGFSLTPDLTEVLVIPK--RNSHNFCEDPNEIPKIHEFEYEIQFE--------SEAMKSK-LESCVALYMIEKSYDIMAKRITFIFNLVFTPKKPLRSHITLKIECVTEGIWKFPIMLIATEPDTDAVIDIEGVGLFKESVFELRLKSQTRNPEPFTAHFLPGSDLEFFVKPQAGELLP------FNTNGTLITVGFKPKMYCRKYKATLVIQTEEMYWKYEINGLTPTTVPPKNAKAKIDATHKTH-----DNMPVRPHNFVRENTKLIRTGVSSTIKGAPLV 3184          

HSP 2 Score: 582.408 bits (1500), Expect = 8.169e-166
Identity = 430/1543 (27.87%), Postives = 751/1543 (48.67%), Query Frame = 2
Query:    2 MENSIDIFGVRITPNVINFRNCEINGSYIRVVNVQNIGNKNVTVRFYSPQSKDFSMICKMHEKIISSGLSHLCSLKYTMEVEERSVDRLIVTVDGQVHEIPIFIYPSAPDLQIDRIINFGTVVMANKVVTQQANITNEGLKIGEFKLLYSGSRPLNIVPNEGIVYQQSSIPIQIEYVTHEAHKINEKCLVIFEGQDPFEIDIKGDVVKRSLELLDINSDERKLIQCIKFPYTYYGSDKSEVSLLFNNSPEKIQFVAVLEEDAVGQESGSHITM-TAAGINPKECTNPL-----TSLITMYPNQGNLGPYERIPVLFRFSPRWISPKQAFKKTLEPPLQQTFAVFIKIQIXXXXXXXXXXXXXXKDDTLT----RSQKLEVAITGTAAPVLIEMKPNSI-DFGECLENEEKTEKLLFYNRSSILSSLIDFPREAHFLISPNQIRVGPNEQVEISVTFCPKQYGNFNTKQVVKVLSYVKDEENPFLEYEQTIYEQILQLTGSCVAISKSVAPKYCNGLDPLVTNKVGYLAEANFSNLGFKPHNGPATAYITTDAFATGGPQGSRLFKCTDANLHPYSNRTAFVAFPNDRAESIRPSEQNKEFRTILKRIKRYNYIDPDYAYDDEEMRKIRHHQDSYQTMIRRQHSLKKIVKLNSKFKAFE-NDINLGIIPGNGLYPPKLTTDQINTDKIEVFKDNKNFKLLSTKDL-KQSEKVINITKLGTFNAIPTTAQEKEHCSVVLTPQQLHQIIIGPNTINFGDVCVRSISNRDINVVNNLNQFIHVSVVIDCKELRQSSPLSQVIPAKTKSSFPLVFESTKKGKFQRNLSYTINGYYQNHVIVLANVVVNQXXXXXXXXXXXXXXIYPPETGIRNTITMTNPLNCATEFLWEPVFNSTNGIAFSIRPKEGVVEAFSKLDCEVVFHPSFMAPSEGDFILRI-PGNEEGSVETSSQDTLNTDTPTISNGDKSNITMKCIAILGNIHVAFQSRRVMFGNIPINMSSSRTATLLNTGGKHAYYRIVPDDLYEEYPGMTIHPLKGSIPVGGQAELTIKYHPVALSKFDCSIPIVIRGWKELDLKMSGNIIIPQVEILQKRLEFGGVPVGSEKSLDLTLINKSQCRANIEFDFIKQKDFTILTVGQCGNDKALSKDNYKCLITLKPLQE---FQCQLIFTPNEVASYEFPLSVKVNQIEIMVQGAGRGQTAXXXXXXXXXXXXPVRIETVSSSIVTSDRNSILAANLIR--NVSATATRQPINLSNNSFKF----HFFSISEAKSHSKQLIVFNTLEAEVEICLKFNSAN--WKYGTEKTTLKNLSKSRLIPFKFSCESEPIPNNDDYLICLSSLGEAIKIDIKFEPDHPGHYNGEVFVFINNNFEQIFQRIL-LTGLLESPELMCYPEHLTFIPSPLKTEVSLDFKLLAINFETKTFIRINLPLLTKPGTSEEYQPFQFVLSTSNEIQPISENSRVTEIRGTLSFCSDVPINVRSFMEVLTYSGVSK---SISLSATADNCQLTWQNFFNIHQSEYHIVC--DEGKHLEGT-DGI 4534
            M++S     +R+ P  + F +      Y   + V NI   N  +RF  P    F ++    +K ++SGL     ++Y  + +E + DRL+++++ +  EIP+     +  L+I+ ++NFGT+V  +KV +++  ITN G   G FK  Y G  P+ I P  GIV  +SS+ I++++   +   ++E+ +VI +GQ    + IK  VV++ +ELL ++SD R  ++CI F   ++GS K + + ++NNSPE I +VA++++DAVG+E G+ I   T   +N       +     T +I+  PN+G L PY++  + F F+P+ ++     KK + P  +Q +A+F++ +     S    +     DD  T    R QK+E+A+TGT  PVL++  P  + +F  C   E    + +  N+  +L     F + A+F I P + ++     V++  +F P Q G F  KQ+++++  V +E+   L   ++ +   L     C A +K V  K+  G+ P + N  G     + +    K  N    A + +    T   +      C +        +   +AFPNDRA +IR  + +K FR I  ++ R+NY++ D+AY   E ++ + H++ Y   ++   S++   K   + + +  +D ++G+ PG+GL  P L+  +I  +        +  +LL+T+ +  Q E+ +    L    + P+T QEK  CS++LTP+Q+HQ+I+GP+ +NFG++CV S +   ++V+N L   + + +  D +EL++++  S VI   + +   +VF+S   GKF ++ ++T+N     H++V+A VV       +   L+     +  +T  R T+ + N  NC  +F W+PV N+  GIAFSI P +G VEA+S L+CEV +   F +P EG+FIL +  GN                           + +KC+A LG   V     R++F N P  +++ R A L N G  HAY+++    L    P + I P +G +P GG   L I   P    KFD    + IR    +DL++ G+  I  VEI      F G  +G  + +   + NK   RA +EF+    KDF   ++      +         + +L+ L+E    +C + F+P EV   EF + V++N  E                              + +  ++S  ++     LIR   V ATA + P+NLS+  F F    H  + +   + ++ L+++N  +  V   L  ++    +K GT               FKFS  +  +  N+ Y            + I F P+ PG Y  ++ + +  N+  +  +IL LTG ++SPEL+  P  + F P PL     +D  +L  N+   + + + +P + +    EE  P   V      + P S +    ++   LSF S  P+   SF   L +    K   S+ ++ATA+NC LT   +  IH  + +I+   D+ ++L+ T DG+
Sbjct:   31 MDSSGRDMQLRVIPAEVKFLDTMAGRVYRLPITVHNICRWNQKIRFKEPVKPQFKLMLTSLDKELASGLQMTAMVEYHPDKDEDTFDRLLISIENKTTEIPLIGLIPSCQLEIESVVNFGTLVANSKVYSKEITITNHGKAPGIFKAEYHGQLPILIFPTSGIVDAKSSMVIKVDFCADQPRIVDEEAIVILQGQPEMLLSIKAHVVEQIIELLSMSSDRR--LECIHFGPVFFGSSKIKHARVYNNSPEPINWVAIIQDDAVGEELGTDIQQRTDIALNNLTYIRKIKNIDTTIIISCLPNEGTLQPYQKTVITFCFTPKLMA---VGKKDIGPSYRQDYALFLRFE-----SVGSKDGFLRDDDYKTIKSERFQKVELALTGTGLPVLLQFDPGPVLNFKPCFMGERSEIQCIIKNQCELLPVTYHFKKTANFEIDPEKGKITGGGMVDVMCSFVPHQLGVFKVKQMIEIIGLVAEEDLQSLSV-KSFHHVYLAFNSICKASTKKVVMKFDPGILPSIRNPTGKFVVKDLA----KRKNYAPVAMLQSAMTRTHNHRS-----CEEP------VKDMLLAFPNDRAATIRSKDHHKHFRPIFTKVPRFNYVNHDFAYTTFEKQQKKLHENYYAMYLKYLRSVRLQKKQAERERMYSYDDTDIGLEPGSGLKSPSLSEAEIEEELSSAANSIRANRLLTTRGIASQEEESVRRKVLKGLKSEPSTPQEKHDCSLMLTPKQIHQVIVGPSVLNFGNICVNSPNTHLLHVINMLPMHVLLQLDTDLEELQKTNQFSYVILPTSSTYISMVFDSPTIGKFWKSFTFTVNNVPSGHILVVA-VVQPVTLELSSNELVLRPRGFFMKTCFRGTVRLYNRQNCCAQFQWQPV-NTGRGIAFSICPAKGTVEAYSSLECEVTWQQGFSSPEEGEFILHVFQGNA--------------------------LKLKCVAHLGRTKVLLLQPRILFSNCPQGLTTWRKAILQNVGQNHAYFKVCSQSL---LPIINIIPSQGIVPFGGITVLNISCKPTVAEKFDTRAKVSIRHANVIDLRIGGSAEIADVEINPDVFNFSGAYIGGTQIIPFVIKNKGITRARVEFNL---KDFPDFSMDLKDKSEEFKDPAVPYIYSLE-LEENTSLECSITFSPKEVTVVEFIIQVQINFFE---------------------------SSKLYTKYLSSSPSNPKTVPLIRPCYVQATALQSPLNLSSTKFVFEIPLHEMNPNNKVTKTQNLVLYNITKHHVTWTLDLSNTGKLFKDGT---------------FKFSVLNGILRPNEKY-----------NVSISFCPNRPGTYTADIPMLL--NYIPVCYKILHLTGEVKSPELLFDPPFIFFTPVPLDITTVMDINILPQNYFRNSTLCVQIPTV-RLLDGEEIHPLS-VKFPKGRVIPGSHSGINNKLTCHLSFKSSKPV---SFFTNLLFCDDRKNWFSLPVTATAENCILTIYPYMAIHLDKQNIILKNDKDEYLKKTRDGV 1452          
BLAST of cilia- and flagella-associated protein 47 vs. UniProt
Match: sp|Q80W93|HYDIN_MOUSE (Hydrocephalus-inducing protein OS=Mus musculus OX=10090 GN=Hydin PE=1 SV=2)

HSP 1 Score: 70.4774 bits (171), Expect = 3.508e-10
Identity = 110/469 (23.45%), Postives = 178/469 (37.95%), Query Frame = 2
Query: 7397 IYFKIPLQEVLAQNIPIVNKTKQDWPLKATITGTSAAFSGPDFIMAKALSVSQ-YPLQFKPVK---EGKVNAKLTLFNEADGSEHVFELYGEGESPLALESLYFECTVGENITKTLQIPNLTRKKHFFTV--------ESDLDWMIVGDDTISILPGRNCSYDIAINPKRSGKYTGILAFVSGKKTVIEYDSDGDEIVDVYNDETVNSANKSCEIYRIWYSLVVHVSPGAPQGIFDVKCNCLEKVVLEIPINNP-SEDMELKFEAAISGANLTGNSEITVNSLSTESYLLTFTPSFIGNFDGRLIFFNDIVGEFWYKLNLTA-DSPIEKFIPPVKCE--LGKWCLVEIPLKNIDNENKLVMYPEISNPECFSILIGDLELFDQDKQCFSIAP----RTEHVLSVRFTPCEIGSGTHLCFLVMKSKLLGDQKFI-LTGCGMPPNPSDIIGVSSEAGSNMTFLIPFHNPLL 8740
            + F   ++    Q I + N++ Q W L     G    + GP+FI  +A   ++ Y + +KP     E + +     F   DG+  ++ L+G  E P A+ ++Y E       T+ L I N   K   F V        ++DL   + G D I +L G    Y +     + G YT  +                     ++ +E  N          ++Y++   V+P        +     + V   I + NP    +    E  +S  +L     +  NS  T S+   F P   G   GRL   N  +G + Y+L L A  +P EK   PV  +  LG             +++ L  +   +  +       D   F  +K   + AP     TE  + V F P  +G    +  L   S L+G +  I L G  +PP P     +   AG N+  +IPF N  L
Sbjct: 4668 VNFNCQVRSRHTQTILLSNRSNQTWNLHPIFEGEH--WEGPEFITLEAHQQNKPYEITYKPRTMNLENRKHQGTLFFPLPDGTGWLYALHGTAELPKAVANIYREVPCKTPYTELLPISNWLNKPQRFRVIVEILKPEKTDLSVTLKGLDYIDVLSGSKKDYKLNFFSYKEGLYTAKV---------------------IFRNEVTNEF--------LYYTVSFRVTPSGIIKTIQMTSPVRQSVSASIKLENPLPYSVTFSTECKLSDISLPSQFAVPPNSEGTFSF--EFQPLKAGELCGRLTLHNSDLGYYQYELALKALPAPPEK---PVHFQTVLG------------SSQSILAKFTNYTRLKTEYYCKTDCSDFHTEK-VINAAPGAQGGTEVSVEVFFEPSHLGETKGILCL---SSLIGGEYIIPLFGIALPPKPQGPFLI--RAGYNI--IIPFKNVFL 5080          
BLAST of cilia- and flagella-associated protein 47 vs. UniProt
Match: sp|Q4G0P3|HYDIN_HUMAN (Hydrocephalus-inducing protein homolog OS=Homo sapiens OX=9606 GN=HYDIN PE=1 SV=3)

HSP 1 Score: 63.929 bits (154), Expect = 3.453e-8
Identity = 104/496 (20.97%), Postives = 176/496 (35.48%), Query Frame = 2
Query: 7325 IKGPDDVRLFRIECTVTPEGNLSQIYFKIPLQEVLAQNIPIVNKTKQDWPLKATITGTSAAFSGPDFIMAKALSVSQ-YPLQFKPVK---EGKVNAKLTLFNEADGSEHVFELYGEGESPLALESLYFECTVGENITKTLQIPNLTRKKHFFTV--------ESDLDWMIVGDDTISILPGRNCSYDIAINPKRSGKYTGILAFVSGKKTVIEYDSDGDEIVDVYNDETVNSANKSCEIYRIWYSLVVHVSPGAPQGIFDVKCNCLEKVVLEIPINNPSEDMELKFEAAISGANLTGNSEITVNSLSTESYLLTFTPSFIGNFDGRLIFFNDIVGEFWYKLNLTADSPIEKFIPPVKCELGKWCLVEIPLKNIDNENKLVMYPEISNPECFSILIGDLELFDQDKQCFSIAP----RTEHVLSVRFTPCEIGSGTHLCFLVMKSKLLGDQKFI-LTGCGMPPNPSDIIGVSSEAGSNMTFLIPFHNPLLEPVLIDI 8761
            I+G   + L      V P      + F   ++    Q I + N+T Q W L     G    + GP+FI  +A   ++ Y + ++P     E + +     F   DG+  ++ L+G  E P A+ ++Y E       T+ L I N   K   F V        + DL   + G D I +L G    Y +     + G Y   +                     ++ +E  N          ++Y++   V P       ++     +     I + NP     + F       ++   S+  V + S  ++   F P   G   GRL   N  +G + Y+L L A   + +     +  LG   ++ +   N   +         +   C +    D   F  +K   + AP     TE  + V F P  +G    +  L   S L G +  I L G  +PP P     +     +  + +IPF N     V   I
Sbjct: 4611 IQGGSPLSLTLSGVCVGPPAVKEVVNFTCQVRSKHTQTILLSNRTNQTWNLHPIFEGEH--WEGPEFITLEAHQQNKPYEITYRPRTMNLENRKHQGTLFFPLPDGTGWLYALHGTSELPKAVANIYREVPCKTPYTELLPITNWLNKPQRFRVIVEILKPEKPDLSITMKGLDYIDVLSGSKKDYKLNFFSHKEGTYAAKV---------------------IFRNEVTNEF--------LYYNVSFRVIPSGIIKTIEMVTPVRQVASASIKLENPL-PYSVTFSTECRMPDIALPSQFVVPANSEGTFSFEFQPLKAGETFGRLTLHNTDLGYYQYELYLKATPALPEKPVHFQTVLGSSQIILVKFINYTRQR--------TEYYCRT----DCTDFHAEK-LINAAPGGQGGTEASVEVLFEPSHLGETKGILIL---SSLAGGEYIIPLFGMALPPKPQGPFSIR----AGYSIIIPFKNVFYHMVTFSI 5054          
BLAST of cilia- and flagella-associated protein 47 vs. TrEMBL
Match: gnl|BL_ORD_ID|18340785 (tr|A0A1I8G2Q9|A0A1I8G2Q9_9PLAT Calponin-homology (CH) domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 2001.48 bits (5184), Expect = 0.000e+0
Identity = 1216/3475 (34.99%), Postives = 1880/3475 (54.10%), Query Frame = 2
Query:   11 SIDIFGVRITPNVINFRNCEINGSYIRVVNVQNIGNKNVTVRFYSPQSKDFSMICKMHEKIISSGLSHLCSLKYTMEVEERSVDRLIVTVDGQVHEIPIFIYPSAPDLQIDRIINFGTVVMANKVVTQQANITNEGLKIGEFKLLYSGSRPLNIVPNEGIVYQQSSIPIQIEYVTHEAHKINEKCLVIFEGQ-DPFEIDIKGDVVKRSLELLDINSDERKLIQCIKFPYTYYGSDKSEVSLLFNNSPEKIQFVAVLEEDAVGQESGSHITMTAAGINPKECTNPLTSLITMYPNQGNLGPYERIPVLFRFSPRWISPKQAFKKTLEPPLQQTFAVFIKIQIXXXXXXXXXXXXXXKDDTLTRSQKLEVAITGTAAPVLIEMKPN-SIDFGECLENEEKTEKLLFYNRSSI-LSSLIDFPREAHFLISPNQIRVGPNEQVEISVTFCPKQYGNFNTKQVVKVLSYVKDE-ENPFLEYEQTIYEQILQLTGSCVAISKSVAPKYCNGLDPLVTNKVGYLAEANFSNLGFKPHNGPATAYITTDAFATGGPQGSRLFKCTDANLHPYS-------------NRTAFVAFPNDRAESIRPSEQNKEFRTILKRIKRYNYIDPDYAYDDEEMRKIRHHQDSYQTMIRRQHSLKKIVKLNSKFKAFENDINLGIIPGNGLYPPKLTTDQINTDKIEVFKDNKNFKLLSTKDLKQ-SEKVINITKLGTFNAIPTTAQEKEHCSVVLTPQQLHQIIIGPNTINFGDVCVRSISNRDINVVNNLNQFIHVSVVIDCKELRQSSPLSQVIPAKTKSSFPLVFESTKKGKFQRNLSYTINGYYQNHVIVLANVVVNQXXXXXXXXXXXXXXIYPPETGIRNTITMTNPLNCATEFLWEPVFNSTNGIAFSIRPKEGVVEAFSKLDCEVVFHPSFMAPSEGDFILRIPGNEEGSVETSSQDTLNTDTPTISNGDKSNITMKCIAILGNIHVAFQSRRVMFGNIPINMSSSRTATLLNTGGKHAYYRIVPDDLYEEYPGMTIHPLKGSIPVGGQAELTIKYHPVALSKFDCSIPIVIRGWKELDLKMSGNIIIPQVEILQKRLEFGGVPVGSEKSLDLTLINKSQCRANIEFDFIKQKDFTILTVGQCGNDKALSKDNYKCLITLKPLQEFQCQLIFTPNEVASYEFPLSVKVNQIEIMVQGAGRGQTAXXXXXXXXXXXXPVRIETVSSSIVTSDRNSILAANLIRN-VSATATRQPINLSNNSFKFHFF--------------------SISEAKSHSKQLIVFNTLEAEVEICLKFNSANWKYGTEKTTLKNLSKSRLIPFKFSCESEPIPNNDDYLICLSSLGEAIKIDIKFEPDHPGHYNGEVFVFINNNFEQIFQRILLTGLLESPELMCYPEHLTFIPSPLKTEVSLDFKLLAINFETKTFIRINLPLL-TKPGTSEEYQPFQFVLSTSNEIQPISEN------------SRVTEIRGTLSFCSDVPINVRSFMEVLTYSGVSKSISLSATADNCQLTWQNFFNIHQSEYHIVCDEGKHLEGTDGIHGHRFADFGEAQLKSYNKDTANINVNMDGQSVHSRNSTTITSSNFXXXXXXXXXXXXXXXXXXXXXPIVLREGALNKIGEKVKYKSSTTPLLKQNVKPVERS---NDSTLEINSSIMSDKNYVTMYMYPNQITFANXXXXXXXXXXXLNKDFDFPWDYDADVLLIIQRWFTMHGWAGNLHPINVPVSFRSSLQKRFGFSQ---TSTKEKISNTEN-----------------IENTGLKNDSRDLYDMILYLTGRQIPGINTTVVLPTHPIERSCHIYIQHATLIAFIENQGGQLAQIKPEHLMDLPEYELWHSVGC------------------------PGLPNSDMKPVQYDSNSFEKISKKAWTVVLLQILKVFILIKVTYSSYRHALQILHGKEPIPEIQLAATVSNCYSLNERILLAWLNYLYEAYRHVCWPGNSNPDIGTTSSTPVSRWIINFDNDFMDSLILATAIGAYIPFMIERHFKYMYPNPQNPEQCLHNALKIVSALKDIGLEFDIQAIDIVDPNPVMMIXXXXXXXXXXXXYIPKSEIVFTGSLHEQITKQIQISNPTSKPLSYECIIIGNDNCDFALPKGNVVNLSGKASIKWPIVFKSRFIRSAEVTVMFVGRKTGFSIPTNLIFSVKTKIMSINPSKVEKIVGKCYIMKKINLKIISPYNKSGNFSVKLIESSEGNL--------------KSIKETSNEFKQTETSFIKP-AIAKKATLDAIKTTNKLRAFFSHCETVFINENKSGSLELFYLPFHLGIKRCTIIFSNDSIGEFVHSVEASAELPEPIII-------TPNDDKPKSGVWVSRAEAANRGLEG---NEKTIYWKCEVGSFIQETLSIPINNIYKEYALHTAAQLHLSSQEVSRRQXX-XXXXXXXXXXXXXXXXXXXXDDHDFVNSNKQIKKKADTKYSNKGKFINFEVESDSSFYTTPLIVQIPDPLMHLGNDSTKNNAIQTP--STIDIPIKFHASTAGVYPCNLVIKGPDDVRLFRIECTVTPEGNLSQIYFKIPLQEVLAQNIPIVNKTKQDWPLKATITGTSAAFSGPDFIMAKALSVSQYPLQFKPVKEGKVNAKLTLFNEADGSEHVFELYGEGESPLALESLYFECTVGENITKTLQIPNLTRKKHFFTVESDLDWMIVGDDTISILPGRNCSYDIAINPKRSGKYTGILAFVSGKKTVIEYDSDGDEIVDVYNDETVNSANKSCEIYRIWYSLVVHVSPGAPQGIFDVKCNCLEKVVLEIPINNPSEDMELKFEAAISGANLTGNSEITVNSLSTESYLLTFTPSFIGNFDGRLIFFNDIVGEFWYKLNLTADSPIEKFIPPVKCELGKWCLVEIPLKNIDNENKLVMYPEISNPECFSILIGDLELFDQDKQCFSIAPRTEHVLSVRFTPCEIGSGTHLCFLVMKSKLLGDQKFILTGCGMPPNPSDIIGVSSEAGSNMTFLIPFHNPLLEPVLIDIRITEEHQSVLDKYRIGSVNLDKDFKEMETSVFXXXXXXXXXXXXESKQSIEIPISFAPQEMRKYDAICCVVMKRKNGEPLISDEDFNDLILPNSDNITPFDKKQLRWLFPIKGVPETLVSLNVFTTPLVQGPLRIETKEHLEFNLWGLPPPVTREDFVTKSVKSAPATINDGNE--LKPIDRFLQDFTTELRVITVENGDAMDTATLNEYVHLFLMKQSKQLDTGVTVLTYEIRMRPLKKFRLNSEIIITSLTGGVWRFPIRFVAHDCDPDDEITIEAIGLNKPVSTRFYLNSTTYNELPFKAYFLKGGDP-DFTVSPESGILPPIQSFSKFQISGLEFVVTWQPKTYSRSKGARLVIETEMMEWVYKFVGISPQYVVPDTRSIIQSNWDSDMXXXXXXXXXXXXXFLKQNIEMLSTAVSSPVKGAPLLPK 10045
            ++DI G+RI P +I F +C++  S    V+V+NI  K  T+RFY+PQ+K F++  K HEK ++SGL H+  ++YT   E    DRLIVTVDG+V  +P+   P  P L+I   ++FG VV+ANKVVT    + N G + GEF+  YSGSRPL+I+P  G +  +S +P++ +Y+T E  K NE+ + + EG+ +P +I + G++V+R LELL   + E   + C+ F   +YG+DK E ++LFNN+PE + FV++LEE+A+GQESG  +  +A     KECTNPLTSL+ M PNQG + PY++  V FRFSPRW   K++F  T + P +Q FA+F+ IQ+VG+ +D  S          +   +LEVA+TGTA P+L+++ P   ++FG    N          N+S   L  L  F + AHF   P + ++ P  ++ +SVTFCP+Q+GNF+ +  + +L  V D+ ++P       I+   ++L+GSC       A ++  G+ PLV N+VG   +  F  L  +P   P  A +                  T+A LH ++              + A +AFPNDRA S+RPSE++ ++ T+  R+KR+N++DPDYAY+D E+ ++R H+  Y    R++     + + + + K FEND ++G+IP  G+ P KL  + +  D       NK F+LLSTK+++   E   N T      A+P + +EKE C ++L PQ+LHQ++I P TI+FG VC+RS+  R++ V+NNL   IH+ V IDC+ELR SSPLSQV+P K+K+  PL+FES  +G+FQRN+SY ING Y+NHVI LA VV  QLELST  L +      P E GIR  IT+ N LN   EF WEPV       AFSIRP+ GVVEAF  +DCEVVF PSF AP EG F L + G                          +++ +KC+A  G  +V F +RRVMFG++P+NM++ + A L+N    HAY+ ++     + +PGM + PL G +PVGGQ E+ I + P A+SKFDC   + IRGW++L+L+M G I+ P V+I  K   F GV VG+ KS+   L+N++Q  + +EFD  +  DF++   G+   +   +   +   +TL+P +  +  L F P EVASY F + V +N        A     + + +     + + +   T SSS        +      R  V   A R  + LS   F F                         + A +  + L + NT ++ +   +   ++         +L  +  +   P + S ES         L         + + ++F P  PG +   + V IN++++  +  + L G L  P +   P  LT  P PL + +S+ F +LA N+   + +   LP +    G+  +    +++     +I P +++            +++ E+R  L+F +  P+++   +      G    + +SATADNC LT   F   H+ +YHIV ++GK LEG          + GE Q+ +   +  +  V     +  SR STT TSSNFE+SS +YEET +E+ ++        R+GA+N      K    + P +   V    ++   + +  E +S  + D+NY                         L ++  F      D+L I+QRWFT +GW G   P+ VP S RS L ++    +   +S ++K S T N                 +++ G K++ + +YDMI +L GR  PGI  +  LP+   ER   IY QHATL+ F+ +QGG LA ++PEHLM+  +Y  W S+                          PG    D++    D   FE +SK+AWT VLLQILK  +L KVT  S+++ L+      P+P I L+   SN Y++NERILLAWLN+ Y+ YR   W        G     P +RW+INFD+D +D L+LA  IGA+ P++I+ H + MY  P  PEQCLHN+L++V+A++ +GL+FD+QA+D+  PNPV+++L  + L+ +LP YI KS + F+G LH+  ++Q+ + NP +K L+Y   + G D  DF+LPKG++V+L  K  +   + F+SRF+R AE  ++ +GR +G    +  +F + T++ SI P    ++   CY +K + L +++P+N    F+V L+E     L              +  +E   E K+++     P ++  K      +    +++FF H   + +    S  +++ +LPF +  K+C+++  N ++GEFV+ VEA A+LP P  I       TP    P   V +S A AA+RG      +   +YW+ E    ++E L IP+ N YKE AL  AAQ HLS +EV RR+VT    + + +      +  +  D      +N  I+++   K+    + I+F+VE DS  +  P ++ IP P       ST N+  + P  +T D+P++F     GVYP  +++K  DDVRLFR+EC V PEG  +++ F+ P+ + + QNIP++N+TK DW LKA + G +  F GPD+++AKA   + YPL FKP  EG+   +L L N  DG+EH + L G G  PLAL+ L F+C VGE+IT+ + +PN +++K  + VES+L + + G   +++LPGR   Y I I P + GK+ G++AFV+ K  +++YDSDG+E+  V +       N S E +R+WYS+ + V+PG P G  +V C C     +E  + NP  D E++ +A I G +L+G   + +      +Y L F+P+ + +  G +IFFN  VGEFWY+LNL A  P    + P++CELG+    E+ L+N  +   +V+ P++SN   F + I D E+         I       L++RFTP ++G   H C +   S  L +  F + G G+ P+  + + +++ AGSN T +IPFHNPL  PV+ DI +T+  +S  D             KE+E S F LLLK+ +K++LE K  ++IP+SFAP+ M++++A+C V+M+R++G+      D     LP SD+       ++RW F + GVPE          PLV  P R   ++ LE  L G+ P       + ++    PA    GN+  L        D         V   D++    L++ V L L++Q +   TG+ VLT+ +R++P K FR+ + ++I S  GG WR+P+   + D +PDD ITI A GL++     F L S   + + F+AYF +  D  DF V P+SG LPP          GL F VT+ P  Y + K  RLVI T+ MEW Y  VG  P+Y  P  RS+      S    +   ++ R KN++++N+ M  T VSSP+K APL+ K
Sbjct:    2 ALDIQGIRINPGIIQFFDCDVGVSQKCHVSVKNISEKTRTIRFYAPQNKIFTLKVKEHEKNVASGLDHVACIEYTPTDENTQSDRLIVTVDGEVIPVPVQGMPRQPVLEISDSVSFGVVVVANKVVTTNVKLYNRGSRPGEFRFEYSGSRPLSILPPHGSIPPKSVLPVRFDYITKEPGKFNEEVVAVLEGRTEPQKIAVFGEIVERQLELLSPATGEP--MPCVHFGSAFYGTDKIEAAVLFNNAPEPVSFVSILEENAIGQESGP-VNKSANLAEAKECTNPLTSLVCMIPNQGTIAPYQKALVCFRFSPRWYKSKRSFHTTEDSPPKQDFALFMYIQLVGTQTDSASPD--------SHRTQLEVALTGTALPILLQVSPKPEVNFGAVQLNNPADAAFTLANQSEDGLPVLFAFRKIAHFNARPERGQIEPGRELPVSVTFCPRQFGNFDVQLEICILGEVADDRQDPLTRRLDVIHSVFMRLSGSCRVFGTQPAGRFNPGITPLVANEVGLCTDTRFDELNERPVQPPLAALVAH----------------TNARLHRHAVSADEGSGGDGKRRKQARIAFPNDRAASLRPSERHVDYCTLFTRVKRHNFVDPDYAYEDSEVERVRQHKQGYADSQRKRTENLIVSQRDRRLKRFENDRDMGMIPAMGMRPVKLGLEDLRPDTPPPEPPNKVFQLLSTKEIQDVKETAANQTAKDGLGAVPMSQKEKEECRMLLRPQELHQVVITPGTIDFGVVCLRSVVTRELIVMNNLETSIHLVVEIDCRELRHSSPLSQVVPPKSKALVPLIFESALQGRFQRNVSYVINGNYRNHVIALAEVVPVQLELSTQELEVVPCEGQPAEAGIRGVITLYNRLNHPAEFSWEPVLKERQHTAFSIRPRAGVVEAFKDIDCEVVFRPSFNAPDEGYFRLHVEGG-------------------------NDLNLKCVAKFGPTNVQFVNRRVMFGSVPLNMTTVKKAVLVNNSQNHAYFHVINS---KPWPGMELEPLSGVVPVGGQKEIRISFTPSAVSKFDCGTRVAIRGWRDLELRMGGTILSPCVDIPLKEFNFDGVYVGASKSISFELVNQTQTDSRLEFDLKRYPDFSLDFGGRASPEDLANPGVHT--VTLRPEETLKAVLTFRPKEVASYSFLMPVVINNTRAPSPAATPVPPSPAPTVKDGISMSRIDSATSSSSGRVGWTPHVPVVQTPRKLVKGIALRPVLRLSRREFAFQLAPEALQDQLDAQVSPTPPPLNQATPANNRLQLLTLENTGDSAITWAVDLPNSQKALRDSCFSLTPIEGTEAAPEEASSES------GRRLFGRLEPAATVTLTVQFSPRSPGQFKARLPVVINDDWQFPYDHLTLRGELTWPSITFVPPALTLTPCPLHSAISVQFSILAANYAAPSRLEFTLPQVEADDGSPIKPLRLEYIDGRGPDIFPATKDPDANGGGSDASLAQLIELRCRLTFEASTPVSISKEILFQDSFGNQTRLPVSATADNCLLTLYPFVLKHREDYHIVTEQGKLLEGRRAAQQLPATETGEPQMVACRAEDLSGLV-----AASSRPSTTATSSNFEDSSTSYEETLTESAASNTP-----RDGAVNNPASSSKATGQSGPHVPGMVGKTGKTRWPDHALTESSSDGLVDENY------------------------HLEREGLF----YRDMLSIVQRWFTNYGWPGGQFPVTVPNSMRSGLSRKQQSDEQDDSSNRKKKSTTSNDKDGNKDGNNAGGKGAALDSGGGKSEVKTIYDMITHLCGRPAPGIPISAALPSQAAERVKQIYWQHATLLTFLRSQGGCLASVRPEHLMEPKDYRCWKSLQAKKPNSAAEASGSPESIEDDGLEPSPGRLVRDVEEAGRDEELFECVSKRAWTDVLLQILKTLVLYKVTPRSFKN-LRQPDPHMPLPSISLSPLASNVYTVNERILLAWLNHFYDNYRTKIWTD------GDKGGVPPARWVINFDHDLLDGLVLAAVIGAHCPYLIDSHLRGMYTAPSTPEQCLHNSLRVVNAMRFVGLDFDVQALDLTAPNPVLLMLLCVYLYQTLPQYIIKSNVDFSGGLHQTCSRQVTLVNPVAKTLAYRAALAGRDAADFSLPKGDLVSLPPKGRVPVSVEFRSRFLRPAEAVLLLIGRPSGPHQGSTQVFRLVTQVNSIQPISTVQVASHCYELKPVRLNVVNPFNCEAVFAVSLVEGGTDQLLLNACEKRQQQQQQQQQQERQIERKKSKQGPPPPRSVDTKGAQSRPEPPVSMKSFFCHVPEIRLAPRGSAEIDMNFLPFQVDKKQCSVVLRNPTVGEFVYGVEAVADLPVPTRIPMEEANATPG-APPTKTVRISSAVAASRGQSSVVHDHSIVYWRTEANKEVKEVLKIPLINEYKEKALLQAAQQHLSLKEVQRRRVTGTLESGTLVEKAMEMLSAVGVDGKKLEKTNSSIERR---KFQFSKETIDFQVELDSHHFRAPSVISIPHP------RSTDNSLKKDPTVTTFDLPLEFRPKRPGVYPVTIILKANDDVRLFRVECIVIPEGFSAELQFESPVNQAVLQNIPVINQTKDDWRLKAEMHGVN--FHGPDYLLAKAYKTTSYPLTFKPTHEGEATGRLLLTNLDDGTEHCYVLGGIGRKPLALDHLVFDCQVGESITRVVLVPNNSKRKLLYQVESNLSF-VGGKKEVTVLPGRQVEYTIVIAPNKRGKFDGVIAFVADKDRLVDYDSDGEELPPVDD-------NPSTE-HRVWYSMELSVAPGEPMGRLNVTCPCYRTCEVEFTVRNPLTDKEIELDAEIRGESLSGEKVLRLAPAEEVTYRLAFSPALVEDTIGSVIFFNSEVGEFWYELNLHATPPPLTVLEPMECELGQHVCQEMTLEN-PSSAPIVLRPQLSNANNFGLEITDSEVH--------IPAGGSVTLNLRFTPSDLGFADHACRITFHSDKLKEWIFEVNGSGLMPSAQNPVAITAPAGSNSTLIIPFHNPLDVPVMCDILLTDSGKSTND-----------GIKELENSPFCLLLKHCKKIRLEPKARLDIPVSFAPENMQQHEAVCVVIMRRRDGKGWHYCPD-EPKALPRSDS---GGIAEIRWRFRVVGVPENKADRPEVPAPLVSCPARTVAEDRLEVWLAGVAPTPGAPQTLIRARTRTPA----GNQPALPAGVEEAADVPEPFTFGLVSLDDSL-AGLLSQSVKLELLRQVRDSRTGMVVLTFALRLQPYKTFRVKTHLVIKSNAGGFWRYPLTVESTDPEPDDVITINAAGLDRASKVMFRLTSKELHPVKFRAYFEENHDSGDFHVEPQSGELPP------HGTDGLPFTVTFLPSYYGKPKRVRLVIRTDDMEWTYIIVGEIPEYQPPQGRSLPPV---SGPHPNPIVRSGRVKNYIRENMRMEHTGVSSPIKLAPLMCK 3309          
BLAST of cilia- and flagella-associated protein 47 vs. TrEMBL
Match: gnl|BL_ORD_ID|23517607 (tr|A0A210QA05|A0A210QA05_MIZYE Uncharacterized protein CXorf22 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT07856 PE=4 SV=1)

