Phospholipid scramblase

Overview
NamePhospholipid scramblase
Smed IDSMED30005191
Length (bp)1085
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phospholipid scramblase (SMED30005191) t-SNE clustered cells

Violin plots show distribution of expression levels for Phospholipid scramblase (SMED30005191) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phospholipid scramblase (SMED30005191) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phospholipid scramblase (SMED30005191) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005191

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30005191SMESG000050656.1 dd_Smed_v4_6444_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30005191SMESG000050656.1 dd_Smed_v4_6444_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30005191SMESG000050656.1 dd_Smed_v6_6444_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30005191SMESG000050656.1 Contig14553newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30005191SMESG000050656.1 Contig14553uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30005191SMESG000050656.1 Contig14553newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30005191SMESG000050656.1 Contig14553uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30005191SMESG000050656.1 dd_Smed_v4_6444_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30005191SMESG000050656.1 dd_Smed_v4_6444_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30005191SMESG000050656.1 dd_Smed_v4_6444_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phospholipid scramblase vs. Ensembl Human
Match: PLSCR1 (phospholipid scramblase 1 [Source:HGNC Symbol;Acc:HGNC:9092])

HSP 1 Score: 202.601 bits (514), Expect = 4.575e-62
Identity = 105/244 (43.03%), Postives = 152/244 (62.30%), Query Frame = 3
Query:  150 VTWVTAPVVP-GCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGD-DYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFENKNKDSNGAFSW 875
            V W+ AP  P  CPPGLEYL+QI+Q+L+ Q  +L+EV T ++TNNKY + N  GQ V++A E+  CC R  CG +R F + + DN  Q V+ + RPL+C        C  C   E+E+QAPPG  IGYV Q +  C  ++ I ++ +  +L++ GP    C C GD D+   + + +    +GKI+K W+G  +E +T ADNFG+QFP+DLDVK KA+++ A FLIDFM+FE+       +  W
Sbjct:   83 VPWMPAPQPPLNCPPGLEYLSQIDQILIHQQIELLEVLTGFETNNKYEIKNSFGQRVYFAAEDTDCCTRNCCGPSRPFTLRIIDNMGQEVITLERPLRCSSC-----CCPCCLQEIEIQAPPGVPIGYVIQTWHPCLPKFTIQNEKREDVLKISGP-CVVCSCCGDVDF--EIKSLDEQCVVGKISKHWTGILREAFTDADNFGIQFPLDLDVKMKAVMIGACFLIDFMFFESTGSQEQKSGVW 318          
BLAST of Phospholipid scramblase vs. Ensembl Human
Match: PLSCR1 (phospholipid scramblase 1 [Source:HGNC Symbol;Acc:HGNC:9092])

HSP 1 Score: 202.601 bits (514), Expect = 4.642e-62
Identity = 105/244 (43.03%), Postives = 152/244 (62.30%), Query Frame = 3
Query:  150 VTWVTAPVVP-GCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGD-DYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFENKNKDSNGAFSW 875
            V W+ AP  P  CPPGLEYL+QI+Q+L+ Q  +L+EV T ++TNNKY + N  GQ V++A E+  CC R  CG +R F + + DN  Q V+ + RPL+C        C  C   E+E+QAPPG  IGYV Q +  C  ++ I ++ +  +L++ GP    C C GD D+   + + +    +GKI+K W+G  +E +T ADNFG+QFP+DLDVK KA+++ A FLIDFM+FE+       +  W
Sbjct:   76 VPWMPAPQPPLNCPPGLEYLSQIDQILIHQQIELLEVLTGFETNNKYEIKNSFGQRVYFAAEDTDCCTRNCCGPSRPFTLRIIDNMGQEVITLERPLRCSSC-----CCPCCLQEIEIQAPPGVPIGYVIQTWHPCLPKFTIQNEKREDVLKISGP-CVVCSCCGDVDF--EIKSLDEQCVVGKISKHWTGILREAFTDADNFGIQFPLDLDVKMKAVMIGACFLIDFMFFESTGSQEQKSGVW 311          
BLAST of Phospholipid scramblase vs. Ensembl Human
Match: PLSCR3 (phospholipid scramblase 3 [Source:HGNC Symbol;Acc:HGNC:16495])

HSP 1 Score: 191.43 bits (485), Expect = 5.922e-58
Identity = 93/233 (39.91%), Postives = 140/233 (60.09%), Query Frame = 3
Query:  174 VPGCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFENKNKDSNGAFS 872
            +PG P GLE+L QI+Q+L+ Q  + +E F  ++T N+Y + +  GQ +  A EE+ CC R  CG+ R   + + D  ++ V+ + RPL C      C+C  C   E+EVQAPPG  IG+V Q +     +++I D D+  +LR+ GP +  C C G D    V T +    +G+I+KQW G  +E  T AD+FG+QFP+DLDV+ KA++L A FLID+M+FE +      A +
Sbjct:   69 LPGVPSGLEFLVQIDQILIHQKAERVETFLGWETCNRYELRSGAGQPLGQAAEESNCCARLCCGARRPLRVRLADPGDREVLRLLRPLHCG-----CSCCPCGLQEMEVQAPPGTTIGHVLQTWHPFLPKFSIQDADRQTVLRVVGPCWT-CGC-GTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFGLQFPLDLDVRVKAVLLGATFLIDYMFFEKRGGAGPSAVT 294          
BLAST of Phospholipid scramblase vs. Ensembl Human
Match: PLSCR3 (phospholipid scramblase 3 [Source:HGNC Symbol;Acc:HGNC:16495])

HSP 1 Score: 191.43 bits (485), Expect = 5.922e-58
Identity = 93/233 (39.91%), Postives = 140/233 (60.09%), Query Frame = 3
Query:  174 VPGCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFENKNKDSNGAFS 872
            +PG P GLE+L QI+Q+L+ Q  + +E F  ++T N+Y + +  GQ +  A EE+ CC R  CG+ R   + + D  ++ V+ + RPL C      C+C  C   E+EVQAPPG  IG+V Q +     +++I D D+  +LR+ GP +  C C G D    V T +    +G+I+KQW G  +E  T AD+FG+QFP+DLDV+ KA++L A FLID+M+FE +      A +
Sbjct:   69 LPGVPSGLEFLVQIDQILIHQKAERVETFLGWETCNRYELRSGAGQPLGQAAEESNCCARLCCGARRPLRVRLADPGDREVLRLLRPLHCG-----CSCCPCGLQEMEVQAPPGTTIGHVLQTWHPFLPKFSIQDADRQTVLRVVGPCWT-CGC-GTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFGLQFPLDLDVRVKAVLLGATFLIDYMFFEKRGGAGPSAVT 294          
BLAST of Phospholipid scramblase vs. Ensembl Human
Match: PLSCR3 (phospholipid scramblase 3 [Source:HGNC Symbol;Acc:HGNC:16495])

HSP 1 Score: 191.43 bits (485), Expect = 5.922e-58
Identity = 93/233 (39.91%), Postives = 140/233 (60.09%), Query Frame = 3
Query:  174 VPGCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFENKNKDSNGAFS 872
            +PG P GLE+L QI+Q+L+ Q  + +E F  ++T N+Y + +  GQ +  A EE+ CC R  CG+ R   + + D  ++ V+ + RPL C      C+C  C   E+EVQAPPG  IG+V Q +     +++I D D+  +LR+ GP +  C C G D    V T +    +G+I+KQW G  +E  T AD+FG+QFP+DLDV+ KA++L A FLID+M+FE +      A +
Sbjct:   69 LPGVPSGLEFLVQIDQILIHQKAERVETFLGWETCNRYELRSGAGQPLGQAAEESNCCARLCCGARRPLRVRLADPGDREVLRLLRPLHCG-----CSCCPCGLQEMEVQAPPGTTIGHVLQTWHPFLPKFSIQDADRQTVLRVVGPCWT-CGC-GTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFGLQFPLDLDVRVKAVLLGATFLIDYMFFEKRGGAGPSAVT 294          
BLAST of Phospholipid scramblase vs. Ensembl Celegans
Match: scrm-1 (Phospholipid scramblase [Source:UniProtKB/TrEMBL;Acc:Q7JKP1])

HSP 1 Score: 174.481 bits (441), Expect = 6.780e-52
Identity = 95/239 (39.75%), Postives = 144/239 (60.25%), Query Frame = 3
Query:  168 PVVPGCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELE--VQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYC-FCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFE--NKNKDSNGAF 869
            P + G P GLEYLT ++ ++V Q+ +LIE+ T+++T NKY++ N  G+  +YA EE+GCC R  CG  R FV+++ DN  + V+ I+R  KC   G C   +     + E  ++ P   V+G ++Q        Y I+D D N+I ++ GP  C  C C   ++P  + TAN    +G ITK+W G  +E +T AD F V FP DLDVK K +++ A FLIDFM FE  ++N+++ GA+
Sbjct:   55 PAIQGVPTGLEYLTYLDTIMVHQIKELIEIVTDWETKNKYVLKNANGEQCYYAFEESGCCERQCCGPQRGFVMHIVDNFKREVLTIKREFKCCGGGCCGCLACIGCCQQECIIETPSMGVLGIIRQRCGCMSSNYDIMDGDGNVIFQIDGPCCCMLCGCQDKEFP--IKTANNGTVVGAITKKWGGCFREAFTDADTFAVNFPGDLDVKLKGVLIGATFLIDFMEFEQQSQNRNNGGAY 291          
BLAST of Phospholipid scramblase vs. Ensembl Celegans
Match: scrm-1 (Phospholipid scramblase [Source:UniProtKB/TrEMBL;Acc:Q7JKP1])

HSP 1 Score: 173.711 bits (439), Expect = 1.114e-51
Identity = 93/234 (39.74%), Postives = 140/234 (59.83%), Query Frame = 3
Query:  168 PVVPGCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELE--VQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYC-FCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFENKNKDSN 860
            P + G P GLEYLT ++ ++V Q+ +LIE+ T+++T NKY++ N  G+  +YA EE+GCC R  CG  R FV+++ DN  + V+ I+R  KC   G C   +     + E  ++ P   V+G ++Q        Y I+D D N+I ++ GP  C  C C   ++P  + TAN    +G ITK+W G  +E +T AD F V FP DLDVK K +++ A FLIDFM FE ++++ N
Sbjct:   55 PAIQGVPTGLEYLTYLDTIMVHQIKELIEIVTDWETKNKYVLKNANGEQCYYAFEESGCCERQCCGPQRGFVMHIVDNFKREVLTIKREFKCCGGGCCGCLACIGCCQQECIIETPSMGVLGIIRQRCGCMSSNYDIMDGDGNVIFQIDGPCCCMLCGCQDKEFP--IKTANNGTVVGAITKKWGGCFREAFTDADTFAVNFPGDLDVKLKGVLIGATFLIDFMEFEQQSQNRN 286          
BLAST of Phospholipid scramblase vs. Ensembl Celegans
Match: scrm-1 (Phospholipid scramblase [Source:UniProtKB/TrEMBL;Acc:Q7JKP1])

