ptf-4 protein

Overview
Nameptf-4 protein (AGZ94919.1)
Smed IDSMED30005182
Length (bp)777
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ptf-4 protein (SMED30005182) t-SNE clustered cells

Violin plots show distribution of expression levels for ptf-4 protein (SMED30005182) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ptf-4 protein (SMED30005182) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ptf-4 protein (SMED30005182) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005182

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30005182SMESG000079648.1 SmedASXL_004375SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30005182SMESG000079648.1 dd_Smed_v4_13704_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30005182SMESG000079648.1 dd_Smed_v4_13704_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30005182SMESG000079648.1 dd_Smed_v4_13704_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30005182SMESG000079648.1 dd_Smed_v4_13704_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30005182SMESG000079648.1 dd_Smed_v6_13704_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
progenitor cellSMED30005182SMESG000079648.1 KF487104smed_ncbi_20200123PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
stem cellSMED30005182SMESG000079648.1 KF487104smed_ncbi_20200123PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30005182SMESG000079648.1 KF487104smed_ncbi_20200123PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ptf-4 protein vs. Ensembl Human
Match: PTF1A (pancreas associated transcription factor 1a [Source:HGNC Symbol;Acc:HGNC:23734])

HSP 1 Score: 119.398 bits (298), Expect = 2.740e-31
Identity = 71/142 (50.00%), Postives = 87/142 (61.27%), Query Frame = 3
Query:  378 RQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTE------------SRIDHYDNDRDEPHS--KKIILTSRTVTSEKGKD-DKEILIVTTHSLSWRNIREPKIGPNNTL-AAKIWRPE 755
            RQAAN+RERRRMQSIN+AFEGLR+HIPTLPYEKRLSKVDTLRLAIGYINFL +LV+ +                      D P S  +K+I+  R   S    D D  +  +  HSLSW +  E ++   N +  AK+W PE
Sbjct:  165 RQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSELVQADLPLRGGGAGGCGGPGGGGRLGGDSPGSQAQKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWTD--EKQLKEQNIIRTAKVWTPE 304          
BLAST of ptf-4 protein vs. Ensembl Human
Match: FERD3L (Fer3 like bHLH transcription factor [Source:HGNC Symbol;Acc:HGNC:16660])

HSP 1 Score: 79.7221 bits (195), Expect = 8.340e-18
Identity = 35/58 (60.34%), Postives = 50/58 (86.21%), Query Frame = 3
Query:  375 QRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKT 548
            QRQAAN+RER+RM ++NEAF+ LR  +PT  YEKRLS+++TLRLAI YI+F+ +L+++
Sbjct:  102 QRQAANIRERKRMFNLNEAFDQLRRKVPTFAYEKRLSRIETLRLAIVYISFMTELLES 159          
BLAST of ptf-4 protein vs. Ensembl Human
Match: TWIST1 (twist family bHLH transcription factor 1 [Source:HGNC Symbol;Acc:HGNC:12428])

HSP 1 Score: 66.2402 bits (160), Expect = 4.136e-13
Identity = 34/64 (53.12%), Postives = 48/64 (75.00%), Query Frame = 3
Query:  360 QKLVFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTE 551
            ++L  QR  AN+RER+R QS+NEAF  LR  IPTLP +K LSK+ TL+LA  YI+FL  +++++
Sbjct:   37 EELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDK-LSKIQTLKLAARYIDFLYQVLQSD 99          
BLAST of ptf-4 protein vs. Ensembl Human
Match: TWIST2 (twist family bHLH transcription factor 2 [Source:HGNC Symbol;Acc:HGNC:20670])

HSP 1 Score: 66.2402 bits (160), Expect = 5.893e-13
Identity = 37/72 (51.39%), Postives = 50/72 (69.44%), Query Frame = 3
Query:  360 QKLVFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTESRIDHYDN 575
            ++L  QR  AN+RER+R QS+NEAF  LR  IPTLP +K LSK+ TL+LA  YI+FL  ++++    D  DN
Sbjct:   62 EELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDK-LSKIQTLKLAARYIDFLYQVLQS----DEMDN 128          
BLAST of ptf-4 protein vs. Ensembl Human
Match: TWIST2 (twist family bHLH transcription factor 2 [Source:HGNC Symbol;Acc:HGNC:20670])

HSP 1 Score: 66.2402 bits (160), Expect = 5.893e-13
Identity = 37/72 (51.39%), Postives = 50/72 (69.44%), Query Frame = 3
Query:  360 QKLVFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTESRIDHYDN 575
            ++L  QR  AN+RER+R QS+NEAF  LR  IPTLP +K LSK+ TL+LA  YI+FL  ++++    D  DN
Sbjct:   62 EELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDK-LSKIQTLKLAARYIDFLYQVLQS----DEMDN 128          
BLAST of ptf-4 protein vs. Ensembl Celegans
Match: hlh-13 (Helix-loop-helix protein 13 [Source:UniProtKB/Swiss-Prot;Acc:Q20561])