HSP 1 Score: 1877.83 bits (4863), Expect = 0.000e+0
Identity = 1225/3437 (35.64%), Postives = 1891/3437 (55.02%), Query Frame = 2
Query:   17 DIFGVRITPNVINFRNCEINGSYIRVVNVQNIGNKNVTVRFYSPQSKDFSMICKMHEKIISSGLSHLCSLKYTMEVEERSVDRLIVTVDGQVHEIPIFIYPSAPDLQIDRIINFGTVVMANKVVTQQANITNEGLKIGEFKLLYSGSRPLNIVPNEGIVYQQSSIPIQIEYVTHEAHKINEKCLVIFEGQDPFEIDIKGDVVKRSLELLDINSDERKLIQCIKFPYTYYGSDKSEVSLLFNNSPEKIQFVAVLEEDAVGQESGSHITMTA----------AGINPKECTNPLTSLITMYPNQGNLGPYERIPVLFRFSPRWISPKQAFKKTLEPPLQQTFAVFIKIQIXXXXXXXXXXXXXXKDDTLTRSQKLEVAITGTAAPVLIEMKPN-SIDFGECLENEEKTEKLLFYNRSSILSSLIDFPREAHFLISPNQIRVGPNEQVEISVTFCPKQYGNFNTKQVVKVLSYVKDEENPFLEYEQTIYEQILQLTGSCVAISKSVAPKYCNGLDPLVTNKVGYLAEANFSNLGFKPHNGPATAYITTDAFATGGPQGSRLFKCTDANLHPYSNRTAFVAFPNDRAESIRPSEQNKEFRTILKRIKRYNYIDPDYAYD-DEEMRKIRHHQDSYQTMIR--RQHSLKKIVKLNSKFKAFENDINLGIIPGNGLYPPKLTTDQINTDKIEVFKDNKNFKLLSTKDLKQSE-KVINITKLGTFNAIPTTAQEKEHCSVVLTPQQLHQIIIGPNTINFGDVCVRSISNRDINVVNNLNQFIHVSVVIDCKELRQSSPLSQVIPAKTKSSFPLVFESTKKGKFQRNLSYTINGYYQNHVIVLANVVVNQXXXXXXXXXXXXXXIYPPETGIRNTITMTNPLNCATEFLWEPVFNSTNGIAFSIRPKEGVVEAFSKLDCEVVFHPSFMAPSEGDFILRIPGNEEGSVETSSQDTLNTDTPTISNGDKSNITMKCIAILGNIHVAFQSRRVMFGNIPINMSSSRTATLLNTGGKHAYYRIVPDDLYEEYPGMTIHPLKGSIPVGGQAELTIKYHPVALSKFDCSIPIVIRGWKELDLKMSGNIIIPQVEILQKRLEFGGVPVGSEKSLDLTLINKSQCRANIEFDFIKQKDFTILTVG-QCGNDKALSKDNYKCL-ITLKPLQEFQCQLIFTPNEVASYEFPLSVKVNQIEIMVQGAGRGQTAXXXXXXXXXXXXPVRIETVSSSIVTSDRNSILAANLIRNVSATATRQPINLSNNSFKFHFFSISEAKSH------SKQLIVFNTLEAEVEICLKFNSANWKYGTEKTTLKNLSKSRLIPFKFSCESEPIPNNDDYLICLSSLGEAIKIDIKFEPDHPGHYNGEVFVFINNNFEQIFQRILLTGLLESPELMCYPEHLTFIPSPLKTEVSLDFKLLAINFETKTFIRINLPLLTKPGTSEEYQPFQFVLSTSNEIQPISENSRVTE---IRGTLSFCSDVPINVRSFMEVLTYSGVSK---SISLSATADNCQLTWQNFFNIHQSEYHIVCDEGKHLEGTDGIHGHRFADFGEAQLKSYNKDTANINVNMDGQSVHSRNSTTITSSNFXXXXXXXXXXXXXXXXXXXXXPIVLREGALNKIGEKVKYKSSTTPLLKQNVKPVERSNDSTLEINSSIMSDKNYVTMYMYPNQITFANXXXXXXXXXXXLNKDFDFPWDYDADVLLIIQRWFTMHGWAGNLHPINVPVSFRSSLQKRFGFSQTSTKEKISNTENIENTGLKNDSRDLYDMILYLTGRQIPGINTTVVLPTHPIERSCHIYIQHATLIAFIENQGGQLAQIKPEHLMDLPEYELWHSV-----------GCPGLPNSDMKPVQYDSNSFEKISKKAWTVVLLQILKVFILIKVTYSSYRHALQILHGKEPIPEIQLAATVSNCYSLNERILLAWLNYLYEAYRHVCWPGNSNPDIGTTSSTPVSRWIINFDNDFMDSLILATAIGAYIPFMIERHFKYMYPNPQNPEQCLHNALKIVSALKDIGLEFDIQAIDIVDPNPVMMIXXXXXXXXXXXXYIPKSEIVFTGSLHEQITKQIQISNPTSKPLSYECIIIGNDNCDFALPKGNVVNLSGKASIKWPIVFKSRFIRSAEVTVMFVGRKTGFSIPTNLIFSVKTKIMSINPSKVEKIVGKCYIMKKINLKIISPYNKSGNFSVKLIESSEGNLKSIKETSNEFKQTETSFIKPAIAKKATLDA-------------------IKTTNK-------LRAFFSHCETVFINENKSGSLELFYLPFHLGIKRCTIIFSNDSIGEFVHSVEASAELPEPIIITPNDDKPKSGVWVSRAEAA--NRGL-EGNEKTIYWKCEVGSFIQETLSIPINNIYKEYALHTAAQLHLSSQEVSRRQXXXXXXXXXXXXXXXXXXXXXXDDHDFVNSNKQIKKKADTKYSNKGKF---------------INFEVESDSSFYTTPLIVQIPDPLMHLGNDSTKNNAIQTPSTIDIPIKFHASTAGVYPCNLVIKGPDDVRLFRIECTVTPEGNLSQIYFKIPLQEVLAQNIPIVNKTKQDWPLKATITGTSAAFSGPDFIMAKALSVSQYPLQFKPVKEGKVNAKLTLFNEADGSEHVFELYGEGESPLALESLYFECTVGENITKTLQIPNLTRKKHFFTVESDLDWMIVGDDTISILPGRNCSYDIAINPKRSGKYTGILAFVSGKKTVIEYDSDGDEIVDVYNDETVNSANKSCEIYRIWYSLVVHVSPGAPQGIFDVKCNCLEKVVLEIPINNPSEDMELKFEAAISGANLTGNSEITVNSLSTESYLLTFTPSFIGNFDGRLIFFNDIVGEFWYKLNLTADSPIEKFIPPVKCELGKWCLVEIPLKNIDNENKLVMYPEISNPECFSILIGDLELFDQDKQCFSIAPRTEHVLSVRFTPCEIGSGTHLCFLVMKSKLLGDQKFILTGCGMPPNPSDIIGVSSEAGSNMTFLIPFHNPLLEPVLIDIRITEEHQSVLDKYRIGSVNLDKDFKEMETSVFXXXXXXXXXXXXESKQSIEIPISFAPQEMRKYDAICCVVMKRKNG---EPLISDEDFNDLILPNSDNITPFDKKQLRWLFPIKGVPETLVSLNVFTTPLVQGPLRIETKEHLEFNLWGLPPPVT--REDFVTKSV--KSAPATINDGNELKPIDRFLQDFTTELRVITVENGDAMDTATLNEYVHLFLMKQSKQLDTGVTVLTYEIRMRPLKKFRLNSEIIITSLTGGVWRFPIRFVAHDCDPDDEITIEAIGLNKPVSTRFYLNSTTYNELPFKAYFLKGGDPDFTVSPESGILPPIQSFSKFQISGLEFVVTWQPKTYSRSKGARLVIETEMMEWVYKFVGISPQYVVP---DTRSIIQSNWDSDMXXXXXXXXXXXXXFLKQNIEMLSTAVSSPVKGAPLLPK 10045
            D  GVRITP+V+ F + E+N  +   V V+N    + ++R+Y P+SK F +  +   K ++ GL     +++ ++ E+   DRL+VTVDG V EIP+  YP  P L+I++++NFG +V  +K V+ + ++ N G K G+FK+ Y+G +P+ I+P+ G V  +S   I++EYVT +A    E   V  EG++   + I G +V R+LE+L +N+  R+ I+C++F  TYYGSDK+E +LLFNN PE I FVAVL+EDAV QE G  +T +           +   P+  TN LTSLIT  PNQG L PYE+IPV FRFSPRW + K+ +K   +PP ++ FA+F++IQIVGS +   ++S     D       +EVA+TGTA PVL+ + P+   DFGEC   E         N S+ L++   F R AHF   P   ++ PN+  ++  +F PKQ G F T Q++ V+  V D +NP +   Q I    L   GS   I K   PKY  G+ P ++N+VG   +  FS L   P N          A A G   G    K    N+ P  ++ A V+FPNDRA SIRPSE+ + ++TI  + KR+NY+DPDYA +  EE  K+ +H++SY  M+R  RQ+ L +I   + +FK   N +++GI    GL P +LT  +I  D       N +FKLLSTK+L  +E + +        NA+PTT +EK  CS  L+PQQLHQIIIGP T++FG VC+RS+  +++ ++NNL+  IH+   IDC+ELRQSSPLSQV+P K+K+  P+V+ES  KGKFQR++SYT+NG+Y++HV V+A VV   L+LST+ L+LT +   P E   R  IT+ N LN   EF W P      G AFSIRP  G+V+A   LDCEVV+HPSF+AP +G F L + G                  PT+         ++C   +G  +V F  RRVMFG  PIN+++ R+A L NTG  HAY++++  +    +PG+ + PL G +PVGG AEL ++  P A+ KFD  + + I+G K L+L+M G +  P V+I      FGGV  GS  +L   L NK+  +  +E D  + KDF++   G Q  +D +    N     +T+ P +  + ++IFTP+EVA+Y+F + V +NQI       G    A +             I+     I+      +  A   ++V ATA RQP+ LS+N  +F   S  E  +       SK  ++ N  +  ++  L   SA  K   +   +K +  S  +PF         P     +  +   G+   I I F P  P  +   + + IN++ E+ +Q + +   ++SP+L   P  +   P PL TEVS +F +LA  +   + I +  P +     S    P   V    +E+ P   +    E   +   L F S  P+   SF E + +         + + AT+DNC LT  +F  +H++++ IVC++G   +G   +     +  GEA +      T N           SR ST+ TSSNF+ SS +YE + S T+S   STP V REGA+NK     ++  S     +Q++    RS  S                  M+P++ +                        +  +VLL +QRW++  GW     PI++P S RS + ++   +    K+  + + +  N  LK + + +YDM+ +L GR IPGI     LP+ PIER   +Y QH+TL+ F++ QG  +A IKPE+LM+  +Y LW  +           G         +  + + + FE +SK+AWT +LLQILK  +L KVT  S ++ +      E +P +      SN Y + ERI+L WLN+ YE YR   W   S          P SRWI+N+D D +D L+LA  +GA++PF+I+ H + MY +P   EQCLHNALK+V+A++  G+++DIQAIDI DPNP+ ++L  +NL+  LP YIPK+ I F+GSLH  +T+Q+++SNP+ K L Y+ +I G+D  DF +PKG  V++S ++ +   + F SRF+R AE T++ VGR+ G S+ T L F+++T+I +I P    K    CY ++KI + + +P+N++G+F + L+E+    L+  K           S +KP   +K  + A                    + T+K       + AF+S   +V+++   S ++E+++LPF++G ++ ++IF N+SIGEF++SVEA+A LP P ++ P    P S V +S A AA   RGL  G+++ +YWKCE G  +QE L +P+ N  KE AL  AAQ H+SS E+ RRQ+TGTL +SS+    +++LT         N  + I + A +  S  G                   F VE DS F++ P  + +  P     + +  ++       +++PIKF A   G YPC ++++G DDVR+++IECTV PEG+ +++ FK P+ + ++Q IP+VN T  DWPLKATI G+   F GP  ++ KA + + YPL FKP  E +V  KL L N  DG+EH++ L+G  E PLAL+ +  +C   ++    L+IPN+T++K  + VESDL ++  G+ ++++L G+   Y++++ P R G Y GI+AF++GK  VIE DS           E  +  ++    YRIWYSL VHV P  P+ I  V C C +K V+E+ + NP+ +  +  +A I G NL+G S I++++   + Y +T+ P+ IG   G LIF+ + VGEFWY L L A+ P +  +  ++C+LG+W    I L+N  +E+ L + P +SN   FS       L   +++   + PR+   + + F P  +G G HL  ++  S+ LG+  FI +G G+ P P D + V +EAGSN T +IPF NP+   V++DI +  +  + LD  R+   N +   K  + S F LLLK+   +++  K +++IP+ FAP EM KYDA+C VV+++++G   +    D +   L    SD +     +++RW++PI G+PE+  + +     +++   R   +E LE  L G+ P  +  +   +T+SV  K     I DG  +       ++F  EL     E  +      L   V + L++Q +   +G+ +L Y I   P K    N E+++ + TGG+WRFP++FVA +   DD ITIEA GLN+  S  F L S   + + + +YF  G DP+F VSP+SG L P  +      +G    ++++P  Y +   A+L+++T  M+W Y   G+ PQY  P    T+ +   + D  +          + N++++NI +L+TAVSSP+KGA ++P+
Sbjct:    4 DKCGVRITPSVLEFYDAEVNTVHQLNVTVKNTSKTSKSIRYYGPKSKYFQLKVRNPNKPVAPGLCVPAVIEFEIKEEKEVTDRLVVTVDGDVIEIPLVAYPPQPLLEIEQVVNFGNLVANSKTVSHEISLVNHGSKAGDFKIKYNGDKPIAIMPSSGSVPPKSVQMIKVEYVTKQAGTFEEVAKVKLEGKETKNLVITGQLVDRTLEVLAVNT--RQPIECVRFGSTYYGSDKTECALLFNNGPEPINFVAVLDEDAVAQEMGVDLTKSTVDALADQGSDSAEKPQGRTNVLTSLITAIPNQGTLQPYEKIPVFFRFSPRWNASKEGWKGQKKPPPRKDFALFMRIQIVGSSTGFSAKSPTKYAD----GSFVEVALTGTALPVLLSVMPSLKYDFGECPIGEHADVLCTIKNESTDLATTFQFRRVAHFSTHPPSGKIPPNQSQDVIFSFSPKQIGGFKTTQMLDVIGQVADNQNPTVVNLQVISSFPLTFLGSSDPIFKKKQPKYNPGITPYISNEVGMFVDTTFSQLDENPRN----------AVAGGLKPGLHSLK----NIDPL-DKDARVSFPNDRATSIRPSERGETYKTIFTKTKRHNYVDPDYALNLSEEANKV-NHRNSYVGMLRQMRQNRLNQIK--SREFKDTNNKLDIGIKTAAGLRPKRLTQMEIIPDPRSPTPPNADFKLLSTKELSTAEAETLTKEACEGLNAVPTTKKEKLDCSKCLSPQQLHQIIIGPPTLDFGQVCLRSVCTKNLAIINNLDTNIHIVAEIDCRELRQSSPLSQVVPPKSKAHLPIVYESNTKGKFQRSVSYTVNGHYKHHVTVVAEVVPVALDLSTEELILTPAFGLPAEAEFRGVITLYNNLNYPAEFTWAPNLGD-RGTAFSIRPATGIVDAHKDLDCEVVWHPSFLAPEDGSFSLMVHGG-----------------PTLQ--------LQCKVEMGTPNVQFMERRVMFGQTPINLTTVRSALLANTGQHHAYFQVIDSN---PFPGLMVTPLHGVVPVGGHAELKVQLTPSAILKFDTKVQVAIKGGKVLELRMGGTVEPPTVDIDMDSFNFGGVYCGSGATLPFKLANKAITKVKLELDLTRYKDFSLNFSGYQTQDDYSYQMLNPGMFTVTMAPEETIEGEIIFTPSEVAAYDFIMPVIINQI-------GAPSPAPTPFPPTPAPSNKNSIQ----HIINPRPQPLSIATPRKHVIATALRQPLQLSSNKIEFALPSTFEDPTASTGLGVSKGTVLVNNSDKPLKWLLDL-SAPVK-ALQDGIIKFIHPSG-VPFVVM-----DPQESKGVEGILEPGQTQHIAILFCPTEPCRHELVIPILINDS-EKPYQYLQVIAEMKSPKLWFDPLAIVMTPVPLMTEVSTEFTVLAGQYSKPSQISVITPTVECEDGS-TISPISVVWPEGSEVSPCCGDDGQIEPCALPCKLIFSSPKPV---SFAEPILFVDSDDRKFKLMVMATSDNCLLTCYHFLALHRTDHQIVCEQGASPKGRKFLTKESLSG-GEAVIVPCVSPTHN-----------SRPSTSATSSNFQISSSSYESSGSVTDSTDGSTP-VNREGAMNKPPSGSEHAMSRN---QQDL--ASRSLGSA-----------------MFPDEDSEEGI--------------------FHLEVLLAVQRWYSSQGWPSGQFPISIPHSLRSGISRK-PINDDMPKQAKAGSWDTNN--LKKEFKTIYDMMCHLAGRPIPGIPINSPLPSDPIERVKQVYWQHSTLLTFLKCQGACVASIKPEYLMEPRDYHLWKQMQKQLKLELMTQGEEEEAKRMDEEEELEGDVFEAVSKRAWTDILLQILKCVVLSKVTPRSLKNLVSPDKNVE-MPIVNPDPLSSNIYCVGERIILTWLNHHYEHYRTRIWSNCSK------GGVPPSRWIVNYDFDLLDGLVLAAVLGAHMPFLIKTHLQDMYTHPATAEQCLHNALKVVNAMRYAGIDYDIQAIDITDPNPIALLLLCVNLYQRLPQYIPKATIDFSGSLHASVTRQVKLSNPSGKTLVYQVLIAGHDARDFGVPKGEFVSISPRSILYLNVDFTSRFLRPAEATLILVGRRHGSSVGTTLTFNLRTQIDNITPKYTIKCEAPCYELEKIPINVRNPFNEAGDFRIVLVEAQSSLLEPGK---------TASLLKPKDKRKRKVRARIDHGQKRPETPPTPPPKLPEETDKSNDDQVSMSAFYSPNSSVYLDAKGSSTVEIYFLPFNIGERQVSVIFLNESIGEFLYSVEATATLPLPAVV-PFVKTPHS-VRISSAAAAGTGRGLFGGDDRVVYWKCESGQTLQENLKVPVLNKTKEKALLMAAQQHMSSMELQRRQITGTLKTSSVTAKTISLLTN--------NVAQSISRTAKSVSSETGVLETNNSENMPSKSPYEAEFTVEVDSEFFSVPNKLTMKPPSSSRSHSAPVSDYQGREPFMELPIKFKAKEPGHYPCEIILRGSDDVRVYKIECTVNPEGSTAELQFKTPVHQSVSQEIPVVNMTNHDWPLKATIEGS--GFYGPPTVLVKAYNPTTYPLVFKPQNEVEVKGKLVLTNTEDGTEHIYHLHGRPEKPLALDHVVIKCDAKKSTAHILKIPNVTKRKMCYRVESDLPFL-SGNTSLTVLQGKTGVYNMSLTPSRRGIYKGIVAFIAGKNPVIEVDS-----DGDEIPEDEDEESRKYYGYRIWYSLEVHVKPPPPERIMSVVCACQKKAVIEVIVRNPTPNY-ITIQAQIEGRNLSGPSSISLDAGEKDVYSVTYAPAIIGKQRGSLIFYQESVGEFWYDLRLQAEPPPQTTLLHMECDLGRWTKQTILLENPTDES-LELIPTMSNTNNFS-------LERDNERPIVLRPRSSIQVPIHFMPSTLGQGDHLTKVIFNSEQLGEWVFIASGTGLLPLPQDPVSVFTEAGSNTTLIIPFRNPMDHAVMVDI-LLRDTNAELD--RLTYENSNPSNKTADDSAFCLLLKHRNMIRVGPKSTLDIPVCFAPTEMMKYDALCTVVVRKEDGGKWQYAPRDSEGYQLSTTGSDGL-----QEIRWVYPISGIPESKPAKDT-QGAVIECKARDRVEERLEVTLAGVAPASSGPQRSILTRSVTPKDQKPKIADGVVIGETLATAEEFVHELGFTDNEAQE-----NLQNSVAVTLVRQQRDTSSGLVILVYNIVYAPFKPMSHNVELVVKAATGGLWRFPLKFVAAEPPSDDTITIEATGLNQESSVGFRLTSQAKHPVIYNSYFAAGSDPEFLVSPQSGELLPQGT------NGTLLKISFKPAVYGKLYQAKLIVQTPDMQWSYNVKGVLPQYNPPRGISTQPMAGPHPDPRL-------RMERVNYIRENIRLLTTAVSSPIKGANVVPR 3235          
BLAST of cilia- and flagella-associated protein 47 vs. TrEMBL
Match: gnl|BL_ORD_ID|23919570 (tr|K1P8P3|K1P8P3_CRAGI Uncharacterized protein CXorf22 OS=Crassostrea gigas OX=29159 GN=CGI_10006978 PE=4 SV=1)