HSP 1 Score: 173.711 bits (439), Expect = 1.114e-51
Identity = 93/234 (39.74%), Postives = 140/234 (59.83%), Query Frame = 3
Query:  168 PVVPGCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELE--VQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYC-FCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFENKNKDSN 860
            P + G P GLEYLT ++ ++V Q+ +LIE+ T+++T NKY++ N  G+  +YA EE+GCC R  CG  R FV+++ DN  + V+ I+R  KC   G C   +     + E  ++ P   V+G ++Q        Y I+D D N+I ++ GP  C  C C   ++P  + TAN    +G ITK+W G  +E +T AD F V FP DLDVK K +++ A FLIDFM FE ++++ N
Sbjct:   55 PAIQGVPTGLEYLTYLDTIMVHQIKELIEIVTDWETKNKYVLKNANGEQCYYAFEESGCCERQCCGPQRGFVMHIVDNFKREVLTIKREFKCCGGGCCGCLACIGCCQQECIIETPSMGVLGIIRQRCGCMSSNYDIMDGDGNVIFQIDGPCCCMLCGCQDKEFP--IKTANNGTVVGAITKKWGGCFREAFTDADTFAVNFPGDLDVKLKGVLIGATFLIDFMEFEQQSQNRN 286          
BLAST of Phospholipid scramblase vs. Ensembl Celegans
Match: scrm-1 (Phospholipid scramblase [Source:UniProtKB/TrEMBL;Acc:Q7JKP1])

HSP 1 Score: 173.711 bits (439), Expect = 1.158e-51
Identity = 93/234 (39.74%), Postives = 140/234 (59.83%), Query Frame = 3
Query:  168 PVVPGCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELE--VQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYC-FCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFENKNKDSN 860
            P + G P GLEYLT ++ ++V Q+ +LIE+ T+++T NKY++ N  G+  +YA EE+GCC R  CG  R FV+++ DN  + V+ I+R  KC   G C   +     + E  ++ P   V+G ++Q        Y I+D D N+I ++ GP  C  C C   ++P  + TAN    +G ITK+W G  +E +T AD F V FP DLDVK K +++ A FLIDFM FE ++++ N
Sbjct:   55 PAIQGVPTGLEYLTYLDTIMVHQIKELIEIVTDWETKNKYVLKNANGEQCYYAFEESGCCERQCCGPQRGFVMHIVDNFKREVLTIKREFKCCGGGCCGCLACIGCCQQECIIETPSMGVLGIIRQRCGCMSSNYDIMDGDGNVIFQIDGPCCCMLCGCQDKEFP--IKTANNGTVVGAITKKWGGCFREAFTDADTFAVNFPGDLDVKLKGVLIGATFLIDFMEFEQQSQNRN 286          
BLAST of Phospholipid scramblase vs. Ensembl Celegans
Match: scrm-2 (Phospholipid scramblase [Source:UniProtKB/TrEMBL;Acc:G5EEQ3])

HSP 1 Score: 164.851 bits (416), Expect = 1.404e-48
Identity = 91/233 (39.06%), Postives = 135/233 (57.94%), Query Frame = 3
Query:  156 WVTA-PVVPGCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCF-CYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFENKN 848
            W+ A P + G P GLEYL  ++ ++V Q+ +++E+ T +++ NKY + N  GQ  +YA EE+    R  CGS R F +++ DN N+ V+ ++R L+C      C C    ++   +++    ++G V Q Y      Y ILDKD N+I  + G   C  C C   D+   + T +  + IG ITK+W G  +E +T AD F V FP+DLDVK KAI+L A FLIDF+ FEN N
Sbjct:   36 WMEALPAIEGIPAGLEYLAYLDTVMVHQVKEVLEILTGWESKNKYAIRNKNGQQCYYAFEESNAWERQCCGSQRGFTMHIVDNFNKNVLIVKRELRC-CADSFCGCLLGLQNICTIESLSTGLLGTVLQGYGCTNSFYNILDKDGNLIFLVDGQGCCTSCCCEDKDFT--IKTPDSSVPIGSITKKWGGLLREAFTDADTFAVTFPIDLDVKLKAILLGATFLIDFVEFENNN 265          
BLAST of Phospholipid scramblase vs. Ensembl Fly
Match: scramb1 (gene:FBgn0052056 transcript:FBtr0076302)

HSP 1 Score: 212.231 bits (539), Expect = 3.264e-67
Identity = 108/234 (46.15%), Postives = 149/234 (63.68%), Query Frame = 3
Query:  174 VPGCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHY-MGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFE---NKNKDSNG 863
            +P CP GLEYLT I+QLLVKQ  +L+E FT ++TNNK+ + N LGQ V++A E+N CC R  CG  R F + V+DN  Q V+ + RPL C   + PCC         +EV APPG VIG ++Q +  C   + IL+   + ++R+ GP   F  C   D    V++  G+ +IGKI+KQWSG A+E++T AD FG+ FP+DLDV+ KA++L A FLID M+FE   N+  D  G
Sbjct:    7 IPNCPRGLEYLTTIDQLLVKQKVELLEAFTGFETNNKFTIKNALGQKVYFAAEDNDCCTRNCCGPARPFDMRVFDNFQQEVIHMHRPLACSSCLFPCC------LQSIEVSAPPGNVIGTIEQEWSICSPSFRILNHVGDTVMRIEGPFCTFSLC--GDVEFNVVSLTGE-KIGKISKQWSGLAREIFTDADFFGINFPLDLDVRMKAVLLGATFLIDAMFFEKAGNQETDRPG 231          
BLAST of Phospholipid scramblase vs. Ensembl Fly
Match: scramb1 (gene:FBgn0052056 transcript:FBtr0076303)

HSP 1 Score: 212.616 bits (540), Expect = 4.797e-66
Identity = 109/234 (46.58%), Postives = 150/234 (64.10%), Query Frame = 3
Query:  174 VPGCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHY-MGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFE---NKNKDSNG 863
            +P CP GLEYLT I+QLLVKQ  +L+E FT ++TNNK+ + N LGQ V++A E+N CC R  CG  R F + V+DN  Q V+ + RPL C   + PCC  S      +EV APPG VIG ++Q +  C   + IL+   + ++R+ GP   F  C   D    V++  G+ +IGKI+KQWSG A+E++T AD FG+ FP+DLDV+ KA++L A FLID M+FE   N+  D  G
Sbjct:  106 IPNCPRGLEYLTTIDQLLVKQKVELLEAFTGFETNNKFTIKNALGQKVYFAAEDNDCCTRNCCGPARPFDMRVFDNFQQEVIHMHRPLACSSCLFPCCLQS------IEVSAPPGNVIGTIEQEWSICSPSFRILNHVGDTVMRIEGPFCTFSLC--GDVEFNVVSLTGE-KIGKISKQWSGLAREIFTDADFFGINFPLDLDVRMKAVLLGATFLIDAMFFEKAGNQETDRPG 330          
BLAST of Phospholipid scramblase vs. Ensembl Fly
Match: scramb1 (gene:FBgn0052056 transcript:FBtr0076301)

HSP 1 Score: 211.46 bits (537), Expect = 1.250e-64
Identity = 110/241 (45.64%), Postives = 153/241 (63.49%), Query Frame = 3
Query:  156 WVTAPV-VPGCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHY-MGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFE---NKNKDSNG 863
            W++ P  +P CP GLEYLT I+QLLVKQ  +L+E FT ++TNNK+ + N LGQ V++A E+N CC R  CG  R F + V+DN  Q V+ + RPL C   + PCC         +EV APPG VIG ++Q +  C   + IL+   + ++R+ GP   F  C   D    V++  G+ +IGKI+KQWSG A+E++T AD FG+ FP+DLDV+ KA++L A FLID M+FE   N+  D  G
Sbjct:  183 WMSIPTGIPNCPRGLEYLTTIDQLLVKQKVELLEAFTGFETNNKFTIKNALGQKVYFAAEDNDCCTRNCCGPARPFDMRVFDNFQQEVIHMHRPLACSSCLFPCC------LQSIEVSAPPGNVIGTIEQEWSICSPSFRILNHVGDTVMRIEGPFCTFSLC--GDVEFNVVSLTGE-KIGKISKQWSGLAREIFTDADFFGINFPLDLDVRMKAVLLGATFLIDAMFFEKAGNQETDRPG 414          
BLAST of Phospholipid scramblase vs. Ensembl Fly
Match: scramb2 (gene:FBgn0035390 transcript:FBtr0073005)

HSP 1 Score: 186.422 bits (472), Expect = 1.025e-56
Identity = 100/230 (43.48%), Postives = 149/230 (64.78%), Query Frame = 3
Query:  153 TWVTAPV-VPGCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFE 839
             W++ PV +P CP GLEYLT ++QLLV Q  + +E+ T ++T N++ V N LGQ+V++A EE+ CC R   G +R F + + DN    V+ + RP KC  +  CC  S    + +EV APPG+VIG V+Q+    + ++ I +   + +L++ GP  C C C   D    V++AN + EIGKI+KQWSG  +EL+T AD F V FP++LDV+ KA++ AA+FLID +Y+E
Sbjct:   40 NWMSIPVGMPNCPQGLEYLTALDQLLVSQKIEKLELLTGFETKNRFKVKNSLGQNVYFAYEESDCCTRNMLGRSRPFEMKILDNFQNEVLHLYRPFKCDIL--CCFPS--CMNAVEVSAPPGQVIGSVEQVCTFMRPKFNIKNTCGDTVLQIEGP-VCPCKC-FSDTNFKVLSANNE-EIGKISKQWSGLGRELFTDADYFSVTFPLNLDVRMKALIFAALFLIDAVYYE 262          
BLAST of Phospholipid scramblase vs. Ensembl Fly
Match: CG9084 (gene:FBgn0033582 transcript:FBtr0088197)

HSP 1 Score: 75.8702 bits (185), Expect = 2.344e-15
Identity = 57/222 (25.68%), Postives = 105/222 (47.30%), Query Frame = 3
Query:  192 GLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDK-NIILRLHGP---HYCFCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFENK 845
            G + L  +  + ++Q F+L +  T   + N+Y+V + LG ++F A E +    R   G+ R F +++ D ++Q  +  R+ L    MG  C    C    LE+  PPG ++G V Q     Q  + I D+    +   + GP    +C    P D Y    + + G++    I  +W   ++  YTT   F       L  K +A++L + FL+++++F+ +
Sbjct:   67 GYDCLADLPSVHIEQTFELNDALTGVSSENRYVVRSPLGDAIFAANESSTEKNRLLWGAGRPFQMHLLDKTHQEALVFRKKLA---MGSMC----CQAKSLEIWIPPGNLLGKVVQSPTFMQPEFFIEDESTGQLTFCVEGPVGLGFCCFSLPKDCY--FKIHSGGNMR-ASIDHKWLA-SKSQYTTNIYFS---DAKLTAKERALILGSAFLLEYLFFQTR 274          
BLAST of Phospholipid scramblase vs. Ensembl Zebrafish
Match: si:ch211-71m22.1 (si:ch211-71m22.1 [Source:ZFIN;Acc:ZDB-GENE-070705-193])

