Venom allergen 5

Overview
NameVenom allergen 5
Smed IDSMED30005188
Length (bp)1330
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Venom allergen 5 (SMED30005188) t-SNE clustered cells

Violin plots show distribution of expression levels for Venom allergen 5 (SMED30005188) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Venom allergen 5 (SMED30005188) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Venom allergen 5 (SMED30005188) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005188

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30005188 dd_Smed_v4_607_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30005188 dd_Smed_v4_607_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
posterior region of the whole animalSMED30005188 dd_Smed_v4_607_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30005188 dd_Smed_v4_607_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005188 dd_Smed_v4_607_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30005188 dd_Smed_v4_607_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30005188SMESG000062609.1 dd_Smed_v6_159_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30005188SMESG000062609.1 SMESG000005324.1 OX_Smed_1.0.17429ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
body wall musculatureSMED30005188SMESG000062609.1 dd_Smed_v4_159_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30005188 dd_Smed_v6_607_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30005188SMESG000062609.1 dd_Smed_v4_159_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Venom allergen 5 vs. Ensembl Human
Match: TSPO (translocator protein [Source:HGNC Symbol;Acc:HGNC:1158])

HSP 1 Score: 130.568 bits (327), Expect = 1.681e-35
Identity = 66/152 (43.42%), Postives = 90/152 (59.21%), Query Frame = -2
Query:  100 MAFAISLPFYGSLPSQFTMKKEIDGWYKTIKKPCFTPPNYVFGPVWTALYAAMGYASYLLWKEGGGFNEQTKLPIMLYGTQLVLNWAWSVIFFKKHQIGWASVDLTILYANVVACVLTFRPISHQASNLLLPYLAWITLASALNFRIWMLNK 555
            M F ++ P  G       +  E   WY  ++KP + PP++V GPVW  LY+AMGY SYL+WKE GGF E+  +P+ LY  QL LNWAW  IFF   Q+GWA VDL ++     A  + +  +S  A+ LL PYLAW+   + LN+ +W  N 
Sbjct:    9 MGFTLA-PSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAMGYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNH 159          
BLAST of Venom allergen 5 vs. Ensembl Human
Match: TSPO (translocator protein [Source:HGNC Symbol;Acc:HGNC:1158])

HSP 1 Score: 130.568 bits (327), Expect = 1.681e-35
Identity = 66/152 (43.42%), Postives = 90/152 (59.21%), Query Frame = -2
Query:  100 MAFAISLPFYGSLPSQFTMKKEIDGWYKTIKKPCFTPPNYVFGPVWTALYAAMGYASYLLWKEGGGFNEQTKLPIMLYGTQLVLNWAWSVIFFKKHQIGWASVDLTILYANVVACVLTFRPISHQASNLLLPYLAWITLASALNFRIWMLNK 555
            M F ++ P  G       +  E   WY  ++KP + PP++V GPVW  LY+AMGY SYL+WKE GGF E+  +P+ LY  QL LNWAW  IFF   Q+GWA VDL ++     A  + +  +S  A+ LL PYLAW+   + LN+ +W  N 
Sbjct:    9 MGFTLA-PSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAMGYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNH 159          
BLAST of Venom allergen 5 vs. Ensembl Human
Match: TSPO (translocator protein [Source:HGNC Symbol;Acc:HGNC:1158])

HSP 1 Score: 130.568 bits (327), Expect = 1.681e-35
Identity = 66/152 (43.42%), Postives = 90/152 (59.21%), Query Frame = -2
Query:  100 MAFAISLPFYGSLPSQFTMKKEIDGWYKTIKKPCFTPPNYVFGPVWTALYAAMGYASYLLWKEGGGFNEQTKLPIMLYGTQLVLNWAWSVIFFKKHQIGWASVDLTILYANVVACVLTFRPISHQASNLLLPYLAWITLASALNFRIWMLNK 555
            M F ++ P  G       +  E   WY  ++KP + PP++V GPVW  LY+AMGY SYL+WKE GGF E+  +P+ LY  QL LNWAW  IFF   Q+GWA VDL ++     A  + +  +S  A+ LL PYLAW+   + LN+ +W  N 
Sbjct:    9 MGFTLA-PSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAMGYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNH 159          
BLAST of Venom allergen 5 vs. Ensembl Human
Match: PI16 (peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGNC:21245])

HSP 1 Score: 112.464 bits (280), Expect = 1.956e-26
Identity = 62/182 (34.07%), Postives = 97/182 (53.30%), Query Frame = 3
Query:  744 GVTPAQQKQLIDAHNKYRRDAAQGKIGGQPAAANMLELKWNNEAAQRAQNSANKCVFGHDQPRDRKFGNYDWVGQNIAFWSSN--DVTEGVKMWYDEVNGYNFNSDQCS-GFTCLHYTALVWAKTKEFGCGIADCSR----QNLGKIFLFCNYGPGGNWNREKPYEVGKACSKCPSGTRCNN 1268
             +T  +++ +++ HN YR   +       P A++ML ++W+ E A  A+  A +CV+GH++ R R+       G+N+   +    DV   ++ W+ E   YN ++  CS G  C HYT +VWAKT+  GCG   C +    +      L CNY P GN   ++PY+ G  CS+CPSG  C N
Sbjct:   27 ALTDEEKRLMVELHNLYRAQVS-------PTASDMLHMRWDEELAAFAKAYARQCVWGHNKERGRR-------GENLFAITDEGMDVPLAMEEWHHEREHYNLSAATCSPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIELLVCNYEPPGNVKGKRPYQEGTPCSQCPSGYHCKN 194          
BLAST of Venom allergen 5 vs. Ensembl Human
Match: PI16 (peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGNC:21245])

HSP 1 Score: 112.464 bits (280), Expect = 1.956e-26
Identity = 62/182 (34.07%), Postives = 97/182 (53.30%), Query Frame = 3
Query:  744 GVTPAQQKQLIDAHNKYRRDAAQGKIGGQPAAANMLELKWNNEAAQRAQNSANKCVFGHDQPRDRKFGNYDWVGQNIAFWSSN--DVTEGVKMWYDEVNGYNFNSDQCS-GFTCLHYTALVWAKTKEFGCGIADCSR----QNLGKIFLFCNYGPGGNWNREKPYEVGKACSKCPSGTRCNN 1268
             +T  +++ +++ HN YR   +       P A++ML ++W+ E A  A+  A +CV+GH++ R R+       G+N+   +    DV   ++ W+ E   YN ++  CS G  C HYT +VWAKT+  GCG   C +    +      L CNY P GN   ++PY+ G  CS+CPSG  C N
Sbjct:   27 ALTDEEKRLMVELHNLYRAQVS-------PTASDMLHMRWDEELAAFAKAYARQCVWGHNKERGRR-------GENLFAITDEGMDVPLAMEEWHHEREHYNLSAATCSPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIELLVCNYEPPGNVKGKRPYQEGTPCSQCPSGYHCKN 194          
BLAST of Venom allergen 5 vs. Ensembl Celegans
Match: scl-5 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q18543])

HSP 1 Score: 97.4413 bits (241), Expect = 2.435e-23
Identity = 67/211 (31.75%), Postives = 97/211 (45.97%), Query Frame = 3
Query:  684 MRNSILFGLIICVVLSVIECGVTPAQQKQLIDAHNKYRRDAAQG----KIGGQPAAANMLELKWNNEAAQRAQNSANKCVFGHDQPRDRKFGNYDWVGQNIA-FWSSNDVT-------EGVKMWYDEVNGYNFNSDQCS----GFTCLHYTALVWAKTKEFGCGIADCSRQNLG--KIFLFCNYGPGGNWNREKPYEVGKACSKCPSGTRC 1262
            M  SIL    +C   +      +   Q  +++ HN  R   A+G    K   +PAA++ML++KW+   A  AQ  ANKC  GH             +G+N+  +W+S  +T        G   W  E   Y ++S+  S         H T + WAKT   GCG+ +C +   G  K+ + C Y P GN+  +  Y  G  CSKCPSGT C
Sbjct:    1 MHTSILLLTALC---AGAYAQFSANGQAAILNVHNTLRSRIAKGTYVAKGTAKPAASDMLKMKWDATVAASAQAYANKCPTGHSGAAG--------LGENLYWYWTSATITNIDQFGATGSAAWEKEFQDYGWSSNTLSMSLFNTGIGHATQMAWAKTNLIGCGVKNCGKDTNGFNKVTVVCQYKPQGNYLNQNIYTSGTTCSKCPSGTSC 200          
BLAST of Venom allergen 5 vs. Ensembl Celegans
Match: scl-10 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q20609])

HSP 1 Score: 92.4337 bits (228), Expect = 1.858e-21
Identity = 60/207 (28.99%), Postives = 96/207 (46.38%), Query Frame = 3
Query:  702 FGLIICVVLSVIE--CGVTPAQQKQLIDAHNKYRRDAAQGK-IGG---QPAAANMLELKWNNEAAQRAQNSANKCVFGHDQPRDRKFGNYDWVGQNIAFWSSNDVTE---------GVKMWYDEVNGYNFN----SDQCSGFTCLHYTALVWAKTKEFGCGIADCSRQNLGKIFLF-CNYGPGGNWNREKPYEVGKACSKCPSGTRC 1262
            F LI  ++ S  E  C  +   +  ++  HN  R   A GK + G   +P+A+NM++L W+      AQ+ +  C  GH   R         +G+N+ +W+S  VT+            +W  E   + +N    +++       H T + WA T + GCGI+ CS  + G  ++  C Y P GN+     Y+ G+ CS CP GT C
Sbjct:    5 FRLICLLIFSFCETLCEFSETGKNYILSRHNYLRSQIALGKYVAGNSTKPSASNMMKLIWDTTLETTAQDYSTGCPTGHSASRAN-------IGENMYWWTSPVVTQTDAELLGNRSANLWESEFQRFGWNGNLLTEELFNSGIGHATQMAWATTNKIGCGISKCSSDSFGTQYVVVCLYSPAGNYIGMDIYKSGETCSNCPDGTNC 204          
BLAST of Venom allergen 5 vs. Ensembl Celegans
Match: scl-11 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q93746])

HSP 1 Score: 88.9669 bits (219), Expect = 2.822e-20
Identity = 61/206 (29.61%), Postives = 92/206 (44.66%), Query Frame = 3
Query:  708 LIICVVLSVIECGVTPAQQKQLIDAHNKYRRDAAQG----KIGGQPAAANMLELKWNNEAAQRAQNSANKCVFGHDQPRDRKFGNYDWVGQNIA-FWSSNDV-------TEGVKMWYDEVNGYNFNSDQCSGFT----CLHYTALVWAKTKEFGCGIADCSRQ---NLGKIFLFCNYGPGGNWNREKPYEVGKACSKCPSGTRCNN 1268
            L++C +  V     T   Q+ ++DAHNK R   A+G    K   Q + +NM ++KW+   A  AQN AN C  GH Q            G+N+  +W+S  +             W  E   Y + S+     T      H T + WA T   GCG+ +C +       K+ + C Y   GN+  +  Y+ G  C+ CPSGT C++
Sbjct:    6 LLVCCIAGVFS-QFTSTGQQAIVDAHNKLRSSIAKGTYVAKGTTQKSGSNMRKIKWDATVATSAQNYANTCPTGHSQGSG--------YGENLYWYWTSGTIGNLDTFGPAASSSWESEFQQYGWTSNTLDMNTFNTGIGHATQMAWANTFAIGCGVKNCGKDPSNGYNKVAVVCQYKTPGNYLNQPIYQQGTTCAACPSGTACDS 202          
BLAST of Venom allergen 5 vs. Ensembl Celegans
Match: scl-14 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q93444])

HSP 1 Score: 88.9669 bits (219), Expect = 2.999e-20
Identity = 62/207 (29.95%), Postives = 95/207 (45.89%), Query Frame = 3
Query:  702 FGLIICVVLSVIECGVTPAQQKQLIDAHNKYRRDAAQGKIGG----QPAAANMLELKWNNEAAQRAQNSANKCVFGHDQPRDRKFGNYDWVGQNIA-FWSSNDVTE-------GVKMWYDEVNGYNFNSDQC------SGFTCLHYTALVWAKTKEFGCGIADCSRQN--LGKIFLFCNYGPGGNWNREKPYEVGKACSKCPSGTRC 1262
            F L++ V+ +      T   Q  +++ HN  R   A+G        + AA++ML++KW    A  +Q  AN+C  GH         N   VG+N+  +W+S  +T            W  E   Y ++S+        SG    H T + WAKT   GCG+ +C      + K+ + C+Y P GN+  +  Y  G  CSKCP+GT C
Sbjct:    4 FILLLTVLCAGAYTQFTANGQAAILNVHNTLRSRIAKGTYVARGTVKHAASDMLKMKWLRSLATSSQIYANRCPTGHS--------NMIGVGENLYWYWTSGTITNIDQFGAMASAAWEKEFQDYGWSSNTLTMSLFNSGVG--HATQMAWAKTNLIGCGVKNCGMDTNGMNKVAVVCHYQPQGNYLNQNIYTSGTTCSKCPAGTSC 200          
BLAST of Venom allergen 5 vs. Ensembl Celegans
Match: scl-2 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q20603])