HSP 1 Score: 1827.37 bits (4732), Expect = 0.000e+0
Identity = 1178/3422 (34.42%), Postives = 1848/3422 (54.00%), Query Frame = 2
Query:   17 DIFGVRITPNVINFRNCEINGSYIRVVNVQNIGNKNVTVRFYSPQSKDFSMICKMHEKIISSGLSHLCSLKY-TMEVEERSVDRLIVTVDGQVHEIPIFIYPSAPDLQIDRIINFGTVVMANKVVTQQANITNEGLKIGEFKLLYSGSRPLNIVPNEGIVYQQSSIPIQIEYVTHEAHKINEKCLVIFEGQDPFEIDIKGDVVKRSLELLDINSDERKLIQCIKFPYTYYGSDKSEVSLLFNNSPEKIQFVAVLEEDAVGQESGSHITMTA---------AGINPKECTNPLTSLITMYPNQGNLGPYERIPVLFRFSPRWISPKQAFKKTLEPPLQQTFAVFIKIQI---XXXXXXXXXXXXXXKDDTLTRSQKLEVAITGTAAPVLIEMKPN-SIDFGECLENEEKTEKLLFYNRSSILSSLIDFPREAHFLISPNQIRVGPNEQVEISVTFCPKQYGNFNTKQVVKVLSYVKDEENPFLEYEQTIYEQILQLTGSCVAISKSVAPKYCNGLDPLVTNKVGYLAEANFSNLGFKPHNGPATAYITTDAFATGGPQGSRLFKCTDANLHPYSNRTAFVAFPNDRAESIRPSEQNKEFRTILKRIKRYNYIDPDYAYDDEEMRKIRHHQDSYQTMIR--RQHSLKKIVKLNSKFKAFENDINLGIIPGNGLYPPKLTTDQINTDKIEVFKDNKNFKLLSTKDLKQSEKVINITKLGT-FNAIPTTAQEKEHCSVVLTPQQLHQIIIGPNTINFGDVCVRSISNRDINVVNNLNQFIHVSVVIDCKELRQSSPLSQVIPAKTKSSFPLVFESTKKGKFQRNLSYTINGYYQNHVIVLANVVVNQXXXXXXXXXXXXXXIYPPETGIRNTITMTNPLNCATEFLWEPVFNSTNGIAFSIRPKEGVVEAFSKLDCEVVFHPSFMAPSEGDFILRIPGNEEGSVETSSQDTLNTDTPTISNGDKSNITMKCIAILGNIHVAFQSRRVMFGNIPINMSSSRTATLLNTGGKHAYYRIVPDDLYEEYPGMTIHPLKGSIPVGGQAELTIKYHPVALSKFDCSIPIVIRGWKELDLKMSGNIIIPQVEILQKRLEFGGVPVGSEKSLDLTLINKSQCRANIEFDFIKQKDFTI-LTVGQCGNDKALSKDNYKCL-ITLKPLQEFQCQLIFTPNEVASYEFPLSVKVNQIEIMVQGAGRGQTAXXXXXXXXXXXXPVRIETVSSSIVTSDRNSILAANLIRNVSATATRQPINLSNNSFKFHFFSISEAKSHS------KQLIVFNTLEAEVEICLKFNSANWKYGTEKTTLKNLSKSRLIPFKFSCESEPIPNNDDYLICLSSLGEAIKIDIKFEPDHPGHYNGEVFVFINNNFEQIFQRILLTGLLESPELMCYPEHLTFIPSPLKTEVSLDFKLLAINFETKTFIRINLPLL-TKPGT---------SEEYQPFQFVLSTSNEIQPISENSRVTEIRGTLSFCSDVPINVRSFMEVLTYSGVSKSISLSATADNCQLTWQNFFNIHQSEYHIVCDEGKHLEGTDGIHGHRFADFGEAQLKSYNKDTANINVNMDGQSVHSRNSTTITSSNFXXXXXXXXXXXXXXXXXXXXXPIVLREGALNKIGEKVKYKSSTTPLLKQNVKPVERSNDSTLEINSSIMSDKNYVTMYMYPNQITFANXXXXXXXXXXXLNKDFDFPWDYDADVLLIIQRWFTMHGWAGNLHPINVPVSFRSSLQKRFGFSQTSTKEKISNTENIENTGLKNDSRDLYDMILYLTGRQIPGINTTVVLPTHPIERSCHIYIQHATLIAFIENQGGQLAQIKPEHLMDLPEYELWHSV-----------GCPGLPNSDMKPVQYDSNSFEKISKKAWTVVLLQILKVFILIKVTYSSYRHALQILHGKEPIPEIQLAATVSNCYSLNERILLAWLNYLYEAYRHVCWPGNSNPDIGTTSSTPVSRWIINFDNDFMDSLILATAIGAYIPFMIERHFKYMYPNPQNPEQCLHNALKIVSALKDIGLEFDIQAIDIVDPNPVMMIXXXXXXXXXXXXYIPKSEIVFTGSLHEQITKQIQISNPTSKPLSYECIIIGNDNCDFALPKGNVVNLSGKASIKWPIVFKSRFIRSAEVTVMFVGRKTGFSIPTNLIFSVKTKIMSINPSKVEKIVGKCYIMKKINLKIISPYNKSGNFSVKLIESSEGNLKSIKETSNEFKQTET------SFIKPAIAKKATLDAIKTTNK------------LRAFFSHCETVFINENKSGSLELFYLPFHLGIKRCTIIFSNDSIGEFVHSVEASAELPEPIIITPNDDKPKSGVWVSRAEAAN--RGL-EGNEKTIYWKCEVGSFIQETLSIPINNIYKEYALHTAAQLHLSSQEVSRRQXXXXXXXXXXXXXXXXXXXXXXDDHDFVNSNKQIKKKADTKYSNKGKFINFEVESDSSFYTTPLIVQIPDPLMHLGNDSTKNNAIQTPSTIDIPIKFHASTAGVYPCNLVIKGPDDVRLFRIECTVTPEGNLSQIYFKIPLQEVLAQNIPIVNKTKQDWPLKATITGTSAAFSGPDFIMAKALSVSQYPLQFKPVKEGKVNAKLTLFNEADGSEHVFELYGEGESPLALESLYFECTVGENITKTLQIPNLTRKKHFFTVESDLDWMIVGDDTISILPGRNCSYDIAINPKRSGKYTGILAFVSGKKTVIEYDSDGDEIVDVYNDETVNSANKSCEIYRIWYSLVVHVSPGAPQGIFDVKCNCLEKVVLEIPINNPSEDMELKFEAAISGANLTGNSEITVNSLSTESYLLTFTPSFIGNFDGRLIFFNDIVGEFWYKLNLTADSPIEKFIPPVKCELGKWCLVEIPLKNIDNENKLVMYPEISNPECFSILIGDLELFDQDKQCFSIAPRTEHVLSVRFTPCEIGSGTHLCFLVMKSKLLGDQKFILTGCGMPPNPSDIIGVSSEAGSNMTFLIPFHNPLLEPVLIDIRITEEHQSVLDKYRIGSVNLDKDFKEMET--SVFXXXXXXXXXXXXESKQSIEIPISFAPQEMRKYDAICCVVMKRKNG---EPLISDEDFNDLILPNSDNITPFDKKQLRWLFPIKGVPETLVSLNVFTTPLVQGPLRIETKEHLEFNLWGLPPPVT--REDFVTKSV--KSAPATINDGNELKPIDRFLQDFTTELRVITVENGDAMDTATLNEYVHLFLMKQSKQLDTGVTVLTYEIRMRPLKKFRLNSEIIITSLTGGVWRFPIRFVAHDCDPDDEITIEAIGLNKPVSTRFYLNSTTYNELPFKAYFLKGGDPDFTVSPESGILPPIQSFSKFQISGLEFVVTWQPKTYSRSKGARLVIETEMMEWVYKFVGISPQYVVPDTRS---IIQSNWDSDMXXXXXXXXXXXXXFLKQNIEMLSTAVSSPVKGAPLLPK 10045
            D+ GVRI+P V+ F + E N  +   V V NI   + ++RFY P++K F +  K   K I+ GL     +++ T+E +E   DRL+VT+DG V EIP+  YP  P L+I+  I FG +V  +K ++++ ++ N G K GEFKL YSG +P+ I+P+ G V  +S   I++EYVT EA KI+E   V  EGQD   + ++G +V R++E+L + ++E+  + C++F   YYGSDK+E ++LFNN PE + FVAVL+EDA+ QE G  +T +           G   +  TN +TSLIT  PNQG L P+E+IPV FRFSPRW + K+ +K  + PP ++ FA+F++IQI           S S  +KD ++     +EVA+TGTA PVL+ + P+   +FGEC   E         N S++L ++  F + AHFL  P   ++ P +  ++  +F P Q G F  KQ++ V+ +V D +NP + + Q I+   +   GS   I      ++  GL P ++N+VG  A+   S L   P N            A  G   +++ +       P     A VAFPNDRA+SIRP  ++ +++TI  +  R+ Y DPDY   +EE +    H+DSY  M+R  RQ  + +I   + +FK   N +++GI    GL P  L   +I  D       N +F+LLS+K+L ++EK  +   +    NA+PTT  EK  CS  L+PQQLHQ++IGP T++F  VC+RS+  R+++++NNL+Q+IH+   IDC+ELRQSSPLSQV+P K+K++ P+VFES  KG FQR++SYT+NG+Y++HV V+A VV   LELST+ L+L  S   P E G+R  IT+ N LN   EF W P      G AFSIRP  G V+A+  LDCEVV+HPS++AP +G F L I G                  PT+         ++C A LGN  V F  RRVMFG  PIN++++RTA L NTG  HAY++++  +    +PG+ + P+ G +PVGG AEL ++  P A+ KFD  I + I+G K L+L+M GN+  P V+I     +F GV  GS  ++   L N++  ++ +EFD  + +DFT+     Q  +D +    N     +T+ P +  + +LIF P EV  Y                                                  D  +   A   ++V ATA RQP+ LSNN  +F   S  E  + S      K  I+ N  +  ++     +    K  T    +   +    +PF      E        +      G+  +I + F P  PG +   + ++IN++ ++ +Q + + G ++SP +   P  +   P PL TEV  +F +LA  +   + I + +P + ++ G+         SE     +       +I+P + + R+        F S  P++    +  +  SG    + ++ATADNC LT   F  +H+++Y IVC++G   +G   +      + GEA           + +        SR ST+ TSSNF+ SS +YE +AS T+S   STP+  REGA+NK     ++  S     +  +    RS  S                  M+P++ T                        +  +VLL +QRWF+  GW G   PI +P S R  + ++     T    K +   + +   LK + + +YDMI  L+GR +PGI     LP+ PIER   IY QHATL+ F+  QG  +A +KPE+L++  +Y LW  +           G     N   +  + + + FE +SK++WT VLLQ+LK  IL KVT  S ++        + +P I      SN YS+ ERI+L+WLN+ YE YR   W G S          P SRWI+N+D D +D L++   +GA++PF+I+ H + MY +P   EQCLHNALKIV+A++ +G+++DIQAIDI DPNP+ +++  ++L+  +P ++PK+ + F+G LH  + +Q+++SNP+ KPL Y+ ++ G+D  DF +PKG+ V +  K+++   + F SRF+R AE  ++ VGR+ G ++ + L F+++T+I +I P  V K    CY +++I LK+ +P+++ G F V L+E+S  +L    + +N  K  E       + +   I +  T        +            + AF+S   ++++  + S ++E+ +LPF++G ++C+IIF N++IGEF++S+EA+A LP P  + P    P S V ++ A AA   RGL  G+++ +YWKCE G  ++E++ +PI N  KE AL  AAQ  +S +E+ RR VTGT+N+ S+    V +L+          S  Q K K+   Y+       ++V+ DS FY  P  + +P PL    +    NN     S +++PI+F A   G YPC + +  PDDVR++++ECTV PEG+ +++ FK P+ + + Q IPI N T  DWPL+A I G    F GP  ++AKA + ++YPL FKP  E  V  KL L N  DG++HVF L G+ + PLAL+ +   C   + +   L +PN+T+KK  + VESD  + + G++++++LPG+  +Y + I P R G Y G++AF++ K  V+E DS           +  +  ++    YR+WYSL +HV P  P+ I  V+C C +K VLE+ + NP+ + ++  E  I G +L G   IT+ +   + Y LT+ P+ +G   G LIF++  VGEFWY L L AD P    +P ++C+LG+W    I L N  +E  L + P ISN   FS       L   +++   + P +E  + + F P  +G G HL  ++  S+ LG+  F+ +G G+ P P + + V +EAGSN T +IPF NP+   VL+D+ + +            S+ +++      T  + F LLLK N  +++  K +++IP+ FAP EM KY+A+C V++++++G   +    D +   L +  ++ I     K++RWL+PI+G+PE+   +      +V+   R   +E LE  L G+ P  +   +  +T+S+  K +   I+DG  +        +F  EL       GD      L   V L L++  ++  +G+ VL + +   P K    N E+++ + TGG+WRFP++FVA +   DD ITIEA GLNK  S  F L S + + + + AYF  G DP+FTV+P++G L P  +      +G    + ++P  Y +   A+LVI+T  M+W Y   G+ P Y  P  +S   I   + D  M          K N++++N+ + +TAVSSP+KGAPLL +
Sbjct:    4 DVSGVRISPPVVEFYDTEPNNVHQLNVTVSNISKTSKSIRFYGPKTKYFQLRVKNPNKPIAPGLCVPAVVEFETIEPKEIK-DRLVVTIDGDVIEIPLIAYPCQPVLEIEEEIYFGNLVANSKTISKEISLFNHGSKSGEFKLKYSGDKPIAIMPSSGSVPPKSVQLIKVEYVTKEAGKIDELIKVKLEGQDTKSLHVRGVLVDRAIEVLSLETEEQ--LGCVQFGEAYYGSDKTECAILFNNGPEPVNFVAVLDEDAIAQEMGVDLTRSTDVALADEMTGGERAQGSTNVITSLITAIPNQGVLKPFEKIPVFFRFSPRWNASKEGWKSQVAPPPRKDFALFMRIQIIGSSNLSDSKRSGSMNTKDGSM-----VEVAMTGTALPVLLSISPSYKFNFGECPVGEHADVLCTIKNESNVLPAIFQFRKIAHFLTHPPNGKIPPGQSQDVIFSFSPNQIGTFKPKQLLDVIGHVADNQNPTISHLQVIHTYPILFCGSSDPIPVDRKARFNPGLTPYISNEVGMFADTKMSKLNGSPRN------------AVAGGHKTQMHRVGYYEEDP----EAKVAFPNDRAQSIRP--EHDKYKTIFTKSDRHVYRDPDYMLTEEEGQIKHSHRDSYVMMLREMRQKRMNRIK--SREFKVTNNSVDIGIKSAAGLRPKMLKQQEIQPDPETPRPPNADFRLLSSKELSEAEKETSAKPVCEGLNALPTTKVEKADCSKWLSPQQLHQVVIGPATLDFDKVCLRSVVTRNLSIINNLDQYIHIVAEIDCRELRQSSPLSQVVPPKSKANLPIVFESNVKGNFQRSVSYTVNGFYKHHVTVVAEVVAVSLELSTEELVLYPSYGMPAEAGLRGVITLKNILNYPAEFTWAPNLGE-KGTAFSIRPATGTVDAYKDLDCEVVWHPSYLAPEDGSFSLMIHGG-----------------PTLQ--------LQCRAELGNTSVQFVERRVMFGQTPINITTTRTALLANTGQTHAYFQVLDPN---PFPGLAVSPIHGVVPVGGHAELKVQLTPSAILKFDTKIQVAIKGGKTLELRMGGNVEPPTVDIDVATFDFNGVYCGSGSTITFKLRNQAVTKSKLEFDLTRFRDFTLNFPSYQTQDDYSYQLLNPGMFTVTMAPEETIEGELIFMPTEVTEY-------------------------------------------------CDFTTPQVATPRKHVIATALRQPLQLSNNKIEFSLPSTFEDPTASTGMGVTKGTILVNNSDKPLKWMFNLSE---KCETLDEGIFKFTHPSGVPFVVMSGEE-----SKGIEGTLEPGKTQQISVIFCPKKPGKHECVIPIYINDDTQKPYQYLQVVGEMKSPRIWFDPLAIVMTPVPLLTEVCTEFTVLASQYTKASNITVEVPEVESEDGSIITPLTVSWSEGSSVIKPCNGDDGQIEPCALSCRIV-------FSSPKPVSFCQPVNFIDDSGTIFKLMVTATADNCLLTCYPFLALHRTDYQIVCEQGASPKGRKVVMAKDNQNGGEA-----------VFIPCASPQHTSRPSTSATSSNFQISSSSYESSASVTDSTDESTPLN-REGAMNKPPSGSEHNVS-----RGQMDLASRSLGSA-----------------MFPDEDTEEGI--------------------FHMEVLLAVQRWFSSQGWPGGQFPIIIPHSLRCGISRK---PITDDSPKAAKAGSWDTNNLKKEFKTIYDMISNLSGRPVPGIPINSPLPSDPIERVKQIYWQHATLLTFLRCQGACVASVKPEYLLEPRDYHLWKQMQKQLKLELAKQGEVNQANKMEEEEELEEDVFEAVSKRSWTDVLLQLLKTLILAKVTPRSLKNTPSPDKNID-LPSINQDPLSSNIYSVGERIILSWLNHHYETYRERIWTGCSK------GGVPPSRWIVNYDFDLLDGLVIGAVLGAHMPFLIKTHLQDMYTHPSTAEQCLHNALKIVNAMRYVGVDYDIQAIDITDPNPIALLMLCVHLYQKIPQFLPKATVEFSGRLHTTVCRQVKLSNPSGKPLQYQVLVAGHDARDFCVPKGDQVTIPPKSTLHLNVEFTSRFLRPAEAILVLVGRRHGSAVGSTLTFNLRTQIDNITPKHVIKTESPCYELERIPLKVTNPFDEGGEFRVVLVEAS-ADLLDPNKPANLMKPKEKRRRKIRARVDHGIKRPETPPTPPPPRQEDSFFKKDEPPLMSAFYSPVASLYLEAHDSANIEIHFLPFNIGERQCSIIFLNETIGEFLYSIEANATLPLPSEV-PFVRTPHS-VRITSAAAAGTGRGLFGGDDRVVYWKCESGQTLKESIHVPITNKAKERALLMAAQQRMSDKELHRRLVTGTINTCSVTAKTVTMLSTNAQ-----KSITQAKTKSPQGYT-------YKVKWDSEFYKLPEKIVVPPPLQRSSSAPVSNNGKD--SCVELPIQFTAKDPGHYPCQIELCAPDDVRVYKVECTVNPEGSTAELEFKAPVHQSVTQEIPIANMTNHDWPLRAAIQG--PGFFGPPMVLAKAYNTTKYPLVFKPQNETIVQGKLVLSNTEDGTDHVFHLCGKPQKPLALDHVVIRCEAKKGVQHILSVPNVTKKKLCYKVESDFSF-VSGNNSLTVLPGQTGTYGMDITPSRRGVYKGLIAFIASKNPVVEVDS-----DGDEIPDEEDEESRKYYGYRVWYSLEIHVKPSPPERIMAVECCCQKKAVLEVIVRNPTPE-DITLEVTIEGRDLRGKDSITLKAGEKDVYTLTYAPAVVGKHRGSLIFYHKSVGEFWYDLRLKADPPPPTTLPHMECDLGRWTKQIIVLSNPTDE-LLELTPTISNSNNFS-------LERDNERPLVLRPHSEIEVPIHFMPSTLGQGDHLAKVIFHSEQLGEWVFVASGTGLLPQPQEPVSVYTEAGSNTTMIIPFRNPMDHAVLVDVSLKDT-----------SIAMEQILNSYPTPDAAFCLLLKQNSTIRVGPKSTLDIPVCFAPTEMTKYEALCSVIVRKEDGSRWQYAPKDSEGYQLSVTGNEGI-----KEIRWLYPIQGIPESK-PIKDSQGAVVECKARDRLEERLEVTLSGVAPSSSGPHKSVLTRSITPKGSSTNISDGIVVGETLATASEFEYELNF-----GDRDSQENLQNSVALTLIRARREEVSGLVVLVFNVVFAPFKAMSHNVELVVRAATGGLWRFPVKFVAAEPPVDDTITIEATGLNKESSVGFRLTSQSKHPVMYNAYFGAGSDPEFTVTPQTGELLPQGT------NGTLLAIKFKPALYGKIYMAKLVIQTPDMQWSYDVKGVLPHYSPPRGKSAQPIAGPHPDPRM-------RGDKMNYIRENLRLTTTAVSSPIKGAPLLTR 3171          
BLAST of cilia- and flagella-associated protein 47 vs. TrEMBL
Match: gnl|BL_ORD_ID|18340373 (tr|A0A267DP68|A0A267DP68_9PLAT Calponin-homology (CH) domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004670g3 PE=4 SV=1)