HSP 1 Score: 221.861 bits (564), Expect = 6.970e-71
Identity = 114/221 (51.58%), Postives = 149/221 (67.42%), Query Frame = 3
Query:  180 GCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFEN 842
            GCPPGLEYLTQI+QLLV+Q  +L EV   ++TNNKY+V N +GQ VFY  EEN CC R +CG  RSFVI+V DN  Q VM + RPLKC      C C  C   ELE+Q+PPG  IGYV Q +     ++ I ++ K  +L++ GP +C C C   D    V++ +   ++GKI+KQW+G  +E +T ADNFG+ FPMDLDVK KA++  A FLIDFM+FE+
Sbjct:   10 GCPPGLEYLTQIDQLLVQQKVELAEVILGWETNNKYIVKNSMGQQVFYVAEENDCCNRQFCGPLRSFVIHVQDNLGQEVMRLMRPLKCGS----CFCP-CCLQELEIQSPPGYPIGYVIQNWHPFLPKFTIQNEKKEAVLKIEGP-FCSCRC-CSDVNFDVLSLDESTKVGKISKQWTGLVREAFTDADNFGISFPMDLDVKIKAVLFGACFLIDFMFFEH 223          
BLAST of Phospholipid scramblase vs. Ensembl Zebrafish
Match: si:ch211-71m22.1 (si:ch211-71m22.1 [Source:ZFIN;Acc:ZDB-GENE-070705-193])

HSP 1 Score: 221.861 bits (564), Expect = 6.970e-71
Identity = 114/221 (51.58%), Postives = 149/221 (67.42%), Query Frame = 3
Query:  180 GCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFEN 842
            GCPPGLEYLTQI+QLLV+Q  +L EV   ++TNNKY+V N +GQ VFY  EEN CC R +CG  RSFVI+V DN  Q VM + RPLKC      C C  C   ELE+Q+PPG  IGYV Q +     ++ I ++ K  +L++ GP +C C C   D    V++ +   ++GKI+KQW+G  +E +T ADNFG+ FPMDLDVK KA++  A FLIDFM+FE+
Sbjct:   10 GCPPGLEYLTQIDQLLVQQKVELAEVILGWETNNKYIVKNSMGQQVFYVAEENDCCNRQFCGPLRSFVIHVQDNLGQEVMRLMRPLKCGS----CFCP-CCLQELEIQSPPGYPIGYVIQNWHPFLPKFTIQNEKKEAVLKIEGP-FCSCRC-CSDVNFDVLSLDESTKVGKISKQWTGLVREAFTDADNFGISFPMDLDVKIKAVLFGACFLIDFMFFEH 223          
BLAST of Phospholipid scramblase vs. Ensembl Zebrafish
Match: si:ch211-71m22.1 (si:ch211-71m22.1 [Source:ZFIN;Acc:ZDB-GENE-070705-193])

HSP 1 Score: 221.861 bits (564), Expect = 6.970e-71
Identity = 114/221 (51.58%), Postives = 149/221 (67.42%), Query Frame = 3
Query:  180 GCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFEN 842
            GCPPGLEYLTQI+QLLV+Q  +L EV   ++TNNKY+V N +GQ VFY  EEN CC R +CG  RSFVI+V DN  Q VM + RPLKC      C C  C   ELE+Q+PPG  IGYV Q +     ++ I ++ K  +L++ GP +C C C   D    V++ +   ++GKI+KQW+G  +E +T ADNFG+ FPMDLDVK KA++  A FLIDFM+FE+
Sbjct:   10 GCPPGLEYLTQIDQLLVQQKVELAEVILGWETNNKYIVKNSMGQQVFYVAEENDCCNRQFCGPLRSFVIHVQDNLGQEVMRLMRPLKCGS----CFCP-CCLQELEIQSPPGYPIGYVIQNWHPFLPKFTIQNEKKEAVLKIEGP-FCSCRC-CSDVNFDVLSLDESTKVGKISKQWTGLVREAFTDADNFGISFPMDLDVKIKAVLFGACFLIDFMFFEH 223          
BLAST of Phospholipid scramblase vs. Ensembl Zebrafish
Match: si:ch211-71m22.1 (si:ch211-71m22.1 [Source:ZFIN;Acc:ZDB-GENE-070705-193])

HSP 1 Score: 221.861 bits (564), Expect = 1.876e-70
Identity = 117/232 (50.43%), Postives = 153/232 (65.95%), Query Frame = 3
Query:  150 VTWVTAPVVP-GCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFEN 842
            V  +  P  P GCPPGLEYLTQI+QLLV+Q  +L EV   ++TNNKY+V N +GQ VFY  EEN CC R +CG  RSFVI+V DN  Q VM + RPLKC      C C  C   ELE+Q+PPG  IGYV Q +     ++ I ++ K  +L++ GP +C C C   D    V++ +   ++GKI+KQW+G  +E +T ADNFG+ FPMDLDVK KA++  A FLIDFM+FE+
Sbjct:   37 VVMMPVPQRPDGCPPGLEYLTQIDQLLVQQKVELAEVILGWETNNKYIVKNSMGQQVFYVAEENDCCNRQFCGPLRSFVIHVQDNLGQEVMRLMRPLKCGS----CFCP-CCLQELEIQSPPGYPIGYVIQNWHPFLPKFTIQNEKKEAVLKIEGP-FCSCRC-CSDVNFDVLSLDESTKVGKISKQWTGLVREAFTDADNFGISFPMDLDVKIKAVLFGACFLIDFMFFEH 261          
BLAST of Phospholipid scramblase vs. Ensembl Zebrafish
Match: si:ch73-206p6.1 (si:ch73-206p6.1 [Source:ZFIN;Acc:ZDB-GENE-030131-5048])

HSP 1 Score: 220.32 bits (560), Expect = 2.751e-70
Identity = 110/231 (47.62%), Postives = 151/231 (65.37%), Query Frame = 3
Query:  159 VTAPVVPGCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHY-MGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFENKN 848
            V  P +PGCPPGLEYLTQ++QLL+KQ  +LIE    +++NNKY + N LGQ+VFYA EEN C  R  CG  RSF I V DN  Q ++ + RPLKC     PCC        ELE+Q+PPG  +GYV Q +     ++ I ++ +  +L+L GP   +   P  D+ +  M    ++ IGKI+KQW+G  +E++T +DNFG+QFPMDLDV+ KA+++ A FLIDFM+FE  N
Sbjct:    9 VPNPGIPGCPPGLEYLTQVDQLLIKQKVELIEALAGFESNNKYEIRNSLGQNVFYAVEENDCLTRQCCGPLRSFTIRVLDNFGQEIITVNRPLKCMSCFFPCC------LQELEIQSPPGNTVGYVVQQWHPFLPKFTIENEHRQPVLKLQGPFCGWSCLPDVDFEILTMD---EVSIGKISKQWTGLLREVFTDSDNFGIQFPMDLDVRMKAVMIGACFLIDFMFFETNN 230          
BLAST of Phospholipid scramblase vs. Ensembl Xenopus
Match: insyn1 (inhibitory synaptic factor 1 [Source:Xenbase;Acc:XB-GENE-5931898])

HSP 1 Score: 215.312 bits (547), Expect = 6.110e-67
Identity = 108/226 (47.79%), Postives = 148/226 (65.49%), Query Frame = 3
Query:  183 CPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCF-CYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFENKNKDS 857
            CPPGLEYLTQI+Q+LV Q  +L+EV T ++TNNKY + N LGQ V++A EEN CC R  CG +R F + + DN+ Q VM++ RP +C        C  C   +LEVQAPPG  +GYV Q +  C  ++ I D+ +  IL++ GP  C  C C   D    + + +    +G+ITKQW+G+ +E +T ADNFG+QFPMDLDVK KA++L A FLIDFM+FE    ++
Sbjct:  102 CPPGLEYLTQIDQILVHQQVELLEVLTGFETNNKYEIKNSLGQRVYFAAEENDCCTRNCCGPSRPFSMTIVDNAGQEVMKLHRPCRCSAC-----CFPCCLQKLEVQAPPGTTVGYVIQNWHPCLPKFTIQDEREQGILKIKGP--CIPCRCCA-DVKFEIKSMDESAVVGRITKQWTGFVKEAFTDADNFGIQFPMDLDVKIKAVLLGACFLIDFMFFEQSQNNN 319          
BLAST of Phospholipid scramblase vs. Ensembl Xenopus
Match: insyn1 (inhibitory synaptic factor 1 [Source:Xenbase;Acc:XB-GENE-5931898])

HSP 1 Score: 214.927 bits (546), Expect = 8.485e-67
Identity = 108/226 (47.79%), Postives = 148/226 (65.49%), Query Frame = 3
Query:  183 CPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCF-CYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFENKNKDS 857
            CPPGLEYLTQI+Q+LV Q  +L+EV T ++TNNKY + N LGQ V++A EEN CC R  CG +R F + + DN+ Q VM++ RP +C        C  C   +LEVQAPPG  +GYV Q +  C  ++ I D+ +  IL++ GP  C  C C   D    + + +    +G+ITKQW+G+ +E +T ADNFG+QFPMDLDVK KA++L A FLIDFM+FE    ++
Sbjct:  107 CPPGLEYLTQIDQILVHQQVELLEVLTGFETNNKYEIKNSLGQRVYFAAEENDCCTRNCCGPSRPFSMTIVDNAGQEVMKLHRPCRCSAC-----CFPCCLQKLEVQAPPGTTVGYVIQNWHPCLPKFTIQDEREQGILKIKGP--CIPCRCCA-DVKFEIKSMDESAVVGRITKQWTGFVKEAFTDADNFGIQFPMDLDVKIKAVLLGACFLIDFMFFEQSQNNN 324          
BLAST of Phospholipid scramblase vs. Ensembl Xenopus
Match: ENSXETT00000012543.1 (phospholipid scramblase 2 [Source:NCBI gene;Acc:100489273])

HSP 1 Score: 210.305 bits (534), Expect = 1.688e-65
Identity = 105/231 (45.45%), Postives = 149/231 (64.50%), Query Frame = 3
Query:  150 VTWVTAPVV-PGCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCF-CYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYF 836
              W+  P   P CPPGLEYL+QI+Q+LV Q  +L+EV T ++TNNKY + N LGQ V++A EEN CC R +CG +R F + + DN+ + VM++ RPL+C        C  C   +LEVQAPPG V+GYV Q +  C  ++ I D+ +  +L++ GP  C  C C   D    VM+ +    +G+I+KQW+G  +E++T  DNFG+QFPMDLD+K KA++L A FLI   +F
Sbjct:   55 AAWMPIPAANPNCPPGLEYLSQIDQILVHQQVELLEVLTGFETNNKYEIKNSLGQRVYFAAEENDCCTRNYCGPSRPFAMTIVDNTGREVMKLHRPLRCSAC-----CFPCCLQKLEVQAPPGTVVGYVVQNWHPCLPKFTIQDEREQGVLKISGP--CIPCRC-CTDVNFEVMSVDESSVVGRISKQWAGSVKEIFTDTDNFGIQFPMDLDIKTKAVLLGACFLIVSSFF 277          
BLAST of Phospholipid scramblase vs. Ensembl Xenopus
Match: kpna6 (karyopherin alpha 6 (importin alpha 7) [Source:Xenbase;Acc:XB-GENE-946491])