HSP 1 Score: 87.4261 bits (215), Expect = 1.144e-19
Identity = 62/204 (30.39%), Postives = 93/204 (45.59%), Query Frame = 3
Query:  708 LIICVVLSV-IECGVTPAQQKQLIDAHNKYRRDAAQG----KIGGQPAAANMLELKWNNEAAQRAQNSANKCVFGHDQPRDRKFGNYDWVGQNIA-FWSSNDV-------TEGVKMWYDEVNGYNFNSDQCS----GFTCLHYTALVWAKTKEFGCGIADCSRQN--LGKIFLFCNYGPGGNWNREKPYEVGKACSKCPSGTRC 1262
            L++ V L+V        + Q  +I+AHN  R   A+G    K   +    N+L++KW++  A  AQN AN C  GH             +G+N+  +W+S  +       +     W  E   Y + S+  +         H T + WAK+   GCG+ DC R +  L K+ + C Y P GN+  +  Y  G  CS CPSGT C
Sbjct:    4 LLLVVALAVGCSADFGSSGQNGIINAHNTLRSKIAKGTYVAKGTQKSPGTNLLKMKWDSAVAASAQNYANGCPTGHSGDAG--------LGENLYWYWTSGSLGDLNQYGSAASASWEKEFQDYGWKSNLMTIDLFNTGIGHATQMAWAKSNLIGCGVKDCGRDSNGLNKVTVVCQYKPQGNFINQYIYVSGATCSGCPSGTSC 199          
BLAST of Venom allergen 5 vs. Ensembl Fly
Match: Tspo (gene:FBgn0031263 transcript:FBtr0078066)

HSP 1 Score: 149.058 bits (375), Expect = 1.295e-42
Identity = 71/154 (46.10%), Postives = 99/154 (64.29%), Query Frame = -2
Query:  103 LKMAFAISLPFYGSLPSQFTMKKEIDGWYKTIKKPCFTPPNYVFGPVWTALYAAMGYASYLLWKEGGGF-NEQTKLPIMLYGTQLVLNWAWSVIFFKKHQIGWASVDLTILYANVVACVLTFRPISHQASNLLLPYLAWITLASALNFRIWMLN 561
            L++A A+ LP  G + +    ++ +  WY  +K P F PPN VF P+W +LYA MGY SYL+W++GGGF  E  KLP++ YGTQL LNWAW+ IFF +H I    +D+  L A   AC + F  ++  A  L +PY+AW+  A+ALN+ IW LN
Sbjct:   11 LRIAGAVILPNLGGIYNGRLTRQHLQSWYANLKFPSFKPPNSVFAPMWISLYAGMGYGSYLVWRDGGGFAGEAAKLPLIAYGTQLALNWAWTPIFFGQHNIKGGLIDIVALTAAASACGVLFYRVNKTAGLLFVPYVAWLGFATALNYAIWKLN 164          
BLAST of Venom allergen 5 vs. Ensembl Fly
Match: CG8483 (gene:FBgn0038126 transcript:FBtr0082782)

HSP 1 Score: 110.153 bits (274), Expect = 3.249e-26
Identity = 69/178 (38.76%), Postives = 95/178 (53.37%), Query Frame = 3
Query:  732 VIECGVTPAQQKQLIDAHNKYRRDAAQGKIGGQPAAANMLELKWNNEAAQRAQNSANKCVFGHDQPRDRKFGNYDWVGQNIA-FWSS-------NDVTEGVKMWYDEVNGYNFNSDQCSGFTCLHYTALVWAKTKEFGCGIADCSRQNLGKIFLFCNYGPGGNWNREKPYEVGK-ACS 1238
            +I  G+T  ++  ++  HN+ R+  A G+  GQP A NM E+ W++E A RAQ  A+ C F HD  R     N   +GQN+A  WS+        D    ++ W++EV  Y+F  D  S  T  HY+ LVW +T   GCG A+    +       CNYGPGGN     PYEVGK +CS
Sbjct:   27 IIASGITAEERSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHDPHRTI---NRFTMGQNLAIIWSTAPLDADDGDFPSRIQSWFNEVQKYSFG-DAWSPKTG-HYSQLVWGETSLVGCGYAEYKDTSKYNKLYVCNYGPGGNVVGYNPYEVGKPSCS 199          
BLAST of Venom allergen 5 vs. Ensembl Fly
Match: Ag5r (gene:FBgn0015010 transcript:FBtr0333658)

HSP 1 Score: 73.9442 bits (180), Expect = 1.322e-14
Identity = 58/187 (31.02%), Postives = 82/187 (43.85%), Query Frame = 3
Query:  747 VTPAQQKQLIDAHNKYRRDAAQGKIGGQPAAANMLELKWNNEAAQRAQNSANKCVFGHDQPRDRKFGNYDWVGQNIA---FWSSNDVTE----GVKMWYDE--------VNGYNFNSDQCSGFTCLHYTALVWAKTKEFGCGIA--DCSRQNLGKIFLFCNYGPGGNWNREKPYEVGKACSKCPSGT 1256
            ++ A++  L+   N+YR   A G      AA  M  +KWN+E A  A  +   C   HD   +     +DW GQN+A   +++  +VT     GV MWYDE        ++ Y  N +   G    H+T LV  +  E GC  A    S Q+     L CNY        +      KA SKC +GT
Sbjct:   54 LSSAEKDALVARTNEYRNHIAGGLNANLSAACRMATIKWNDELAYLASLNVKSCQMKHDGCHNTD--AFDWSGQNLAWMGYYNPLNVTHYLEWGVDMWYDEAVYTKQAYIDAYPSNYN---GPAIGHFTVLVADRNTEVGCAAATYSVSGQSYKAFLLACNYAATNVLGIKMYSSCSKAASKCTTGT 235          
BLAST of Venom allergen 5 vs. Ensembl Fly
Match: Ag5r (gene:FBgn0015010 transcript:FBtr0073937)

HSP 1 Score: 73.9442 bits (180), Expect = 1.322e-14
Identity = 58/187 (31.02%), Postives = 82/187 (43.85%), Query Frame = 3
Query:  747 VTPAQQKQLIDAHNKYRRDAAQGKIGGQPAAANMLELKWNNEAAQRAQNSANKCVFGHDQPRDRKFGNYDWVGQNIA---FWSSNDVTE----GVKMWYDE--------VNGYNFNSDQCSGFTCLHYTALVWAKTKEFGCGIA--DCSRQNLGKIFLFCNYGPGGNWNREKPYEVGKACSKCPSGT 1256
            ++ A++  L+   N+YR   A G      AA  M  +KWN+E A  A  +   C   HD   +     +DW GQN+A   +++  +VT     GV MWYDE        ++ Y  N +   G    H+T LV  +  E GC  A    S Q+     L CNY        +      KA SKC +GT
Sbjct:   54 LSSAEKDALVARTNEYRNHIAGGLNANLSAACRMATIKWNDELAYLASLNVKSCQMKHDGCHNTD--AFDWSGQNLAWMGYYNPLNVTHYLEWGVDMWYDEAVYTKQAYIDAYPSNYN---GPAIGHFTVLVADRNTEVGCAAATYSVSGQSYKAFLLACNYAATNVLGIKMYSSCSKAASKCTTGT 235          
BLAST of Venom allergen 5 vs. Ensembl Fly
Match: Ag5r (gene:FBgn0015010 transcript:FBtr0305582)

HSP 1 Score: 73.9442 bits (180), Expect = 1.322e-14
Identity = 58/187 (31.02%), Postives = 82/187 (43.85%), Query Frame = 3
Query:  747 VTPAQQKQLIDAHNKYRRDAAQGKIGGQPAAANMLELKWNNEAAQRAQNSANKCVFGHDQPRDRKFGNYDWVGQNIA---FWSSNDVTE----GVKMWYDE--------VNGYNFNSDQCSGFTCLHYTALVWAKTKEFGCGIA--DCSRQNLGKIFLFCNYGPGGNWNREKPYEVGKACSKCPSGT 1256
            ++ A++  L+   N+YR   A G      AA  M  +KWN+E A  A  +   C   HD   +     +DW GQN+A   +++  +VT     GV MWYDE        ++ Y  N +   G    H+T LV  +  E GC  A    S Q+     L CNY        +      KA SKC +GT
Sbjct:   54 LSSAEKDALVARTNEYRNHIAGGLNANLSAACRMATIKWNDELAYLASLNVKSCQMKHDGCHNTD--AFDWSGQNLAWMGYYNPLNVTHYLEWGVDMWYDEAVYTKQAYIDAYPSNYN---GPAIGHFTVLVADRNTEVGCAAATYSVSGQSYKAFLLACNYAATNVLGIKMYSSCSKAASKCTTGT 235          
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Match: tspo (translocator protein [Source:ZFIN;Acc:ZDB-GENE-041010-125])

HSP 1 Score: 142.124 bits (357), Expect = 4.266e-40
Identity = 68/162 (41.98%), Postives = 101/162 (62.35%), Query Frame = -2
Query:   79 YLKMAFAISLPFYGSLPSQFTMKKEIDGWYKTIKKPCFTPPNYVFGPVWTALYAAMGYASYLLWKEGGGFNEQTKLPIMLYGTQLVLNWAWSVIFFKKHQIGWASVDLTILYANVVACVLTFRPISHQASNLLLPYLAWITLASALNFRIWMLNKHNLTRED 564
            ++ M    +LP  G +      ++E+  WY T+ KP + PPN  F  VWT LY  MGY SYL+WKE GGF +   +P+ LYG QL LNWAW+ IFF  H+I  A ++L ++   V A ++++ PIS  A+ L++PY+AW+ +A++LN+ IW  N     +ED
Sbjct:    2 WIPMLSLTALPHVGGIFGGIITRREVKTWYSTLNKPSWRPPNAAFPVVWTTLYTGMGYGSYLVWKELGGFTQDAMVPLGLYGLQLALNWAWTPIFFGAHKIQLALIELLLMSGTVAATMVSWYPISRTATLLMVPYMAWLCVATSLNYCIWRDNPEP-KKED 162          
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Match: tspo (translocator protein [Source:ZFIN;Acc:ZDB-GENE-041010-125])

HSP 1 Score: 142.124 bits (357), Expect = 4.266e-40
Identity = 68/162 (41.98%), Postives = 101/162 (62.35%), Query Frame = -2
Query:   79 YLKMAFAISLPFYGSLPSQFTMKKEIDGWYKTIKKPCFTPPNYVFGPVWTALYAAMGYASYLLWKEGGGFNEQTKLPIMLYGTQLVLNWAWSVIFFKKHQIGWASVDLTILYANVVACVLTFRPISHQASNLLLPYLAWITLASALNFRIWMLNKHNLTRED 564
            ++ M    +LP  G +      ++E+  WY T+ KP + PPN  F  VWT LY  MGY SYL+WKE GGF +   +P+ LYG QL LNWAW+ IFF  H+I  A ++L ++   V A ++++ PIS  A+ L++PY+AW+ +A++LN+ IW  N     +ED
Sbjct:    2 WIPMLSLTALPHVGGIFGGIITRREVKTWYSTLNKPSWRPPNAAFPVVWTTLYTGMGYGSYLVWKELGGFTQDAMVPLGLYGLQLALNWAWTPIFFGAHKIQLALIELLLMSGTVAATMVSWYPISRTATLLMVPYMAWLCVATSLNYCIWRDNPEP-KKED 162          
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Match: r3hdml (R3H domain containing-like [Source:ZFIN;Acc:ZDB-GENE-090313-275])

HSP 1 Score: 102.449 bits (254), Expect = 2.081e-24
Identity = 62/175 (35.43%), Postives = 90/175 (51.43%), Query Frame = 3
Query:  771 LIDAHNKYRRDAAQGKIGGQPAAANMLELKWNNEAAQRAQNSANKCVFGHDQPRDRKFGNYDWVGQNIAFWSSN--DVTEGVKMWYDEVNGYNFNSDQCSGFTCLHYTALVWAKTKEFGCGIADCSRQNL------GKIFLFCNYGPGGNWNREKPYEVGKACSKCPS--GTRCN 1265
            L+D HN+ R           P AANM  + W+   A+ A+  A++C++ H       F  +  +GQN++  S     + + VK WYDE + +++ S +CSG  C HYT +VWA + + GC I  CS   +          L CNY   GNW  E PY++G+ CS CPS  G  CN
Sbjct:   69 LLDYHNRVRSQVF-------PPAANMEYMVWDERLAKSAEFWASQCIWEHG---PHHFLQH--IGQNLSIISGRYKSIIDLVKSWYDERHSFSYPS-RCSGSVCTHYTQMVWAASNKIGCAIKKCSDIFVFGSMWKQATLLVCNYAIKGNWVGEAPYKIGRPCSACPSSYGGSCN 230          
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Match: r3hdml (R3H domain containing-like [Source:ZFIN;Acc:ZDB-GENE-090313-275])