HSP 1 Score: 1766.13 bits (4573), Expect = 0.000e+0
Identity = 1046/2993 (34.95%), Postives = 1624/2993 (54.26%), Query Frame = 2
Query:   11 SIDIFGVRITPNVINFRNCEINGSYIRVVNVQNIGNKNVTVRFYSPQSKDFSMICKMHEKIISSGLSHLCSLKYTMEVEERSVDRLIVTVDGQVHEIPIFIYPSAPDLQIDRIINFGTVVMANKVVTQQANITNEGLKIGEFKLLYSGSRPLNIVPNEGIVYQQSSIPIQIEYVTHEAHKINEKCLVIFEGQ-DPFEIDIKGDVVKRSLELLDINSDERKLIQCIKFPYTYYGSDKSEVSLLFNNSPEKIQFVAVLEEDAVGQESGSHITMTAAGINPKECTNPLTSLITMYPNQGNLGPYERIPVLFRFSPRWISPKQAFKKTLEPPLQQTFAVFIKIQIXXXXXXXXXXXXXXKDDTLTRSQKLEVAITGTAAPVLIEMKPN-SIDFGECLENEEKTEKLLFYNRSSI-LSSLIDFPREAHFLISPNQIRVGPNEQVEISVTFCPKQYGNFNTKQVVKVLSYVKDE-ENPFLEYEQTIYEQILQLTGSCVAISKSVAPKYCNGLDPLVTNKVGYLAEANFSNLGFKPHNGPATAYITTDAFATGGPQGSRLFKCTDANLHPYS-------------NRTAFVAFPNDRAESIRPSEQNKEFRTILKRIKRYNYIDPDYAYDDEEMRKIRHHQDSYQTMIRRQHSLKKIVKLNSKFKAFENDINLGIIPGNGLYPPKLTTDQINTDKIEVFKDNKNFKLLSTKDLKQ-SEKVINITKLGTFNAIPTTAQEKEHCSVVLTPQQLHQIIIGPNTINFGDVCVRSISNRDINVVNNLNQFIHVSVVIDCKELRQSSPLSQVIPAKTKSSFPLVFESTKKGKFQRNLSYTINGYYQNHVIVLANVVVNQXXXXXXXXXXXXXXIYPPETGIRNTITMTNPLNCATEFLWEPVFNSTNGIAFSIRPKEGVVEAFSKLDCEVVFHPSFMAPSEGDFILRIPGNEEGSVETSSQDTLNTDTPTISNGDKSNITMKCIAILGNIHVAFQSRRVMFGNIPINMSSSRTATLLNTGGKHAYYRIVPDDLYEEYPGMTIHPLKGSIPVGGQAELTIKYHPVALSKFDCSIPIVIRGWKELDLKMSGNIIIPQVEILQKRLEFGGVPVGSEKSLDLTLINKSQCRANIEFDFIKQKDFTILTVGQCGNDKALSKDNYKCLITLKPLQEFQCQLIFTPNEVASYEFPLSVKVNQIEIMVQGAGRGQTAXXXXXXXXXXXXPVRIETVSSSIVTSDRNSILAANLIRN-VSATATRQPINLSNNSFKFHFF--------------------SISEAKSHSKQLIVFNTLEAEVEICLKFNSANWKYGTEKTTLKNLSKSRLIPFKFSCESEPIPNNDDYLICLSSLGEAIKIDIKFEPDHPGHYNGEVFVFINNNFEQIFQRILLTGLLESPELMCYPEHLTFIPSPLKTEVSLDFKLLAINFETKTFIRINLPLL-TKPGTSEEYQPFQFVLSTSNEIQPISEN------------SRVTEIRGTLSFCSDVPINVRSFMEVLTYSGVSKSISLSATADNCQLTWQNFFNIHQSEYHIVCDEGKHLEGTDGIHGHRFADFGEAQLKSYNKDTANINVNMDGQSVHSRNSTTITSSNFXXXXXXXXXXXXXXXXXXXXXPIVLREGALNKIGEKVKYKSSTTPLLKQNVKPVERS---NDSTLEINSSIMSDKNYVTMYMYPNQITFANXXXXXXXXXXXLNKDFDFPWDYDADVLLIIQRWFTMHGWAGNLHPINVPVSFRSSLQKRFGFSQ---TSTKEKISNTEN-----------------IENTGLKNDSRDLYDMILYLTGRQIPGINTTVVLPTHPIERSCHIYIQHATLIAFIENQGGQLAQIKPEHLMDLPEYELWHSVGC------------------------PGLPNSDMKPVQYDSNSFEKISKKAWTVVLLQILKVFILIKVTYSSYRHALQILHGKEPIPEIQLAATVSNCYSLNERILLAWLNYLYEAYRHVCWPGNSNPDIGTTSSTPVSRWIINFDNDFMDSLILATAIGAYIPFMIERHFKYMYPNPQNPEQCLHNALKIVSALKDIGLEFDIQAIDIVDPNPVMMIXXXXXXXXXXXXYIPKSEIVFTGSLHEQITKQIQISNPTSKPLSYECIIIGNDNCDFALPKGNVVNLSGKASIKWPIVFKSRFIRSAEVTVMFVGRKTGFSIPTNLIFSVKTKIMSINPSKVEKIVGKCYIMKKINLKIISPYNKSGNFSVKLIESSEGNL--------------KSIKETSNEFKQTETSFIKP-AIAKKATLDAIKTTNKLRAFFSHCETVFINENKSGSLELFYLPFHLGIKRCTIIFSNDSIGEFVHSVEASAELPEPIII-------TPNDDKPKSGVWVSRAEAANRGLEG---NEKTIYWKCEVGSFIQETLSIPINNIYKEYALHTAAQLHLSSQEVSRRQXX-XXXXXXXXXXXXXXXXXXXXDDHDFVNSNKQIKKKADTKYSNKGKFINFEVESDSSFYTTPLIVQIPDPLMHLGNDSTKNNAIQTP--STIDIPIKFHASTAGVYPCNLVIKGPDDVRLFRIECTVTPEGNLSQIYFKIPLQEVLAQNIPIVNKTKQDWPLKATITGTSAAFSGPDFIMAKALSVSQYPLQFKPVKEGKVNAKLTLFNEADGSEHVFELYGEGESPLALESLYFECTVGENITKTLQIPNLTRKKHFFTVESDLDWMIVGDDTISILPGRNCSYDIAINPKRSGKYTGILAFVSGKKTVIEYDSDGDEIVDVYNDETVNSANKSCEIYRIWYSLVVHVSPGAPQGIFDVKCNCLEKVVLEIPINNPSEDMELKFEAAISGANLTGNSEITVNSLSTESYLLTFTPSFIGNFDGRLIFFNDIVGEFWYKLNLTADSPIEKFIPPVKCELGKWCLVEIPLKNIDNENKLVMYPEISNPECFSILIGDLELFDQDKQCFSIAPRTEHVLSVRFTPCEIGSGTHLCFLVMKS 8608
            ++DI G+RI P +I F +C++  S    V+V+NI  K  T+RFY+PQ+K F++  K HEK ++SGL H+  ++YT   E    DRLIVTVDG+V  +P+   P  P L+I   ++FG VV+ANKVVT    + N G + GEF+  YSGSRPL+I+P  G +  +S +P++ +Y+T E  K NE+ + + EG+ +P +I + G++V+R LELL   + E   + C+ F   +YG+DK E ++LFNN+PE + FV++LEE+A+GQESG  +  +A     KECTNPLTSL+ M PNQG + PY++  V FRFSPRW   K++F  T + P +Q FA+F+ IQ+VG+ +D  S          +   +LEVA+TGTA P+L+++ P   ++FG    N          N+S   L  L  F + AHF   P + ++ P  ++ +SVTFCP+Q+GNF+ +  + +L  V D+ ++P       I+   ++L+GSC       A ++  G+ PLV N+VG   +  F  L  +P   P  A +                  T+A LH ++              + A +AFPNDRA S+RPSE++ ++ T+  R+KR+N++DPDYAY+D E+ ++R H+  Y    R++     + + + + K FEND ++G+IP  G+ P KL  + +  D       NK F+LLSTK+++   E   N T      A+P + +EKE C ++L PQ+LHQ++I P TI+FG VC+RS+  R++ V+NNL   IH+ V IDC+ELR SSPLSQV+P K+K+  PL+FES  +G+FQRN+SY ING Y+NHVI LA VV  QLELST  L +      P E GIR  IT+ N LN   EF WEPV       AFSIRP+ GVVEAF  +DCEVVF PSF AP EG F L + G                          +++ +KC+A  G  +V F +RRVMFG++P+NM++ + A L+N    HAY+ ++     + +PGM + PL G +PVGGQ E+ I + P A+SKFDC   + IRGW++L+L+M G I+ P V+I  K   F GV VG+ KS+   L+N++Q  + +EFD  +  DF++   G+   +   +   +   +TL+P +  +  L F P EVASY F + V +N        A     + + +     + + +   T SSS        +      R  V   A R  + LS   F F                         + A +  + L + NT ++ +   +   ++         +L  +  +   P + S ES         L         + + ++F P  PG +   + V IN++++  +  + L G L  P +   P  LT  P PL + +S+ F +LA N+   + +   LP +    G+  +    +++     +I P +++            +++ E+R  L+F +  P+++   +      G    + +SATADNC LT   F   H+ +YHIV ++GK LEG          + GE Q+ +   +  +  V     +  SR STT TSSNFE+SS +YEET +E+ ++        R+GA+N      K    + P +   V    ++   + +  E +S  + D+NY                         L ++  F      D+L I+QRWFT +GW G   P+ VP S RS L ++    +   +S ++K + T N                 +++ G K++ + +YDMI +L GR  PGI  +  LP+   ER   IY QHATL+ F+ +QGG LA ++PEHLM+  +Y  W S+                          PG    D++    D   FE +SK+AWT VLLQILK  +L KVT  S+++ L+      P+P I L+   SN Y++NERILLAWLN+ Y+ YR   W        G     P +RW+INFD+D +D L+LA  IGA+ P++I+ H + MY  P  PEQCLHN+L++V+A++ +GL+FD+QA+D+  PNPV+++L  + L+ +LP YI KS + F+G LH+  ++Q+ + NP +K L+Y   + G D  DF+LPKG++V+L  K  +   + F+SRF+R AE  ++ +GR +G    +  +F + T++ SI P    ++   CY +K + L +++P+N    F+V L+E     L              +  +E   E K+++     P ++  K      +    +++FF H   + +    S  +++ +LPF +  K+C+++  N ++GEFV+ VEA A+LP P  I       TP    P   V +S A AA+RG      +   +YW+ E    ++E L IP+ N YKE AL  AAQ HLS +EV RR+VT    + + +      +  +  D      +N  I+++   K+    + I+F+VE DS  +  P ++ IP P       ST N+  + P  +T D+P++F     GVYP  +++K  DDVRLFR+EC V PEG  +++ F+ P+ + + QNIP++N+TK DW LKA + G +  F GPD+++AKA   + YPL FKP  EG+   +L L N  DG+EH + L G G  PLAL+ L F+C VGE+IT+ + +PN +++K  + VES+L + + G   +++LPGR   Y I I P + GK+ G++AFV+ K  +++YDSDG+E+  V +       N S E +R+WYS+ + V+PG P G  DV C C     +E  + NP  D E++ +A I G +L+G   + +      +Y L F+P+ + +  G +IFFN   GEFWY+LNL A  P    + P++CELG+    E+ L+N  +   +V+ P++SN   F + I D E+         I       L++RFTP ++G   H C +   S
Sbjct:   23 ALDIQGIRINPGIIQFFDCDVGVSQKCHVSVKNISEKTRTIRFYAPQNKIFTLKVKEHEKNVASGLDHVACIEYTPTDENTQSDRLIVTVDGEVIPVPVQGMPRQPVLEISDSVSFGVVVVANKVVTTNVKLYNRGSRPGEFRFEYSGSRPLSILPPHGSIPPKSVLPVRFDYITKEPGKFNEEVVAVLEGRTEPQKIAVFGEIVERQLELLSPATGEP--MPCVHFGSAFYGTDKIEAAVLFNNAPEPVSFVSILEENAIGQESGP-VNKSANLAEAKECTNPLTSLVCMIPNQGTIAPYQKALVCFRFSPRWYKSKRSFHTTEDSPPKQDFALFMYIQLVGTQTDSASPD--------SHRTQLEVALTGTALPILLQVSPKPEVNFGAVQLNNPADAAFTLANQSEDGLPVLFAFRKIAHFNARPERGQIEPGRELPVSVTFCPRQFGNFDVQLEICILGEVADDRQDPLTRRLDVIHSVFMRLSGSCRVFGTQPAGRFNPGITPLVANEVGLCTDTRFDELNERPVQPPLAALVAH----------------TNARLHRHAVSADEGSGGDGKRRKQARIAFPNDRAASLRPSERHVDYCTLFTRVKRHNFVDPDYAYEDSEVERVRQHKQGYADSQRKRTENLIVSQRDRRLKRFENDRDMGMIPAMGMRPVKLGLEDLRPDTPPPEPPNKVFQLLSTKEIQDVKETAANQTAKDGLGAVPMSQKEKEECRMLLRPQELHQVVITPGTIDFGVVCLRSVVTRELIVMNNLETSIHLVVEIDCRELRHSSPLSQVVPPKSKALVPLIFESALQGRFQRNVSYVINGNYRNHVIALAEVVPVQLELSTQELEVVPCEGQPAEAGIRGVITLYNRLNHPAEFSWEPVLKERQHTAFSIRPRAGVVEAFKDIDCEVVFRPSFNAPDEGYFRLHVEGG-------------------------NDLNLKCVAKFGPTNVQFVNRRVMFGSVPLNMTTVKKAVLVNNSQNHAYFHVINS---KPWPGMELEPLSGVVPVGGQKEIRISFTPSAVSKFDCGTRVAIRGWRDLELRMGGTILSPCVDIPLKEFNFDGVYVGASKSISFELVNQTQTDSRLEFDLKRYPDFSLDFGGRASPEDLANPGVHT--VTLRPEETLKAVLTFRPKEVASYSFLMPVVINNTRAPSPAATPVPPSPAPTVKDGISMSRIDSATSSSSGRVGWTPHVPVVQTPRKLVKGIALRPVLRLSRREFAFQLAPEALQDQLDAQVSPTPPPLNQATPANNRLQLLTLENTGDSAITWAVDLPNSQKALRDSCFSLTPIEGTEAAPEEASSES------GRRLFGRLEPAATVTLTVQFSPRSPGQFKARLPVVINDDWQFPYDHLTLRGELTWPSITFVPPALTLTPCPLHSAISVQFSILAANYAAPSRLEFTLPQVEADDGSPIKPLRLEYIDGRGPDIFPATKDPDANGGGSDASLAQLIELRCRLTFEASTPVSISKEILFQDSFGNQTRLPVSATADNCLLTLYPFVLKHREDYHIVTEQGKLLEGRRAAQQLPATETGEPQMVACRAEDLSGLV-----AASSRPSTTATSSNFEDSSTSYEETLTESAASNTP-----RDGAVNNPASSSKATGQSGPHVPGMVGKTGKTRWPDHALTESSSDGLVDENY------------------------HLEREGLF----YRDMLSIVQRWFTNYGWPGGQFPVTVPSSMRSGLSRKQQSDEQDDSSNRKKKTTTSNDKDGNKDGNNAGGKGAALDSGGGKSEVKTIYDMITHLCGRPAPGIPISAALPSQAAERVKQIYWQHATLLTFLRSQGGCLASVRPEHLMEPKDYRCWKSLQAKKPNSAAEASGSPESIEDDGLEPSPGRLVRDVEEAGRDEELFECVSKRAWTDVLLQILKTLVLYKVTPRSFKN-LRQPDPHMPLPSISLSPLASNVYTVNERILLAWLNHFYDNYRTKIWTD------GDKGGVPPARWVINFDHDLLDGLVLAAVIGAHCPYLIDSHLRGMYTAPSTPEQCLHNSLRVVNAMRFVGLDFDVQALDLTAPNPVLLMLLCVYLYQTLPQYIIKSNVDFSGGLHQTCSRQVTLVNPVAKTLAYRAALAGRDAADFSLPKGDLVSLPPKGRVPVSVEFRSRFLRPAEAVLLLIGRPSGPHQGSTQVFRLVTQVNSIQPISTVQVASHCYELKPVRLNVVNPFNCEAVFAVSLVEGGTDQLLLNACEKRQQQQQQQQQQERQIERKKSKQGPPPPRSVDTKGAQSRPEPPVSMKSFFCHVPEIRLAPRGSAEIDMNFLPFQVDKKQCSVVLRNPTVGEFVYGVEAVADLPVPTRIPMEEANATPG-APPTKTVRISSAVAASRGQSSVVHDHSIVYWRTEANKEVKEVLKIPLINEYKEKALLQAAQQHLSLKEVQRRRVTGTLESGTLVEKAMEMLSAVGVDGKKLEKTNSSIERR---KFQFSKETIDFQVELDSHHFRAPSVISIPHP------RSTDNSLKKDPTVTTFDLPLEFRPKRPGVYPVTIILKANDDVRLFRVECIVIPEGFSAELQFESPVNQAVLQNIPVINQTKDDWRLKAEMHGVN--FHGPDYLLAKAYKTTSYPLTFKPTHEGEATGRLLLTNLDDGTEHCYVLGGIGRKPLALDHLVFDCQVGESITRVVLVPNNSKRKLLYQVESNLSF-VGGKKEVTVLPGRQVEYTIVIAPNKRGKFDGVIAFVADKDRLVDYDSDGEELPPVDD-------NPSTE-HRVWYSMELSVAPGEPMGRLDVTCPCYRTCEVEFTVRNPLTDKEIELDAEIRGESLSGEKVLRLAPAEEVTYRLAFSPALVEDTIGSVIFFNSEAGEFWYELNLHATPPPLTVLEPMECELGQHVCQEMTLEN-PSSAPIVLRPQLSNANNFGLEITDSEVH--------IPAGGSVTLNLRFTPSDLGFADHACRITFHS 2877          
BLAST of cilia- and flagella-associated protein 47 vs. TrEMBL
Match: gnl|BL_ORD_ID|15749655 (tr|R7T4M6|R7T4M6_CAPTE Calponin-homology (CH) domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_225518 PE=4 SV=1)