HSP 1 Score: 130.183 bits (326), Expect = 2.614e-35
Identity = 80/209 (38.28%), Postives = 116/209 (55.50%), Query Frame = 3
Query:  213 INQLL---VKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFM 830
            INQL    V   FD+  VF   + +NKY + +  GQ  ++A EEN    + +CG  R F + + ++  Q V+ I RPL+C +      C  C   ELEVQAP G   G++ Q ++    ++ I ++ K  +L + GP Y    C GD     V T N +  IGKI K WSG+  +++T ADNFG++FP+DLDVK KA ++   FLI  M
Sbjct:    2 INQLFWGGVLIYFDVFPVFLGTEKSNKYEIKDNFGQRFYFATEENEYFNKNFCGPVRPFTMRISNSRGQEVITIIRPLRCIHC-----CFPCYLQELEVQAPLGTTAGFIVQKWDPLLPKFIIQNESKEDVLIVIGP-YLTSSCFGD-VIFEVKTLNEESTIGKICKYWSGFVNDVFTNADNFGIEFPVDLDVKLKAALIGTCFLIVSM 203          
BLAST of Phospholipid scramblase vs. Ensembl Xenopus
Match: kpna6 (karyopherin alpha 6 (importin alpha 7) [Source:Xenbase;Acc:XB-GENE-946491])

HSP 1 Score: 128.642 bits (322), Expect = 4.676e-35
Identity = 74/194 (38.14%), Postives = 110/194 (56.70%), Query Frame = 3
Query:  240 FDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLI 821
            FD+  VF   + +NKY + +  GQ  ++A EEN    + +CG  R F + + ++  Q V+ I RPL+C +      C  C   ELEVQAP G   G++ Q ++    ++ I ++ K  +L + GP Y    C GD   V   T N +  IGKI K WSG+  +++T ADNFG++FP+DLDVK KA ++   FLI
Sbjct:   13 FDVFPVFLGTEKSNKYEIKDNFGQRFYFATEENEYFNKNFCGPVRPFTMRISNSRGQEVITIIRPLRCIHC-----CFPCYLQELEVQAPLGTTAGFIVQKWDPLLPKFIIQNESKEDVLIVIGP-YLTSSCFGD---VIFETLNEESTIGKICKYWSGFVNDVFTNADNFGIEFPVDLDVKLKAALIGTCFLI 197          
BLAST of Phospholipid scramblase vs. Ensembl Mouse
Match: Plscr1 (phospholipid scramblase 1 [Source:MGI Symbol;Acc:MGI:893575])

HSP 1 Score: 207.223 bits (526), Expect = 7.954e-64
Identity = 100/229 (43.67%), Postives = 146/229 (63.76%), Query Frame = 3
Query:  192 GLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFENKNKDSNGAFSWQ 878
            GLEYL QI+QLLV Q  +L+EV T ++TNNKY + N LGQ V++A E+  CC R  CG++R F + + DN  + VM + RPL+C        C  C   E+E+QAPPG  +GYV Q +  C  ++ + ++ K  +L++ GP      C   D+ +  +  + +  +GKI+KQWSG+ +E +T ADNFG+QFP+DLDVK KA++L A FLIDFM+FE    +   + +WQ
Sbjct:  107 GLEYLAQIDQLLVHQQIELLEVLTGFETNNKYEIKNSLGQRVYFAVEDTDCCTRNCCGASRPFTLRILDNLGREVMTLERPLRCSSC-----CFPCCLQEIEIQAPPGVPVGYVTQTWHPCLPKFTLQNEKKQDVLKVVGPCVVCSCCSDIDFELKSL--DEESVVGKISKQWSGFVREAFTDADNFGIQFPLDLDVKMKAVMLGACFLIDFMFFERTGNEEQRSGAWQ 328          
BLAST of Phospholipid scramblase vs. Ensembl Mouse
Match: Plscr1 (phospholipid scramblase 1 [Source:MGI Symbol;Acc:MGI:893575])

HSP 1 Score: 207.223 bits (526), Expect = 7.954e-64
Identity = 100/229 (43.67%), Postives = 146/229 (63.76%), Query Frame = 3
Query:  192 GLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFENKNKDSNGAFSWQ 878
            GLEYL QI+QLLV Q  +L+EV T ++TNNKY + N LGQ V++A E+  CC R  CG++R F + + DN  + VM + RPL+C        C  C   E+E+QAPPG  +GYV Q +  C  ++ + ++ K  +L++ GP      C   D+ +  +  + +  +GKI+KQWSG+ +E +T ADNFG+QFP+DLDVK KA++L A FLIDFM+FE    +   + +WQ
Sbjct:  107 GLEYLAQIDQLLVHQQIELLEVLTGFETNNKYEIKNSLGQRVYFAVEDTDCCTRNCCGASRPFTLRILDNLGREVMTLERPLRCSSC-----CFPCCLQEIEIQAPPGVPVGYVTQTWHPCLPKFTLQNEKKQDVLKVVGPCVVCSCCSDIDFELKSL--DEESVVGKISKQWSGFVREAFTDADNFGIQFPLDLDVKMKAVMLGACFLIDFMFFERTGNEEQRSGAWQ 328          
BLAST of Phospholipid scramblase vs. Ensembl Mouse
Match: Plscr2 (phospholipid scramblase 2 [Source:MGI Symbol;Acc:MGI:1270860])

HSP 1 Score: 199.904 bits (507), Expect = 3.284e-61
Identity = 101/229 (44.10%), Postives = 142/229 (62.01%), Query Frame = 3
Query:  156 WVTAPV-VPGCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFE 839
            W+ AP  +  CPPGLEYL QI+QLL+ Q  +L+EV T ++TNNK+ + N LGQ V+ A E+  CC R  C ++R F + + D+  Q VM + RPLKC        C  C   E+E+QAPPG  IGYV Q +  C  +  + +  +  +L++ GP      C   D+ +  +  +    IGKITKQWSG  +E +T +DNFG+QFP+DL+VK KA+ L A FLID+M+FE
Sbjct:   83 WMPAPPPILNCPPGLEYLNQIDQLLIHQQVELLEVLTGFETNNKFEIKNSLGQMVYVAVEDTDCCTRNCCEASRPFTLRILDHLGQEVMTLERPLKCSSC-----CFPCCLQEIEIQAPPGVPIGYVTQTWHPCLPKLTLQNDKRENVLKVVGPCVACTCCSDIDFEIKSL--DEVTRIGKITKQWSGCVKEAFTDSDNFGIQFPLDLEVKMKAVTLGACFLIDYMFFE 304          
BLAST of Phospholipid scramblase vs. Ensembl Mouse
Match: Plscr2 (phospholipid scramblase 2 [Source:MGI Symbol;Acc:MGI:1270860])

HSP 1 Score: 199.904 bits (507), Expect = 3.284e-61
Identity = 101/229 (44.10%), Postives = 142/229 (62.01%), Query Frame = 3
Query:  156 WVTAPV-VPGCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFE 839
            W+ AP  +  CPPGLEYL QI+QLL+ Q  +L+EV T ++TNNK+ + N LGQ V+ A E+  CC R  C ++R F + + D+  Q VM + RPLKC        C  C   E+E+QAPPG  IGYV Q +  C  +  + +  +  +L++ GP      C   D+ +  +  +    IGKITKQWSG  +E +T +DNFG+QFP+DL+VK KA+ L A FLID+M+FE
Sbjct:   83 WMPAPPPILNCPPGLEYLNQIDQLLIHQQVELLEVLTGFETNNKFEIKNSLGQMVYVAVEDTDCCTRNCCEASRPFTLRILDHLGQEVMTLERPLKCSSC-----CFPCCLQEIEIQAPPGVPIGYVTQTWHPCLPKLTLQNDKRENVLKVVGPCVACTCCSDIDFEIKSL--DEVTRIGKITKQWSGCVKEAFTDSDNFGIQFPLDLEVKMKAVTLGACFLIDYMFFE 304          
BLAST of Phospholipid scramblase vs. Ensembl Mouse
Match: Plscr3 (phospholipid scramblase 3 [Source:MGI Symbol;Acc:MGI:1917560])

HSP 1 Score: 197.208 bits (500), Expect = 2.379e-60
Identity = 98/233 (42.06%), Postives = 142/233 (60.94%), Query Frame = 3
Query:  174 VPGCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFENKNKDSNGAFS 872
            +PG PPGLE+L QI+Q+L+ Q  + +E F  ++T N Y + +  GQ +  A EE+ CC R  CG+ R F I + D  ++ V+ + RPL C      C+C  C   E+EVQAPPG  IG+V Q +     +++ILD D+  +LR+ GP +  C C G D    V T +    +G+I+KQW G  +E  T AD+FG+QFP+DLDVK KA++L A FLID+M+FE +      A +
Sbjct:   70 LPGVPPGLEFLVQIDQILIHQKAERVETFLGWETCNMYELRSGTGQQLGQAAEESNCCARLCCGARRPFRIRLADPGDREVLRLLRPLHCG-----CSCCPCGLQEMEVQAPPGTTIGHVLQTWHPFLPKFSILDADRQPVLRVVGPCWT-CGC-GTDTNFEVKTKDESRSVGRISKQWGGLLREALTDADDFGLQFPVDLDVKVKAVLLGATFLIDYMFFEKRGGAGPSAIT 295          
BLAST of Phospholipid scramblase vs. UniProt/SwissProt
Match: sp|Q3ZBG9|PLS2_BOVIN (Phospholipid scramblase 2 OS=Bos taurus OX=9913 GN=PLSCR2 PE=2 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 3.264e-65
Identity = 103/231 (44.59%), Postives = 147/231 (63.64%), Query Frame = 3
Query:  150 VTWVTAPVVP-GCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFE 839
            V W+ AP+ P  CPPGLEYLTQI+QLL+ Q  +L+EV   ++TNNKY + N LGQ +++A E+  CC R  CG +R F + + DN  + V+ + RPL+C        C  C   E+E+QAPPG  +GYV Q +  C  ++ I ++ +  +LR+ GP      C   D+   V + +    +GKI+K W+G  +EL+T  DNFG+QFP+DLDVK KA++L A FLIDFM+FE
Sbjct:   65 VPWMPAPLPPLNCPPGLEYLTQIDQLLIHQQIELLEVLIGFETNNKYEIKNSLGQRIYFAAEDTDCCTRNCCGPSRPFTMRILDNMGREVITLERPLRCTSC-----CFPCCLQEIEIQAPPGVPVGYVTQTWHPCLPKFTIQNERREDVLRISGPCVICSCCADIDF--EVKSLDDKYVVGKISKHWTGLIKELFTDVDNFGIQFPLDLDVKMKAVMLGACFLIDFMFFE 288          
BLAST of Phospholipid scramblase vs. UniProt/SwissProt
Match: sp|Q9JJ00|PLS1_MOUSE (Phospholipid scramblase 1 OS=Mus musculus OX=10090 GN=Plscr1 PE=1 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 5.564e-63
Identity = 100/229 (43.67%), Postives = 146/229 (63.76%), Query Frame = 3
Query:  192 GLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFENKNKDSNGAFSWQ 878
            GLEYL QI+QLLV Q  +L+EV T ++TNNKY + N LGQ V++A E+  CC R  CG++R F + + DN  + VM + RPL+C        C  C   E+E+QAPPG  +GYV Q +  C  ++ + ++ K  +L++ GP      C   D+ +  +  + +  +GKI+KQWSG+ +E +T ADNFG+QFP+DLDVK KA++L A FLIDFM+FE    +   + +WQ
Sbjct:  107 GLEYLAQIDQLLVHQQIELLEVLTGFETNNKYEIKNSLGQRVYFAVEDTDCCTRNCCGASRPFTLRILDNLGREVMTLERPLRCSSC-----CFPCCLQEIEIQAPPGVPVGYVTQTWHPCLPKFTLQNEKKQDVLKVVGPCVVCSCCSDIDFELKSL--DEESVVGKISKQWSGFVREAFTDADNFGIQFPLDLDVKMKAVMLGACFLIDFMFFERTGNEEQRSGAWQ 328          
BLAST of Phospholipid scramblase vs. UniProt/SwissProt
Match: sp|O15162|PLS1_HUMAN (Phospholipid scramblase 1 OS=Homo sapiens OX=9606 GN=PLSCR1 PE=1 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 2.197e-61
Identity = 105/244 (43.03%), Postives = 152/244 (62.30%), Query Frame = 3
Query:  150 VTWVTAPVVP-GCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGD-DYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFENKNKDSNGAFSW 875
            V W+ AP  P  CPPGLEYL+QI+Q+L+ Q  +L+EV T ++TNNKY + N  GQ V++A E+  CC R  CG +R F + + DN  Q V+ + RPL+C        C  C   E+E+QAPPG  IGYV Q +  C  ++ I ++ +  +L++ GP    C C GD D+   + + +    +GKI+K W+G  +E +T ADNFG+QFP+DLDVK KA+++ A FLIDFM+FE+       +  W
Sbjct:   83 VPWMPAPQPPLNCPPGLEYLSQIDQILIHQQIELLEVLTGFETNNKYEIKNSFGQRVYFAAEDTDCCTRNCCGPSRPFTLRIIDNMGQEVITLERPLRCSSC-----CCPCCLQEIEIQAPPGVPIGYVIQTWHPCLPKFTIQNEKREDVLKISGP-CVVCSCCGDVDF--EIKSLDEQCVVGKISKHWTGILREAFTDADNFGIQFPLDLDVKMKAVMIGACFLIDFMFFESTGSQEQKSGVW 318          
BLAST of Phospholipid scramblase vs. UniProt/SwissProt
Match: sp|P58195|PLS1_RAT (Phospholipid scramblase 1 OS=Rattus norvegicus OX=10116 GN=Plscr1 PE=1 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 4.348e-61
Identity = 98/228 (42.98%), Postives = 145/228 (63.60%), Query Frame = 3
Query:  192 GLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFENKNKDSNGAFSW 875
            GLEYLTQI+Q+LV Q  +L+EV T ++TNNKY + N LGQ V++A E+  CC R  CG++R F + + DN  + VM + RPL+C        C  C   E+E+QAPPG  +GYV Q +  C  ++ + ++ +  +L++ GP      C   D+   + + + +  +GKI+KQWSG+ +E +T ADNFG+QFP+DLDVK KA++L A FLIDFM+FE    +   +  W
Sbjct:  115 GLEYLTQIDQILVHQQIELLEVLTGFETNNKYEIKNSLGQRVYFAVEDTDCCTRNCCGASRPFTLRILDNMGREVMTLERPLRCSSC-----CFPCCLQEIEIQAPPGVPVGYVIQTWHPCLPKFTLQNEKRQDVLKVVGPCVVCSCCSDIDF--ELKSLDEESVVGKISKQWSGFVREAFTDADNFGIQFPLDLDVKMKAVMLGACFLIDFMFFERTGNEEQRSGVW 335          
BLAST of Phospholipid scramblase vs. UniProt/SwissProt
Match: sp|Q9DCW2|PLS2_MOUSE (Phospholipid scramblase 2 OS=Mus musculus OX=10090 GN=Plscr2 PE=1 SV=3)