HSP 1 Score: 102.449 bits (254), Expect = 2.081e-24
Identity = 62/175 (35.43%), Postives = 90/175 (51.43%), Query Frame = 3
Query:  771 LIDAHNKYRRDAAQGKIGGQPAAANMLELKWNNEAAQRAQNSANKCVFGHDQPRDRKFGNYDWVGQNIAFWSSN--DVTEGVKMWYDEVNGYNFNSDQCSGFTCLHYTALVWAKTKEFGCGIADCSRQNL------GKIFLFCNYGPGGNWNREKPYEVGKACSKCPS--GTRCN 1265
            L+D HN+ R           P AANM  + W+   A+ A+  A++C++ H       F  +  +GQN++  S     + + VK WYDE + +++ S +CSG  C HYT +VWA + + GC I  CS   +          L CNY   GNW  E PY++G+ CS CPS  G  CN
Sbjct:   69 LLDYHNRVRSQVF-------PPAANMEYMVWDERLAKSAEFWASQCIWEHG---PHHFLQH--IGQNLSIISGRYKSIIDLVKSWYDERHSFSYPS-RCSGSVCTHYTQMVWAASNKIGCAIKKCSDIFVFGSMWKQATLLVCNYAIKGNWVGEAPYKIGRPCSACPSSYGGSCN 230          
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Match: pi15b (peptidase inhibitor 15b [Source:ZFIN;Acc:ZDB-GENE-070912-590])

HSP 1 Score: 101.293 bits (251), Expect = 3.992e-24
Identity = 63/193 (32.64%), Postives = 90/193 (46.63%), Query Frame = 3
Query:  747 VTPAQQKQLIDAHNKYRRDAAQGKIGGQPAAANMLELKWNNEAAQRAQNSANKCVFGHDQPRDRKFGNYDWVGQNIAFWSSN--DVTEGVKMWYDEVNGYNFNSDQ---------CSGFTCLHYTALVWAKTKEFGCGIADCSRQNL------GKIFLFCNYGPGGNWNREKPYEVGKACSKCPS--GTRCNN 1268
            ++ +    ++D HNK R +         P AANM  + W++  A+ A+  A  C++ H  P   ++     +GQN++  + N   + + VK WYDEV  Y F   +         C G  C HYT +VWA +   GC I  C    +         +L CNY P GNW  E PY VG  CS CP   G  C+N
Sbjct:   46 ISQSDMIAILDYHNKVRANVF-------PPAANMEYMLWDDGLARSAEAWAATCIWEHGPPYLLRY-----LGQNLSVRTGNYRSILQLVKPWYDEVRDYMFPYPRDCNPHCPMRCYGPMCTHYTQMVWASSNRVGCAIQTCFNMVVWGAVWREATYLVCNYSPKGNWIGEAPYRVGVPCSACPPSYGGSCSN 226          
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Match: dlc1 (DLC1 Rho GTPase activating protein [Source:Xenbase;Acc:XB-GENE-482055])

HSP 1 Score: 157.532 bits (397), Expect = 1.934e-45
Identity = 77/148 (52.03%), Postives = 102/148 (68.92%), Query Frame = -2
Query:   94 LPFYGSLPSQFTMKKEIDGWYKTIKKPCFTPPNYVFGPVWTALYAAMGYASYLLWKEGGGFNEQTKLPIMLYGTQLVLNWAWSVIFFKKHQIGWASVDLTILYANVVACVLTFRPISHQASNLLLPYLAWITLASALNFRIWMLNKHN 537
            LP  G +      ++E+  WY T+ KP + PPN++FGPVWT LY +MGY SYL++KE GG NE   +P+ LY +QL LNWAW+ IFF  H+IGW  VDL +L+    A  +++ PIS  A+ L+LPYLAW+TLASALN+RIW  NK  
Sbjct:   13 LPHVGGIAGGLITRQEVKTWYTTLVKPSWRPPNWMFGPVWTTLYTSMGYGSYLIYKELGGLNENAVVPLGLYASQLALNWAWTPIFFGAHKIGWGLVDLLLLWGAAAATTISWYPISRPAAYLMLPYLAWLTLASALNYRIWRDNKDK 160          
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Match: dlc1 (DLC1 Rho GTPase activating protein [Source:Xenbase;Acc:XB-GENE-482055])

HSP 1 Score: 157.918 bits (398), Expect = 2.411e-45
Identity = 77/146 (52.74%), Postives = 102/146 (69.86%), Query Frame = -2
Query:  100 LPFYGSLPSQFTMKKEIDGWYKTIKKPCFTPPNYVFGPVWTALYAAMGYASYLLWKEGGGFNEQTKLPIMLYGTQLVLNWAWSVIFFKKHQIGWASVDLTILYANVVACVLTFRPISHQASNLLLPYLAWITLASALNFRIWMLNK 537
            LP  G +      ++E+  WY T+ KP + PPN++FGPVWT LY +MGY SYL++KE GG NE   +P+ LY +QL LNWAW+ IFF  H+IGW  VDL +L+    A  +++ PIS  A+ L+LPYLAW+TLASALN+RIW  NK
Sbjct:   62 LPHVGGIAGGLITRQEVKTWYTTLVKPSWRPPNWMFGPVWTTLYTSMGYGSYLIYKELGGLNENAVVPLGLYASQLALNWAWTPIFFGAHKIGWGLVDLLLLWGAAAATTISWYPISRPAAYLMLPYLAWLTLASALNYRIWRDNK 207          
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Match: dlc1 (DLC1 Rho GTPase activating protein [Source:Xenbase;Acc:XB-GENE-482055])

HSP 1 Score: 157.532 bits (397), Expect = 8.051e-45
Identity = 77/148 (52.03%), Postives = 102/148 (68.92%), Query Frame = -2
Query:   94 LPFYGSLPSQFTMKKEIDGWYKTIKKPCFTPPNYVFGPVWTALYAAMGYASYLLWKEGGGFNEQTKLPIMLYGTQLVLNWAWSVIFFKKHQIGWASVDLTILYANVVACVLTFRPISHQASNLLLPYLAWITLASALNFRIWMLNKHN 537
            LP  G +      ++E+  WY T+ KP + PPN++FGPVWT LY +MGY SYL++KE GG NE   +P+ LY +QL LNWAW+ IFF  H+IGW  VDL +L+    A  +++ PIS  A+ L+LPYLAW+TLASALN+RIW  NK  
Sbjct:   62 LPHVGGIAGGLITRQEVKTWYTTLVKPSWRPPNWMFGPVWTTLYTSMGYGSYLIYKELGGLNENAVVPLGLYASQLALNWAWTPIFFGAHKIGWGLVDLLLLWGAAAATTISWYPISRPAAYLMLPYLAWLTLASALNYRIWRDNKDK 209          
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Match: pi15 (peptidase inhibitor 15 [Source:NCBI gene;Acc:100489915])

HSP 1 Score: 103.219 bits (256), Expect = 1.660e-24
Identity = 62/178 (34.83%), Postives = 84/178 (47.19%), Query Frame = 3
Query:  771 LIDAHNKYRRDAAQGKIGGQPAAANMLELKWNNEAAQRAQNSANKCVFGHDQPRDRKFGNYDWVGQNIAFWSS--NDVTEGVKMWYDEVNGYNFNSDQ---------CSGFTCLHYTALVWAKTKEFGCGIADCSRQNL------GKIFLFCNYGPGGNWNREKPYEVGKACSKCPSG 1253
            +++ HN+ R     GK+   P AANM  + W+   A+ A+  A  C++ H      KF     +GQN++  +     + + VK WYDEV  Y F   Q         C G  C HYT +VWA T   GC I  C   N+        ++L CNY P GNW  E PY +G  CS CP  
Sbjct:   70 IVEYHNQVR-----GKVF--PPAANMEYMVWDENLAKLAEAWAATCIWDHGPSYLLKF-----LGQNLSVRTGRYKSILQLVKPWYDEVKDYAFPYPQECNPRCPLRCYGPMCTHYTQMVWATTNRIGCAIHTCHNMNVWGAVWRRAVYLVCNYSPKGNWIGEAPYTIGVPCSACPPS 235          
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Match: ENSXETT00000036788.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV464547.1:593:5826:1 gene:ENSXETG00000015856.1 transcript:ENSXETT00000036788.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 103.99 bits (258), Expect = 6.408e-24
Identity = 60/175 (34.29%), Postives = 93/175 (53.14%), Query Frame = 3
Query:  759 QQKQLIDAHNKYRRDAAQGKIGGQPAAANMLELKWNNEAAQRAQNSANKCVFGHDQPRDRKFGNYDWVGQNIAFWS--SNDVTEGVKMWYDEVNGYNFNSDQC-SGFTCLHYTALVWAKTKEFGCGIADCSR----QNLGKIFLFCNYGPGGNWNREKPYEVGKACSKCPSGTRC 1262
            +++ ++D HN YR          +P+A++M++L W++     A++ A KC++ H+  +DR F     +G+N+   S  S DV  G+  W+ E   YNF +  C  G  C HYT +VWA T+  GCG   C +     +     L CNY P GN+  E PY+ G  C++CPS   C
Sbjct:   34 EKRIILDKHNFYRSQT-------EPSASDMIKLTWDSALEAMAKSYAEKCIWEHN--KDRGF-----IGENLFVMSGSSLDVALGLDDWHKERGYYNFTTGMCQEGQMCGHYTQMVWAGTERVGCGQNFCPKLEGVDDENMYLLVCNYEPPGNFEGESPYKEGSRCTECPSDHVC 194          
BLAST of Venom allergen 5 vs. Ensembl Mouse
Match: Tspo (translocator protein [Source:MGI Symbol;Acc:MGI:88222])