HSP 1 Score: 1742.63 bits (4512), Expect = 0.000e+0
Identity = 1150/3427 (33.56%), Postives = 1787/3427 (52.14%), Query Frame = 2
Query:   17 DIFGVRITPNVINFRNCEINGSYIRVVNVQNIGNKNVTVRFYSPQSKDFSMICKMHEKIISSGLSHLCSLKYTMEVEERSVDRLIVTVDGQVHEIPIFIYPSAPDLQIDRIINFGTVVMANKVVTQQANITNEGLKIGEFKLLYSGSRPLNIVPNEGIVYQQSSIPIQIEYVTHEAHKINEKCLVIFEGQDPFEIDIKGDVVKRSLELLDINSDERKLIQCIKFPYTYYGSDKSEVSLLFNNSPEKIQFVAVLEEDAVGQESGSHITMTAAGINPKECTNPLTSLITMYPNQGNLGPYERIPVLFRFSPRWISPKQAFKKTLEPPLQQTFAVFIKIQ-IXXXXXXXXXXXXXXKDDTLTRSQK----LEVAITGTAAPVLIEMKPNS-IDFGECLENEEKTEKLLFYNRSSILSSLIDFPREAHFLISPNQIRVGPNEQVEISVTFCPKQYGNFNTKQVVKVLSYVKDEENPFLEYEQTIYEQILQLTGSCVAISKSVAPKYCNGLDPLVTNKVGYLAEANFSNLGFKPHNGPATAYITTDAFATGGPQGSRLFKCTDANLHPYSNRTAFVAFPNDRAESIRPSEQNKEFRTILKRIKRYNYIDPDYAYDDEEMRKIRHHQDSYQTMIRRQHSLKKIVKLNSKFKAFENDINLGIIPGNGLYPPKLTTDQINTDKIEVFKDNKNFKLLSTKDLKQSEKVINITKLGTFNAIPTTAQEKEHCSVVLTPQQLHQIIIGPNTINFGDVCVRSISNRDINVVNNLNQFIHVSVVIDCKELRQSSPLSQVIPAKTKSSFPLVFESTKKGKFQRNLSYTINGYYQNHVIVLANVVVNQXXXXXXXXXXXXXXIYPPETGIRNTITMTNPLNCATEFLWEPVFNSTNGIAFSIRPKEGVVEAFSKLDCEVVFHPSFMAPSEGDFILRIPGNEEGSVETSSQDTLNTDTPTISNGDKSNITMKCIAILGNIHVAFQSRRVMFGNIPINMSSSRTATLLNTGGKHAYYRIVPDDLYEEYPGMTIHPLKGSIPVGGQAELTIKYHPVALSKFDCSIPIVIRGWKELDLKMSGNIIIPQVEILQKRLEFGGVPVGSEKSLDLTLINKSQCRANIEFDFIKQKDFTI-LTVGQCGNDKALSKDNYKCL-ITLKPLQEFQCQLIFTPNEVASYEFPLSVKVNQIEIMVQGAGRGQTAXXXXXXXXXXXXPVRIETVSSSIVTSDRNSILAANLIRNVSATATRQPINLSNNSFKF------HFFSISEAKSHSKQLIVFNTLEAEVEICLKFNSANWKYGTEKTTLKNLSKSRL---IPFKFSCESEPIPNNDDYL---ICLSSLGEAIKIDIKF----EP--DHPGHYNGEVFVFINNNFEQIFQRILLTGLLESPELMCYPEHLTFIPSPLKTEVSLDFKLLAINFETKTFIRINLPLLTKPGTSEEYQPFQFVLSTSNEIQPISENS---RVTEIRGTLSFCSDVPINVRSFMEVLTYS---GVSKSISLSATADNCQLTWQNFFNIHQSEYHIVCDEGKHLEGTDGIHGHRFADFGEAQLKSYNKDTANINVNMDGQSVHSRNSTTITSSNFXXXXXXXXXXXXXXXXXXXXXPIVLREGALNKIGEKVKYKSSTTPLLKQNVKPVERSNDSTLEINSSIMSDKNYVTMYMYPNQITFANXXXXXXXXXXXLNKDFDFPWDYDADVLLIIQRWFTMHGWAGNLHPINVPVSFRSSLQKRFGFSQTSTKEKISNT--ENIENTGLKNDSRDLYDMILYLTGRQIPGINTTVVLPTHPIERSCHIYIQHATLIAFIENQGGQLAQIKPEHLMDLPEYELW------------HSVGCPGLPNSDMKPVQYDSNSFEKISKKAWTVVLLQILKVFILIKVTYSSYRHALQILHGKEPIPEIQLAATVSNCYSLNERILLAWLNYLYEAYRHVCWPGNSNPDIGTTSSTPVSRWIINFDNDFMDSLILATAIGAYIPFMIERHFKYMYPNPQNPEQCLHNALKIVSALKDIGLEFDIQAIDIVDPNPVMMIXXXXXXXXXXXXYIPKSEIVFTGSLHEQITKQIQISNPTSKPLSYECIIIGNDNCDFALPKGNVVNLSGKASIKWPIVFKSRFIRSAEVTVMFVGRKTGFSIPTNLIFSVKTKIMSINPSKVEKIVGKCYIMKKINLKIISPYNKSGNFSVKLIESSEGNL---KSIKETSNEFKQTETSFIKPAIAKKA-------------------------TLDAIKTTNKLRAFFSHCETVFINENKSGSLELFYLPFHLGIKRCTIIFSNDSIGEFVHSVEASAELPEP----IIITPNDDKPKSGVWVSRAEAANRGLEGNEKTIYWKCEVGSFIQETLSIPINNIYKEYALHTAAQLHLSSQEVSRRQXXXXXXXXXXXXXXXXXXXXXXDDHDFVNSNKQIKKKADTKYSNKGKFINFEVESDSSFYTTPLIVQIPDPLMHLGNDSTKNNAIQTPSTIDIPIKFHASTAGVYPCNLVIKGPDDVRLFRIECTVTPEGNLSQIYFKIPLQEVLAQNIPIVNKTKQDWPLKATITGTSAAFSGPDFIMAKALSVSQYPLQFKPVKEGKVNAKLTLFNEADGSEHVFELYGEGESPLALESLYFECTVGENITKTLQIPNLTRKKHFFTVESDLDWMIVGDDTISILPGRNCSYDIAINPKRSGKYTGILAFVSGKKTVIEYDSDGDEIVDVYNDETVNSANKSCEIYRIWYSLVVHVSPGAPQGIFDVKCNCLEKVVLEIPINNPSEDMELKFEAAISGANLTGNSEITVNSLSTESYLLTFTPSFIGNFDGRLIFFNDIVGEFWYKLNLTADSPIEKFIPPVKCELGKWCLVEIPLKNIDNENKLVMYPEISNPECFSILIGDLELFDQDKQC-FSIAPRTEHVLSVRFTPCEIGSGTHLCFLVMKSKLLGDQKFILTGCGMPPNPSDIIGVSSEAGSNMTFLIPFHNPLLEPVLIDIRITEEHQSVLDKYRIGSVNLDKDFKEMETSVF-XXXXXXXXXXXXESKQSIEIPISFAPQEMRKYDAICCVVMKRKNGEPLISDEDFNDLILPNSDNITPFDKKQLRWLFPIKGVPETLVSLNVFTTPLVQGPLRIETKEHLEFNLWGLPPPVTREDFVTKSVKSAPA----TINDGNELKPIDRFLQDFTTELRVITVENGDAMDTATLNEYVHLFLMKQSKQLDTGVTVLTYEIRMRPLKKFRLNSEIIITSLTGGVWRFPIRFVAHDCDPDDEITIEAIGLNKPVSTRFYLNSTTYNELPFKAYFLKGGDPDFTVSPESGILPPIQSFSKFQISGLEFVVTWQPKTYSRSKGARLVIETEMMEWVYKFVGISPQYVVPDTRSIIQSNWDSDMXXXXXXXXXXXXXFLKQNIEMLSTAVSSPVKGAPLLPK 10045
            D+ GVRI P +I F++C +N SY   + V+N+  K+  +R+Y PQSK F       EK + +GL    +++YT   E  + DRL+VTV+G V E+P+  YP  PDL I   ++FG VV +++V+++   I N G K G+FKL YSG +P+ +VP+ G V    S  I++EYVT      +E   V  EG++  ++ +KG VV  SLELL   S++  ++ CI F  TYYGSD+++V++L NN PE   FVAVL+EDA+GQE  S  T  A G       NPLTSL+T  PNQG LGPYE+IPV FRFSPRW   KQ F  + +PP  Q FA+F+  + +  S     ++  E K +   + +     LEVA+ GTA PVLI + P S  DFGECL  +        +N S  +S+   F R AHF   P    +GP ++ EI  +F P Q G F   Q V +L  V DE NP     + I    +Q  G+   I+    P +  G+ PL++N+VG  A+  FS  G  P      +  T         Q SR       +    + +   +AFPNDRA+SIRPSE+ +++ ++ KRI+R+NY+DPDYA  DEE                    ++K+ +  + F+ F     LG           L  ++ + +  + +K +KN K +  K        +   KL   +  P  +                    GP T++FG VC++S++ ++IN++NNLNQ IHV+V +DC+ELRQ+SPLSQV+P  +K++ PL+FES+ KG+FQR+L YTING+Y+NH+   A VV   LE+ST  L++      P + GIR  IT+ N LN   EF W P+     G AFS+RP  G+V+A++ LDCEVVFHPS+MAP EG F L++ G                          +++ ++C A LG  +V F  RR++FG +P++++++R A L NTG  HAY++++  +    +PG+T+ P+ G +PVGG A+L I   P A+ KFD  I I IRGWK L+L++ G +  P VEI     + GGV  GS  +L   LIN    +A +EFD  + +DFT+     Q   D      N     +TL   +    QLIF P EVASY+F + V +NQ        G    A +             I+     IV      +  A   R V ATA RQP+ LS++  +F      H  + S   S ++ L++ N  + +++  +  +  N     E    K L  S +   +      E    P     L    C       +   ++F     P  + PG Y   + V ++++FE+ +Q I+     +  +L+                     KLL  +   K  I   LP + + G      P         E+ P S +      T I   LSF S  P+   SF + +T+    G S S+S+SA+ADNC +T   F   H++++ IVC +G+ L G              A ++S     A +   +      SR STT TSSN      +     +      ++ P   REGA NK   + +  S T              ND  L+  S        +   ++P++ T                        +  +VLL +QRWF   GW+G  +PI VP S RS      G S+   ++ ++N   ++ E++GLK +++ +YDMI +L G+ +PGI     LPT P+ER+  +Y QH+TLIAF++ QGG +A +KPE+LM+  EY  W             S    GL    ++    +   FE +SK+AWT +LLQ+LK   L +VT   +++ +   +    +P +      SN YSL+ERILL WLN+ YE  R   W   +  ++      P +RW++NFD D +D L+LA  + AYIPF+++ HF+ MYP P   EQCLHNAL++V+A++ +G+++DI AIDI DPNP+ ++L  ++L+L+LP Y+P++ + F G LH  + +Q++++NP++KPL+Y  +I G D  DF LPKG+ V L+ K+++   + F SRF+R AE  ++ VGR+ G  I + L+F++++ + SI+P    K+   CY +  I +++++P+ ++G F + L E  + NL   KS K++S+    + +++ K + A ++                         +LD     N + AF +  ++V +   +SG++++ +LPFH G ++C++IF N+ IGEF++ +EA+A LP P      ++P+  +  S     R ++ + G   ++  ++WKCE GS +QE+L IP+ N  KE AL  +A  H+S  E+ RR +TGTL S+                   V+    I     T        + F+VE DS  +  P  +            S  NNA ++   I++PIKF A  AG Y C + +   DD+R++ I+CTV PEGN +++ F  P+ + + Q+IPIVN T  DWP++A + G  A F GP  +MAKA + S YPL F+P  EG V  +L L N ADG  H F L  +GE PL LE +  ECTV E    T+Q+PN+T+KK  + VESDL + + G + I++LPG+  ++++++ P + G YTG+++FV+G   + E DSDGDE+   + D+ +N        YR+WYSLVV V P  P     + CNC + V++E+ + NP+  ++L  +A + G  LTG SE+ +   +   Y L +TP+ +    G L+F++D  GEFWY + L A+ P+   +PPV+CELG+W   E+ L N  +E  L + P ISN   F        L ++D      + P +   L + F P  +G   H   +      LG+  + ++G G+ P P D + +++ AGSN T +IPF NPL  PVL  +       S+LD        LD        S F  LL +    L+L  K S++IPISF P++M++++A C V + R++G+   +   +     P  D    +   +++W++PI G PE L       + L+Q   R   +E LE  L G+ P         K+    P      + +G  +       ++F+ E+     +N D+     L   V L L++Q +   TG+ VL + +   P K    ++++ +   TGG+WRFP++FVA + +PDD + IEA  LN+  +  F L S T + +P+ AYF+ G D +FTV+P++G L P  S      +G    V ++P  Y +   A+LV+++  M+W Y   G+ P+Y  P       S+        + R+   K N++++N+ + +TAVSSP+KGAP++ +
Sbjct:    4 DVHGVRILPPLIEFKDCAVNKSYKVNITVKNVSKKSSEIRYYGPQSKCFKFKVNNPEKPVPAGLEVPATIEYTCTDENVNKDRLVVTVEGNVIEVPVIGYPCLPDLVIQGPVDFGHVVASSRVISRTITIYNHGSKEGDFKLKYSGDKPIAVVPSSGKVLPNDSQVIKVEYVTKVPGSFDEVIKVKLEGKESVQLHVKGHVVNGSLELLSCESEQ--ILPCIDFGSTYYGSDQTQVAMLCNNGPEPTCFVAVLQEDAIGQEVTS--TGQAGGK-----MNPLTSLVTAIPNQGMLGPYEKIPVFFRFSPRWTDAKQGFNCSKQPPPIQQFALFMHFKAVGASEGFQDTDRREPKSNAEAKGKSSGSILEVALKGTAQPVLISVAPLSKFDFGECLVGDHVDALCSLHNDSKEMSASFKFRRLAHFTTMPVSGNIGPGDKQEIIFSFRPNQAGTFKPTQYVDILGQVADENNPLSLNSEVIQCIPIQFLGTSDPITIKKEPVFNPGITPLISNEVGLYADVPFSGSGKNPRAALHNSLTT---------QKSR-------SASKRNEQNVRIAFPNDRAQSIRPSERGQKYESVFKRIERHNYVDPDYAMTDEE--------------------MEKVKEHKNGFRRF-----LG----------GLMEERHHKELSKEYKKHKNTKDIGIKPAAG----LRPKKLKLEDVKPDPS--------------------GPPTVDFGKVCLKSVTYKEINIINNLNQHIHVNVAVDCRELRQTSPLSQVVPPNSKAALPLIFESSTKGRFQRSLDYTINGFYKNHLTTFAEVVSVSLEMSTCDLIVEPQVGLPADAGIRGVITLYNRLNYPAEFTWNPILGD-RGTAFSVRPATGIVDAYTDLDCEVVFHPSYMAPEEGFFTLKVHGG-------------------------NSLKLRCSAKLGATNVQFIDRRIVFGQVPLHLTTTRKAMLKNTGLNHAYFQVLDPN---PFPGLTVSPIHGIVPVGGNAQLQIHLTPNAVIKFDTRINISIRGWKTLELRVGGTVEPPVVEIDIPSFQVGGVYCGSTATLPFKLINNVHTKAKVEFDLSRYQDFTMEFPNKQNSEDITFQLMNPGVYSVTLNAHETINSQLIFKPTEVASYDFIMPVTINQ-------TGAPTPAPTPFPPTPAPSHKNSIQ----HIVNPRPIQVTIATPRRKVVATALRQPLQLSHHLLEFSMTPKMHSIAASAVLSQNEGLLLVNNSDHDLKWAIDLSRGN--QALEDGIFKFLHSSGMPIVMDPDSGVEGNLTPGQTQALGVMFCPGKFHNVVYYQLQFLLVLSPFVEKPGIYEVCLPVVLDDDFERPYQMIMAANYAKYVQLIV-------------------LKLLLTSNVRKCKITAELPSV-ECGDGSTLSPLSISFPEGQEVVPCSGDDGQDECTSITCKLSFQSPKPV---SFTKPITFKDELGNSFSMSVSASADNCLMTCYPFLAHHRADHQIVCAQGQILRGPK-----------TASMESIGAGEAVLLPCVSPHGPGSRPSTTATSSN--FEISSSSYEDNINSMTESTYPSTPREGAFNKFTAESEQPSQTI------------CND--LQSRS--------LGSALFPDEDTDEGV--------------------FHTEVLLAVQRWFASQGWSGGPNPITVPESMRS------GISRIQVEDTVTNAKGQSYESSGLKKETKTVYDMINHLCGKPVPGIPVNNPLPTDPMERAKQVYWQHSTLIAFLKAQGGCVASLKPEYLMEPQEYRAWMRLQKELEARKNKSGHRSGLRMKTVEEETIEDQLFEAVSKRAWTDILLQLLKTLYLSRVTPRQFKN-MPTPYKSSAMPLVDADPLCSNVYSLSERILLLWLNHNYEQQRTNIWQTCNKGEL------PPARWVVNFDFDLLDGLVLAAVLSAYIPFLVDSHFREMYPRPATAEQCLHNALRVVNAMRVVGIDYDISAIDITDPNPIALLLLCIHLYLNLPQYLPRNTLDFVGGLHVMVLRQVKLTNPSNKPLTYHALIAGRDAADFHLPKGDTVILAPKSTMNLMVEFTSRFLRPAEAILVLVGRRQGSGIGSTLVFNLRSLVDSISPKTTIKVESPCYELHTIPVEVVNPFGQAGEFHLLLAE--KDNLLPGKSTKDSSDGKSLSNSNWKKQSRAIRSKVDSGLRREMTPDMVEMDPEEPAATSLDESNDENLMPAFTACSKSVHLGALESGTVDINFLPFHTGSRKCSLIFLNEDIGEFIYEIEANATLPLPSSLPFKLSPHSVRISSAAAFGRQKSNDFG-GVDDNVVFWKCECGSLLQESLCIPVRNAAKEKALLMSATQHMSQLELDRRHITGTLQST-----------------SLVSKAMSILGGTQTADLTMEDCV-FDVELDSKLFQAPKTI------------SFANNAKES-DCIELPIKFQAKDAGHYTCRVTLSTADDIRVYFIDCTVIPEGNEAELEFTSPVHQAITQDIPIVNNTNHDWPIEAQLEG--AGFVGPQTLMAKAQTTSLYPLIFRPSFEGPVKGELRLTNTADGVVHTFHLEAKGEKPLPLEQIAIECTVKEMKKTTVQVPNITKKKLHYKVESDLGF-VTGPEMITVLPGQLGTFELSVAPLKRGYYTGVISFVAGNSPIKEVDSDGDEVEATHEDDILNG-------YRVWYSLVVDVLPQPPVTCLTITCNCQKTVLVEVGVTNPTR-VDLCLQAEVRGQGLTGPSELLLTPKARGVYELEYTPAIVDTTKGSLVFYHDATGEFWYDITLIAEKPLATTMPPVECELGRWVQQELMLFNPTDET-LELMPMISNTNNF--------LLERDSDSTIQLRPHSTIHLPISFMPSALGPADHSACISFHCPQLGEWVYNVSGVGILPQPQDPVSITAIAGSNSTIIIPFRNPLDVPVLAKV-------SLLDLKEEAPKALDAQVLPNAGSPFCLLLKQKEGGLRLGPKASLDIPISFGPEDMQRFEAECVVSICREDGQQWTA---YRAETSPK-DTAPSWQVNEIKWIYPIHGYPE-LSQGQDSPSALIQCKARERVEERLEVTLSGVAPAAGGPKRGIKARSVTPTDESPRVPEGVVVGETMAKAEEFSYEM---VYDNDDS--ERLLKSAVALKLIRQHRDKHTGLVVLVFNVVFAPFKTISNDAQLRVQGATGGMWRFPLKFVATEPEPDDLVIIEASALNQESAIGFRLTSQTRHPIPYNAYFVAGSDSEFTVTPQTGELLPTGS------NGTLISVVFKPTKYGKLYSAKLVVQSPDMQWTYTIRGVLPEYQPPAG----YSSHPMAGPHPDPRRHGDKVNYVRENLRLSTTAVSSPIKGAPIVQR 3132          
BLAST of cilia- and flagella-associated protein 47 vs. Ensembl Cavefish
Match: hydin (HYDIN axonemal central pair apparatus protein [Source:ZFIN;Acc:ZDB-GENE-050419-219])

HSP 1 Score: 55.8398 bits (133), Expect = 1.234e-6
Identity = 99/450 (22.00%), Postives = 179/450 (39.78%), Query Frame = 2
Query: 7403 FKIPLQEVLAQNIPIVNKTKQDWPLKATITGTSAAFSGPDFIMAKALSVSQYPLQFKPVK---EGKVNAKLTLFNEADGSEHVFELYGEGESPLALESLYFECTVGENITKTLQIPNLTRKKHFFTVESDLDWMIVGDDTISILPGRNCSY-DIAINPKRSGKYTGILAFVSGKKTVIEYDSDGDEIVDVYNDETVNSANKSCEIYRIWYSLVVHVSPGAPQGIFDVKCNCLEKVVLEIPINNPSEDMELKFEAAISGANLTGNSEITVNSLSTESYLLTFTPSFIGNFDGRLIFFNDIVGEFWYKLNLTA-DSPIEKFIPPVKCELGKWCLVEIPLKNIDNENKLVMYPEISNPECFSILIGDLELFDQDKQCFSIAPRTEHVLSVR--FTPCEIGSGTHLCFLVMKSKLLGDQKFILTGCGMPPNPSDIIGVSSEAGSNMTFLIPFHN 8731
            F   ++    Q++ + N + Q W L+  + G   + + P F++        Y + ++P+    +GK +     F   DG+  ++ L G  E P A+ ++  E       T+ + + N   K   F V  ++      D+T+S+   +   Y D+    KR  K    ++F S K+   +Y++             V   N+    Y ++Y+L    +P       ++  +  +     + + NP     + F       +++  S+++V++LS       + P  IG    RL   N  +G F Y+L L A  +P EK +   K  LG    +           K   Y  +           D    ++     +   +T   +SV+  F P ++G    L  L + S L GD  F L G   PP P   + +   AGS++T  IPF N
Sbjct: 3932 FACQVRSQCTQSLSLSNPSNQSWNLQPVLEGEYWS-AAPFFVVEPYQQNKAYEITYEPMTMTTDGKKHLGSVFFAFPDGAGMLYTLQGTTEPPKAVGTISGEVPCKTLYTEMIPVQNWLHKPQRFRVLMEMVNPDRPDNTVSL---KGLDYMDVPALAKRDYK----ISFFSYKEG--QYNAK------------VTFKNEVTGEY-LFYNLSFKATPPGVMSTVEMVASVRQTTSACVEVENPLP-TNVVFSVECRSPDISVQSQLSVSALSKVGLDFEYQPLCIGESTTRLTLQNSELGSFHYELLLRALPAPPEKPL-YFKAPLGSSQYLTA---------KFTSYSRVKTEYTCKTDCPDF-FVEKTVSAAAAGSQTGSDVSVKVHFEPSQLGEVRGL--LTVSSSLGGDYLFPLYGTCTPPKPQGPLTIY--AGSHVT--IPFKN 4340          
BLAST of cilia- and flagella-associated protein 47 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000512.1 (pep scaffold:Pmarinus_7.0:GL479366:22296:26735:-1 gene:ENSPMAG00000000460.1 transcript:ENSPMAT00000000512.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 211.846 bits (538), Expect = 6.279e-61
Identity = 117/322 (36.34%), Postives = 178/322 (55.28%), Query Frame = 2
Query: 5021 IQRWFTMHGWAGNLHPINVPVSFRSSLQKRFGFSQTSTKEKISNTENIENTGLKNDSRDLYDMILYLTGRQIPGINTTVVLPTHPIERSCHIYIQHATLIAFIENQGGQLAQIKPEHLMDLPEYELWHSV------GCPGLPNSDMKPV----QYDSNSFEKISKKAWTVVLLQILKVFILIKVTYSSYRHALQILHGKEPIPEIQLAATVS-NCYSLNERILLAWLNYLYEAYRHVCWPGNSNPDIGTTSSTPVSRWIINFDNDFMDSLILATAIGAYIPFMIERHFKYMYPNPQNPEQCLHNALKIVSALKDIGLEFDIQ 5953
            + RWF+  GW G  + ++ P   RS   +R+ ++    K  +          L+   R LYDM+ +L GR +PG+  +  +P    +R+  ++ QHATL+ F+  QG  L  +KPEHL+ + +Y  WHS+       C G+ N + + V    +   + FE +S++AWT +LLQI KVF+L +VT  + R AL   +     P +   A +S N YS +ER+LL+WLN+ Y A R +         I +    P +RW++NFD D MD L+LA  + +Y P++I  H   + P+P +PEQ LHNAL +VSAL   GL  DIQ
Sbjct:    9 VTRWFSRFGWPGGTNHLSGPQQLRS---QRYKYAHV--KNYLGPFSLATPWVLRKGGRTLYDMLAHLCGRALPGVPVSQSVPGDVADRAVQLHWQHATLLEFLRGQGACLPNVKPEHLLHMDDYNCWHSLLQKENEKC-GIENEETECVTTATELAESDFENVSERAWTDILLQIFKVFVLSRVTTEAVRKALPTENRTMARPPLLAVAPLSSNFYSSSERLLLSWLNHHYHASRML---------ICSPDDPPSARWVVNFDYDLMDGLVLAAVLASYCPYLIPSHLSRLQPHPCSPEQYLHNALVLVSALHVTGLALDIQ 315          
BLAST of cilia- and flagella-associated protein 47 vs. Ensembl Nematostella
Match: EDO32807 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STZ6])

HSP 1 Score: 826.239 bits (2133), Expect = 0.000e+0
Identity = 533/1578 (33.78%), Postives = 824/1578 (52.22%), Query Frame = 2
Query: 5438 MKPVQYDSNSFEKISKKAWTVVLLQILKVFILIKVTYSSYRHALQILHGKEPIPEIQLAATVSNCYSLNERILLAWLNYLYEAYRHVCWPGNSNPDIGTTSSTPVSRWIINFDNDFMDSLILATAIGAYIPFMIERHFKYMYPNPQNPEQCLHNALKIVSALKDIGLEFDIQAIDIVDPNPVMMIXXXXXXXXXXXXYIPKSEIVFTGSLHEQITKQIQISNPTSKPLSYECIIIGNDNCDFALPKGNVVNLSGKASIKWPIVFKSRFIRSAEVTVMFVGRKTGFSIPTNLIFSVKTKIMSINPSKVEKIVGKCYIMKKINLKIISPYNKSGNFSVKLIESSEGNLKSIKETSNEFKQTETSFIKPAIAKK-------------ATLDAIK----TTNKLRAFFSHCETVFINENKSGSLELFYLPFHLGIKRCTIIFSNDSIGEFVHSVEASAELPEPIIITPNDDKPKSGVWVSRAEAANRG---LEGNEKTIYWKCEVGSFIQETLSIPINNIYKEYALHTAAQLHLSSQEVSRRQXXXXXXXXXXXXXXXXXXXXXXDDHDFVNSNKQIKKKADTKYSNKGKFINFEVESDSSFYTTPLIVQIPDPLMHLGNDSTKNNAIQTPSTIDIPIKFHASTAGVYPCNLVIKGPDDVRLFRIECTVTPEGNLSQIYFKIPLQEVLAQNIP------IVNKTKQDWPLKATITGTSAAFSGPDFIMAKALSVSQYPLQFKPVKEGKVNAKLTLFNEADGSEHVFELYGEGESPLALESLYFECTVGENITKTLQIPNLTRKKHFFTVESDLDWMIVGDDTISILPGRNCSYDIAINPKRSGKYTGILAFVSGKKTVIE----YDSDGDE---IVDVYNDETVNSAN------KSCEIYRIWYSLVVHVSPGAPQGIFDVKCNCLEKVVLEIPINNPSEDMELKFEAAISGANLTGNSEITVNSLSTESYLLTFTPSFIGNFDGRLIFFNDIVGEFWYKLNLTADSPIEKFIPPVKCELGKWCLVEIPLKNIDNENKLVMYPEISNPECFSILIGDLELFDQDKQCFSIAPRTEHVLSVRFTPCEIGSGTHLCFLVMKSKLLGDQKFILTGCGMPPNPSDIIGVSSEAGSNMTFLIPFHNPLLEPVLIDIRITEEHQSVLDKYRIGSVNLDKDFKEMET---SVFXXXXXXXXXXXXESKQSIEIPISFAPQEMRKYDAICCVVMKRKNGEPLISDEDFNDLILPNSDNITPFDKKQLRWLFPIKGVPETLVSLNVFTTPLVQGPLRIETKEHLEFNLWGLPPPVTREDFVTKSVKSAPATI--NDGNELKPIDRFLQDFTTELRVITVENGDAMDTATLNEYVHLFLMKQSKQLDTGVTVLTYEIRMRPLKKFRLNSEIIITSLTGGVWRFPIRFVAHDCDPDDEITIEAIGLNKPVSTRFYLNSTTYNELPFKAYFLKGGDPDFTVSPESGILPPIQSFSKFQISGLEFVVTWQPKTYSRSKGARLVIETEMMEWVYKFVGISPQYVVPDTRSIIQSNWDSDMXXXXXXXXXXXXXFLKQNIEMLSTAVSSPVKGAPLL 10039
            M   + + + F  +S++AWT VL QI+KV +L +VT   ++  +Q    + P P +      SN YS+ ERILLAW+N+ Y+A R   WPG+ +   G     P  R I+        SL       AY  F +  H   MY +P   EQCLHN LK+V AL+ IG++++IQ+ DI  PNP+ ++L  L+L+  LP Y+P++ I F G LH  + K +Q+ NP+ KPL+Y+ I+ G D CDF    G+ V +  K  ++ P+ FKSRF+R    T++ VGR+ G      L+F+++T I +I P    K    CY ++K+   + +P+   G F V L+E+      S   ++    +      KP +A+                LD  +    T  +L AF+    +V ++     ++E+ +LPF  G ++C+++F ND IGEF++S+EA+A L     + PN D P + + +S A AA RG     GN++ +YWK +      E LS+P+ N  +E+AL  AAQ  +S +E  RRQ   T   SS  +TA         D     ++  IKK  D           F VE+ S ++ TP  V IP     L    T NN      T+ IP+ F  + AG YPC +V++   D+R++++ECTV+PEG+  ++ F  P  + + Q++P      IVN +KQDW L A + G    F GP  ++AKAL+ + YPL F+P  EG  + KLTL N  D +E V+ L G GE PLAL+++  EC   + IT+TLQ+PN+T KK    V +DLD ++ G  T+++LP +   + I ++P R G++ G+++FV+  + +       DSD DE        N  T +S++         + YRIWYSL V  S   P+   +V C     V +EI ++NP+ + ++  E    G  + G+  ITV+      Y L F+P+ IG+  G +IF    +GEFWY L L A +P    +P ++CE+GK     + L+N   E  LV+ P ISNP  F      LEL   +    S     E  + ++FTP  IG   H   ++  S+ LGD  F+ +G G+ P  ++ I + SE G N + +IPF NP  + V++D+ + E   S     R G     K F+E +T   S F LLLK    ++L   + + IPISFAP  M+ ++A   V+M R +G      +DF  +      N        L W+FPIKG+PE+   +     P ++   R   +E +E  L G+ P      + +      P  +  ND +         ++F  E     V   DA   A L   + + L+++++   +GV  L +     P K F   ++++++++TGGVWRFPIR +A + + DD I IEA GLNK     F L S T + LP++AYF+ G DP+F+V P +G L P  S       G    + ++P  Y ++  A+LV++T  M+W Y   G +P +  P  +S I S+  S      KR   +K+N++ +N+ + STAVSSP+KGAPL+
Sbjct:    1 MAAARKELSKFNSVSRRAWTDVLAQIIKVLVLSRVTPQLFK-KVQSPFKELPPPAVNPNPQASNVYSVGERILLAWINHHYDAQRQRAWPGSLD---GKLPPHP-PRIIVRLSMSLHASL-------AYFLFYVSTHLHSMYLHPSTAEQCLHNVLKVVEALRHIGMDYEIQSTDITQPNPITIMLLCLHLYRRLPQYLPRATIDFQGPLHTTVVKHVQLQNPSVKPLTYQVIVAGRDACDFTATMGDSVQVPSKGQLQLPVEFKSRFLRPCSATLVLVGRRVGSPCGNTLVFNLETCINNITPVATIKCESPCYELQKVTFDVTNPFTSGGEFRVVLVEAQSAFPGSGSSSTTPRNKPAKPAKKPVVARTDHGYNTTTTSHPWKVLDTTRHPHHTPPQLSAFWCPVPSVHLDGKSLSTIEVHFLPFSTGHRQCSVLFINDKIGEFLYSIEATALL-PLPSLLPNIDSPHT-IRISSAAAAQRGRGTFGGNDRVVYWKSDCDEVFTEELSLPLTNTAREHALAIAAQQRMSDREFQRRQ--LTGTLSSSTVTARVASMGLGGDMFLHAADPSIKKSLDL------ALTRFNVETSSKYFKTPSYVSIP---TDLSRKRTSNN------TVMIPVTFKPNGAGHYPCQVVLRSAHDIRVYQVECTVSPEGSSLELEFNSPTHQSVTQDVPVVSARNIVNHSKQDWQLTAILEG--EGFYGPPVLVAKALTTTHYPLMFRPFYEGPTHGKLTLINTNDTTEQVYNLRGTGERPLALDNVLIECEARKTITRTLQVPNMTSKKLTLKVMTDLD-IVSGASTVTVLPSQTAEHVITVSPWRRGEFKGVISFVATHENIASSSRPQDSDSDEDEPPAPNGNSSTRDSSSGGTKSEHHSQPYRIWYSLEVQASAPPPEKTLEVTCAAHSAVSVEIGVSNPTRE-KVVIEVLHEGMGVYGDPSITVHPRQQAVYRLKFSPTSIGDMSGSVIFQCPSLGEFWYDLALKATAPSPSHVPIMQCEIGKSTYQMVRLQN-PTEEALVLTPYISNPRNFR-----LELDQSNTLLLSAQSVVE--IPLKFTPSNIGHANHSTEIIFNSEQLGDWVFLASGTGLMPGANEPINIYSELGGNSSHIIPFRNPTDQDVIVDVMLKERTLS-----RTG-----KTFEETKTPKESTFCLLLKAPNSIRLAPMEELAIPISFAPDTMQMHEATVTVIMHRHDGS---QSDDFTGVTGTCLMN-------DLTWIFPIKGIPES-CPIRDSLAPCIECKARGRVEEKIEVTLTGVAPSSASTSYASYLRALTPIHVLPNDSDYSMDYINVPEEFRYE-----VVFEDAEGQAALERSLGVNLLRKARNQVSGVISLLFNFVFAPFKPFSHRAQLVVSAVTGGVWRFPIRVLATEPEVDDVIRIEAAGLNKEALVGFRLTSQTRHILPYEAYFVAGSDPEFSVYPPTGELQPYNS------EGTLIKLGYRPTLYGKTHKAKLVVQTSDMQWTYDIFGTTPSHTPPTGQSKIASSAQSQ-----KRTVKQKRNYVLENLRLNSTAVSSPLKGAPLM 1498          
BLAST of cilia- and flagella-associated protein 47 vs. Ensembl Nematostella
Match: EDO32806 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STZ5])