HSP 1 Score: 199.904 bits (507), Expect = 2.297e-60
Identity = 101/229 (44.10%), Postives = 142/229 (62.01%), Query Frame = 3
Query:  156 WVTAPV-VPGCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFE 839
            W+ AP  +  CPPGLEYL QI+QLL+ Q  +L+EV T ++TNNK+ + N LGQ V+ A E+  CC R  C ++R F + + D+  Q VM + RPLKC        C  C   E+E+QAPPG  IGYV Q +  C  +  + +  +  +L++ GP      C   D+ +  +  +    IGKITKQWSG  +E +T +DNFG+QFP+DL+VK KA+ L A FLID+M+FE
Sbjct:   83 WMPAPPPILNCPPGLEYLNQIDQLLIHQQVELLEVLTGFETNNKFEIKNSLGQMVYVAVEDTDCCTRNCCEASRPFTLRILDHLGQEVMTLERPLKCSSC-----CFPCCLQEIEIQAPPGVPIGYVTQTWHPCLPKLTLQNDKRENVLKVVGPCVACTCCSDIDFEIKSL--DEVTRIGKITKQWSGCVKEAFTDSDNFGIQFPLDLEVKMKAVTLGACFLIDYMFFE 304          
BLAST of Phospholipid scramblase vs. TrEMBL
Match: G7YRN6 (Phospholipid scramblase OS=Clonorchis sinensis OX=79923 GN=CLF_108489 PE=3 SV=1)

HSP 1 Score: 265.388 bits (677), Expect = 2.226e-84
Identity = 122/233 (52.36%), Postives = 168/233 (72.10%), Query Frame = 3
Query:  168 PVVPGCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFENKNKDSNGA 866
            PVVP CPPGLEYLTQINQLLVKQ  +L E+ T+ +  N+Y++ N +GQ++F  KEE+  C R  C   R + ++V+DNS   V+ I+RP K    G C +C++C +DEL V+AP G+V+GYVKQ+ +GC +RY + D  +N++L +HGP YC C C G+D    +M+A+G+ E+G+ITKQWS   QEL+T ADNFG+ FPMDLDV+ KA ++ AVFLIDFM+FE     SNG+
Sbjct:   13 PVVPNCPPGLEYLTQINQLLVKQKKELFEILTDIEVANRYIIVNTMGQTLFNCKEESNFCSRQCCKGQRPYTMHVHDNSGTEVIRIKRPYKYVCCGQCFSCAECCQDELTVEAPVGQVVGYVKQVQDGCNIRYMVKDASENVVLLIHGPSYCHCTCIGEDINFMIMSADGETEVGRITKQWSNIIQELFTDADNFGIAFPMDLDVRVKATLIGAVFLIDFMFFE-----SNGS 240          
BLAST of Phospholipid scramblase vs. TrEMBL
Match: A0A075A1P0 (Phospholipid scramblase OS=Opisthorchis viverrini OX=6198 GN=T265_00773 PE=3 SV=1)

HSP 1 Score: 263.462 bits (672), Expect = 9.324e-84
Identity = 120/225 (53.33%), Postives = 165/225 (73.33%), Query Frame = 3
Query:  168 PVVPGCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFEN 842
            PVV  CPPGLEYLTQINQLLVKQ  +L E+ T+ +T N+Y++ N +GQ+V+   EE+  C R  C S R + ++V DNS   V+ ++RP KC+    C +CS+C +DEL+V+AP G+++GYVKQ+ +GC +RYAI D     +LR+HGP YC C C G+D    VM+A+G+ E+G+ITKQWS   QE++T ADNFG+ FPMDLDV+ KA ++ AVFLIDFM+FE+
Sbjct:    4 PVVLDCPPGLEYLTQINQLLVKQKKELFEIMTDIETANRYVIVNTMGQTVYNCSEESNFCARQCCRSQRPYTMHVQDNSGMEVIRVKRPYKCYCCWECLSCSECCQDELQVEAPIGQLVGYVKQIQDGCNIRYAIKDSTGKQVLRIHGPSYCHCACFGEDINFKVMSADGNTEVGRITKQWSNIVQEMFTDADNFGIAFPMDLDVRIKATLIGAVFLIDFMFFED 228          
BLAST of Phospholipid scramblase vs. TrEMBL
Match: A0A5J4NIX5 (Phospholipid scramblase OS=Paragonimus westermani OX=34504 GN=DEA37_0006232 PE=3 SV=1)

HSP 1 Score: 263.077 bits (671), Expect = 2.279e-82
Identity = 121/237 (51.05%), Postives = 164/237 (69.20%), Query Frame = 3
Query:  150 VTWVTAPVVPGCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFENKNKDSN 860
            + W+  P + GCPPGLEYLTQINQLLVKQ  ++ E+ T+ +T N+Y+  N +GQ+V+   EE+  C R  C + R FV++V DNS   V+ + RP K    G CC+CS+C +DELEV+AP G  +GYVKQ+Y GC V Y + + + +++L++HGP YC C C G+D    V++ANG  E+G+ITKQW+   QE  T ADNFGV FPMDLDVK KA ++ AVFLIDFM+FE+     N
Sbjct:   78 MAWMPKPTISGCPPGLEYLTQINQLLVKQKKEIFEMLTDVETPNRYVCLNTMGQTVYNCNEESDFCSRQCCKARRHFVMHVQDNSGMEVIRVNRPYKYQCCGHCCSCSECCQDELEVEAPIGHTVGYVKQVYRGCDVHYEVKNAEGSVVLQIHGPSYCHCACIGEDINFKVLSANGTAEVGRITKQWTNIIQEYLTDADNFGVSFPMDLDVKVKATLIGAVFLIDFMFFEDNQPKQN 314          
BLAST of Phospholipid scramblase vs. TrEMBL
Match: A0A4S2LUZ8 (Phospholipid scramblase OS=Opisthorchis felineus OX=147828 GN=CRM22_004676 PE=3 SV=1)

HSP 1 Score: 264.233 bits (674), Expect = 2.734e-82
Identity = 121/231 (52.38%), Postives = 167/231 (72.29%), Query Frame = 3
Query:  150 VTWVTAPVVPGCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFEN 842
              W+  PVV  CPPGLEYLTQINQLLVKQ  +L E+ T+ +T N+Y++ N +GQ+V+   EE+  C R +C + R + ++V DNS   V+ ++RP KC+    C +CS+C +DEL V+AP G+V+GYVKQ+ EGC++RYAI D     +LR+HGP YC C C G+D    VM+A+G+ E+G+ITKQWS   QE++T ADNFG+ FPMDLD + KA ++ AVFLIDFM+FE+
Sbjct:  117 ANWMPRPVVLDCPPGLEYLTQINQLLVKQKKELFEIMTDIETANRYVILNTMGQTVYNCSEESNFCARQFCKAQRPYTMHVQDNSGMEVIRVKRPYKCYCCWECLSCSECCQDELLVEAPIGQVVGYVKQIQEGCKIRYAIKDSTGKQVLRIHGPSYCHCACFGEDINFKVMSADGNTEVGRITKQWSNIVQEMFTDADNFGIAFPMDLDARIKATLIGAVFLIDFMFFED 347          
BLAST of Phospholipid scramblase vs. TrEMBL
Match: A0A3R7GRQ5 (Phospholipid scramblase OS=Clonorchis sinensis OX=79923 GN=PLSCR2 PE=3 SV=1)