HSP 1 Score: 130.954 bits (328), Expect = 9.772e-36
Identity = 61/148 (41.22%), Postives = 86/148 (58.11%), Query Frame = -2
Query:   94 LPFYGSLPSQFTMKKEIDGWYKTIKKPCFTPPNYVFGPVWTALYAAMGYASYLLWKEGGGFNEQTKLPIMLYGTQLVLNWAWSVIFFKKHQIGWASVDLTILYANVVACVLTFRPISHQASNLLLPYLAWITLASALNFRIWMLNKHN 537
            +P  G     + ++ E   WY +++KP + PP +   P+W  LY+AMGY SY++WKE GGF E   +P+ LY  QL LNWAW  IFF   Q+GWA  DL ++     A  L +  +S  A+ LL PYLAW+  A+ LN+ +W  N   
Sbjct:   14 VPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIVWKELGGFTEDAMVPLGLYTGQLALNWAWPPIFFGARQMGWALADLLLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATVLNYYVWRDNSGR 161          
BLAST of Venom allergen 5 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 110.153 bits (274), Expect = 2.393e-27
Identity = 63/182 (34.62%), Postives = 96/182 (52.75%), Query Frame = 3
Query:  744 GVTPAQQKQLIDAHNKYRRDAAQGKIGGQPAAANMLELKWNNEAAQRAQNSANKCVFGHDQPRDRKFGNYDWVGQNIAFWSSN--DVTEGVKMWYDEVNGYNFNSDQC-SGFTCLHYTALVWAKTKEFGCGIADCSR----QNLGKIFLFCNYGPGGNWNREKPYEVGKACSKCPSGTRCNN 1268
             +T  +++ ++D HN+YR   +       P A++ML+++W++E A  A+  A KCV+GH++ R R+       G+N+   +    DV   V  W++E   YNF++  C     C HYT +VW+KT+  GCG   C      +      L CNY P GN    KPY+ G  CS+CP G  C N
Sbjct:   29 ALTEDEKQTMVDLHNQYRAQVS-------PPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRR-------GENLFAITDEGMDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSCEN 196          
BLAST of Venom allergen 5 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 110.153 bits (274), Expect = 4.737e-27
Identity = 63/182 (34.62%), Postives = 96/182 (52.75%), Query Frame = 3
Query:  744 GVTPAQQKQLIDAHNKYRRDAAQGKIGGQPAAANMLELKWNNEAAQRAQNSANKCVFGHDQPRDRKFGNYDWVGQNIAFWSSN--DVTEGVKMWYDEVNGYNFNSDQC-SGFTCLHYTALVWAKTKEFGCGIADCSR----QNLGKIFLFCNYGPGGNWNREKPYEVGKACSKCPSGTRCNN 1268
             +T  +++ ++D HN+YR   +       P A++ML+++W++E A  A+  A KCV+GH++ R R+       G+N+   +    DV   V  W++E   YNF++  C     C HYT +VW+KT+  GCG   C      +      L CNY P GN    KPY+ G  CS+CP G  C N
Sbjct:   29 ALTEDEKQTMVDLHNQYRAQVS-------PPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRR-------GENLFAITDEGMDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSCEN 196          
BLAST of Venom allergen 5 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 110.153 bits (274), Expect = 4.737e-27
Identity = 63/182 (34.62%), Postives = 96/182 (52.75%), Query Frame = 3
Query:  744 GVTPAQQKQLIDAHNKYRRDAAQGKIGGQPAAANMLELKWNNEAAQRAQNSANKCVFGHDQPRDRKFGNYDWVGQNIAFWSSN--DVTEGVKMWYDEVNGYNFNSDQC-SGFTCLHYTALVWAKTKEFGCGIADCSR----QNLGKIFLFCNYGPGGNWNREKPYEVGKACSKCPSGTRCNN 1268
             +T  +++ ++D HN+YR   +       P A++ML+++W++E A  A+  A KCV+GH++ R R+       G+N+   +    DV   V  W++E   YNF++  C     C HYT +VW+KT+  GCG   C      +      L CNY P GN    KPY+ G  CS+CP G  C N
Sbjct:   29 ALTEDEKQTMVDLHNQYRAQVS-------PPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRR-------GENLFAITDEGMDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSCEN 196          
BLAST of Venom allergen 5 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 110.538 bits (275), Expect = 8.567e-26
Identity = 63/184 (34.24%), Postives = 96/184 (52.17%), Query Frame = 3
Query:  741 CGVTPAQQKQLIDAHNKYRRDAAQGKIGGQPAAANMLELKWNNEAAQRAQNSANKCVFGHDQPRDRKFGNYDWVGQNIAFWSSN--DVTEGVKMWYDEVNGYNFNSDQC-SGFTCLHYTALVWAKTKEFGCGIADCSR----QNLGKIFLFCNYGPGGNWNREKPYEVGKACSKCPSGTRCNNG 1271
              +T  +++ ++D HN+YR   +       P A++ML+++W++E A  A+  A KCV+GH++ R R+       G+N+   +    DV   V  W++E   YNF++  C     C HYT +VW+KT+  GCG   C      +      L CNY P GN    KPY+ G  CS+CP G  C N 
Sbjct:   28 TALTEDEKQTMVDLHNQYRAQVS-------PPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRR-------GENLFAITDEGMDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSCENS 197          
BLAST of Venom allergen 5 vs. UniProt/SwissProt
Match: sp|P16257|TSPO_RAT (Translocator protein OS=Rattus norvegicus OX=10116 GN=Tspo PE=1 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 7.782e-36
Identity = 66/161 (40.99%), Postives = 94/161 (58.39%), Query Frame = -2
Query:   94 MSEYLKMAFAISL-PFYGSLPSQFTMKKEIDGWYKTIKKPCFTPPNYVFGPVWTALYAAMGYASYLLWKEGGGFNEQTKLPIMLYGTQLVLNWAWSVIFFKKHQIGWASVDLTILYANVVACVLTFRPISHQASNLLLPYLAWITLASALNFRIWMLNKHN 573
            MS+    A  ++L P  G     + ++ E   WY +++KP + PP +   P+W  LY+AMGY SY++WKE GGF E+  +P+ LY  QL LNWAW  IFF   Q+GWA VDL ++     A  L +  +S  A+ LL PYLAW+  A+ LN+ +W  N   
Sbjct:    1 MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGR 161          
BLAST of Venom allergen 5 vs. UniProt/SwissProt
Match: sp|P50637|TSPO_MOUSE (Translocator protein OS=Mus musculus OX=10090 GN=Tspo PE=1 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 6.836e-35
Identity = 61/148 (41.22%), Postives = 86/148 (58.11%), Query Frame = -2
Query:   94 LPFYGSLPSQFTMKKEIDGWYKTIKKPCFTPPNYVFGPVWTALYAAMGYASYLLWKEGGGFNEQTKLPIMLYGTQLVLNWAWSVIFFKKHQIGWASVDLTILYANVVACVLTFRPISHQASNLLLPYLAWITLASALNFRIWMLNKHN 537
            +P  G     + ++ E   WY +++KP + PP +   P+W  LY+AMGY SY++WKE GGF E   +P+ LY  QL LNWAW  IFF   Q+GWA  DL ++     A  L +  +S  A+ LL PYLAW+  A+ LN+ +W  N   
Sbjct:   14 VPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIVWKELGGFTEDAMVPLGLYTGQLALNWAWPPIFFGARQMGWALADLLLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATVLNYYVWRDNSGR 161          
BLAST of Venom allergen 5 vs. UniProt/SwissProt
Match: sp|P30536|TSPO_HUMAN (Translocator protein OS=Homo sapiens OX=9606 GN=TSPO PE=1 SV=3)

HSP 1 Score: 130.568 bits (327), Expect = 8.071e-35
Identity = 66/152 (43.42%), Postives = 90/152 (59.21%), Query Frame = -2
Query:  100 MAFAISLPFYGSLPSQFTMKKEIDGWYKTIKKPCFTPPNYVFGPVWTALYAAMGYASYLLWKEGGGFNEQTKLPIMLYGTQLVLNWAWSVIFFKKHQIGWASVDLTILYANVVACVLTFRPISHQASNLLLPYLAWITLASALNFRIWMLNK 555
            M F ++ P  G       +  E   WY  ++KP + PP++V GPVW  LY+AMGY SYL+WKE GGF E+  +P+ LY  QL LNWAW  IFF   Q+GWA VDL ++     A  + +  +S  A+ LL PYLAW+   + LN+ +W  N 
Sbjct:    9 MGFTLA-PSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAMGYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNH 159          
BLAST of Venom allergen 5 vs. UniProt/SwissProt
Match: sp|P0DPU1|VA576_SCODE (Scoloptoxin SSD976 OS=Scolopendra dehaani OX=2609776 PE=1 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 1.210e-34
Identity = 78/200 (39.00%), Postives = 106/200 (53.00%), Query Frame = 3
Query:  684 MRNSILFGLIICVVL-SVIEC-----GVTPAQQKQLIDAHNKYRRDAAQGKIGGQPAAANMLELKWNNEAAQRAQNSANKCVFGHDQPRDRKFGNYDWVGQNIAFWSSND-VTEGVKMWYDEVNGYN---FNSDQCSGFTCLHYTALVWAKTKEFGCGIADCSRQNLGKIFLFCNYGPGGNWNREKPYEVGKACSKCPSG 1253
            + +S LF L++  ++ S + C     G+    +K ++D HNK R+  A G+  GQP+AANM EL WN+E A  AQ SA  CVF H     RK   Y ++G+NI   S  D +   V  WYDEV         S    G    HYT +VWA T+  GCG+   S +N    +LFC YGPGGN+  +  Y+ G   S C +G
Sbjct:    4 LLSSTLFVLLMFQIIGSGMGCDMKVRGLDANMKKMILDLHNKKRQIVANGQQSGQPSAANMKELHWNDEIAANAQRSAETCVFEHTAKSLRKTTKYSYLGENIYKGSYPDPIPRSVNAWYDEVKDVTPAVVKSFSSGGPMIGHYTQMVWANTEALGCGLVTASDRN---SYLFCQYGPGGNYRSQPIYKQGPPASDCKNG 200          
BLAST of Venom allergen 5 vs. UniProt/SwissProt
Match: sp|Q9GMC9|TSPO_SHEEP (Translocator protein OS=Ovis aries OX=9940 GN=TSPO PE=1 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 1.552e-34
Identity = 63/146 (43.15%), Postives = 94/146 (64.38%), Query Frame = -2
Query:   88 GSLPSQFTMKKEIDGWYKTIKKPCFTPPNYVFGPVWTALYAAMGYASYLLWKEGGGFNEQTKLPIMLYGTQLVLNWAWSVIFFKKHQIGWASVDLTILYANVVACVLTFRPISHQASNLLLPYLAWITLASALNFRIWMLNKHNLT 525
            G L +Q+ ++ E   WY +++KP + PP ++  P+W  LY+AMGY SYL+WKE GGF+++  +P+ LY  QL LNWAW  +FF   Q+GWA VDL +      A  + +R +S  A+ LL PYLAW+  A+ LN+R+W  N+   +
Sbjct:   19 GFLGTQY-IRGEGFRWYASLQKPPWHPPRWILAPIWGTLYSAMGYGSYLIWKELGGFSKEAVVPLGLYAGQLALNWAWPPLFFGARQMGWAFVDLLLTGGMAAATAMAWRQVSPPAACLLYPYLAWLAFAAMLNYRMWQDNQGRRS 163          
BLAST of Venom allergen 5 vs. TrEMBL
Match: V4A1Y9 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_210696 PE=4 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 6.420e-53
Identity = 85/165 (51.52%), Postives = 118/165 (71.52%), Query Frame = -2
Query:   79 MSEYLKMAFAISLPFYGSLPSQFTMKKEIDGWYKTIKKPCFTPPNYVFGPVWTALYAAMGYASYLLWKEGGGFNEQTKLPIMLYGTQLVLNWAWSVIFFKKHQIGWASVDLTILYANVVACVLTFRPISHQASNLLLPYLAWITLASALNFRIWMLNKHNLTRED 573
            MSEY++ AFAI LP  G +   F  KK I  WY+ + +P + PPNY+F PVWT LY++MGYASYL+W++GGGF+   KLP+ L+GTQL LNWAW+ IFF   ++G A++++ +L+  V A +++F P++  AS LL+PYL W+TLASAL F IW   K+N  R D
Sbjct:    1 MSEYIRPAFAIILPNLGGIAGGFITKKSIPDWYENLHRPSWRPPNYLFAPVWTFLYSSMGYASYLVWRDGGGFDGDAKLPLALFGTQLALNWAWTPIFFGLRKMGLATIEIGVLWGTVAATIVSFHPVNTTASYLLIPYLGWLTLASALTFNIW---KNNKDRRD 162          
BLAST of Venom allergen 5 vs. TrEMBL
Match: A7S6F6 (Predicted protein OS=Nematostella vectensis OX=45351 GN=v1g167042 PE=4 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 2.668e-50
Identity = 79/161 (49.07%), Postives = 111/161 (68.94%), Query Frame = -2
Query:   82 YLKMAFAISLPFYGSLPSQFTMKKEIDGWYKTIKKPCFTPPNYVFGPVWTALYAAMGYASYLLWKEGGGFNEQTKLPIMLYGTQLVLNWAWSVIFFKKHQIGWASVDLTILYANVVACVLTFRPISHQASNLLLPYLAWITLASALNFRIWMLNKHNLTRE 564
            +L++  A   P  G +      +KE+  WY+ + KP + PPN+ FGPVWT+LY AMGY+SYL+WKEGGG N  TKLP++LYG+Q+VLNWAW+ +FF  H++G A V++  L+  V  C+ TF PIS  A+ L++PYLAW++LAS LN+ IW  N   +  E
Sbjct:    3 WLRIGGACVFPHIGGIAGSVITRKEVKTWYEDLDKPSWRPPNWAFGPVWTSLYTAMGYSSYLVWKEGGGINSTTKLPLILYGSQIVLNWAWTPLFFGAHKMGAAFVEILFLWGTVAGCIYTFYPISKLAAGLMVPYLAWVSLASCLNYSIWKRNTPAIKDE 163          
BLAST of Venom allergen 5 vs. TrEMBL
Match: A0A336M000 (CSON005465 protein OS=Culicoides sonorensis OX=179676 GN=CSON005465 PE=4 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 4.429e-50
Identity = 86/165 (52.12%), Postives = 110/165 (66.67%), Query Frame = -2
Query:   79 SEYLKMAFAISLPFYGSLPSQFTMKKEIDGWYKTIKKPCFTPPNYVFGPVWTALYAAMGYASYLLWKEGGGFN-EQTKLPIMLYGTQLVLNWAWSVIFFKKHQIGWASVDLTILYANVVACVLTFRPISHQASNLLLPYLAWITLASALNFRIWMLNKHNLTRED 570
            S   KM   I+LP  G L       K I GWY+ +K P + PPNYVFGP WTALY+ MGYASYL+W++GGGF+ EQ KLP+MLYGTQL LNWAW+ IFF  H++G A++++  L   VVAC L+F  ++  A  L LPY+AW+  AS LN  IW  N+ N + E 
Sbjct:    3 SNTFKMLGFIALPHLGGLAGGLITSKNIKGWYENLKLPKWRPPNYVFGPAWTALYSGMGYASYLVWRDGGGFSGEQAKLPLMLYGTQLALNWAWTPIFFYAHKMGLAAIEIVALTGTVVACGLSFYKVNPTAGYLFLPYVAWLCFASTLNLNIWWTNRENPSAEQ 167          
BLAST of Venom allergen 5 vs. TrEMBL
Match: A0A1S4EFU9 (translocator protein isoform X1 OS=Diaphorina citri OX=121845 GN=LOC103512545 PE=4 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 4.819e-48
Identity = 79/160 (49.38%), Postives = 112/160 (70.00%), Query Frame = -2
Query:   79 KMAFAISLPFYGSLPSQFTMKKEIDGWYKTIKKPCFTPPNYVFGPVWTALYAAMGYASYLLWKEGGGFNEQTKLPIMLYGTQLVLNWAWSVIFFKKHQIGWASVDLTILYANVVACVLTFRPISHQASNLLLPYLAWITLASALNFRIWMLNKHNLTRED 558
            ++A AI LP  G + S   ++ EI  WY+T+K+P + PPNY+FGPVWTALY  MGYASYL+W++GGGF    K+P+ LYGTQL LNWAWS IFF  H++ WA  ++++L+  V A    F  ++  A  L++PYLAW+TLA+ALN+ IW  N  ++  ++
Sbjct:    5 QVAGAILLPNLGGITSSLLVRNEIKTWYETLKRPSWRPPNYLFGPVWTALYCGMGYASYLVWRDGGGFLGPAKIPLALYGTQLALNWAWSPIFFGLHKLDWALGEISVLWVTVAASGYKFHEVNKTAGYLMVPYLAWLTLATALNYVIWRDNPKSIAEKE 164          
BLAST of Venom allergen 5 vs. TrEMBL
Match: A0A4Y2B6S3 (Translocator protein OS=Araneus ventricosus OX=182803 GN=Tspo PE=4 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 5.459e-48
Identity = 85/169 (50.30%), Postives = 111/169 (65.68%), Query Frame = -2
Query:   79 N*LTMSEYLKMAFAISLPFYGSLPSQFTMKKEIDGWYKTIKKPCFTPPNYVFGPVWTALYAAMGYASYLLWKEGGGFNEQTKLPIMLYGTQLVLNWAWSVIFFKKHQIGWASVDLTILYANVVACVLTFRPISHQASNLLLPYLAWITLASALNFRIWMLNKHNLTRED 585
            N L M +Y  +A AI+LP  G + +    +KE+  WY+T+K+P + PPN VF P+WT LY  MGYASYL+WKEGGGF    +LP+MLYG  L LNW WS IFF  H+ G A V++  L+  +  C  +F PIS  A+ L+LPY AW+TLASAL + IW  NK    +ED
Sbjct:  117 NVLKMEKYGPIAGAIALPHVGGIAAALITRKEVKTWYETLKRPAWRPPNCVFAPMWTTLYTGMGYASYLVWKEGGGFQGPARLPLMLYGGNLALNWVWSPIFFGAHKKGLALVEIAALWGTIGVCTYSFYPISKTAAYLMLPYWAWVTLASALTYCIWRDNKD---KED 282          
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Match: tspo (translocator protein [Source:ZFIN;Acc:ZDB-GENE-041010-125])