HSP 1 Score: 254.603 bits (649), Expect = 1.009e-67
Identity = 216/761 (28.38%), Postives = 361/761 (47.44%), Query Frame = 2
Query: 2459 HVIVLANVVVNQXXXXXXXXXXXXXXIYPPETGIRNTITMTNPLNCATEFLWEPVFNSTNGIAFSIRPKEGVVEAFSKLDCEVVFHPSFMAPSEGDFILRIPG-NEEGSVETSSQDTLNTDTPTISNGDKSNITM---KCIAILGNIHVAFQSRRVMFGNIPINMSSSRTATLLNTGGKHAYYRIVPDDLYEEYP--GMTIHPLKGSIPVGGQAELTIKYHPVALSKFDCSIPIVIRGWKELDLKMSGNIIIPQVEIL---------QKRLEFGGVPVGSEKSLDLTLINKSQCRANIEFDFIKQKDFTILTVGQCGNDKALSKDNYKCLITLKPLQEFQCQLIFTPNEVASYEFPLSVKVNQIEIMVQGAGRGQTAXXXXXXXXXXXXPVRIETVSSSIVTSDRNSILAANLIRNVSATATRQPINLSNNSFKFHF------FSISEAKSHSKQLIVFNTLEAEVEICLKFNSANWKYGTEKTTLKNLSKSRLIPFKFSC--ESEPIPNNDDYLICLSSLGEAIKIDIKFEPDHPGHYNGEVFVFINNNFEQIFQRILLTGLLESPELMCYPEHLTFIPSPLKTEVSLDFKLLAINFETKTFIRINLPLLTKPGTSEEYQPFQFVLSTSNEIQPI----SENSRVTEIRGTLSFCSDVPINVRSFMEVLTYS-GVSK-SISLSATADNCQLTWQNFFNIHQSEYHIVCDEGKHLEGTDGIHGHRFADFGE--AQLKSYNKDTANINVNMDGQSVHSRNST 4648
            H++VLA VV   LELS + L +        E+G++ +I++ N  N   EF W PV +  NG AFSIRP +G V+AF+ L C+V + P++ AP E  F L +   +  G   +    + NT   T+       IT    +C A +G+ H AF  RR++FG + +N++++++ ++ NTG  HAY+ +V     + +P  GM I P +G +PVGG  EL + + P  + KFD  I + +RG K + L++ G +  P V+I          Q+    GGV  G+  +   T+ N ++ RA +  D  +  DFT+  +    +++ + + +    + L+  Q   C L F+P+EVA+Y+F + V +N   IM           + + S++    P  ++T + SI+         A   R V ATA R P+ +S+   +F          I      ++  +  N  ++ +   L   +A      E  T K L ++   PF  S   +   IP+     I L S GE  ++ + F P  PG +   V V +N++ +  ++ I L G L +P L   P  LT  P PL+T V+ +F ++A  +     +    P +     S +             I+P      E+     I   ++F S  P+   SF  ++T++ G  +  + +SATADNC LT  +F + HQ++YH+VC      + T    GHR    GE  A   S+   T+    + + +S  +  ST
Sbjct:  609 HIVVLAQVVTVDLELSAESLTVKPCPCMLSESGLQGSISLINKRNYPAEFSWAPVPDG-NGTAFSIRPSQGTVDAFTNLVCQVTYMPTYSAPDETIFQLHVTMVHRRGCNASQRYSSNNTGRETMLCKGTVVITQEERQCFAKVGSAHCAFVERRLLFGPVALNLTTTKSVSIKNTGQNHAYFEVV-----DTHPIRGMVIVPKEGVVPVGGSTELVVHFSPDTIHKFDTHIQVNVRGGKMISLRVGGTVEPPCVDIDVVSNHGSNNQETFRLGGVYCGALATAPFTMRNMTRTRAELVLDMSRYMDFTLKFLDADEDEEPIYRGDGIYCLALEGQQSISCALEFSPSEVAAYDFIIPVSINN--IMAPSPPPSTFPPTPTPSRSNWTIP-ELDTPAPSIMG-------IATPSRRVLATALRPPLQVSHTRLEFSLPSGYFDLGIESGAGRAQGCMFVNNSDSPLSWTLHTQAAGPHL--EDGTFKFLHRTG-SPFTPSSARKKSTIPS-----ISLES-GETFQLGVLFTPPRPGLFIAHVPVILNDDRDHPYRIIELRGELHAPSLTFEPAVLTMTPVPLETPVTANFCIVAKGYRKTCTVSCEAPAVEMEDGSLQ-NVLDVCFPDGQTIKPCCVDSGEHQDPCVIPCRITFQSPSPV---SFSAMITFTDGKDRYDLPISATADNCLLTCFHFLSQHQTDYHVVCAMRTASKRTREGQGHRIT-VGEWCATSTSFGISTSTYQESSNSESASTFQST 1339          

HSP 2 Score: 118.627 bits (296), Expect = 3.362e-26
Identity = 82/263 (31.18%), Postives = 133/263 (50.57%), Query Frame = 2
Query: 5081 VSFRSSLQKRFGFSQTSTKEKISNTENIENTGLKNDSRDLYDMILYLTGRQIPGINTTVVLPTHPIERSCHIYIQHATLIAFIENQGGQLAQIKPEHLMDLPEYELWHSVGCPGLPNSD-----------MKPVQYDSNSFEKISKKAWTVVLLQILKVFILIKVTYSSYRHALQILHGKEPIPEIQLAATVSNCYSLNERILLAWLNYLYEAYRHVCWPGNSNPDIGTTSSTPVSRWIINFDNDFMDSLILATAIGAYIPFM 5836
            ++  S+    FG S TST ++ SN+E+      ++  +   D      G ++    TT  L   P   S         ++A    QG  LA + PE+L+   +Y+ W  +   G+ ++D           M   + + + F  +S++AWT VL QI+KV +L +VT   ++  +Q    + P P +      SN YS+ ERILLAW+N+ Y+A R   WPG+ +       ++P  RWI+NF+ DFMD L+LA  + AY+PF+
Sbjct:  358 IASTSATSTSFGIS-TSTYQESSNSESAST--FQSTPQPPDDKGAAKEGSEVSEDRTTYTL-DEPAAESKEKQFISTVVLAIQRTQGALLAHVTPENLLSPEDYKRWRRIQ-RGMRDTDAPLDEEIVDREMAAARKELSKFNSVSRRAWTDVLAQIIKVLVLSRVTPQLFKK-VQSPFKELPPPAVNPNPQASNVYSVGERILLAWINHHYDAQRQRAWPGSLD------GASPSCRWIVNFEFDFMDGLVLAALLAAYVPFL 608          

HSP 3 Score: 82.4185 bits (202), Expect = 3.201e-15
Identity = 79/295 (26.78%), Postives = 131/295 (44.41%), Query Frame = 2
Query: 3656 RNVSATATRQPINLSNNSFKFHF------FSISEAKSHSKQLIVFNTLEAEVEICLKFNSANWKYGTEKTTLKNLSKSRLIPFKFSC--ESEPIPNNDDYLICLSSLGEAIKIDIKFEPDHPGHYNGEVFVFINNNFEQIFQRILLTGLLESPELMCYPEHLTFIPSPLKTEVSLDFKLLAINFETKTFIRINLPLLTKPGTSEEYQPFQFVLSTSNEIQPI----SENSRVTEIRGTLSFCSDVPINVRSFMEVLTYS-GVSK-SISLSATADNCQLTWQNFFNIHQSEYHIVC 4498
            R V ATA R P+ +S+   +F          I      ++  +  N  ++ +   L   +A      E  T K L ++   PF  S   +   IP+     I L S GE  ++ + F P  PG +   V V +N++ +  ++ I L G L +P L   P  LT  P PL+T V+ +F ++A  +     +    P +     S +             I+P      E+     I   ++F S  P+   SF  ++T++ G  +  + +SATADNC LT  +F + HQ++YH+VC
Sbjct:   41 RRVLATALRPPLQVSHTRLEFSLPSGYFDLGIESGAGRAQGCMFVNNSDSPLSWTLHTQAAGPHL--EDGTFKFLHRTG-SPFTPSSARKKSTIPS-----ISLES-GETFQLGVLFTPPRPGLFIAHVPVILNDDRDHPYRIIELRGELHAPSLTFEPAVLTMTPVPLETPVTANFCIVAKGYRKTCTVSCEAPTVEMEDGSLQ-NVLDVCFPDGRTIKPCCVDSGEHQDPCVIPCRVTFQSPSPV---SFSAMITFTDGKDRYDLPISATADNCLLTCFHFLSQHQTDYHVVC 322          

HSP 4 Score: 80.1073 bits (196), Expect = 1.468e-14
Identity = 37/107 (34.58%), Postives = 62/107 (57.94%), Query Frame = 2
Query: 5009 VLLIIQRWFTMHGWAGNLHPINVPVSFRSSLQKRFGFSQTSTKEKISNTENIENTGLKNDSRDLYDMILYLTGRQIPGINTTVVLPTHPIERSCHIYIQHATLIAFI 5329
            V+L IQRWF++ GWAG   PI++P S  ++LQ     S+  +    +      ++  + + R ++D++ +L GRQ+PGI     LPT P +R   I+  +ATL+ F+
Sbjct: 1380 VVLAIQRWFSIQGWAGGPFPISIPHSLSAALQD---MSEAPSGNTAATRTTNWDSNNRKEMRSVFDLVTHLCGRQVPGIPLASALPTDPHDRVRQIHWMYATLLTFL 1483          
BLAST of cilia- and flagella-associated protein 47 vs. Ensembl Nematostella
Match: EDO26858 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAV9])

HSP 1 Score: 70.8626 bits (172), Expect = 2.886e-14
Identity = 38/97 (39.18%), Postives = 54/97 (55.67%), Query Frame = 2
Query: 8177 GNSEITVNSLSTESYLLTFTPSFIGNFDGRLIFFNDIVGEFWYKLNLTADSPIEKFIPPVKCELGKWCLVEIPLKNIDNENKLVMYPEISNPECFSI 8467
            G+  ITV+      Y L F+P+ IG+  G +IF    +GEFWY L L A +P    +P ++CE+GK     + L+N   E  LV+ P ISNP  F +
Sbjct:    5 GDPSITVHPRQQAVYRLKFSPTSIGDMSGSVIFQCPSLGEFWYDLALKATAPSPSHVPIMQCEIGKSTYQMVRLQN-PTEEALVLTPYISNPRNFRL 100          
BLAST of cilia- and flagella-associated protein 47 vs. Ensembl Medaka
Match: ENSORLT00000034688.1 (pep primary_assembly:ASM223467v1:2:23937592:23944251:1 gene:ENSORLG00000029425.1 transcript:ENSORLT00000034688.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 138.272 bits (347), Expect = 2.237e-34
Identity = 92/327 (28.13%), Postives = 144/327 (44.04%), Query Frame = 2
Query: 4997 YDADVLLIIQRWFTMHGWAGNLHPINVPVSFRSSLQKRFGFSQTSTKEKISNTENIENTGLKNDSRDLYDMILYLTGRQIPGINTTVVLPTHPIERSCH--IYIQHATLIAFIENQGGQLAQIKPEHLMDLPEYELWHSVGCPGLPNSDMKPVQYDSNSFEKISKKAWTVVLLQILKVFILIKVTYSS------YRHALQILHGKEPIPEIQLAATVSNCYSLNERILLAWLNYLYEAYRHVCWPGNSNPDIGTTSSTPVSRWIINFDNDFMDSLILATAIGAYIPFMIERHFKYMYPNPQNPEQCLHNALKIVSALKDIGLEFDIQ 5953
            ++  VL+ ++RWF++ GW    HP+ VP                                         DM+ +L+GRQIPG+     L +  +ER     +     T + F   QG  L+ I+P+ L+D  E+E W          S  + +      +E +S+++WT VLLQ  KV +L +V+         +  A  +L    P       +  SN YS  E +LL WLN  Y   R   W        G T+ TP +RWI+NFD DF D L+LA+ + A+ P+++       Y +P + E+  HN L +V  L  + L  ++Q
Sbjct:   76 FERSVLVAVERWFSLFGWPAGPHPVTVP--------------------------------------SFVDMLQHLSGRQIPGVPVCRSL-SDDVERRVQELLICSLLTYLWFFRVQGACLSHIRPQDLLDEQEFEHWSQTSVFPQAGSWHQGLDCRGAEYESLSRRSWTDVLLQTYKVLVLRRVSVGCQTSPLDHSEAAGLLFSSYP-------SVQSNVYSSQELLLLFWLNTHYHRMRGSPWAA------GGTAHTP-ARWIVNFDLDFTDGLVLASLLAAHCPYLVS-FLSRTYADPSSLEEIFHNNLLVVQVLSRLHLSMNVQ 348          
BLAST of cilia- and flagella-associated protein 47 vs. Planmine SMEST
Match: SMESG000060264.1 (SMESG000060264.1)