HSP 1 Score: 261.922 bits (668), Expect = 3.403e-82
Identity = 122/233 (52.36%), Postives = 168/233 (72.10%), Query Frame = 3
Query:  168 PVVPGCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFENKNKDSNGA 866
            PVVP CPPGLEYLTQINQLLVKQ  +L E+ T+ +  N+Y++ N +GQ++F  KEE+  C R  C   R + ++V+DNS   V+ I+RP K    G C +C++C +DEL V+AP G+V+GYVKQ+ +GC +RY + D  +N++L +HGP YC C C G+D    +M+A+G+ E+G+ITKQWS   QEL+T ADNFG+ FPMDLDV+ KA ++ AVFLIDFM+FE     SNG+
Sbjct:   75 PVVPNCPPGLEYLTQINQLLVKQKKELFEILTDIEVANRYIIVNTMGQTLFNCKEESNFCSRQCCKGQRPYTMHVHDNSGTEVIRIKRPYKYVCCGQCFSCAECCQDELTVEAPVGQVVGYVKQVQDGCNIRYMVKDASENVVLLIHGPSYCHCTCIGEDINFMIMSADGETEVGRITKQWSNIIQELFTDADNFGIAFPMDLDVRVKATLIGAVFLIDFMFFE-----SNGS 302          
BLAST of Phospholipid scramblase vs. Ensembl Cavefish
Match: si:ch211-71m22.1 (phospholipid scramblase 1-like [Source:NCBI gene;Acc:103030773])

HSP 1 Score: 223.016 bits (567), Expect = 6.608e-71
Identity = 116/223 (52.02%), Postives = 147/223 (65.92%), Query Frame = 3
Query:  180 GCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFENKN 848
            GCPPGLEYLTQI+QLLV Q  +L EV   ++TNNKYLV N LGQ VFY  EEN CC R  CG  RSFV++V DN  Q VM + RPL+C           C   ELEVQAPPG  IGYV Q +     ++ + ++ +  +LR+ GP +C C C   D    VM+ +   ++G+I KQW+G  QE +T ADNFG++FPMDLDVK KA++  A+FLIDFM+FEN N
Sbjct:   47 GCPPGLEYLTQIDQLLVHQKIELAEVILGWETNNKYLVKNTLGQQVFYVAEENDCCTRQCCGPMRSFVLHVQDNMGQEVMTLTRPLRCASCC-----CPCCLQELEVQAPPGNPIGYVIQKWHPFLPKFIVQNEKREDVLRIQGP-FCACNC-CSDVNFEVMSMDESTQVGRICKQWTGMLQEAFTDADNFGIKFPMDLDVKIKAVLFGALFLIDFMFFENSN 262          
BLAST of Phospholipid scramblase vs. Ensembl Cavefish
Match: si:ch73-206p6.1 (phospholipid scramblase 1 [Source:NCBI gene;Acc:103028162])

HSP 1 Score: 218.009 bits (554), Expect = 1.708e-69
Identity = 111/231 (48.05%), Postives = 149/231 (64.50%), Query Frame = 3
Query:  159 VTAPVVPGCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHY-MGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFENKN 848
            V  P +PGCP GLEYLTQ++QLL+KQ  +LIE    +++NNKY + N +GQ+VFYA EEN C  R  CG  RSF I V DN  Q V+ + RPLKC     PCC        ELEVQ+PPG ++GYV Q +     ++ I ++ +  +L+L GP   +   P  D+ +  M    D+ IGKI+KQW+G  +E +T ADNFG+QFPMDLDV+ KA+++   FLIDFM+FE  N
Sbjct:    8 VPNPGMPGCPAGLEYLTQVDQLLIKQKVELIEALAGFESNNKYEIRNAMGQNVFYAVEENDCLTRQCCGPLRSFTIRVLDNFGQEVITVNRPLKCMSCFFPCC------LQELEVQSPPGNIVGYVLQEWHPFLPKFTIKNEHREPVLKLQGPFCGWSCLPDVDFEIMTMD---DVSIGKISKQWTGLLREAFTDADNFGIQFPMDLDVRMKAVMIGLCFLIDFMFFETNN 229          
BLAST of Phospholipid scramblase vs. Ensembl Cavefish
Match: si:ch211-71m22.5 (si:ch211-71m22.5 [Source:ZFIN;Acc:ZDB-GENE-130531-65])

HSP 1 Score: 207.994 bits (528), Expect = 3.255e-65
Identity = 109/225 (48.44%), Postives = 147/225 (65.33%), Query Frame = 3
Query:  195 LEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFENKNKDSNGAF 869
            LEYLTQI+Q+L+ Q  +L+E    ++TNN+Y+V N LGQ VF A EEN  C R  CG  RSFV+++ DN+ + V+ + RPL C     C  C  C   ELEVQ+PPG+ IGYV Q +     ++ I D+ K  ++++ GP +C C C   D    VM+ +G   IG+I+KQW+G   E+ T ADNFGVQFPMDLDVK KA++L+A FLIDFMYFEN  K  +  +
Sbjct:   33 LEYLTQIDQILIHQKVELMEAMLGWETNNQYVVKNSLGQQVFLAAEENDFCTRTMCGPMRSFVLHLQDNTGREVLTLTRPLNC---SSC--CFPCCLQELEVQSPPGQPIGYVIQKWHPYLPKFTIKDERKQSVMQIVGP-FCDCNC-CSDVNFEVMSLDGASVIGRISKQWTGMEAEMLTDADNFGVQFPMDLDVKIKAVILSACFLIDFMYFENSPKQDSHHY 250          
BLAST of Phospholipid scramblase vs. Ensembl Cavefish
Match: si:ch211-71m22.1 (phospholipid scramblase 1-like [Source:NCBI gene;Acc:103030773])

HSP 1 Score: 207.223 bits (526), Expect = 2.318e-64
Identity = 109/214 (50.93%), Postives = 139/214 (64.95%), Query Frame = 3
Query:  180 GCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLI 821
            GCPPGLEYLTQI+QLLV Q  +L EV   ++TNNKYLV N LGQ VFY  EEN CC R  CG  RSFV++V DN  Q VM + RPL+C           C   ELEVQAPPG  IGYV Q +     ++ + ++ +  +LR+ GP +C C C   D    VM+ +   ++G+I KQW+G  QE +T ADNFG++FPMDLDVK KA++  A+FLI
Sbjct:   47 GCPPGLEYLTQIDQLLVHQKIELAEVILGWETNNKYLVKNTLGQQVFYVAEENDCCTRQCCGPMRSFVLHVQDNMGQEVMTLTRPLRCASCC-----CPCCLQELEVQAPPGNPIGYVIQKWHPFLPKFIVQNEKREDVLRIQGP-FCACNC-CSDVNFEVMSMDESTQVGRICKQWTGMLQEAFTDADNFGIKFPMDLDVKIKAVLFGALFLI 253          
BLAST of Phospholipid scramblase vs. Ensembl Cavefish
Match: plscr3b (phospholipid scramblase 2-like [Source:NCBI gene;Acc:103046260])

HSP 1 Score: 203.756 bits (517), Expect = 1.275e-62
Identity = 106/228 (46.49%), Postives = 150/228 (65.79%), Query Frame = 3
Query:  180 GCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCF-CYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFENKNKDSN 860
            G PPGLEYLTQI+Q+L+ Q  +L+E    ++TNN+Y V N +GQ ++ AKE+N CC R  CGS RSF + + DN+++ V+ + RP +C      C C  C   E+EVQAPPG  IGYV Q +  C  +++I   +K  +++L GP  C  C C G D    +   +G   IG+I+KQWSG  +E++T  DNFG+QFP+D+DVK KA+++ A FLIDF++FE K  DSN
Sbjct:  100 GVPPGLEYLTQIDQVLIHQKVELLEAIIGFETNNQYEVKNSMGQKIYKAKEKNDCCTRNCCGSLRSFDMKIKDNTDREVIRLIRPFRCA----TCWCP-CCLQEMEVQAPPGTTIGYVTQDWHPCYPKFSIKGPNKETVMKLEGP--CLACNCCG-DVNFELKGKDGGKSIGRISKQWSGLLKEVFTDTDNFGIQFPLDMDVKMKAVLMGACFLIDFIFFE-KVGDSN 318          
BLAST of Phospholipid scramblase vs. Ensembl Yeast
Match: AIM25 (Mitochondria protein of unknown function; interacts genetically with TOR1 to regulate chronological lifespan, and the response to both heat shock and oxidative stress; involved in maintaining the integrity of the mitochondrial network; negative regulator of mitophagy flux; non-tagged protein is detected in purified mitochondria in high-throughput studies; null mutant is viable and displays an elevated frequency of mitochondrial genome loss; similar to murine NOR1 [Source:SGD;Acc:S000003861])

HSP 1 Score: 59.6918 bits (143), Expect = 1.726e-10
Identity = 53/250 (21.20%), Postives = 104/250 (41.60%), Query Frame = 3
Query:  222 LLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEEN----GCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRP---LKCH---YMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDK------NIILRLHGPHYCFCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQF----------PMD------LDVKYKAIVLAAVFLIDFMYFENKNKDSNGAFSW 875
            +++++  + + VF  ++  N+Y + ++ G  +    E +       MR +   +R F++ V+DN   V+M I+RP   +  H    + P       S          G  +G   Q +   + RY +  KD       +   ++  P   F      D+P  V  A+G + +  + + W G  +E++T    + V+F          P +      L +  +A++LA    IDF YF   ++ + G  S+
Sbjct:   81 VIIERQIEFMNVFLGFEQANRYAIMDVNGNKIASMMERDFSITKAIMRQFYRLHRPFLVDVFDNWGNVIMTIKRPFSFINSHIKTIIPPSAYVDNGSDSTHYHDGKEGTTVGETIQNWHLWRRRYELFQKDGVEGSTFDQFGKIDAPFLSF------DFP--VTDADGKI-MASVDRNWVGLGREMFTDTGVYVVRFDSQRCFDNIYPTEMLSSQVLTLDQRAVLLANAVSIDFDYFSRHSRQTGGFLSF 321          
BLAST of Phospholipid scramblase vs. Ensembl Nematostella
Match: EDO31512 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXP9])

HSP 1 Score: 201.06 bits (510), Expect = 2.468e-63
Identity = 102/222 (45.95%), Postives = 148/222 (66.67%), Query Frame = 3
Query:  195 LEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGD-DYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFENKNKDS 857
            LEYLTQI+QLL++Q  +L E+FT  +  NKY + N LGQ V++AKE+  CC R  CG  R F + + DN+ + V+ + RPL+C           C    +EVQAP G V+GYV+Q +  C+ ++ I D ++  IL + GP  C C C  D ++P  V++A+G + +GK+TKQW+G  +E +T A+NFG+ FPMDLDVK KA++L AVFLIDFM+FE +N ++
Sbjct:   14 LEYLTQIDQLLIRQQVELFELFTGCEMKNKYQITNSLGQQVYFAKEDTDCCTRQCCGPARPFEMEITDNTGREVIHLSRPLRCACFC-----CWCCLQTIEVQAPRGNVVGYVEQEFYICKPKFTIKDANRQTILTMTGP-ICACRCCADVEFP--VLSADGTVPVGKVTKQWTGLIKEAFTDAENFGITFPMDLDVKMKAVMLGAVFLIDFMFFETQNHNN 227          
BLAST of Phospholipid scramblase vs. Ensembl Nematostella
Match: EDO46109 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR56])