HSP 1 Score: 149.443 bits (376), Expect = 7.850e-43
Identity = 72/154 (46.75%), Postives = 102/154 (66.23%), Query Frame = -2
Query:   79 SLPFYGSLPSQFTMKKEIDGWYKTIKKPCFTPPNYVFGPVWTALYAAMGYASYLLWKEGGGFNEQTKLPIMLYGTQLVLNWAWSVIFFKKHQIGWASVDLTILYANVVACVLTFRPISHQASNLLLPYLAWITLASALNFRIWMLNKHNLTRED 540
            +LP  G L   F  +KE+  WY T+ KP + PPN  F  VWT LY  MGY SYL+WKE GGFNE + +P+ LYG QL LNWAW+ IFF  H+I  A ++L +L   V A ++++ P++  A+ L++PY+AW+ LA++LN+ IW  N    T++D
Sbjct:   19 ALPHVGGLYGGFITRKEVKTWYTTLNKPSWRPPNAAFPVVWTTLYTGMGYGSYLVWKELGGFNENSLVPLGLYGLQLALNWAWTPIFFGAHKIKLALIELVMLSGTVAATMVSWYPVNRTATLLMVPYMAWLCLATSLNYCIWRDNPE--TKKD 170          
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Match: r3hdml (R3H domain containing like [Source:NCBI gene;Acc:103046222])

HSP 1 Score: 105.145 bits (261), Expect = 1.633e-25
Identity = 63/183 (34.43%), Postives = 91/183 (49.73%), Query Frame = 3
Query:  747 VTPAQQKQLIDAHNKYRRDAAQGKIGGQPAAANMLELKWNNEAAQRAQNSANKCVFGHDQPRDRKFGNYDWVGQNIAFWSSN--DVTEGVKMWYDEVNGYNFNSDQCSGFTCLHYTALVWAKTKEFGCGIADCSRQNL------GKIFLFCNYGPGGNWNREKPYEVGKACSKCPS--GTRCN 1265
            V+      L++ HN+ R           P AANM  + W+   A+ A++ A++C++ H      K+     +GQN++  S     V E V+ W+DE N +++  ++C+G  C HYT +VWA T   GC I  CS   +          L CNY   GNW  E PY+ GK CS CPS  G  CN
Sbjct:   62 VSSRDMTALLEYHNRVRSQVF-------PPAANMEYMVWDERLAKSAESWASQCIWDHGPSHVMKY-----MGQNLSISSGRYRSVIELVRSWHDEKNSFSY-PNRCTGSVCSHYTQMVWASTNRIGCAINRCSNMYVFGSTWKQATLLVCNYSIKGNWVGEAPYKTGKPCSACPSVYGGSCN 231          
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-130131-1])

HSP 1 Score: 108.227 bits (269), Expect = 3.607e-25
Identity = 64/181 (35.36%), Postives = 90/181 (49.72%), Query Frame = 3
Query:  756 AQQKQLIDAHNKYRRDAAQGKIGGQPAAANMLELKWNNEAAQRAQNSANKCVFGHDQPRDRKFGNYDWVGQNIAF-WSS-NDVTEGVKMWYDEVNGYNFN---------SDQCSGFTCLHYTALVWAKTKEFGCGIADCSRQNL------GKIFLFCNYGPGGNWNREKPYEVGKACSKCP 1247
            + +++++  HNK R        G  P A+NM  + W++E  + A + A +C + H  P+D        +GQN+A  W         V+ WYDEV  Y +           ++CSG  C HYT LVWA T   GC +  CSR N+        I+L CNY P GNW  E PY  G+ CS+CP
Sbjct:   59 SDREEILALHNKLRE-------GVYPTASNMEYMVWDDELERSATHWAEQCQWEHG-PQDLLMS----IGQNLAVHWGRYRSPAYHVQAWYDEVKDYTYPYPHECNPWCPERCSGPMCTHYTQLVWATTSRVGCAVHTCSRMNVWGEIWENAIYLVCNYSPKGNWIGEAPYAHGRPCSQCP 227          
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Match: ENSAMXT00000036030.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 103.605 bits (257), Expect = 4.590e-25
Identity = 59/172 (34.30%), Postives = 97/172 (56.40%), Query Frame = 3
Query:  762 QKQLIDAHNKYRRDAAQGKIGGQPAAANMLELKWNNEAAQRAQNSANKCVFGHDQPRDRKFGNYDWVGQNIAFWSSN-DVTEGVKMWYDEVNGYNFNSDQCS-GFTCLHYTALVWAKTKEFGCGIADC-SRQNLG---KIFLFCNYGPGGNWNREKPYEVGKACSKCPSGTR 1259
            Q+++++ HN +R          +P AA+M+ +KW+ E A  A+  A KC++ H+ P  +       +G+N+   +   D+ + +  W+ E   Y+++++ C+    C HYT +VWAKTKE GCG   C + + LG      L CNY P GN+  +KPY+VG+ CSKCP   +
Sbjct:   30 QQRIVNLHNHHRSTV-------EPPAADMIHMKWSGELALIAKEYATKCIWEHN-PDSQNI-----MGENLFITTGPLDIEKALSDWFMEHKHYSYDNNTCAENEMCGHYTQMVWAKTKEVGCGSHLCETVEALGFKNATLLVCNYLPLGNYMGQKPYQVGEQCSKCPDDLK 188          
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Match: ENSAMXT00000031557.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 103.99 bits (258), Expect = 5.365e-25
Identity = 59/172 (34.30%), Postives = 97/172 (56.40%), Query Frame = 3
Query:  762 QKQLIDAHNKYRRDAAQGKIGGQPAAANMLELKWNNEAAQRAQNSANKCVFGHDQPRDRKFGNYDWVGQNIAFWSSN-DVTEGVKMWYDEVNGYNFNSDQCS-GFTCLHYTALVWAKTKEFGCGIADC-SRQNLG---KIFLFCNYGPGGNWNREKPYEVGKACSKCPSGTR 1259
            Q+++++ HN +R          +P AA+M+ +KW+ E A  A+  A KC++ H+ P  +       +G+N+   +   D+ + +  W+ E   Y+++++ C+    C HYT +VWAKTKE GCG   C + + LG      L CNY P GN+  +KPY+VG+ CSKCP   +
Sbjct:   30 QQRIVNLHNHHRSTV-------EPPAADMIHMKWSGELALIAKEYATKCIWEHN-PDSQNI-----MGENLFITTGPLDIEKALSDWFMEHKHYSYDNNTCAENEMCGHYTQMVWAKTKEVGCGSHLCETVEALGFKNATLLVCNYLPLGNYMGQKPYQVGEQCSKCPDDLK 188          
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000374.1 (pep scaffold:Pmarinus_7.0:GL476650:75849:87118:-1 gene:ENSPMAG00000000334.1 transcript:ENSPMAT00000000374.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.7525 bits (247), Expect = 2.666e-23
Identity = 61/190 (32.11%), Postives = 91/190 (47.89%), Query Frame = 3
Query:  759 QQKQLIDAHNKYRRDAAQGKIGGQPAAANMLELKWNNEAAQRAQNSANKCVFGHDQPRDRKFGNYDWVGQNIAFW--SSNDVTEGVKMWYDEVNGYNFNSDQ---------CSGFTCLHYTALVWAKTKEFGCGIADCSRQNL------GKIFLFCNYGPGGNWNREKPYEVGKACSKCPS--GTRCNNG 1271
            +++ L + HN+ R           P AA+M  + W+ E A  A+  A +C +GH  P D+     D +GQN+A +  S   +   V+ W+DE   Y +  ++         C G  C HYT LVWA+++  GC +  C   ++        ++L CNY P GNW  E PY  G  CS+CP   G  C  G
Sbjct:    5 ERRALTEYHNRLRASV-------HPQAADMEHMSWDWELAGMAEAWAKQCKWGHG-PSDQ----LDAIGQNLAVYVGSERPLAYHVQAWFDEEEWYQYPEEKECSPECPHTCRGPICTHYTQLVWAESRRVGCAVHTCLDISVWDAVWPYALYLVCNYSPKGNWIGEAPYRQGTPCSRCPPRYGGSCRGG 182          
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Match: CRISP3 (cysteine rich secretory protein 3 [Source:HGNC Symbol;Acc:HGNC:16904])

HSP 1 Score: 92.0485 bits (227), Expect = 1.956e-21
Identity = 60/169 (35.50%), Postives = 83/169 (49.11%), Query Frame = 3
Query:  762 QKQLIDAHNKYRRDAAQGKIGGQPAAANMLELKWNNEAAQRAQNSANKCVFGHDQPRDRKFGNYDWVGQNIAFWSSNDVT--EGVKMWYDEVNGYNFNSDQCSGFT--CLHYTALVWAKTKEFGCGIADCSRQ-NLGKIFLFCNYGPGGNWNRE--KPYEVGKACSKCP 1247
            Q  ++D HN  RR+         P+A NML++ W  EA   A + AN C FGH     RK   +   G+NI F SS   T    ++ WY+EV    F  D  S  T    HYT LVW  + + GC +  C +   + K    C+Y P GN N    +PY++G +C+ CP
Sbjct:   44 QTFIVDLHNDLRRNVT-------PSAGNMLQMMWKKEAYLNALSWANNCTFGHSPDARRKTTQWT-CGENI-FMSSAPFTWNYAIRDWYNEVISPGFQYDVGSTTTGAVGHYTQLVWYNSFQLGCAVNYCPKNPGVAKYLYVCHYCPMGNLNTRINRPYDLGTSCASCP 203          
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002250.1 (pep scaffold:Pmarinus_7.0:GL477299:1626:22672:-1 gene:ENSPMAG00000002049.1 transcript:ENSPMAT00000002250.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.1149 bits (209), Expect = 9.604e-20
Identity = 55/182 (30.22%), Postives = 76/182 (41.76%), Query Frame = 3
Query:  777 DAHNKYRRDAAQGKIGGQPAAANMLELKWNNEAAQRAQNSANKCV-FGHDQPRDRKFGNYDWVGQNIAFWSSNDVTEGVKMWYDEVNGYNFNSDQ---------CSGFTCLHYTALVWAKTKEFGCGIADCSRQNL------GKIFLFCNYGPGGNWNREKPYEVGKACSKCPS--GTRCNN 1268
            + HNK R +         P ++NM  + W  +  + A     +C+            G   W+       S    +  V+ WYDE   Y +  +Q         C+G  C HYT LVWA T   GC I  C   N+        ++L CNY P GNW    PY+ G+ACS+CP   G  C N
Sbjct:    1 ELHNKLRGEV-------HPPSSNMEYMAWVKKLIKEAARYPGRCLRLMQPMAMIHFLGQPHWL-------SHRPPSFHVQAWYDEAKDYQYPYEQECNPWCPFRCNGAVCTHYTQLVWATTNRVGCAINTCYNMNVWGQIWEKAVYLVCNYSPKGNWIGLSPYKSGRACSECPPSYGGSCRN 168          
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Match: CRISP2 (cysteine rich secretory protein 2 [Source:HGNC Symbol;Acc:HGNC:12024])