HSP 1 Score: 6561.48 bits (17022), Expect = 0.000e+0
Identity = 3334/3350 (99.52%), Postives = 3340/3350 (99.70%), Query Frame = 2
Query:    2 MENSIDIFGVRITPNVINFRNCEINGSYIRVVNVQNIGNKNVTVRFYSPQSKDFSMICKMHEKIISSGLSHLCSLKYTMEVEERSVDRLIVTVDGQVHEIPIFIYPSAPDLQIDRIINFGTVVMANKVVTQQANITNEGLKIGEFKLLYSGSRPLNIVPNEGIVYQQSSIPIQIEYVTHEAHKINEKCLVIFEGQDPFEIDIKGDVVKRSLELLDINSDERKLIQCIKFPYTYYGSDKSEVSLLFNNSPEKIQFVAVLEEDAVGQESGSHITMTAAGINPKECTNPLTSLITMYPNQGNLGPYERIPVLFRFSPRWISPKQAFKKTLEPPLQQTFAVFIKIQIXXXXXXXXXXXXXXKDDTLTRSQKLEVAITGTAAPVLIEMKPNSIDFGECLENEEKTEKLLFYNRSSILSSLIDFPREAHFLISPNQIRVGPNEQVEISVTFCPKQYGNFNTKQVVKVLSYVKDEENPFLEYEQTIYEQILQLTGSCVAISKSVAPKYCNGLDPLVTNKVGYLAEANFSNLGFKPHNGPATAYITTDAFATGGPQGSRLFKCTDANLHPYSNRTAFVAFPNDRAESIRPSEQNKEFRTILKRIKRYNYIDPDYAYDDEEMRKIRHHQDSYQTMIRRQHSLKKIVKLNSKFKAFENDINLGIIPGNGLYPPKLTTDQINTDKIEVFKDNKNFKLLSTKDLKQSEKVINITKLGTFNAIPTTAQEKEHCSVVLTPQQLHQIIIGPNTINFGDVCVRSISNRDINVVNNLNQFIHVSVVIDCKELRQSSPLSQVIPAKTKSSFPLVFESTKKGKFQRNLSYTINGYYQNHVIVLANVVVNQXXXXXXXXXXXXXXIYPPETGIRNTITMTNPLNCATEFLWEPVFNSTNGIAFSIRPKEGVVEAFSKLDCEVVFHPSFMAPSEGDFILRIPGNEEGSVETSSQDTLNTDTPTISNGDKSNITMKCIAILGNIHVAFQSRRVMFGNIPINMSSSRTATLLNTGGKHAYYRIVPDDLYEEYPGMTIHPLKGSIPVGGQAELTIKYHPVALSKFDCSIPIVIRGWKELDLKMSGNIIIPQVEILQKRLEFGGVPVGSEKSLDLTLINKSQCRANIEFDFIKQKDFTILTVGQCGNDKALSKDNYKCLITLKPLQEFQCQLIFTPNEVASYEFPLSVKVNQIEIMVQGAGRGQTAXXXXXXXXXXXXPVRIETVSSSIVTSDRNSILAANLIRNVSATATRQPINLSNNSFKFHFFSISEAKSHSKQLIVFNTLEAEVEICLKFNSANWKYGTEKTTLKNLSKSRLIPFKFSCESEPIPNNDDYLICLSSLGEAIKIDIKFEPDHPGHYNGEVFVFINNNFEQIFQRILLTGLLESPELMCYPEHLTFIPSPLKTEVSLDFKLLAINFETKTFIRINLPLLTKPGTSEEYQPFQFVLSTSNEIQPISENSRVTEIRGTLSFCSDVPINVRSFMEVLTYSGVSKSISLSATADNCQLTWQNFFNIHQSEYHIVCDEGKHLEGTDGIHGHRFADFGEAQLKSYNKDTANINVNMDGQSVHSRNSTTITSSNFXXXXXXXXXXXXXXXXXXXXXPIVLREGALNKIGEKVKYKSSTTPLLKQNVKPVERSNDSTLEINSSIMSDKNYVTMYMYPNQITFANXXXXXXXXXXXLNKDFDFPWDYDADVLLIIQRWFTMHGWAGNLHPINVPVSFRSSLQKRFGFSQTSTKEKISNTENIENTGLKNDSRDLYDMILYLTGRQIPGINTTVVLPTHPIERSCHIYIQHATLIAFIENQGGQLAQIKPEHLMDLPEYELWHSVGCPGLPNSDMKPVQYDSNSFEKISKKAWTVVLLQILKVFILIKVTYSSYRHALQILHGKEPIPEIQLAATVSNCYSLNERILLAWLNYLYEAYRHVCWPGNSNPDIGTTSSTPVSRWIINFDNDFMDSLILATAIGAYIPFMIERHFKYMYPNPQNPEQCLHNALKIVSALKDIGLEFDIQAIDIVDPNPVMMIXXXXXXXXXXXXYIPKSEIVFTGSLHEQITKQIQISNPTSKPLSYECIIIGNDNCDFALPKGNVVNLSGKASIKWPIVFKSRFIRSAEVTVMFVGRKTGFSIPTNLIFSVKTKIMSINPSKVEKIVGKCYIMKKINLKIISPYNKSGNFSVKLIESSEGNLKSIKETSNEFKQTETSFIKPAIAKKATLDAIKTTNKLRAFFSHCETVFINENKSGSLELFYLPFHLGIKRCTIIFSNDSIGEFVHSVEASAELPEPIIITPNDDKPKSGVWVSRAEAANRGLEGNEKTIYWKCEVGSFIQETLSIPINNIYKEYALHTAAQLHLSSQEVSRRQXXXXXXXXXXXXXXXXXXXXXXDDHDFVNSNKQIKKKADTKYSNKGKFINFEVESDSSFYTTPLIVQIPDPLMHLGNDSTKNNAIQTPSTIDIPIKFHASTAGVYPCNLVIKGPDDVRLFRIECTVTPEGNLSQIYFKIPLQEVLAQNIPIVNKTKQDWPLKATITGTSAAFSGPDFIMAKALSVSQYPLQFKPVKEGKVNAKLTLFNEADGSEHVFELYGEGESPLALESLYFECTVGENITKTLQIPNLTRKKHFFTVESDLDWMIVGDDTISILPGRNCSYDIAINPKRSGKYTGILAFVSGKKTVIEYDSDGDEIVDVYNDETVNSANKSCEIYRIWYSLVVHVSPGAPQGIFDVKCNCLEKVVLEIPINNPSEDMELKFEAAISGANLTGNSEITVNSLSTESYLLTFTPSFIGNFDGRLIFFNDIVGEFWYKLNLTADSPIEKFIPPVKCELGKWCLVEIPLKNIDNENKLVMYPEISNPECFSILIGDLELFDQDKQCFSIAPRTEHVLSVRFTPCEIGSGTHLCFLVMKSKLLGDQKFILTGCGMPPNPSDIIGVSSEAGSNMTFLIPFHNPLLEPVLIDIRITEEHQSVLDKYRIGSVNLDKDFKEMETSVFXXXXXXXXXXXXESKQSIEIPISFAPQEMRKYDAICCVVMKRKNGEPLISDEDFNDLILPNSDNITPFDKKQLRWLFPIKGVPETLVSLNVFTTPLVQGPLRIETKEHLEFNLWGLPPPVTREDFVTKSVKSAPATINDGNELKPIDRFLQDFTTELRVITVENGDAMDTATLNEYVHLFLMKQSKQLDTGVTVLTYEIRMRPLKKFRLNSEIIITSLTGGVWRFPIRFVAHDCDPDDEITIEAIGLNKPVSTRFYLNSTTYNELPFKAYFLKGGDPDFTVSPESGILPPIQSFSKFQISGLEFVVTWQPKTYSRSKGARLVIETEMMEWVYKFVGISPQYVVPDTRSIIQSNWDSDMXXXXXXXXXXXXXFLKQNIEMLSTAVSSPVKGAPLLPKIV 10051
            MENSIDIFGVRITPNVINFRNCEINGSYIRVVNVQNIGNKNVTVRFYSPQSKDFSMICKMHEKIISSGLSHLCSLKYTMEVEERSVDRLIVTVDGQVHEIPIFIYPSAPDLQIDRIINFGTVVMANKVVTQQANITNEGLKIGEFKLLYSGSRPLNIVPNEGI Y QSSIPIQIEYVTHEAHKINEKCLVIFEGQDPFEIDIKGDVVKRSLELLDINSDERKLIQCIKFPYTYYGSDKSEVSLLFNNSPEKIQFVAVLEEDAVGQESGSHITMTAAGINPKECTNPLTSLITMYPNQGNLGPYERIPVLFRFSPRWISPKQAFKKTLEPPLQQTFAVFIKIQIVGSGSDPVSESSESKDDTLTRSQKLEVAITGTAAPVLIEMKPNSIDFGECLE EEKTEKLLFYNRSSILSSLIDFPREAHFLISPNQIRVGPNEQVEISVTFCPKQYGNFNTKQVVKVLSYVKDEENPFLEYEQTIYEQILQLTGSCVAISKSVAPKYCNGLDPLVTNKVGYLAEANFSNLGFKPHNGPATAYITTDAFATGGPQGSRLFKCTDANLHPYSNRTAFVAFPNDRAESIRPSEQNKEFRTILKRIKRYNYIDPDYAYDDEEMRKIRHHQDSYQTMIRRQHSLKKIVKLNSKFKAFENDINLGIIPGNGLYPPKLTTDQINTDKIEVFKDNKNFKLLSTKDLKQSEKVINITKLGTFNAIPTTAQEKEHCSVVLTPQQLHQIIIGPNTINFGDVCVRSISNRDINVVNNLNQFIHVSVVIDCKELRQSSPLSQVIPAKTKSSFPLVFESTKKGKFQRNLSYTINGYYQNHVIVLANVVVNQLELSTDCLLLTSSSIYPPETGIRNTITMTNPLNCATEFLWEPVFNSTNGIAFSIRPKEGVVEAFSKLDCEVVFHPSFMAPSEGDFILRIPGNEEGSVETSSQDTLNTDTPTISNGDKSNITMKCIAILGNI VAFQSRRVMFGNIPINMSSSRTATLLNTGGKHAYYRIVPDDLYEEYPGMTIHPLKGSIPVGGQAELTIKYHPVALSKFDCSIPIVIRGWKELDLKMSGNIIIPQVEILQKRLEFGGVPVGSEKSLDLTLINKSQCRANIEFDFIKQKDFTILTVGQCGNDKALSKDNYKC+ITLKPLQEFQCQLIFTPNEVASYEFPLSVKVNQIEIMVQGAGRGQTASSTSSSKNTNKTPVRIETVSSSIVTSDRNSILAANLIRNVSATATRQPINLSNNSFKFHFFSISEAKSHSKQLIVFNTLEAEVEICLKFNSANWKYGTEKTTLKNLSKSRLIPFKFSCESEPIPNNDDYLICLSSLGEAIKIDIKFEPDHPGHYNGEVFVFINNNFEQIFQRILLTGLLESPELMCYPEHLTFIPSPLKTEVSLDFKLLAINFETKTFI INLPLLTKPGTSEEYQPFQFVLSTSNEIQPISENSRVTEIRGTLSFCSDVPINVRSFMEVLTYSGVSKSISLSATADNCQLTWQNFFNIHQSEYHIVCDEGKHLEGTDGIHGHRFADFGEAQLKSYNKDTANINVNMDGQSVHSRNSTTITSSNFEESSVTYEETASETESACNSTPIVLREGALNKIGEKVKYKSSTTPLLKQNVKPVERSNDSTLEINSSIMSDKNYVTMYMYPNQITFANEE+SSTKTETSLNKDFDFPWDYDADVLLIIQRWFTMHGWAGNLHPINVPVSFRSSLQKRFGFSQTSTKEKISNTENIENTGLKNDSRDLYDMILYLTGRQIPGINTTVVLPTHPIERSCHIYIQHATLIAFIENQGGQLAQIKPEHLMDLPEYELWHSVGCPGLPNSDMKPVQYDSNSFEKISKKAWT+VLLQILKVFILIKVTYSSYRHALQILHGKEPIPEIQLAATVSNCYSLNERILLAWLNYLYEAYRHVCWPGNSNPDIGTTSSTPVSRWIINFDNDFMDSLILATAIGAYIPFMIERHFKYMYPNPQNPEQCLHNALKIVSALKDIGLEFDIQAIDIVDPNPVMMILFTLNLFLSLPLYIPKSEIVFTGSLHEQITKQIQISNPTSKPLSYECIIIGNDNCDFALPKGNVVNLSGKASIKWPIVFKSRFIRSAEVTVMFVGRKTGFSIPTNLIFSVKTKIMSINPSKVEKIVGKCYIMKKINLKIISPYNKSGNFSVKLIESSEGNLKSIKETSNEFKQTETSFIKPAIAKKATLDAIKTTNKLRAFFSHCETVFINENKSGSLELFYLPFHLGIKRCTIIFSNDSIGEFVHSVEASAELPEPIIITPNDDKPKSGVWVSRAEAANRGLEGNEKTIYWKCEVGSFIQETLSIPINNIYKEYALHTAAQLHLSSQEVSRRQVTGTLNSSSLLLTAVNVLTLENDDHDFVNSNKQIKKKADTKYSNKGKFINFEVESDSSFYTTPLIVQIPDPLMHLGNDSTKNNAIQTPSTIDIPIKFHASTAGVYPCNLVIKGPDDVRLFRIECTVTPEGNLSQIYFKIPLQEVLAQNIPIVNKTKQDWPLKATITGTSAAFSGPDFIMAKALSVSQYPLQFKPVKEGKVNAKLTLFNEADGSEHVFELYGEGESPLALESLYFECTVGENITKTLQIPNLTRKKHFFTVESDLDWMIVGDDTISILPGR+CSYDIAINPKRSGKYTGILAFVSGKKTVIEYDSDGDEIVDVYNDETVNSANKSCEIYRIWYSLVVHVSPGAPQGIFDVKCNCLEKVVLEIPINNPSEDMELKFEAAISGANLTGNSEITVNSLSTESYLLTFTPSFIGN DGRLIFFNDIVGEFWYKLNLTADSPIEKFIPPVKCELGKWCLVEIPLKNIDNENKLVMYPEISNPECFSILIGDLELFDQDKQCFSIAPRTEHVLSVRFTPCEIGSGTHLCFLVMKSKLLGDQKFILTGCGMPPNPSDIIGVSSEAGSNMTFLIPFHNPLLEPVLIDIRITEEHQSVLDKYRIGSVNLDKDFKEMETSVFKLLLKNNRKLKLESKQSIEIPISFAPQEMRKYDAICCVVMKRKNGEPLISDEDFNDLILPNSDNITPFDKKQLRWLFPIKGVPETLVSLNVFTTPLVQGPLRIETKEHLEFNLWGLPPPVTREDFVTKSVKSAPATINDGNELKPIDRFLQDFTTELRVITV+NGD MDTATLNEYVHLFLMKQSKQLDTG+TVLTYEIRMRPLKKFRLNSEIIITSLTGGVWRFPIRFVAHDCDPDDEITIEAIGLNKPVSTRFYLNSTTYNELPFKAYFLKGGDPDFTVSPESGILPPIQSFSK QISGLEFVVTWQPKTYSRSKGARLVIETEMMEWVYKFVGISPQYVVP TRSIIQSNWDSDMDKDNKRKANRKKNFLKQNI MLSTAVSSPVKGAPLLPKIV
Sbjct:    1 MENSIDIFGVRITPNVINFRNCEINGSYIRVVNVQNIGNKNVTVRFYSPQSKDFSMICKMHEKIISSGLSHLCSLKYTMEVEERSVDRLIVTVDGQVHEIPIFIYPSAPDLQIDRIINFGTVVMANKVVTQQANITNEGLKIGEFKLLYSGSRPLNIVPNEGIAYPQSSIPIQIEYVTHEAHKINEKCLVIFEGQDPFEIDIKGDVVKRSLELLDINSDERKLIQCIKFPYTYYGSDKSEVSLLFNNSPEKIQFVAVLEEDAVGQESGSHITMTAAGINPKECTNPLTSLITMYPNQGNLGPYERIPVLFRFSPRWISPKQAFKKTLEPPLQQTFAVFIKIQIVGSGSDPVSESSESKDDTLTRSQKLEVAITGTAAPVLIEMKPNSIDFGECLEKEEKTEKLLFYNRSSILSSLIDFPREAHFLISPNQIRVGPNEQVEISVTFCPKQYGNFNTKQVVKVLSYVKDEENPFLEYEQTIYEQILQLTGSCVAISKSVAPKYCNGLDPLVTNKVGYLAEANFSNLGFKPHNGPATAYITTDAFATGGPQGSRLFKCTDANLHPYSNRTAFVAFPNDRAESIRPSEQNKEFRTILKRIKRYNYIDPDYAYDDEEMRKIRHHQDSYQTMIRRQHSLKKIVKLNSKFKAFENDINLGIIPGNGLYPPKLTTDQINTDKIEVFKDNKNFKLLSTKDLKQSEKVINITKLGTFNAIPTTAQEKEHCSVVLTPQQLHQIIIGPNTINFGDVCVRSISNRDINVVNNLNQFIHVSVVIDCKELRQSSPLSQVIPAKTKSSFPLVFESTKKGKFQRNLSYTINGYYQNHVIVLANVVVNQLELSTDCLLLTSSSIYPPETGIRNTITMTNPLNCATEFLWEPVFNSTNGIAFSIRPKEGVVEAFSKLDCEVVFHPSFMAPSEGDFILRIPGNEEGSVETSSQDTLNTDTPTISNGDKSNITMKCIAILGNIRVAFQSRRVMFGNIPINMSSSRTATLLNTGGKHAYYRIVPDDLYEEYPGMTIHPLKGSIPVGGQAELTIKYHPVALSKFDCSIPIVIRGWKELDLKMSGNIIIPQVEILQKRLEFGGVPVGSEKSLDLTLINKSQCRANIEFDFIKQKDFTILTVGQCGNDKALSKDNYKCIITLKPLQEFQCQLIFTPNEVASYEFPLSVKVNQIEIMVQGAGRGQTASSTSSSKNTNKTPVRIETVSSSIVTSDRNSILAANLIRNVSATATRQPINLSNNSFKFHFFSISEAKSHSKQLIVFNTLEAEVEICLKFNSANWKYGTEKTTLKNLSKSRLIPFKFSCESEPIPNNDDYLICLSSLGEAIKIDIKFEPDHPGHYNGEVFVFINNNFEQIFQRILLTGLLESPELMCYPEHLTFIPSPLKTEVSLDFKLLAINFETKTFIHINLPLLTKPGTSEEYQPFQFVLSTSNEIQPISENSRVTEIRGTLSFCSDVPINVRSFMEVLTYSGVSKSISLSATADNCQLTWQNFFNIHQSEYHIVCDEGKHLEGTDGIHGHRFADFGEAQLKSYNKDTANINVNMDGQSVHSRNSTTITSSNFEESSVTYEETASETESACNSTPIVLREGALNKIGEKVKYKSSTTPLLKQNVKPVERSNDSTLEINSSIMSDKNYVTMYMYPNQITFANEENSSTKTETSLNKDFDFPWDYDADVLLIIQRWFTMHGWAGNLHPINVPVSFRSSLQKRFGFSQTSTKEKISNTENIENTGLKNDSRDLYDMILYLTGRQIPGINTTVVLPTHPIERSCHIYIQHATLIAFIENQGGQLAQIKPEHLMDLPEYELWHSVGCPGLPNSDMKPVQYDSNSFEKISKKAWTIVLLQILKVFILIKVTYSSYRHALQILHGKEPIPEIQLAATVSNCYSLNERILLAWLNYLYEAYRHVCWPGNSNPDIGTTSSTPVSRWIINFDNDFMDSLILATAIGAYIPFMIERHFKYMYPNPQNPEQCLHNALKIVSALKDIGLEFDIQAIDIVDPNPVMMILFTLNLFLSLPLYIPKSEIVFTGSLHEQITKQIQISNPTSKPLSYECIIIGNDNCDFALPKGNVVNLSGKASIKWPIVFKSRFIRSAEVTVMFVGRKTGFSIPTNLIFSVKTKIMSINPSKVEKIVGKCYIMKKINLKIISPYNKSGNFSVKLIESSEGNLKSIKETSNEFKQTETSFIKPAIAKKATLDAIKTTNKLRAFFSHCETVFINENKSGSLELFYLPFHLGIKRCTIIFSNDSIGEFVHSVEASAELPEPIIITPNDDKPKSGVWVSRAEAANRGLEGNEKTIYWKCEVGSFIQETLSIPINNIYKEYALHTAAQLHLSSQEVSRRQVTGTLNSSSLLLTAVNVLTLENDDHDFVNSNKQIKKKADTKYSNKGKFINFEVESDSSFYTTPLIVQIPDPLMHLGNDSTKNNAIQTPSTIDIPIKFHASTAGVYPCNLVIKGPDDVRLFRIECTVTPEGNLSQIYFKIPLQEVLAQNIPIVNKTKQDWPLKATITGTSAAFSGPDFIMAKALSVSQYPLQFKPVKEGKVNAKLTLFNEADGSEHVFELYGEGESPLALESLYFECTVGENITKTLQIPNLTRKKHFFTVESDLDWMIVGDDTISILPGRSCSYDIAINPKRSGKYTGILAFVSGKKTVIEYDSDGDEIVDVYNDETVNSANKSCEIYRIWYSLVVHVSPGAPQGIFDVKCNCLEKVVLEIPINNPSEDMELKFEAAISGANLTGNSEITVNSLSTESYLLTFTPSFIGNIDGRLIFFNDIVGEFWYKLNLTADSPIEKFIPPVKCELGKWCLVEIPLKNIDNENKLVMYPEISNPECFSILIGDLELFDQDKQCFSIAPRTEHVLSVRFTPCEIGSGTHLCFLVMKSKLLGDQKFILTGCGMPPNPSDIIGVSSEAGSNMTFLIPFHNPLLEPVLIDIRITEEHQSVLDKYRIGSVNLDKDFKEMETSVFKLLLKNNRKLKLESKQSIEIPISFAPQEMRKYDAICCVVMKRKNGEPLISDEDFNDLILPNSDNITPFDKKQLRWLFPIKGVPETLVSLNVFTTPLVQGPLRIETKEHLEFNLWGLPPPVTREDFVTKSVKSAPATINDGNELKPIDRFLQDFTTELRVITVDNGDTMDTATLNEYVHLFLMKQSKQLDTGMTVLTYEIRMRPLKKFRLNSEIIITSLTGGVWRFPIRFVAHDCDPDDEITIEAIGLNKPVSTRFYLNSTTYNELPFKAYFLKGGDPDFTVSPESGILPPIQSFSKSQISGLEFVVTWQPKTYSRSKGARLVIETEMMEWVYKFVGISPQYVVPYTRSIIQSNWDSDMDKDNKRKANRKKNFLKQNIGMLSTAVSSPVKGAPLLPKIV 3350          
BLAST of cilia- and flagella-associated protein 47 vs. Planmine SMEST
Match: SMESG000016228.1 (SMESG000016228.1)

HSP 1 Score: 52.373 bits (124), Expect = 8.975e-6
Identity = 49/210 (23.33%), Postives = 88/210 (41.90%), Query Frame = 2
Query: 7325 IKGPDDVRLFRIECTVTPEGNLSQIYFKI-----PLQEVLAQNIP----------IVNKTKQDWPLKATITGTSAAFSGPDFIMAKALSVSQYPLQFKPVK---EGKVNAKLTLFNEADGSEHVFELYGEGESPLALESLYFECTVGENITKTLQIPNLTRKKHFFTV--------ESDLDWMIVGDDTISILPGRNCSYDIAINPKRSG 7876
            +K   D+R   ++C++    NLS +   +     P++E+L  N+P          I N T   W LK  I G    +SG +  + +      Y L FKP+    +GK +         DGS  ++ L G  E P A+  +  E       ++ L++PN  ++   F V        +S+    + G + + +  G +  Y + I  ++ G
Sbjct: 4557 VKPAPDIRYDNLQCSIEGWKNLSLVLTGVCQTVTPVKEILNFNVPVRQQDVKSLKIGNTTNGTWVLKPVIEG--EHWSGSETFVVEPQQTKNYELTFKPLTMTTDGKKHQGSVFIAIPDGSGILYNLSGGAEPPKAISKITREVPSRIPFSELLEVPNWLKRPQRFKVIKEVLKPEKSESSLQLKGFEYVDVPGGGSKQYKLTIVAQKEG 4764          
BLAST of cilia- and flagella-associated protein 47 vs. Planmine SMEST
Match: SMESG000016228.1 (SMESG000016228.1)