HSP 1 Score: 196.052 bits (497), Expect = 1.156e-55
Identity = 98/211 (46.45%), Postives = 137/211 (64.93%), Query Frame = 3
Query:  192 GLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHY-MGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLI 821
            GLEYLT ++QLL+KQ  +L+E FT ++TNNKY + N LGQ VF+A E+  CC R  CG +R F I + DN+ + V+ + RPL+C     PCC        E+EVQ+PPG V+GY  Q +  C  +Y + D ++  IL++ GP   F  C   D    V++A+G  ++GK++KQWSG  +E +T ADNFGV FPMDLDVK KA+++   FLI
Sbjct:   86 GLEYLTMVDQLLIKQQVELLEAFTGFETNNKYKITNNLGQQVFFAAEDTDCCTRQCCGPSRPFDIKIMDNTQREVIHLTRPLRCSSCWFPCC------LQEVEVQSPPGTVVGYCCQSWSICIPKYTLQDANRQTILQIEGPLCTFNIC--GDVEFQVLSADGQNQVGKVSKQWSGLVKEAFTDADNFGVTFPMDLDVKMKAVIIGTAFLI 288          
BLAST of Phospholipid scramblase vs. Ensembl Medaka
Match: plscr3b (phospholipid scramblase 2 [Source:NCBI gene;Acc:101157328])

HSP 1 Score: 199.134 bits (505), Expect = 2.433e-61
Identity = 108/233 (46.35%), Postives = 151/233 (64.81%), Query Frame = 3
Query:  150 VTWVTAPVVP-GCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCF-CYCPGDDYPVGV-MTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFE 839
            V     P+VP G PPGLEYL QI+Q+L+ Q  +L+E F  ++TNN+Y + N LGQ ++ AKE+N CC R  CG+ RSF + + DN+++ V+ + RP +C        C  C   E+EVQAPPG  +GYVKQ +     +++I   +K  ++RL GP  CF C C GD   V   +    +  IG+ITKQWSG  +E++T  DNFG+QFP+DLDVK KA+++ A FLIDFM+FE
Sbjct:   55 VGAAPVPLVPIGIPPGLEYLAQIDQILIHQKVELLEAFIGFETNNQYEIKNNLGQKIYTAKEKNDCCTRNCCGALRSFDMKIKDNTDREVIRLIRPFRCVSC-----CCPCCLQEMEVQAPPGTTVGYVKQDWHPFLPKFSIQGANKETLMRLEGP--CFACNCCGD---VSFELKGKDETPIGRITKQWSGLLKEVFTDTDNFGIQFPLDLDVKMKAVLMGACFLIDFMFFE 277          
BLAST of Phospholipid scramblase vs. Ensembl Medaka
Match: plscr3b (phospholipid scramblase 2 [Source:NCBI gene;Acc:101157328])

HSP 1 Score: 199.134 bits (505), Expect = 2.433e-61
Identity = 108/233 (46.35%), Postives = 151/233 (64.81%), Query Frame = 3
Query:  150 VTWVTAPVVP-GCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCF-CYCPGDDYPVGV-MTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFE 839
            V     P+VP G PPGLEYL QI+Q+L+ Q  +L+E F  ++TNN+Y + N LGQ ++ AKE+N CC R  CG+ RSF + + DN+++ V+ + RP +C        C  C   E+EVQAPPG  +GYVKQ +     +++I   +K  ++RL GP  CF C C GD   V   +    +  IG+ITKQWSG  +E++T  DNFG+QFP+DLDVK KA+++ A FLIDFM+FE
Sbjct:   55 VGAAPVPLVPIGIPPGLEYLAQIDQILIHQKVELLEAFIGFETNNQYEIKNNLGQKIYTAKEKNDCCTRNCCGALRSFDMKIKDNTDREVIRLIRPFRCVSC-----CCPCCLQEMEVQAPPGTTVGYVKQDWHPFLPKFSIQGANKETLMRLEGP--CFACNCCGD---VSFELKGKDETPIGRITKQWSGLLKEVFTDTDNFGIQFPLDLDVKMKAVLMGACFLIDFMFFE 277          
BLAST of Phospholipid scramblase vs. Ensembl Medaka
Match: si:ch73-206p6.1 (phospholipid scramblase 1 [Source:NCBI gene;Acc:101170797])

HSP 1 Score: 190.274 bits (482), Expect = 1.979e-58
Identity = 95/217 (43.78%), Postives = 140/217 (64.52%), Query Frame = 3
Query:  201 YLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHY-MGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFENKN 848
            Y  Q++QLL+KQ  +L+E    +++NNKY + N++GQ+VFYA EEN C  R  CG  RSF I+V DN  Q ++ + RPLKC     PCC        ELEVQ+PPG  +GYV Q +     ++ + ++    +L++HGP   +   P  D+   ++T +   +IGKI+KQW+G  +E +T +DNFG+QFP+DLDV+ KA+++ A FLIDFM+FE  N
Sbjct:   37 YCCQVDQLLMKQKVELVEALVGFESNNKYEIRNVMGQNVFYAVEENDCLSRQCCGPLRSFTIHVLDNFGQEIITVTRPLKCMSCFFPCC------LQELEVQSPPGNTVGYVIQQWHPFFPKFIVANEHNEPVLKIHGPFCGWSCLPDVDFE--ILTMDEVNKIGKISKQWTGLLREAFTDSDNFGIQFPLDLDVRMKAVMIGACFLIDFMFFETTN 245          
BLAST of Phospholipid scramblase vs. Ensembl Medaka
Match: si:ch73-206p6.1 (phospholipid scramblase 1 [Source:NCBI gene;Acc:101170797])

HSP 1 Score: 190.274 bits (482), Expect = 1.979e-58
Identity = 95/217 (43.78%), Postives = 140/217 (64.52%), Query Frame = 3
Query:  201 YLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHY-MGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFENKN 848
            Y  Q++QLL+KQ  +L+E    +++NNKY + N++GQ+VFYA EEN C  R  CG  RSF I+V DN  Q ++ + RPLKC     PCC        ELEVQ+PPG  +GYV Q +     ++ + ++    +L++HGP   +   P  D+   ++T +   +IGKI+KQW+G  +E +T +DNFG+QFP+DLDV+ KA+++ A FLIDFM+FE  N
Sbjct:   37 YCCQVDQLLMKQKVELVEALVGFESNNKYEIRNVMGQNVFYAVEENDCLSRQCCGPLRSFTIHVLDNFGQEIITVTRPLKCMSCFFPCC------LQELEVQSPPGNTVGYVIQQWHPFFPKFIVANEHNEPVLKIHGPFCGWSCLPDVDFE--ILTMDEVNKIGKISKQWTGLLREAFTDSDNFGIQFPLDLDVRMKAVMIGACFLIDFMFFETTN 245          
BLAST of Phospholipid scramblase vs. Planmine SMEST
Match: SMESG000050656.1 (SMESG000050656.1)

HSP 1 Score: 509.605 bits (1311), Expect = 0.000e+0
Identity = 243/243 (100.00%), Postives = 243/243 (100.00%), Query Frame = 3
Query:  150 VTWVTAPVVPGCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFENKNKDSNGAFSWQ 878
            VTWVTAPVVPGCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFENKNKDSNGAFSWQ
Sbjct:   17 VTWVTAPVVPGCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFENKNKDSNGAFSWQ 259          
BLAST of Phospholipid scramblase vs. Planmine SMEST
Match: SMESG000050651.1 (SMESG000050651.1)

HSP 1 Score: 303.138 bits (775), Expect = 1.790e-101
Identity = 131/237 (55.27%), Postives = 187/237 (78.90%), Query Frame = 3
Query:  150 VTWVTAPVVPGCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFENKNKDSN 860
            V W++ P V GCP GLEYLT I+QLL+ Q  +L E+ + Y+TNN+Y++ NI GQ ++YAKE+  CC+R   G NR FVI+V D  N  V++IRRP  C+  G C +CS+C +DE++V+APPG+++GYVKQLYEGC++RY+I ++++ I+LRLHGP Y  CYCPGDD+P+ +++A+G +E+GK++KQWS   +EL+T ADNFG+QFPMDLDVK KA+++ +VFL+DFMYFE  NK ++
Sbjct:   88 VQWMSRPEVVGCPIGLEYLTLIDQLLIHQQVELFEILSGYETNNRYILKNIFGQKIYYAKEDTDCCIRNLTGPNRPFVIHVSDYLNHEVIQIRRPCTCNCCGQCFSCSECCQDEVQVEAPPGQIVGYVKQLYEGCEIRYSISNENREIVLRLHGPSYFKCYCPGDDFPLKLLSADGSVELGKVSKQWSNLVRELFTDADNFGIQFPMDLDVKIKAVIIGSVFLLDFMYFEQANKQNH 324          
BLAST of Phospholipid scramblase vs. Planmine SMEST
Match: SMESG000050651.1 (SMESG000050651.1)

HSP 1 Score: 298.13 bits (762), Expect = 9.056e-101
Identity = 129/234 (55.13%), Postives = 185/234 (79.06%), Query Frame = 3
Query:  159 VTAPVVPGCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFENKNKDSN 860
            ++ P V GCP GLEYLT I+QLL+ Q  +L E+ + Y+TNN+Y++ NI GQ ++YAKE+  CC+R   G NR FVI+V D  N  V++IRRP  C+  G C +CS+C +DE++V+APPG+++GYVKQLYEGC++RY+I ++++ I+LRLHGP Y  CYCPGDD+P+ +++A+G +E+GK++KQWS   +EL+T ADNFG+QFPMDLDVK KA+++ +VFL+DFMYFE  NK ++
Sbjct:    1 MSRPEVVGCPIGLEYLTLIDQLLIHQQVELFEILSGYETNNRYILKNIFGQKIYYAKEDTDCCIRNLTGPNRPFVIHVSDYLNHEVIQIRRPCTCNCCGQCFSCSECCQDEVQVEAPPGQIVGYVKQLYEGCEIRYSISNENREIVLRLHGPSYFKCYCPGDDFPLKLLSADGSVELGKVSKQWSNLVRELFTDADNFGIQFPMDLDVKIKAVIIGSVFLLDFMYFEQANKQNH 234          
BLAST of Phospholipid scramblase vs. Planmine SMEST
Match: SMESG000050116.1 (SMESG000050116.1)

HSP 1 Score: 209.534 bits (532), Expect = 2.817e-66
Identity = 99/231 (42.86%), Postives = 148/231 (64.07%), Query Frame = 3
Query:  159 VTAPVVPGCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCF-CYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFENKN 848
            +T  VV  C PGLEYLTQ++ +LVK++ + IE+  + D  NKY+V N++GQSV+YA E++  C+R+ CG+ R   I+VYD S+ VV++I  P + +     C C KC R+++++     +V+GY++++     + Y ILD++  ++L L GPHYC  C     D+   +M   G +EIG IT  W  W QE  + ++NFGVQFP+DL V  KA+ LAA F IDF+YFE  N
Sbjct:    1 MTKAVVKNCIPGLEYLTQLDSVLVKRMMNWIEILRKIDPKNKYIVKNMIGQSVYYAIEDSNQCLRWCCGTKRPSNIFVYDKSDSVVLKIEHPFQNNCFNISCICCKCCRNQIKITTGSDQVLGYIQEINNCGFIVYFILDENSKLLLILKGPHYCHGCCSSRSDFSFKIMDNTGKVEIGAITNSWRCWTQEWLSNSENFGVQFPIDLAVNVKALALAATFFIDFLYFERIN 231          
BLAST of Phospholipid scramblase vs. Planmine SMEST
Match: SMESG000043802.1 (SMESG000043802.1)