HSP 1 Score: 57.3806 bits (137), Expect = 5.782e-10
Identity = 43/141 (30.50%), Postives = 68/141 (48.23%), Query Frame = 3
Query:  852 ELKWNNEAAQRAQNSANKCVFGHDQPRDRKFGNYDWV--GQNIAFWSSNDV---TEGVKMWYDEVN--GYNFNSDQCSGFTCLHYTALVWAKTKEFGCGIADCSRQNLGKIFLFCNYGPGGNWNRE--KPYEVGKACSKCP 1247
            +++  N  A R  N+ + C+      R ++   Y  +   +NI F  SN +    E +K+W DE N  G+++     +     HYT ++W  T + GC I  C  +    ++L C Y P GNWN    KPY+ G +C  CP
Sbjct:    9 KIERRNWLACRGCNAGSLCIAVIMGMRAKQRCVYTGILCSENIVF--SNTLYSWDEAIKVWVDEANSPGFDYGKGPRNPGIVGHYTQIIWYSTYQVGCTINYCPEEAYKYMYL-CAYCPVGNWNNRLTKPYDEGPSCQDCP 146          
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000359.1 (pep scaffold:Pmarinus_7.0:GL487788:450:5784:1 gene:ENSPMAG00000000319.1 transcript:ENSPMAT00000000359.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.2914 bits (116), Expect = 6.908e-8
Identity = 31/84 (36.90%), Postives = 42/84 (50.00%), Query Frame = 3
Query: 1008 VKMWYDEVNGYNFNSDQC-SGFTCLHYTA-LVWAKTKEFGCGIADCSRQNLGKIFLFCNYGPGGNWNRE--KPYEVGKACSKCP 1247
            +  WY+EV    F  D+   G    HYT  LVW  + + GC +  C+     K F  C+Y P GN N    +PY+ G AC+ CP
Sbjct:   20 IGEWYNEVTAPGFVYDKAGQGAGVEHYTQQLVWYSSFQIGCSVNFCATAK--KYFYVCHYCPAGNLNTRVFRPYDKGSACTSCP 101          
BLAST of Venom allergen 5 vs. Ensembl Yeast
Match: PRY3 (Cell wall-associated protein involved in export of acetylated sterols; member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); role in mating efficiency; expression of full-length transcript is daughter cell-specific; in response to alpha factor, a short transcript starting at +452 is expressed and the long form is repressed by Ste12p [Source:SGD;Acc:S000003614])

HSP 1 Score: 54.299 bits (129), Expect = 2.512e-8
Identity = 54/185 (29.19%), Postives = 83/185 (44.86%), Query Frame = 3
Query:  693 SILFGLIICVVLSVIECGVT-PAQQKQLIDAHNKYRRDAAQGKIGGQPAAANMLELKWNNEAAQRAQNSANK--C--VFGHDQPRDRKFGNYDWVGQNIAFWSSNDVTEGVKMWYDEVNGYNFNSDQCSGFTCLHYTALVWAKTKEFGCGIADCSRQNLGKI---FLFCNYGPGGNWNREKPYEV 1223
            S+L G ++ V     +   T P  +  +++ HNK+R       +   P       L W++  A  AQN A++  C  V  H        G Y   G+N+A   ++  T  V  WY E++ YN+++   S  T  H+T +VW  T E GCG   C     G     ++ C+Y P GN+  E   EV
Sbjct:    7 SVLLGCLVAV-----KAQTTFPNFESDVLNEHNKFRA----LHVDTAP-------LTWSDTLATYAQNYADQYDCSGVLTHSD------GPY---GENLALGYTD--TGAVDAWYGEISKYNYSNPGFSESTG-HFTQVVWKSTAEIGCGYKYC-----GTTWNNYIVCSYNPPGNYLGEFAEEV 158          
BLAST of Venom allergen 5 vs. Ensembl Yeast
Match: PRY1 (Sterol binding protein involved in the export of acetylated sterols; secreted glycoprotein and member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); sterol export function is redundant with that of PRY2; may be involved in detoxification of hydrophobic compounds; PRY1 has a paralog, PRY2, that arose from the whole genome duplication [Source:SGD;Acc:S000003615])

HSP 1 Score: 50.0618 bits (118), Expect = 2.992e-7
Identity = 36/118 (30.51%), Postives = 56/118 (47.46%), Query Frame = 3
Query:  855 LKWNNEAAQRAQNSANKCVFGHDQPRDRKFGNYDWVGQNIAFWSSNDVTEGVKMWYDEVNGYNFNSDQCSGFTCLHYTALVWAKTKEFGCGIADCSRQNLGKIFLFCNYGPGGNWNRE 1208
            L W++  A  AQ+ A+   +          G Y   G+N+A     D    V  WY+E++ Y+F++   S  T  H+T +VW  T + GCGI  C        ++ C+Y P GN+  E
Sbjct:  183 LSWSDTLASYAQDYADN--YDCSGTLTHSGGPY---GENLAL--GYDGPAAVDAWYNEISNYDFSNPGFSSNTG-HFTQVVWKSTTQVGCGIKTCG--GAWGDYVICSYDPAGNYEGE 290          
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Match: EDO40711 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6F6])

HSP 1 Score: 177.563 bits (449), Expect = 3.690e-54
Identity = 79/161 (49.07%), Postives = 111/161 (68.94%), Query Frame = -2
Query:   82 YLKMAFAISLPFYGSLPSQFTMKKEIDGWYKTIKKPCFTPPNYVFGPVWTALYAAMGYASYLLWKEGGGFNEQTKLPIMLYGTQLVLNWAWSVIFFKKHQIGWASVDLTILYANVVACVLTFRPISHQASNLLLPYLAWITLASALNFRIWMLNKHNLTRE 564
            +L++  A   P  G +      +KE+  WY+ + KP + PPN+ FGPVWT+LY AMGY+SYL+WKEGGG N  TKLP++LYG+Q+VLNWAW+ +FF  H++G A V++  L+  V  C+ TF PIS  A+ L++PYLAW++LAS LN+ IW  N   +  E
Sbjct:    3 WLRIGGACVFPHIGGIAGSVITRKEVKTWYEDLDKPSWRPPNWAFGPVWTSLYTAMGYSSYLVWKEGGGINSTTKLPLILYGSQIVLNWAWTPLFFGAHKMGAAFVEILFLWGTVAGCIYTFYPISKLAAGLMVPYLAWVSLASCLNYSIWKRNTPAIKDE 163          
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Match: EDO27659 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8M6])

HSP 1 Score: 98.5969 bits (244), Expect = 1.635e-24
Identity = 60/157 (38.22%), Postives = 86/157 (54.78%), Query Frame = -2
Query:  103 MSEYLKMAFAISLPFYGSLPSQFTMKKEIDGWYKTIKKPCFTPPNYVFGPVWTALYAAMGYASYLLWKEGGGFNEQTKLPIMLYGTQLVLNWAWSVIFFKKHQIGWASVDLTILYANVVACVLTFRPISHQASNLLLPYLAWITLASALNFRIWMLN 573
            MS+ LK+ + +++       S    +  I+ WY TIKKP F PPN+VF PVWT L+  MG A  L+W +     E  K  + L+  QL+LN  WS IFF    I  AS+++ +L   +    + F+ I   AS LL+PYL W++ A+ L   I  LN
Sbjct:    4 MSKSLKILYVVAICLAVGYLSSLVTQSSIETWYPTIKKPIFNPPNWVFAPVWTLLFIMMGIAGGLVWDKLEQNRELVKKGLFLFTIQLLLNAFWSYIFFSLKNILLASIEIILLLLIIYETYVVFKKIDSMASKLLIPYLFWVSFATILTVTICFLN 160          
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Match: EDO41919 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S310])

HSP 1 Score: 60.8474 bits (146), Expect = 3.044e-11
Identity = 46/138 (33.33%), Postives = 61/138 (44.20%), Query Frame = 3
Query:  855 LKWNNEAAQRAQN----SANKCVFGHDQPRDRKFGNYDWVGQNIAFWS---SNDVT--EGVKMWYDEVNGYNFNSD-----QCSGFTCLHYTALVWAKTKEFGCGIADCSRQNLGKIFLFCNYGPGGNWNREKPYEVG 1226
            L W+N  A+ A       AN   F H    D         G+N+ + S   ++ VT  E VK WYDEV  Y FN+      Q SG    H+T +VW  T+  G  IA   R      ++   Y P GN+N E   +VG
Sbjct:   20 LTWDNSLARDAGKWSLLLANSNTFKHAPNSDE--------GENLYYISKVSASPVTCVEAVKAWYDEVVDYPFNNPPESVFQVSGAPIGHFTQIVWKDTRRLGVAIARIKRGLWYSTYIVARYSPPGNYNGEFTQQVG 149          
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Match: EDO31682 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX85])

HSP 1 Score: 60.4622 bits (145), Expect = 3.364e-11
Identity = 48/149 (32.21%), Postives = 61/149 (40.94%), Query Frame = 3
Query:  762 QKQLIDAHNKYRRDAAQGKIGGQPAAANMLELKWNNEAAQRAQNSANKCVFGHDQPRDRKFGNYDWVGQNIAFWSSNDVTE----GVKMWYDEVNGYNFNSDQCSGFTCLHYTALVWAKTKEFGCGIADCSRQNLGKIFLFCNYGPGGN 1196
            QKQ +DAHN++R     GK            L W+ E A  AQ  AN         RD         G+NI +    +  E     V+ WY EV  Y+F +      T  H++ LVW  TK+ G G A       G  FL   Y P GN
Sbjct:    4 QKQCLDAHNEFRTRHGAGK------------LAWSGELASEAQKWANHLASIDQMERDPLTNG----GENIFYMYGGNPREACERAVRNWYQEVKNYDFKNPHSDPSTS-HFSQLVWKGTKKLGVGEAQSKS---GNFFLVARYHPKGN 132          
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Match: EDO35287 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLZ5])

HSP 1 Score: 63.929 bits (154), Expect = 6.535e-11
Identity = 36/117 (30.77%), Postives = 57/117 (48.72%), Query Frame = 3
Query:  855 LKWNNEAAQRAQNSANKCVFGHDQPRDRKFGNYDWVGQNIAFWSSN-DVT--EGVKMWYDEVNGYNFNSDQCSGFTCLHYTALVWAKTKEFGCGIADCSRQNLGKIFLFCNYGPGGN 1196
            LKW+++ A++AQ  A       +   D  +   +  G+NIA +  + D+      + WY+EV GY F S    G    H++ LVW  TK  G G+A  +R    + ++   Y P GN
Sbjct:  721 LKWSDKLAKKAQKLAQSMAADSNHTDDEAYSQNELPGENIAVFKHDYDIAAERATRKWYEEVEGYRFGS-PVLGEATKHFSQLVWKGTKSVGIGVARGARD---RTYVVALYDPPGN 833          
BLAST of Venom allergen 5 vs. Ensembl Medaka
Match: tspo (translocator protein [Source:NCBI gene;Acc:101165869])

HSP 1 Score: 146.747 bits (369), Expect = 5.405e-42
Identity = 73/157 (46.50%), Postives = 100/157 (63.69%), Query Frame = -2
Query:   94 YLKMAFAISLPFYGSLPSQFTMKKEIDGWYKTIKKPCFTPPNYVFGPVWTALYAAMGYASYLLWKEGGGFNEQTKLPIMLYGTQLVLNWAWSVIFFKKHQIGWASVDLTILYANVVACVLTFRPISHQASNLLLPYLAWITLASALNFRIWMLNKHN 564
            +L M    +LP  G L   F  +K++  WY T+KKP + PPN  F  VWT LY +MGY SYL+WKE GGF +   +P+ LYGTQL LNWAW+ IFF  H++  A +++ +L   V A + ++ PIS  A+ LL PYLAW+ LA++LN+ IW  N   
Sbjct:    2 WLPMIGMTALPHLGGLYGGFITRKQVKTWYPTLKKPSWRPPNAAFPVVWTCLYTSMGYGSYLIWKELGGFTQDALVPLGLYGTQLALNWAWTPIFFGAHKLKLALMEIVLLTGTVGATMASWYPISSTATLLLAPYLAWLCLATSLNYCIWRDNAEE 158          
BLAST of Venom allergen 5 vs. Ensembl Medaka
Match: tspo (translocator protein [Source:NCBI gene;Acc:101165869])