HSP 1 Score: 52.373 bits (124), Expect = 9.126e-6
Identity = 49/210 (23.33%), Postives = 88/210 (41.90%), Query Frame = 2
Query: 7325 IKGPDDVRLFRIECTVTPEGNLSQIYFKI-----PLQEVLAQNIP----------IVNKTKQDWPLKATITGTSAAFSGPDFIMAKALSVSQYPLQFKPVK---EGKVNAKLTLFNEADGSEHVFELYGEGESPLALESLYFECTVGENITKTLQIPNLTRKKHFFTV--------ESDLDWMIVGDDTISILPGRNCSYDIAINPKRSG 7876
            +K   D+R   ++C++    NLS +   +     P++E+L  N+P          I N T   W LK  I G    +SG +  + +      Y L FKP+    +GK +         DGS  ++ L G  E P A+  +  E       ++ L++PN  ++   F V        +S+    + G + + +  G +  Y + I  ++ G
Sbjct: 4550 VKPAPDIRYDNLQCSIEGWKNLSLVLTGVCQTVTPVKEILNFNVPVRQQDVKSLKIGNTTNGTWVLKPVIEG--EHWSGSETFVVEPQQTKNYELTFKPLTMTTDGKKHQGSVFIAIPDGSGILYNLSGGAEPPKAISKITREVPSRIPFSELLEVPNWLKRPQRFKVIKEVLKPEKSESSLQLKGFEYVDVPGGGSKQYKLTIVAQKEG 4757          
The following BLAST results are available for this feature:
BLAST of cilia- and flagella-associated protein 47 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CFAP471.701e-16630.81cilia and flagella associated protein 47 [Source:H... [more]
CFAP478.287e-13429.80cilia and flagella associated protein 47 [Source:H... [more]
CFAP473.403e-9628.51cilia and flagella associated protein 47 [Source:H... [more]
CFAP472.388e-5335.69cilia and flagella associated protein 47 [Source:H... [more]
HYDIN7.498e-920.97HYDIN axonemal central pair apparatus protein [Sou... [more]
back to top
BLAST of cilia- and flagella-associated protein 47 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cilia- and flagella-associated protein 47 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cilia- and flagella-associated protein 47 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
hydin7.808e-620.46HYDIN axonemal central pair apparatus protein [Sou... [more]
back to top
BLAST of cilia- and flagella-associated protein 47 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000023157.13.785e-5433.85pep primary_assembly:Xenopus_tropicalis_v9.1:2:103... [more]
back to top
BLAST of cilia- and flagella-associated protein 47 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cfap471.492e-15930.25cilia and flagella associated protein 47 [Source:M... [more]
Cfap472.620e-14032.15cilia and flagella associated protein 47 [Source:M... [more]
Cfap473.641e-6138.34cilia and flagella associated protein 47 [Source:M... [more]
Cfap471.821e-4830.86cilia and flagella associated protein 47 [Source:M... [more]
Hydin5.016e-1123.45HYDIN, axonemal central pair apparatus protein [So... [more]
back to top
BLAST of cilia- and flagella-associated protein 47 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q6ZTR5|CFA47_HUMAN8.169e-16630.81Cilia- and flagella-associated protein 47 OS=Homo ... [more]
sp|Q80W93|HYDIN_MOUSE3.508e-1023.45Hydrocephalus-inducing protein OS=Mus musculus OX=... [more]
sp|Q4G0P3|HYDIN_HUMAN3.453e-820.97Hydrocephalus-inducing protein homolog OS=Homo sap... [more]
back to top
BLAST of cilia- and flagella-associated protein 47 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|183407850.000e+034.99tr|A0A1I8G2Q9|A0A1I8G2Q9_9PLAT Calponin-homology (... [more]
gnl|BL_ORD_ID|235176070.000e+035.64tr|A0A210QA05|A0A210QA05_MIZYE Uncharacterized pro... [more]
gnl|BL_ORD_ID|239195700.000e+034.42tr|K1P8P3|K1P8P3_CRAGI Uncharacterized protein CXo... [more]
gnl|BL_ORD_ID|183403730.000e+034.95tr|A0A267DP68|A0A267DP68_9PLAT Calponin-homology (... [more]
gnl|BL_ORD_ID|157496550.000e+033.56tr|R7T4M6|R7T4M6_CAPTE Calponin-homology (CH) doma... [more]
back to top
BLAST of cilia- and flagella-associated protein 47 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
hydin1.234e-622.00HYDIN axonemal central pair apparatus protein [Sou... [more]
back to top
BLAST of cilia- and flagella-associated protein 47 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000000512.16.279e-6136.34pep scaffold:Pmarinus_7.0:GL479366:22296:26735:-1 ... [more]
back to top
BLAST of cilia- and flagella-associated protein 47 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cilia- and flagella-associated protein 47 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO328070.000e+033.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328061.009e-6728.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO268582.886e-1439.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of cilia- and flagella-associated protein 47 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000034688.12.237e-3428.13pep primary_assembly:ASM223467v1:2:23937592:239442... [more]
back to top
BLAST of cilia- and flagella-associated protein 47 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000060264.10.000e+099.52SMESG000060264.1[more]
SMESG000016228.18.975e-623.33SMESG000016228.1[more]
SMESG000016228.19.126e-623.33SMESG000016228.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005211 ID=SMED30005211|Name=cilia- and flagella-associated protein 47|organism=Schmidtea mediterranea sexual|type=transcript|length=10075bp
AATGGAAAATTCCATTGACATATTTGGCGTACGCATTACTCCAAACGTTA
TCAATTTCAGAAATTGTGAAATCAATGGATCCTACATTCGAGTTGTGAAC
GTTCAAAATATTGGAAACAAAAATGTTACAGTCAGATTTTATTCTCCTCA
ATCTAAAGATTTTTCTATGATTTGTAAAATGCATGAAAAAATAATTTCGT
CCGGACTTAGCCATTTGTGCTCATTGAAATACACGATGGAAGTGGAGGAA
CGGTCGGTTGATAGGCTGATTGTGACAGTTGACGGCCAAGTTCATGAAAT
TCCGATTTTTATCTATCCATCAGCTCCAGATTTACAAATTGATAGAATAA
TAAATTTTGGCACCGTAGTGATGGCTAACAAGGTTGTCACGCAGCAGGCC
AATATTACAAACGAGGGTTTGAAAATCGGAGAATTTAAATTATTATATAG
TGGGAGCCGGCCATTAAATATTGTTCCTAACGAAGGCATAGTTTACCAAC
AGTCTTCAATTCCTATTCAAATCGAATACGTAACTCACGAGGCTCATAAA
ATCAACGAGAAGTGCTTAGTGATATTTGAAGGTCAAGATCCGTTTGAAAT
AGATATTAAAGGGGATGTTGTGAAAAGAAGCTTGGAACTGCTGGACATAA
ATTCTGATGAAAGGAAACTTATTCAATGTATTAAATTCCCATATACTTAT
TACGGATCGGATAAATCAGAGGTATCTCTACTGTTCAACAATTCCCCGGA
AAAGATCCAATTTGTTGCGGTTCTAGAAGAAGACGCCGTTGGACAGGAAT
CGGGTTCACACATTACGATGACGGCCGCAGGAATCAATCCAAAGGAGTGC
ACAAACCCCTTGACATCTTTAATAACTATGTATCCCAATCAGGGAAACCT
TGGACCCTATGAAAGAATTCCTGTTCTTTTTCGATTCAGTCCAAGATGGA
TTTCACCGAAACAAGCATTCAAGAAGACATTGGAGCCTCCTTTGCAACAA
ACCTTTGCCGTTTTCATTAAGATTCAAATTGTTGGAAGTGGATCCGACCC
CGTTTCCGAATCATCGGAAAGTAAAGATGACACACTTACTAGAAGTCAAA
AACTGGAGGTGGCCATAACCGGCACTGCTGCTCCGGTTCTAATTGAAATG
AAACCGAATTCAATTGATTTTGGTGAATGTCTGGAAAATGAAGAGAAAAC
AGAAAAACTTTTATTCTACAATCGGTCATCCATTCTATCCAGTTTGATAG
ATTTTCCAAGAGAAGCTCACTTTTTGATTAGCCCGAATCAAATCCGTGTT
GGACCGAATGAACAGGTTGAGATAAGTGTGACCTTCTGTCCCAAACAATA
TGGAAACTTTAATACAAAACAAGTGGTTAAAGTTCTTTCTTATGTCAAAG
ACGAAGAAAATCCGTTTTTAGAATATGAACAAACGATCTACGAACAAATT
CTTCAATTAACCGGATCCTGTGTCGCGATTTCCAAATCTGTGGCACCGAA
ATACTGCAATGGGTTAGATCCATTGGTTACAAATAAAGTTGGATATCTCG
CCGAAGCTAATTTTTCTAATTTGGGTTTCAAGCCACATAATGGACCAGCC
ACTGCCTACATCACGACAGACGCCTTCGCTACTGGGGGACCTCAAGGGTC
CAGATTATTTAAATGTACAGATGCTAACTTACATCCATATAGCAACCGAA
CAGCTTTTGTCGCCTTCCCAAATGACAGAGCTGAAAGTATTAGGCCATCG
GAACAAAATAAAGAATTTCGAACGATTCTAAAACGGATCAAACGCTACAA
CTACATCGATCCAGATTATGCGTATGATGATGAAGAAATGAGAAAGATTC
GGCACCACCAAGACTCCTATCAGACAATGATAAGACGGCAGCACTCACTG
AAGAAAATTGTGAAGTTGAATTCAAAATTCAAAGCTTTCGAAAACGACAT
CAATTTAGGAATAATTCCTGGAAATGGTCTTTATCCTCCAAAGTTAACCA
CTGATCAGATAAATACAGACAAAATCGAAGTCTTCAAAGATAACAAGAAT
TTCAAATTGCTGAGCACTAAAGACCTGAAACAATCAGAAAAAGTTATCAA
TATTACTAAACTGGGGACATTCAACGCGATCCCGACAACCGCCCAGGAGA
AAGAACACTGCTCAGTGGTATTGACCCCCCAACAACTCCATCAAATTATT
ATTGGACCGAACACAATAAATTTCGGAGATGTTTGTGTCAGATCTATATC
AAATAGAGACATAAACGTTGTGAACAATTTGAACCAGTTCATCCACGTAT
CTGTCGTGATTGACTGCAAGGAACTCCGTCAGAGCAGTCCGTTATCTCAA
GTCATTCCTGCCAAAACTAAATCTAGTTTTCCACTAGTATTTGAATCAAC
TAAAAAGGGAAAATTTCAACGGAATTTGAGCTATACAATTAATGGATACT
ATCAAAATCACGTAATTGTTCTTGCAAATGTGGTTGTGAATCAATTGGAA
TTGTCGACTGACTGCCTACTACTGACTTCATCTTCAATTTACCCTCCTGA
GACTGGAATCAGAAACACAATAACAATGACTAATCCGTTAAATTGTGCCA
CAGAATTTTTATGGGAACCTGTTTTTAATTCCACTAATGGAATAGCGTTC
TCTATACGACCAAAAGAAGGAGTAGTTGAAGCATTCAGTAAACTTGACTG
TGAAGTTGTATTTCATCCATCATTCATGGCTCCGAGTGAAGGAGATTTTA
TTTTACGAATCCCCGGAAATGAAGAGGGAAGTGTCGAAACTAGTTCCCAG
GATACACTGAATACTGATACACCGACAATCTCAAATGGGGACAAGTCAAA
TATCACTATGAAATGCATTGCGATTCTAGGCAATATTCACGTTGCTTTCC
AATCACGTCGGGTAATGTTCGGCAATATTCCCATCAACATGTCGAGTTCA
CGCACCGCAACTCTATTAAATACCGGAGGAAAGCATGCATATTATAGAAT
AGTTCCAGATGACTTGTACGAAGAATATCCTGGCATGACTATTCATCCAT
TGAAAGGCTCAATTCCAGTCGGTGGTCAAGCGGAATTAACTATAAAATAT
CACCCAGTTGCACTGTCAAAATTCGACTGTTCAATTCCGATAGTTATCCG
AGGCTGGAAAGAATTAGATTTGAAAATGAGCGGAAATATCATTATTCCTC
AAGTTGAAATCTTGCAGAAGCGTTTAGAATTCGGAGGTGTACCGGTTGGG
TCAGAAAAATCGCTGGACTTAACTTTGATTAACAAATCTCAGTGCCGAGC
AAACATTGAATTCGACTTCATAAAGCAGAAAGACTTTACAATTTTGACTG
TTGGACAATGTGGAAATGACAAAGCCTTATCGAAGGATAATTATAAATGC
CTTATTACTTTGAAACCATTGCAAGAATTTCAATGCCAATTAATTTTCAC
TCCAAATGAAGTGGCTTCCTATGAGTTTCCATTATCAGTAAAAGTAAATC
AAATTGAAATTATGGTCCAAGGTGCAGGTCGTGGTCAAACTGCAAGCTCA
ACAAGTTCTTCCAAGAATACAAATAAAACTCCAGTTCGAATAGAAACAGT
TTCCTCGTCCATTGTCACATCGGATCGTAATTCAATTCTCGCAGCGAATC
TTATTCGAAATGTCAGTGCAACTGCAACGCGTCAACCGATAAATCTTTCG
AACAATTCTTTCAAGTTTCATTTCTTTTCCATTTCTGAAGCTAAATCACA
TAGCAAGCAATTGATCGTGTTCAATACTCTGGAAGCCGAAGTTGAAATCT
GTTTAAAATTCAACTCTGCCAACTGGAAGTATGGTACCGAAAAGACAACC
TTAAAGAATTTATCAAAATCAAGGTTGATACCTTTCAAATTCAGCTGTGA
ATCTGAACCTATTCCAAATAATGATGATTATTTGATATGTCTTTCTTCAC
TAGGCGAGGCGATAAAGATTGATATCAAATTCGAACCGGACCATCCAGGC
CACTACAATGGCGAGGTTTTTGTATTTATAAACAATAATTTCGAACAAAT
TTTCCAACGAATCTTGCTCACAGGTCTATTAGAATCTCCAGAACTGATGT
GCTACCCGGAACATTTGACGTTTATCCCTTCACCGTTAAAAACCGAAGTT
TCTTTAGACTTCAAGTTACTTGCCATAAATTTCGAAACAAAAACATTTAT
CCGTATTAATTTGCCTCTGTTAACCAAACCAGGCACATCTGAAGAGTACC
AACCGTTCCAATTTGTTTTGTCGACCTCAAATGAAATTCAGCCGATATCA
GAGAATTCGAGAGTGACTGAAATTCGTGGAACTTTGTCTTTCTGTTCTGA
TGTTCCAATCAATGTGAGGTCCTTTATGGAAGTGTTGACGTATTCCGGAG
TGAGCAAGTCCATAAGTCTCAGTGCTACGGCCGATAACTGCCAGTTGACT
TGGCAAAATTTCTTTAACATCCATCAATCGGAATATCACATTGTTTGTGA
TGAAGGAAAACATTTAGAAGGCACAGATGGAATTCATGGTCATAGATTCG
CAGATTTTGGTGAGGCACAACTGAAGTCATACAATAAGGACACGGCTAAT
ATCAACGTTAACATGGACGGTCAATCTGTTCACAGTCGAAATAGTACAAC
AATTACCAGCTCAAATTTCGAAGAATCCTCAGTGACCTATGAAGAAACTG
CCAGTGAAACCGAATCCGCATGTAATAGCACTCCGATTGTACTTCGAGAG
GGTGCACTAAATAAAATTGGAGAAAAGGTTAAATATAAATCATCTACTAC
TCCTTTACTCAAGCAAAATGTCAAGCCTGTTGAAAGATCAAACGACAGCA
CTTTGGAAATCAACAGTTCAATTATGTCGGACAAAAATTATGTCACAATG
TACATGTATCCTAACCAAATTACTTTTGCCAATGAAGAGAGCTCATCTAC
TAAAACTGAGACAAGTTTGAATAAAGATTTTGATTTTCCATGGGATTATG
ATGCCGACGTATTGCTGATCATTCAAAGATGGTTCACCATGCATGGCTGG
GCGGGAAATTTACATCCTATAAATGTCCCTGTTAGCTTCCGAAGTAGTCT
TCAAAAACGTTTCGGGTTTTCTCAGACATCTACGAAAGAAAAAATCTCCA
ATACTGAGAATATTGAAAATACAGGTTTGAAAAACGACTCACGAGATCTG
TATGACATGATTCTGTATCTGACCGGAAGACAAATACCAGGCATCAATAC
GACTGTTGTTCTACCAACCCATCCGATTGAGCGATCTTGCCACATTTACA
TACAGCACGCCACGTTGATAGCCTTCATAGAAAATCAAGGTGGTCAACTA
GCTCAAATAAAGCCTGAGCATCTAATGGATTTACCAGAATATGAATTGTG
GCATTCCGTCGGTTGTCCCGGGTTACCAAATAGTGATATGAAGCCAGTTC
AATATGACAGCAATTCGTTTGAAAAGATATCCAAAAAAGCTTGGACCGTT
GTTCTATTGCAAATACTAAAAGTTTTCATACTTATTAAAGTCACTTATTC
GTCATATCGGCACGCACTTCAGATTTTACATGGAAAGGAACCGATACCAG
AAATCCAGCTAGCAGCGACAGTGTCTAATTGTTATTCGCTTAATGAGAGA
ATTCTGTTAGCATGGCTCAATTACTTATATGAAGCTTACCGTCATGTTTG
TTGGCCAGGAAATAGTAATCCAGACATAGGGACAACTTCATCAACCCCCG
TTTCTAGATGGATTATAAATTTTGATAATGACTTCATGGATTCGTTGATT
TTAGCCACTGCGATCGGGGCTTATATTCCATTTATGATTGAACGTCATTT
TAAATACATGTACCCAAATCCTCAAAATCCCGAACAATGCTTGCATAATG
CCCTGAAAATAGTAAGTGCATTGAAAGACATAGGACTAGAATTCGACATT
CAAGCCATAGATATTGTGGATCCAAACCCAGTGATGATGATTCTGTTTAC
TTTGAATCTATTTCTTTCACTACCTCTTTACATTCCTAAATCTGAAATAG
TTTTCACAGGATCCCTTCATGAGCAGATCACGAAACAGATCCAAATTTCA
AATCCAACCAGTAAACCTTTATCGTACGAATGCATTATTATAGGAAATGA
CAATTGCGACTTTGCGTTGCCCAAGGGCAATGTTGTCAACCTGTCGGGTA
AAGCCTCAATAAAATGGCCTATCGTATTTAAATCGCGATTTATTCGTTCG
GCTGAAGTCACTGTCATGTTTGTCGGTCGCAAAACTGGATTCTCTATTCC
TACTAATTTGATCTTCTCTGTCAAGACGAAAATTATGTCAATAAATCCAT
CGAAAGTGGAAAAAATAGTAGGAAAGTGCTATATAATGAAAAAAATCAAC
CTGAAAATTATAAGCCCATACAATAAATCTGGAAATTTCTCAGTTAAACT
CATTGAAAGTTCTGAAGGAAATCTCAAATCCATCAAGGAAACATCAAATG
AATTTAAACAAACCGAAACCTCATTTATCAAACCTGCTATCGCTAAAAAG
GCAACTTTAGATGCCATTAAAACAACAAATAAACTGCGAGCATTCTTTTC
CCACTGTGAAACTGTATTTATCAATGAAAACAAGAGTGGTAGTTTAGAGT
TATTTTACTTGCCTTTCCACCTGGGAATTAAAAGATGTACTATTATATTC
TCAAATGACTCCATCGGAGAGTTCGTCCACAGCGTGGAAGCCTCTGCAGA
GTTGCCAGAACCAATTATTATTACTCCTAACGACGATAAACCAAAATCTG
GAGTTTGGGTCTCAAGAGCAGAAGCTGCCAATCGAGGCCTAGAAGGTAAT
GAAAAAACAATATATTGGAAATGTGAAGTTGGCTCATTTATACAAGAAAC
ACTTTCGATTCCGATCAACAATATCTATAAAGAATATGCACTCCATACTG
CAGCTCAGCTTCATTTATCATCTCAAGAGGTCAGTCGAAGACAAGTGACA
GGAACATTGAATAGTAGTAGCCTTCTTCTAACGGCAGTAAATGTATTAAC
CCTTGAAAATGATGATCACGATTTTGTTAATTCAAACAAACAAATCAAGA
AAAAAGCTGACACGAAATACAGCAATAAAGGAAAGTTCATTAATTTTGAA
GTTGAATCGGATTCATCATTTTATACGACTCCTTTAATTGTGCAAATTCC
GGATCCCCTAATGCACTTGGGAAATGACTCCACAAAAAATAACGCGATTC
AAACCCCAAGCACTATTGATATTCCAATCAAATTTCATGCTTCCACCGCA
GGTGTTTATCCGTGCAATTTGGTCATTAAAGGTCCTGATGATGTGAGATT
GTTTCGTATCGAATGCACCGTGACGCCAGAAGGGAATTTGTCTCAAATTT
ACTTTAAAATACCATTACAAGAAGTTTTAGCTCAAAACATACCGATTGTC
AATAAGACTAAACAAGATTGGCCACTGAAAGCCACAATTACAGGAACATC
TGCAGCGTTTTCAGGCCCAGATTTTATAATGGCAAAGGCTCTGTCGGTTT
CTCAGTATCCTTTGCAATTCAAACCAGTGAAGGAGGGTAAAGTCAACGCG
AAATTGACATTATTTAATGAAGCTGATGGCAGTGAACACGTTTTTGAACT
TTATGGCGAAGGTGAAAGTCCTTTAGCCTTAGAATCGCTATATTTCGAAT
GCACTGTAGGCGAAAATATCACGAAAACTTTACAAATTCCGAATTTGACT
CGCAAGAAACATTTTTTTACCGTTGAAAGTGATTTGGACTGGATGATAGT
TGGCGATGATACCATTTCCATTTTGCCAGGACGTAACTGCTCATACGACA
TCGCGATCAACCCAAAACGCAGTGGCAAATACACGGGAATTCTTGCTTTT
GTGTCTGGCAAGAAGACAGTCATTGAATATGACAGTGATGGAGATGAGAT
TGTGGATGTTTACAACGATGAGACAGTAAACAGTGCTAACAAATCGTGCG
AAATCTATAGAATTTGGTATTCATTAGTAGTGCACGTATCACCAGGTGCA
CCTCAAGGAATTTTCGATGTTAAATGTAATTGTCTAGAAAAAGTAGTATT
AGAAATCCCAATAAATAATCCTTCCGAAGACATGGAGTTAAAGTTTGAGG
CTGCCATATCTGGAGCAAATCTGACGGGTAACAGCGAAATTACTGTTAAT
TCCTTGAGTACAGAATCTTATCTCTTGACTTTTACACCTTCTTTCATTGG
AAATTTTGATGGGAGATTAATATTTTTCAATGACATTGTCGGTGAATTTT
GGTACAAATTGAATCTCACCGCTGACAGTCCTATTGAAAAGTTTATCCCT
CCTGTAAAATGTGAGCTCGGAAAATGGTGCTTGGTTGAAATTCCATTAAA
AAATATTGACAATGAAAACAAACTAGTCATGTATCCTGAAATTTCTAATC
CTGAATGCTTCAGCATTCTCATTGGGGACCTCGAATTATTTGATCAGGAC
AAACAATGTTTCTCCATTGCCCCTCGAACTGAACACGTGCTATCAGTTCG
TTTTACGCCTTGTGAAATCGGCTCAGGGACCCATCTGTGTTTTCTCGTTA
TGAAATCTAAATTGCTTGGAGATCAAAAATTTATTTTGACTGGTTGTGGA
ATGCCACCCAATCCTAGCGATATTATTGGAGTGTCTTCTGAAGCGGGTTC
TAACATGACGTTTCTTATTCCATTCCACAATCCGCTATTAGAACCAGTTT
TGATTGATATAAGGATTACTGAAGAACATCAAAGTGTGCTTGACAAGTAT
CGAATAGGCTCAGTGAACCTTGACAAAGATTTCAAGGAGATGGAAACAAG
TGTTTTCAAGCTGCTGTTGAAAAATAATCGGAAGCTAAAATTGGAATCAA
AACAGTCCATAGAAATCCCAATCTCCTTCGCTCCGCAAGAGATGAGAAAG
TACGACGCAATATGCTGTGTGGTTATGAAACGTAAAAACGGAGAGCCATT
AATTTCTGATGAAGACTTCAATGATTTAATTCTACCGAATTCTGATAACA
TAACTCCGTTCGATAAGAAACAATTACGCTGGTTGTTCCCGATAAAAGGT
GTTCCTGAAACTTTGGTATCATTGAATGTTTTCACAACTCCATTAGTGCA
AGGTCCCCTTAGGATTGAAACGAAGGAACATTTGGAATTCAATCTCTGGG
GACTGCCTCCGCCTGTTACTCGAGAAGATTTTGTTACTAAATCAGTGAAG
AGTGCCCCAGCAACAATAAATGATGGAAACGAACTCAAACCGATTGATAG
GTTTTTGCAGGATTTTACGACAGAACTTCGAGTTATAACCGTCGAAAATG
GAGACGCAATGGACACGGCAACTTTAAATGAATATGTGCATTTGTTTCTT
ATGAAACAAAGCAAACAGTTGGATACTGGAGTGACGGTTTTAACTTATGA
AATAAGAATGCGGCCTCTCAAAAAATTCAGACTCAATTCCGAAATAATTA
TAACATCCTTAACTGGCGGAGTTTGGAGATTTCCTATTCGTTTTGTGGCA
CATGACTGTGACCCAGATGACGAGATAACCATTGAAGCTATCGGTCTCAA
TAAGCCTGTCAGTACACGATTTTATTTGAACAGCACAACTTACAATGAAT
TACCATTCAAGGCCTACTTTCTTAAAGGAGGTGACCCGGACTTTACAGTA
TCTCCCGAGAGTGGAATTTTACCACCGATCCAATCGTTCTCGAAATTCCA
AATATCTGGATTGGAATTTGTGGTGACATGGCAACCTAAGACCTATAGTC
GATCTAAAGGTGCCAGATTAGTAATAGAGACTGAAATGATGGAATGGGTG
TATAAATTTGTTGGAATCAGTCCTCAGTACGTGGTGCCAGATACTCGGTC
AATTATTCAGTCGAATTGGGACAGTGATATGGATAAAGATAATAAGAGAA
AAGCAAATAGAAAGAAGAATTTCCTCAAACAAAATATTGAAATGCTATCT
ACCGCGGTTTCCTCCCCGGTTAAAGGAGCCCCATTATTACCGAAAATTGT
TTAAATATAAACATCAAAAAAGATT
back to top

protein sequence of SMED30005211-orf-1

>SMED30005211-orf-1 ID=SMED30005211-orf-1|Name=SMED30005211-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=3351bp
MENSIDIFGVRITPNVINFRNCEINGSYIRVVNVQNIGNKNVTVRFYSPQ
SKDFSMICKMHEKIISSGLSHLCSLKYTMEVEERSVDRLIVTVDGQVHEI
PIFIYPSAPDLQIDRIINFGTVVMANKVVTQQANITNEGLKIGEFKLLYS
GSRPLNIVPNEGIVYQQSSIPIQIEYVTHEAHKINEKCLVIFEGQDPFEI
DIKGDVVKRSLELLDINSDERKLIQCIKFPYTYYGSDKSEVSLLFNNSPE
KIQFVAVLEEDAVGQESGSHITMTAAGINPKECTNPLTSLITMYPNQGNL
GPYERIPVLFRFSPRWISPKQAFKKTLEPPLQQTFAVFIKIQIVGSGSDP
VSESSESKDDTLTRSQKLEVAITGTAAPVLIEMKPNSIDFGECLENEEKT
EKLLFYNRSSILSSLIDFPREAHFLISPNQIRVGPNEQVEISVTFCPKQY
GNFNTKQVVKVLSYVKDEENPFLEYEQTIYEQILQLTGSCVAISKSVAPK
YCNGLDPLVTNKVGYLAEANFSNLGFKPHNGPATAYITTDAFATGGPQGS
RLFKCTDANLHPYSNRTAFVAFPNDRAESIRPSEQNKEFRTILKRIKRYN
YIDPDYAYDDEEMRKIRHHQDSYQTMIRRQHSLKKIVKLNSKFKAFENDI
NLGIIPGNGLYPPKLTTDQINTDKIEVFKDNKNFKLLSTKDLKQSEKVIN
ITKLGTFNAIPTTAQEKEHCSVVLTPQQLHQIIIGPNTINFGDVCVRSIS
NRDINVVNNLNQFIHVSVVIDCKELRQSSPLSQVIPAKTKSSFPLVFEST
KKGKFQRNLSYTINGYYQNHVIVLANVVVNQLELSTDCLLLTSSSIYPPE
TGIRNTITMTNPLNCATEFLWEPVFNSTNGIAFSIRPKEGVVEAFSKLDC
EVVFHPSFMAPSEGDFILRIPGNEEGSVETSSQDTLNTDTPTISNGDKSN
ITMKCIAILGNIHVAFQSRRVMFGNIPINMSSSRTATLLNTGGKHAYYRI
VPDDLYEEYPGMTIHPLKGSIPVGGQAELTIKYHPVALSKFDCSIPIVIR
GWKELDLKMSGNIIIPQVEILQKRLEFGGVPVGSEKSLDLTLINKSQCRA
NIEFDFIKQKDFTILTVGQCGNDKALSKDNYKCLITLKPLQEFQCQLIFT
PNEVASYEFPLSVKVNQIEIMVQGAGRGQTASSTSSSKNTNKTPVRIETV
SSSIVTSDRNSILAANLIRNVSATATRQPINLSNNSFKFHFFSISEAKSH
SKQLIVFNTLEAEVEICLKFNSANWKYGTEKTTLKNLSKSRLIPFKFSCE
SEPIPNNDDYLICLSSLGEAIKIDIKFEPDHPGHYNGEVFVFINNNFEQI
FQRILLTGLLESPELMCYPEHLTFIPSPLKTEVSLDFKLLAINFETKTFI
RINLPLLTKPGTSEEYQPFQFVLSTSNEIQPISENSRVTEIRGTLSFCSD
VPINVRSFMEVLTYSGVSKSISLSATADNCQLTWQNFFNIHQSEYHIVCD
EGKHLEGTDGIHGHRFADFGEAQLKSYNKDTANINVNMDGQSVHSRNSTT
ITSSNFEESSVTYEETASETESACNSTPIVLREGALNKIGEKVKYKSSTT
PLLKQNVKPVERSNDSTLEINSSIMSDKNYVTMYMYPNQITFANEESSST
KTETSLNKDFDFPWDYDADVLLIIQRWFTMHGWAGNLHPINVPVSFRSSL
QKRFGFSQTSTKEKISNTENIENTGLKNDSRDLYDMILYLTGRQIPGINT
TVVLPTHPIERSCHIYIQHATLIAFIENQGGQLAQIKPEHLMDLPEYELW
HSVGCPGLPNSDMKPVQYDSNSFEKISKKAWTVVLLQILKVFILIKVTYS
SYRHALQILHGKEPIPEIQLAATVSNCYSLNERILLAWLNYLYEAYRHVC
WPGNSNPDIGTTSSTPVSRWIINFDNDFMDSLILATAIGAYIPFMIERHF
KYMYPNPQNPEQCLHNALKIVSALKDIGLEFDIQAIDIVDPNPVMMILFT
LNLFLSLPLYIPKSEIVFTGSLHEQITKQIQISNPTSKPLSYECIIIGND
NCDFALPKGNVVNLSGKASIKWPIVFKSRFIRSAEVTVMFVGRKTGFSIP
TNLIFSVKTKIMSINPSKVEKIVGKCYIMKKINLKIISPYNKSGNFSVKL
IESSEGNLKSIKETSNEFKQTETSFIKPAIAKKATLDAIKTTNKLRAFFS
HCETVFINENKSGSLELFYLPFHLGIKRCTIIFSNDSIGEFVHSVEASAE
LPEPIIITPNDDKPKSGVWVSRAEAANRGLEGNEKTIYWKCEVGSFIQET
LSIPINNIYKEYALHTAAQLHLSSQEVSRRQVTGTLNSSSLLLTAVNVLT
LENDDHDFVNSNKQIKKKADTKYSNKGKFINFEVESDSSFYTTPLIVQIP
DPLMHLGNDSTKNNAIQTPSTIDIPIKFHASTAGVYPCNLVIKGPDDVRL
FRIECTVTPEGNLSQIYFKIPLQEVLAQNIPIVNKTKQDWPLKATITGTS
AAFSGPDFIMAKALSVSQYPLQFKPVKEGKVNAKLTLFNEADGSEHVFEL
YGEGESPLALESLYFECTVGENITKTLQIPNLTRKKHFFTVESDLDWMIV
GDDTISILPGRNCSYDIAINPKRSGKYTGILAFVSGKKTVIEYDSDGDEI
VDVYNDETVNSANKSCEIYRIWYSLVVHVSPGAPQGIFDVKCNCLEKVVL
EIPINNPSEDMELKFEAAISGANLTGNSEITVNSLSTESYLLTFTPSFIG
NFDGRLIFFNDIVGEFWYKLNLTADSPIEKFIPPVKCELGKWCLVEIPLK
NIDNENKLVMYPEISNPECFSILIGDLELFDQDKQCFSIAPRTEHVLSVR
FTPCEIGSGTHLCFLVMKSKLLGDQKFILTGCGMPPNPSDIIGVSSEAGS
NMTFLIPFHNPLLEPVLIDIRITEEHQSVLDKYRIGSVNLDKDFKEMETS
VFKLLLKNNRKLKLESKQSIEIPISFAPQEMRKYDAICCVVMKRKNGEPL
ISDEDFNDLILPNSDNITPFDKKQLRWLFPIKGVPETLVSLNVFTTPLVQ
GPLRIETKEHLEFNLWGLPPPVTREDFVTKSVKSAPATINDGNELKPIDR
FLQDFTTELRVITVENGDAMDTATLNEYVHLFLMKQSKQLDTGVTVLTYE
IRMRPLKKFRLNSEIIITSLTGGVWRFPIRFVAHDCDPDDEITIEAIGLN
KPVSTRFYLNSTTYNELPFKAYFLKGGDPDFTVSPESGILPPIQSFSKFQ
ISGLEFVVTWQPKTYSRSKGARLVIETEMMEWVYKFVGISPQYVVPDTRS
IIQSNWDSDMDKDNKRKANRKKNFLKQNIEMLSTAVSSPVKGAPLLPKIV
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036872CH_dom_sf
IPR013783Ig-like_fold
IPR001715CH-domain
IPR019774Aromatic-AA_hydroxylase_C
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0016714oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
Vocabulary: cellular component
TermDefinition
GO:0031514motile cilium
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001715Calponin homology domainSMARTSM00033ch_5coord: 1881..2006
e-value: 1.2E-4
score: 31.5
IPR001715Calponin homology domainPROSITEPS50021CHcoord: 1879..2008
score: 15.639
IPR036872CH domain superfamilyGENE3DG3DSA:1.10.418.10coord: 1879..2009
e-value: 6.7E-12
score: 47.3
IPR036872CH domain superfamilySUPERFAMILYSSF47576Calponin-homology domain, CH-domaincoord: 1880..2006
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 376..475
e-value: 8.6E-10
score: 40.7
coord: 961..1063
e-value: 2.1E-12
score: 49.1
coord: 107..208
e-value: 5.9E-7
score: 31.6
coord: 730..828
e-value: 2.3E-6
score: 29.6
coord: 829..931
e-value: 1.9E-6
score: 29.9
coord: 1064..1182
e-value: 5.6E-8
score: 34.8
NoneNo IPR availablePANTHERPTHR45912FAMILY NOT NAMEDcoord: 11..3339