HSP 1 Score: 204.527 bits (519), Expect = 4.871e-62
Identity = 110/238 (46.22%), Postives = 147/238 (61.76%), Query Frame = 3
Query:  168 PVVPGCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLK---CHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGD----DYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFENKNKDSN 860
            P V GCPPGLEYLT ++Q+LV Q  +L+EVFT ++T NKY + N LGQ V+YA EE+  C R  CG  R FV+++ DN    V+   R  K         C     C++ EL V+APPG+ IG V Q     +  YAI + D+  +L++ GP    C C G     D    V +++   E+G+I+KQWSG+  E +T ADNFGV FP+DLDVK KA +LAAVFLIDFM+FEN  ++ N
Sbjct:  175 PQVVGCPPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKCCAGPCCHCCAGIDMCAQ-ELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGP---ICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFENNQQNQN 408          
The following BLAST results are available for this feature:
BLAST of Phospholipid scramblase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLSCR14.575e-6243.03phospholipid scramblase 1 [Source:HGNC Symbol;Acc:... [more]
PLSCR14.642e-6243.03phospholipid scramblase 1 [Source:HGNC Symbol;Acc:... [more]
PLSCR35.922e-5839.91phospholipid scramblase 3 [Source:HGNC Symbol;Acc:... [more]
PLSCR35.922e-5839.91phospholipid scramblase 3 [Source:HGNC Symbol;Acc:... [more]
PLSCR35.922e-5839.91phospholipid scramblase 3 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Phospholipid scramblase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scrm-16.780e-5239.75Phospholipid scramblase [Source:UniProtKB/TrEMBL;... [more]
scrm-11.114e-5139.74Phospholipid scramblase [Source:UniProtKB/TrEMBL;... [more]
scrm-11.114e-5139.74Phospholipid scramblase [Source:UniProtKB/TrEMBL;... [more]
scrm-11.158e-5139.74Phospholipid scramblase [Source:UniProtKB/TrEMBL;... [more]
scrm-21.404e-4839.06Phospholipid scramblase [Source:UniProtKB/TrEMBL;... [more]
back to top
BLAST of Phospholipid scramblase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scramb13.264e-6746.15gene:FBgn0052056 transcript:FBtr0076302[more]
scramb14.797e-6646.58gene:FBgn0052056 transcript:FBtr0076303[more]
scramb11.250e-6445.64gene:FBgn0052056 transcript:FBtr0076301[more]
scramb21.025e-5643.48gene:FBgn0035390 transcript:FBtr0073005[more]
CG90842.344e-1525.68gene:FBgn0033582 transcript:FBtr0088197[more]
back to top
BLAST of Phospholipid scramblase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-71m22.16.970e-7151.58si:ch211-71m22.1 [Source:ZFIN;Acc:ZDB-GENE-070705-... [more]
si:ch211-71m22.16.970e-7151.58si:ch211-71m22.1 [Source:ZFIN;Acc:ZDB-GENE-070705-... [more]
si:ch211-71m22.16.970e-7151.58si:ch211-71m22.1 [Source:ZFIN;Acc:ZDB-GENE-070705-... [more]
si:ch211-71m22.11.876e-7050.43si:ch211-71m22.1 [Source:ZFIN;Acc:ZDB-GENE-070705-... [more]
si:ch73-206p6.12.751e-7047.62si:ch73-206p6.1 [Source:ZFIN;Acc:ZDB-GENE-030131-5... [more]
back to top
BLAST of Phospholipid scramblase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
insyn16.110e-6747.79inhibitory synaptic factor 1 [Source:Xenbase;Acc:X... [more]
insyn18.485e-6747.79inhibitory synaptic factor 1 [Source:Xenbase;Acc:X... [more]
ENSXETT00000012543.11.688e-6545.45phospholipid scramblase 2 [Source:NCBI gene;Acc:10... [more]
kpna62.614e-3538.28karyopherin alpha 6 (importin alpha 7) [Source:Xen... [more]
kpna64.676e-3538.14karyopherin alpha 6 (importin alpha 7) [Source:Xen... [more]
back to top
BLAST of Phospholipid scramblase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Plscr17.954e-6443.67phospholipid scramblase 1 [Source:MGI Symbol;Acc:M... [more]
Plscr17.954e-6443.67phospholipid scramblase 1 [Source:MGI Symbol;Acc:M... [more]
Plscr23.284e-6144.10phospholipid scramblase 2 [Source:MGI Symbol;Acc:M... [more]
Plscr23.284e-6144.10phospholipid scramblase 2 [Source:MGI Symbol;Acc:M... [more]
Plscr32.379e-6042.06phospholipid scramblase 3 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Phospholipid scramblase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3ZBG9|PLS2_BOVIN3.264e-6544.59Phospholipid scramblase 2 OS=Bos taurus OX=9913 GN... [more]
sp|Q9JJ00|PLS1_MOUSE5.564e-6343.67Phospholipid scramblase 1 OS=Mus musculus OX=10090... [more]
sp|O15162|PLS1_HUMAN2.197e-6143.03Phospholipid scramblase 1 OS=Homo sapiens OX=9606 ... [more]
sp|P58195|PLS1_RAT4.348e-6142.98Phospholipid scramblase 1 OS=Rattus norvegicus OX=... [more]
sp|Q9DCW2|PLS2_MOUSE2.297e-6044.10Phospholipid scramblase 2 OS=Mus musculus OX=10090... [more]
back to top
BLAST of Phospholipid scramblase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G7YRN62.226e-8452.36Phospholipid scramblase OS=Clonorchis sinensis OX=... [more]
A0A075A1P09.324e-8453.33Phospholipid scramblase OS=Opisthorchis viverrini ... [more]
A0A5J4NIX52.279e-8251.05Phospholipid scramblase OS=Paragonimus westermani ... [more]
A0A4S2LUZ82.734e-8252.38Phospholipid scramblase OS=Opisthorchis felineus O... [more]
A0A3R7GRQ53.403e-8252.36Phospholipid scramblase OS=Clonorchis sinensis OX=... [more]
back to top
BLAST of Phospholipid scramblase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-71m22.16.608e-7152.02phospholipid scramblase 1-like [Source:NCBI gene;A... [more]
si:ch73-206p6.11.708e-6948.05phospholipid scramblase 1 [Source:NCBI gene;Acc:10... [more]
si:ch211-71m22.53.255e-6548.44si:ch211-71m22.5 [Source:ZFIN;Acc:ZDB-GENE-130531-... [more]
si:ch211-71m22.12.318e-6450.93phospholipid scramblase 1-like [Source:NCBI gene;A... [more]
plscr3b1.275e-6246.49phospholipid scramblase 2-like [Source:NCBI gene;A... [more]
back to top
BLAST of Phospholipid scramblase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phospholipid scramblase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
AIM251.726e-1021.20Mitochondria protein of unknown function; interact... [more]
back to top
BLAST of Phospholipid scramblase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO315122.468e-6345.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461091.156e-5546.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phospholipid scramblase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
plscr3b2.433e-6146.35phospholipid scramblase 2 [Source:NCBI gene;Acc:10... [more]
plscr3b2.433e-6146.35phospholipid scramblase 2 [Source:NCBI gene;Acc:10... [more]
si:ch73-206p6.11.979e-5843.78phospholipid scramblase 1 [Source:NCBI gene;Acc:10... [more]
si:ch73-206p6.11.979e-5843.78phospholipid scramblase 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Phospholipid scramblase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000050656.10.000e+0100.00SMESG000050656.1[more]
SMESG000050651.11.790e-10155.27SMESG000050651.1[more]
SMESG000050651.19.056e-10155.13SMESG000050651.1[more]
SMESG000050116.12.817e-6642.86SMESG000050116.1[more]
SMESG000043802.14.871e-6246.22SMESG000043802.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005191 ID=SMED30005191|Name=Phospholipid scramblase|organism=Schmidtea mediterranea sexual|type=transcript|length=1085bp
TATCAAAAAAAACATCATTCTTGCACACGAACAATTAAAGTTTGTAAGCA
GAATTATTTTCACCAGAAATTTAAAAATTATTCAGATAACGTAAAATGCA
AATGAACATGGAAAATAGAAATCCACAAAGACAACAACAGCAGGCTCGAG
TTACATGGGTGACCGCTCCTGTGGTGCCGGGATGTCCACCAGGACTTGAA
TATTTGACTCAGATCAATCAGCTATTGGTGAAGCAGCTATTTGATTTAAT
TGAAGTTTTCACTGAATACGATACGAATAACAAATATCTGGTAAATAATA
TTCTTGGACAGTCAGTTTTCTATGCGAAAGAAGAAAATGGTTGCTGCATG
CGATATTGGTGTGGAAGCAACCGATCCTTTGTCATTTATGTGTATGACAA
TTCCAACCAGGTGGTCATGGAAATTAGAAGACCACTAAAGTGCCATTATA
TGGGCCCATGTTGTAATTGTTCTAAATGTTCACGGGATGAATTAGAGGTC
CAGGCTCCCCCTGGTGAAGTAATTGGTTATGTAAAACAACTCTATGAAGG
ATGCCAAGTTCGTTATGCAATATTGGACAAAGACAAAAACATAATATTAA
GATTACACGGCCCGCATTACTGCTTTTGCTATTGTCCAGGGGACGATTAT
CCAGTTGGAGTAATGACAGCAAATGGAGATTTAGAAATAGGAAAGATTAC
AAAACAATGGTCTGGTTGGGCCCAAGAACTTTATACAACTGCAGATAATT
TTGGCGTCCAATTTCCGATGGATCTAGATGTGAAATATAAAGCTATTGTT
CTAGCAGCAGTTTTTCTCATTGATTTCATGTATTTTGAAAATAAAAACAA
AGACAGCAATGGAGCATTTAGCTGGCAGTAATGTTTTAAACAAAAATATT
TGATTTTAATGACTGCATGAAAAACAGCCCATTTGCTAGTTAGAACCTTG
ATTATCATTTTTGAGTTATTTTTGCATTACTATTTCAACATCTTTTTTGT
TTATTTTGTTATCTAACTCAGATAGATAATCTGAGAAGTAATCAAATGAT
CATTAGTTTTTTGTGAATTATAAATCTGCTTACGG
back to top

protein sequence of SMED30005191-orf-1

>SMED30005191-orf-1 ID=SMED30005191-orf-1|Name=SMED30005191-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=262bp
MQMNMENRNPQRQQQQARVTWVTAPVVPGCPPGLEYLTQINQLLVKQLFD
LIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVY
DNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLY
EGCQVRYAILDKDKNIILRLHGPHYCFCYCPGDDYPVGVMTANGDLEIGK
ITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFENK
NKDSNGAFSWQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR005552Scramblase
IPR025659Tubby-like_C
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0017121phospholipid scrambling
Vocabulary: molecular function
TermDefinition
GO:0017128phospholipid scramblase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005552ScramblasePFAMPF03803Scramblasecoord: 26..249
e-value: 7.6E-68
score: 228.1
IPR005552ScramblasePANTHERPTHR23248PHOSPHOLIPID SCRAMBLASE-RELATEDcoord: 11..253
NoneNo IPR availablePANTHERPTHR23248:SF38PHOSPHOLIPID SCRAMBLASE 1-RELATEDcoord: 11..253
IPR025659Tubby-like, C-terminalSUPERFAMILYSSF54518Tubby C-terminal domain-likecoord: 61..246