HSP 1 Score: 134.035 bits (336), Expect = 2.841e-37
Identity = 67/144 (46.53%), Postives = 91/144 (63.19%), Query Frame = -2
Query:  133 YLKMAFAISLPFYGSLPSQFTMKKEIDGWYKTIKKPCFTPPNYVFGPVWTALYAAMGYASYLLWKEGGGFNEQTKLPIMLYGTQLVLNWAWSVIFFKKHQIGWASVDLTILYANVVACVLTFRPISHQASNLLLPYLAWITLAS 564
            +L M    +LP  G L   F  +K++  WY T+KKP + PPN  F  VWT LY +MGY SYL+WKE GGF +   +P+ LYGTQL LNWAW+ IFF  H++  A +++ +L   V A + ++ PIS  A+ LL PYLAW+ L  
Sbjct:    2 WLPMIGMTALPHLGGLYGGFITRKQVKTWYPTLKKPSWRPPNAAFPVVWTCLYTSMGYGSYLIWKELGGFTQDALVPLGLYGTQLALNWAWTPIFFGAHKLKLALMEIVLLTGTVGATMASWYPISSTATLLLAPYLAWLCLED 145          
BLAST of Venom allergen 5 vs. Ensembl Medaka
Match: tspo (translocator protein [Source:NCBI gene;Acc:101165869])

HSP 1 Score: 113.235 bits (282), Expect = 9.513e-30
Identity = 56/114 (49.12%), Postives = 76/114 (66.67%), Query Frame = -2
Query:   94 VFGPVWTALYAAMGYASYLLWKEGGGFNEQTKLPIMLYGTQLVLNWAWSVIFFKKHQIGWASVDLTILYANVVACVLTFRPISHQASNLLLPYLAWITLASALNFRIWMLNKHN 435
             F  VWT LY +MGY SYL+WKE GGF +   +P+ LYGTQL LNWAW+ IFF  H++  A +++ +L   V A + ++ PIS  A+ LL PYLAW+ LA++LN+ IW  N   
Sbjct:   20 AFPVVWTCLYTSMGYGSYLIWKELGGFTQDALVPLGLYGTQLALNWAWTPIFFGAHKLKLALMEIVLLTGTVGATMASWYPISSTATLLLAPYLAWLCLATSLNYCIWRDNAEE 133          
BLAST of Venom allergen 5 vs. Ensembl Medaka
Match: pi15a (peptidase inhibitor 15 [Source:NCBI gene;Acc:101173911])

HSP 1 Score: 103.219 bits (256), Expect = 1.000e-24
Identity = 65/185 (35.14%), Postives = 94/185 (50.81%), Query Frame = 3
Query:  771 LIDAHNKYRRDAAQGKIGGQPAAANMLELKWNNEAAQRAQNSANKCVFGHDQPRDRKFGNYDWVGQNIAFWSSN--DVTEGVKMWYDEVNGYNFNSDQ---------CSGFTCLHYTALVWAKTKEFGCGIADCSRQNL-GKI-----FLFCNYGPGGNWNREKPYEVGKACSKCPS--GTRCNN 1268
            ++D HNK R     GK+   P A+NM  + W+   A+ A++ A+ C++ H      +F     +GQN++  +     + + VK WYDEV  Y+F   +         C G  C HYT +VWA + + GC I  C   N+ G +     +L CNY P GNW  E PY+VG  CS CP   G  C+N
Sbjct:   69 ILDYHNKVR-----GKVF--PPASNMEYMVWDETLAKTAEDWAHACLWEHGPSHLLRF-----LGQNLSVRTGRYRSILQLVKPWYDEVKDYSFPYPRDCNPRCPLRCYGPMCTHYTQMVWATSNKVGCAIHTCYNMNVWGSVWKRATYLVCNYSPKGNWIGEAPYKVGVPCSACPPSYGGSCSN 241          
BLAST of Venom allergen 5 vs. Ensembl Medaka
Match: ENSORLT00000020674.2 (cysteine-rich venom protein pseudecin-like [Source:NCBI gene;Acc:101157728])

HSP 1 Score: 102.449 bits (254), Expect = 1.240e-24
Identity = 60/180 (33.33%), Postives = 95/180 (52.78%), Query Frame = 3
Query:  717 CVVLSVIECGVTPAQQKQLIDAHNKYRRDAAQGKIGGQPAAANMLELKWNNEAAQRAQNSANKCVFGHDQPRDRKFGNYDWVGQNIAFWSSNDVT--EGVKMWYDEVNGYNFNSDQCSGFTCLHYTALVWAKTKEFGCGIADCSRQNLGKIFLF-CNYGPGGNWNREKPYEVGKACSKCP 1247
            CV+  +  C    A Q +++D HN +RR         +P AA+ML + ++ E A  AQ   +KCV  H  P  R    Y+ +G+N+ F+S++ +     +  WY EV+ + F +   +G    HYT +VW  + + GCG+  CS      I+L+ C+Y   GN+ R  PY+VG  C+ CP
Sbjct:   18 CVLADI--CPEDTAVQAEIVDVHNAFRRAV-------EPPAADMLMMSYSEELAVSAQAWVDKCVLDHGPPSSRMLNGYE-LGENL-FYSTSPMLWKSIINAWYKEVSHFAFPNASTNGKPVGHYTQVVWNSSYKVGCGVTLCSNN----IYLYGCHYYRAGNFKRWPPYKVGTPCASCP 182          
BLAST of Venom allergen 5 vs. Planmine SMEST
Match: SMESG000062609.1 (SMESG000062609.1)

HSP 1 Score: 408.297 bits (1048), Expect = 1.604e-143
Identity = 195/196 (99.49%), Postives = 196/196 (100.00%), Query Frame = 3
Query:  684 MRNSILFGLIICVVLSVIECGVTPAQQKQLIDAHNKYRRDAAQGKIGGQPAAANMLELKWNNEAAQRAQNSANKCVFGHDQPRDRKFGNYDWVGQNIAFWSSNDVTEGVKMWYDEVNGYNFNSDQCSGFTCLHYTALVWAKTKEFGCGIADCSRQNLGKIFLFCNYGPGGNWNREKPYEVGKACSKCPSGTRCNNG 1271
            MRNSILFGLIICVVLSVIECGVTPAQQKQLIDAHNKYRRDAAQGKIGGQPAAANMLELKWNNEAAQRAQNSANKCVFGHDQPRDRKFGNYDWVGQNIAFWSS+DVTEGVKMWYDEVNGYNFNSDQCSGFTCLHYTALVWAKTKEFGCGIADCSRQNLGKIFLFCNYGPGGNWNREKPYEVGKACSKCPSGTRCNNG
Sbjct:    1 MRNSILFGLIICVVLSVIECGVTPAQQKQLIDAHNKYRRDAAQGKIGGQPAAANMLELKWNNEAAQRAQNSANKCVFGHDQPRDRKFGNYDWVGQNIAFWSSDDVTEGVKMWYDEVNGYNFNSDQCSGFTCLHYTALVWAKTKEFGCGIADCSRQNLGKIFLFCNYGPGGNWNREKPYEVGKACSKCPSGTRCNNG 196          
BLAST of Venom allergen 5 vs. Planmine SMEST
Match: SMESG000062601.1 (SMESG000062601.1)

HSP 1 Score: 292.738 bits (748), Expect = 4.076e-98
Identity = 132/197 (67.01%), Postives = 159/197 (80.71%), Query Frame = 3
Query:  681 KMRNSILFGLIICVVLSVIECGVTPAQQKQLIDAHNKYRRDAAQGKIGGQPAAANMLELKWNNEAAQRAQNSANKCVFGHDQPRDRKFGNYDWVGQNIAFWSSNDVTEGVKMWYDEVNGYNFNSDQCSGFTCLHYTALVWAKTKEFGCGIADCSRQNLGKIFLFCNYGPGGNWNREKPYEVGKACSKCPSGTRCNNG 1271
            KM   ++F   + + +++  C VTP Q+K LIDAHNKYRR+ AQGK+  QP AANMLELKW++EA  +AQ   NKCVF HD   +RKFG+Y WVGQNIA+W S+DVTEG+KMWYDEV GYNF S++CS  TCLHYT +VWAKTKEFGCG+ADCS++ LGKIFL CNY PGGNWN EK YEVGKACSKCP+GT+CN+G
Sbjct:    2 KMNFKLVF---VAIYITICHCNVTPDQKKALIDAHNKYRREVAQGKVSKQPEAANMLELKWSSEAEAKAQKFVNKCVFKHDSSGERKFGSYQWVGQNIAYWHSDDVTEGIKMWYDEVKGYNFQSEKCSVSTCLHYTQVVWAKTKEFGCGVADCSKKKLGKIFLACNYAPGGNWNNEKAYEVGKACSKCPTGTKCNDG 195          
BLAST of Venom allergen 5 vs. Planmine SMEST
Match: SMESG000062601.1 (SMESG000062601.1)

HSP 1 Score: 291.197 bits (744), Expect = 1.479e-97
Identity = 129/188 (68.62%), Postives = 155/188 (82.45%), Query Frame = 3
Query:  708 LIICVVLSVIECGVTPAQQKQLIDAHNKYRRDAAQGKIGGQPAAANMLELKWNNEAAQRAQNSANKCVFGHDQPRDRKFGNYDWVGQNIAFWSSNDVTEGVKMWYDEVNGYNFNSDQCSGFTCLHYTALVWAKTKEFGCGIADCSRQNLGKIFLFCNYGPGGNWNREKPYEVGKACSKCPSGTRCNNG 1271
            + + + +++  C VTP Q+K LIDAHNKYRR+ AQGK+  QP AANMLELKW++EA  +AQ   NKCVF HD   +RKFG+Y WVGQNIA+W S+DVTEG+KMWYDEV GYNF S++CS  TCLHYT +VWAKTKEFGCG+ADCS++ LGKIFL CNY PGGNWN EK YEVGKACSKCP+GT+CN+G
Sbjct:    6 VFVAIYITICHCNVTPDQKKALIDAHNKYRREVAQGKVSKQPEAANMLELKWSSEAEAKAQKFVNKCVFKHDSSGERKFGSYQWVGQNIAYWHSDDVTEGIKMWYDEVKGYNFQSEKCSVSTCLHYTQVVWAKTKEFGCGVADCSKKKLGKIFLACNYAPGGNWNNEKAYEVGKACSKCPTGTKCNDG 193          
BLAST of Venom allergen 5 vs. Planmine SMEST
Match: SMESG000047165.1 (SMESG000047165.1)

HSP 1 Score: 275.789 bits (704), Expect = 1.913e-91
Identity = 131/201 (65.17%), Postives = 158/201 (78.61%), Query Frame = 3
Query:  696 ILFGLIICVVLSVIECGVTPAQQKQL-----IDAHNKYRR----DAAQGKIGGQPAAANMLELKWNNEAAQRAQNSANKCVFGHDQPRDRKFGNYDWVGQNIAFWSSNDVTEGVKMWYDEVNGYNFNSDQCSGFTCLHYTALVWAKTKEFGCGIADCSRQNLGKIFLFCNYGPGGNWNREKPYEVGKACSKCPSGTRCNNG 1271
            I F L    ++ + E     AQ+ Q+     +  H++ R     D AQG+I GQPAAANMLELKWN+EAAQRAQ SA++CVF HDQ RDR+FG Y WVGQNIA+WSSNDVT+G+KMW+DEV  Y FN D+CSGFTCLHYTAL+WAKTKEFGCGIADCSR+ LG I++ CNYGPGGNWN E PY+VG+ACS+CP+GTRC+NG
Sbjct:    2 ISFDLFKQSLMFLSEWNDEAAQRAQMSADRCVFPHDQSRDRRFGDVAQGQISGQPAAANMLELKWNDEAAQRAQMSADRCVFQHDQSRDRRFGGYSWVGQNIAYWSSNDVTDGIKMWFDEVKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLGNIYIVCNYGPGGNWNNEAPYKVGQACSRCPNGTRCSNG 202          
BLAST of Venom allergen 5 vs. Planmine SMEST
Match: SMESG000047165.1 (SMESG000047165.1)

HSP 1 Score: 269.626 bits (688), Expect = 9.340e-90
Identity = 121/156 (77.56%), Postives = 140/156 (89.74%), Query Frame = 3
Query:  804 AAQGKIGGQPAAANMLELKWNNEAAQRAQNSANKCVFGHDQPRDRKFGNYDWVGQNIAFWSSNDVTEGVKMWYDEVNGYNFNSDQCSGFTCLHYTALVWAKTKEFGCGIADCSRQNLGKIFLFCNYGPGGNWNREKPYEVGKACSKCPSGTRCNNG 1271
             AQG+I GQPAAANMLELKWN+EAAQRAQ SA++CVF HDQ RDR+FG Y WVGQNIA+WSSNDVT+G+KMW+DEV  Y FN D+CSGFTCLHYTAL+WAKTKEFGCGIADCSR+ LG I++ CNYGPGGNWN E PY+VG+ACS+CP+GTRC+NG
Sbjct:    1 VAQGQISGQPAAANMLELKWNDEAAQRAQMSADRCVFQHDQSRDRRFGGYSWVGQNIAYWSSNDVTDGIKMWFDEVKDYTFNGDKCSGFTCLHYTALIWAKTKEFGCGIADCSRKGLGNIYIVCNYGPGGNWNNEAPYKVGQACSRCPNGTRCSNG 156          
The following BLAST results are available for this feature:
BLAST of Venom allergen 5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TSPO1.681e-3543.42translocator protein [Source:HGNC Symbol;Acc:HGNC:... [more]
TSPO1.681e-3543.42translocator protein [Source:HGNC Symbol;Acc:HGNC:... [more]
TSPO1.681e-3543.42translocator protein [Source:HGNC Symbol;Acc:HGNC:... [more]
PI161.956e-2634.07peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGN... [more]
PI161.956e-2634.07peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scl-52.435e-2331.75SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-101.858e-2128.99SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-112.822e-2029.61SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-142.999e-2029.95SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-21.144e-1930.39SCP-Like extracellular protein [Source:UniProtKB/... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tspo1.295e-4246.10gene:FBgn0031263 transcript:FBtr0078066[more]
CG84833.249e-2638.76gene:FBgn0038126 transcript:FBtr0082782[more]
Ag5r1.322e-1431.02gene:FBgn0015010 transcript:FBtr0333658[more]
Ag5r1.322e-1431.02gene:FBgn0015010 transcript:FBtr0073937[more]
Ag5r1.322e-1431.02gene:FBgn0015010 transcript:FBtr0305582[more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tspo4.266e-4041.98translocator protein [Source:ZFIN;Acc:ZDB-GENE-041... [more]
tspo4.266e-4041.98translocator protein [Source:ZFIN;Acc:ZDB-GENE-041... [more]
r3hdml2.081e-2435.43R3H domain containing-like [Source:ZFIN;Acc:ZDB-GE... [more]
r3hdml2.081e-2435.43R3H domain containing-like [Source:ZFIN;Acc:ZDB-GE... [more]
pi15b3.992e-2432.64peptidase inhibitor 15b [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dlc11.934e-4552.03DLC1 Rho GTPase activating protein [Source:Xenbase... [more]
dlc12.411e-4552.74DLC1 Rho GTPase activating protein [Source:Xenbase... [more]
dlc18.051e-4552.03DLC1 Rho GTPase activating protein [Source:Xenbase... [more]
pi151.660e-2434.83peptidase inhibitor 15 [Source:NCBI gene;Acc:10048... [more]
ENSXETT00000036788.16.408e-2434.29pep primary_assembly:Xenopus_tropicalis_v9.1:KV464... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tspo9.772e-3641.22translocator protein [Source:MGI Symbol;Acc:MGI:88... [more]
Pi162.393e-2734.62peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi164.737e-2734.62peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi164.737e-2734.62peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi168.567e-2634.24peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Venom allergen 5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P16257|TSPO_RAT7.782e-3640.99Translocator protein OS=Rattus norvegicus OX=10116... [more]
sp|P50637|TSPO_MOUSE6.836e-3541.22Translocator protein OS=Mus musculus OX=10090 GN=T... [more]
sp|P30536|TSPO_HUMAN8.071e-3543.42Translocator protein OS=Homo sapiens OX=9606 GN=TS... [more]
sp|P0DPU1|VA576_SCODE1.210e-3439.00Scoloptoxin SSD976 OS=Scolopendra dehaani OX=26097... [more]
sp|Q9GMC9|TSPO_SHEEP1.552e-3443.15Translocator protein OS=Ovis aries OX=9940 GN=TSPO... [more]
back to top
BLAST of Venom allergen 5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4A1Y96.420e-5351.52Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A7S6F62.668e-5049.07Predicted protein OS=Nematostella vectensis OX=453... [more]
A0A336M0004.429e-5052.12CSON005465 protein OS=Culicoides sonorensis OX=179... [more]
A0A1S4EFU94.819e-4849.38translocator protein isoform X1 OS=Diaphorina citr... [more]
A0A4Y2B6S35.459e-4850.30Translocator protein OS=Araneus ventricosus OX=182... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tspo7.850e-4346.75translocator protein [Source:ZFIN;Acc:ZDB-GENE-041... [more]
r3hdml1.633e-2534.43R3H domain containing like [Source:NCBI gene;Acc:1... [more]
crispld23.607e-2535.36cysteine-rich secretory protein LCCL domain contai... [more]
ENSAMXT00000036030.14.590e-2534.30peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
ENSAMXT00000031557.15.365e-2534.30peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000374.12.666e-2332.11pep scaffold:Pmarinus_7.0:GL476650:75849:87118:-1 ... [more]
CRISP31.956e-2135.50cysteine rich secretory protein 3 [Source:HGNC Sym... [more]
ENSPMAT00000002250.19.604e-2030.22pep scaffold:Pmarinus_7.0:GL477299:1626:22672:-1 g... [more]
CRISP25.782e-1030.50cysteine rich secretory protein 2 [Source:HGNC Sym... [more]
ENSPMAT00000000359.16.908e-836.90pep scaffold:Pmarinus_7.0:GL487788:450:5784:1 gene... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
PRY32.512e-829.19Cell wall-associated protein involved in export of... [more]
PRY12.992e-730.51Sterol binding protein involved in the export of a... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO407113.690e-5449.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO276591.635e-2438.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO419193.044e-1133.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO316823.364e-1132.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352876.535e-1130.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tspo5.405e-4246.50translocator protein [Source:NCBI gene;Acc:1011658... [more]
tspo2.841e-3746.53translocator protein [Source:NCBI gene;Acc:1011658... [more]
tspo9.513e-3049.12translocator protein [Source:NCBI gene;Acc:1011658... [more]
pi15a1.000e-2435.14peptidase inhibitor 15 [Source:NCBI gene;Acc:10117... [more]
ENSORLT00000020674.21.240e-2433.33cysteine-rich venom protein pseudecin-like [Source... [more]
back to top
BLAST of Venom allergen 5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000062609.11.604e-14399.49SMESG000062609.1[more]
SMESG000062601.14.076e-9867.01SMESG000062601.1[more]
SMESG000062601.11.479e-9768.62SMESG000062601.1[more]
SMESG000047165.11.913e-9165.17SMESG000047165.1[more]
SMESG000047165.19.340e-9077.56SMESG000047165.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005188 ID=SMED30005188|Name=Venom allergen 5|organism=Schmidtea mediterranea sexual|type=transcript|length=1330bp
TGACAACTTCTCGCATCAATTTATTAGTAAAATTTTCTACTTTTAAAAAT
AAACTAAATTCAAGTTAAAAATTTTTCAATCCTCTCTTGTCAGATTGTGC
TTATTAAGCATCCAGATTCTAAAATTCAGAGCACTAGCTAAAGTAATCCA
CGCAAGATACGGAAGCAACAGATTTGACGCTTGGTGGCTGATAGGTCGAA
ACGTTAGAACACACGCAACAACATTCGCATATAGAATTGTCAAATCCACG
GATGCCCATCCAATTTGATGTTTTTTAAAGAAAATCACAGACCAAGCCCA
ATTTAAAACTAATTGTGTTCCATATAACATTATTGGTAATTTTGTTTGTT
CGTTAAATCCCCCACCTTCTTTCCAAAGCAAATACGATGCATATCCCATT
GCTGCATACAATGCAGTCCATACTGGTCCAAAAACGTAATTAGGAGGAGT
GAAACATGGCTTTTTAATCGTTTTATACCATCCATCAATTTCTTTTTTCA
TCGTGAATTGAGAAGGAAGACTTCCATAAAACGGAAGAGAAATCGCAAAA
GCCATTTTTAGATATTCACTCATAGTTAACTAATTCGTTGAGTTAACAAA
ATATAATTAAGCAAAAATTATATAATTGTTAATTTCAAGGTCAAGGTCAC
TAGACAGTTGAATTAGTAAAAAAAAAAAAGAAAATGAGAAATTCTATATT
ATTTGGATTAATAATTTGTGTCGTTTTGTCGGTTATCGAATGTGGAGTGA
CTCCCGCTCAACAGAAGCAACTGATTGATGCTCACAATAAATACCGCCGA
GATGCTGCCCAAGGTAAAATTGGAGGACAACCAGCTGCTGCAAATATGTT
GGAATTGAAATGGAATAATGAAGCCGCACAGCGAGCTCAAAACAGTGCTA
ATAAATGCGTCTTCGGACATGATCAACCCAGAGATCGTAAATTTGGAAAT
TATGATTGGGTCGGTCAAAATATTGCATTCTGGTCGAGCAATGATGTGAC
AGAAGGAGTAAAAATGTGGTACGATGAAGTTAATGGTTACAATTTCAATT
CAGACCAATGTTCAGGATTCACCTGCTTGCACTACACTGCTCTTGTCTGG
GCAAAAACCAAAGAATTCGGATGTGGCATAGCTGATTGTTCTCGACAAAA
CCTGGGAAAGATTTTCTTATTTTGCAATTATGGACCCGGAGGAAATTGGA
ACAGAGAGAAACCATATGAAGTTGGTAAAGCCTGTTCGAAATGCCCAAGT
GGAACCAGATGCAACAATGGACTATGCAGTTAGAAATAATCTAAGAACTT
GTCACTTATCAAAATAATTTAATACAATTT
back to top

protein sequence of SMED30005188-orf-1

>SMED30005188-orf-1 ID=SMED30005188-orf-1|Name=SMED30005188-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=200bp
MRNSILFGLIICVVLSVIECGVTPAQQKQLIDAHNKYRRDAAQGKIGGQP
AAANMLELKWNNEAAQRAQNSANKCVFGHDQPRDRKFGNYDWVGQNIAFW
SSNDVTEGVKMWYDEVNGYNFNSDQCSGFTCLHYTALVWAKTKEFGCGIA
DCSRQNLGKIFLFCNYGPGGNWNREKPYEVGKACSKCPSGTRCNNGLCS*
back to top

protein sequence of SMED30005188-orf-2

>SMED30005188-orf-2 ID=SMED30005188-orf-2|Name=SMED30005188-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=166bp
MSEYLKMAFAISLPFYGSLPSQFTMKKEIDGWYKTIKKPCFTPPNYVFGP
VWTALYAAMGYASYLLWKEGGGFNEQTKLPIMLYGTQLVLNWAWSVIFFK
KHQIGWASVDLTILYANVVACVLTFRPISHQASNLLLPYLAWITLASALN
FRIWMLNKHNLTRED*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000028Category 2 cell
PLANA:0000035Category 3 cell
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000240body wall musculature
PLANA:0000418head
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR035940CAP_sf
IPR004307TspO_MBR
IPR002413V5_allergen-like
IPR001283CRISP-related
IPR014044CAP_domain
IPR018244Allrgn_V5/Tpx1_CS
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005576extracellular region
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002413Venom allergen 5-likePRINTSPR00838V5ALLERGENcoord: 21..37
score: 26.84
coord: 130..149
score: 60.31
coord: 106..121
score: 43.75
IPR001283Cysteine-rich secretory protein-relatedPRINTSPR00837V5TPXLIKEcoord: 58..76
score: 38.39
coord: 161..174
score: 45.79
coord: 131..147
score: 48.85
coord: 108..121
score: 34.81
IPR001283Cysteine-rich secretory protein-relatedPANTHERPTHR10334CYSTEINE-RICH SECRETORY PROTEIN-RELATEDcoord: 21..196
IPR014044CAP domainSMARTSM00198SCP_3coord: 25..174
e-value: 2.5E-51
score: 186.5
IPR014044CAP domainPFAMPF00188CAPcoord: 32..166
e-value: 2.2E-23
score: 83.5
IPR035940CAP superfamilyGENE3DG3DSA:3.40.33.10coord: 16..199
e-value: 5.6E-58
score: 197.8
IPR035940CAP superfamilySUPERFAMILYSSF55797PR-1-likecoord: 10..181
NoneNo IPR availablePANTHERPTHR10334:SF344AT27079P-RELATEDcoord: 21..196
NoneNo IPR availableCDDcd05380CAP_eukcoord: 27..167
e-value: 1.3078E-44
score: 143.364
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.804
IPR018244Allergen V5/Tpx-1-related, conserved sitePROSITEPS01010CRISP_2coord: 161..172