HSP 1 Score: 83.9593 bits (206), Expect = 4.510e-20
Identity = 45/97 (46.39%), Postives = 60/97 (61.86%), Query Frame = 3
Query:  258 PASVLPSPTTSPDIGKLGSGFSSKYRNRNKTRRGQKLVFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKT 548
            P S  PS ++   +  + S + S Y    +         +RQ A++RER+RM SIN AF  LR +IPT PYEKRLSK+DTL LAI YIN L D+++T
Sbjct:   12 PVSQCPSYSSLSKLFFMDSSYDSYYCEEPE---------ERQTASIRERKRMCSINVAFIELRNYIPTFPYEKRLSKIDTLNLAIAYINMLDDVLRT 99          
BLAST of ptf-4 protein vs. Ensembl Celegans
Match: hlh-15 (Helix Loop Helix [Source:UniProtKB/TrEMBL;Acc:Q18590])

HSP 1 Score: 62.3882 bits (150), Expect = 1.334e-12
Identity = 33/73 (45.21%), Postives = 45/73 (61.64%), Query Frame = 3
Query:  327 KYRNRNKTRRGQKLVFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVK 545
            KYRN + TR               ER R++S N AF  LRA +PTLP EK+LSK++ LR +I YI+FL +L++
Sbjct:   32 KYRNLHATR---------------ERIRVESFNMAFSQLRALLPTLPVEKKLSKIEILRFSIAYISFLDNLLQ 89          
BLAST of ptf-4 protein vs. Ensembl Celegans
Match: lin-32 (pep chromosome:WBcel235:X:2229208:2230122:-1 gene:WBGene00003018.1 transcript:T14F9.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-32)

HSP 1 Score: 60.077 bits (144), Expect = 2.658e-11
Identity = 38/101 (37.62%), Postives = 55/101 (54.46%), Query Frame = 3
Query:  255 NPASVLPSPTTSPDIGKLGSGFSSKYRNRNKTRRGQKLVFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTESR 557
            +P   L SP     +   G     K   R KT   Q L  +R AAN RERRRM ++N A++ LR  +P +   K+LSK +TL++A  YI  L  ++K +S+
Sbjct:   33 SPNFSLDSPNYPDSLSNGGGKDDKKKCRRYKTPSPQLLRMRRSAANERERRRMNTLNVAYDELREVLPEIDSGKKLSKFETLQMAQKYIECLSQILKQDSK 133          
BLAST of ptf-4 protein vs. Ensembl Celegans
Match: hlh-6 (Helix-loop-helix protein 6 [Source:UniProtKB/Swiss-Prot;Acc:Q10007])

HSP 1 Score: 59.3066 bits (142), Expect = 2.897e-10
Identity = 29/54 (53.70%), Postives = 41/54 (75.93%), Query Frame = 3
Query:  390 NLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTE 551
            N RER R++++N+ +E LR H+P    EKR+SKVDTLRLAI YI  L +L+++E
Sbjct:  179 NERERCRVRNVNDGYERLRKHLPVHFDEKRISKVDTLRLAIRYIKHLDNLLRSE 232          
BLAST of ptf-4 protein vs. Ensembl Celegans
Match: hlh-8 (Twist-related protein [Source:UniProtKB/Swiss-Prot;Acc:Q11094])

HSP 1 Score: 58.151 bits (139), Expect = 3.441e-10
Identity = 29/64 (45.31%), Postives = 44/64 (68.75%), Query Frame = 3
Query:  369 VFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTESRI 560
            V QR  AN RER+R + +N+AF  LR  IP++P +K +SK+ TLR+A  YI+FL ++ K   ++
Sbjct:   19 VQQRACANRRERQRTKELNDAFTLLRKLIPSMPSDK-MSKIHTLRIATDYISFLDEMQKNGCKL 81          
BLAST of ptf-4 protein vs. Ensembl Fly
Match: Fer1 (gene:FBgn0037475 transcript:FBtr0081567)

HSP 1 Score: 130.568 bits (327), Expect = 1.375e-36
Identity = 83/162 (51.23%), Postives = 93/162 (57.41%), Query Frame = 3
Query:  312 SGFSSKYRNRNKTRRGQK---------LVFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVK-----TESRIDHYDNDRDEPHSKKIILTSRTVTSEKGKDDKEILIVTTHSLSWRNIREPKIGPNNTLAAKIWRPE 755
            SGF+S   N  KTRR  K         +  QRQAANLRERRRMQSINEAFEGLR HIPTLPYEKRLSKVDTL+LAI YI FL ++VK      E  +    N + EP  KKIIL  RT                 HSLSW   R+    P + L A+ W PE
Sbjct:   52 SGFNSDQENTEKTRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEAFEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSLQRNYQKEP-PKKIILKDRTGG-------------VAHSLSW--YRKGDRYPGSKLYARTWTPE 197          
BLAST of ptf-4 protein vs. Ensembl Fly
Match: Fer1 (gene:FBgn0037475 transcript:FBtr0334670)

HSP 1 Score: 124.02 bits (310), Expect = 4.270e-34
Identity = 83/167 (49.70%), Postives = 93/167 (55.69%), Query Frame = 3
Query:  312 SGFSSKYRNRNKT-----RRGQK---------LVFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVK-----TESRIDHYDNDRDEPHSKKIILTSRTVTSEKGKDDKEILIVTTHSLSWRNIREPKIGPNNTLAAKIWRPE 755
            SGF+S   N  KT     RR  K         +  QRQAANLRERRRMQSINEAFEGLR HIPTLPYEKRLSKVDTL+LAI YI FL ++VK      E  +    N + EP  KKIIL  RT                 HSLSW   R+    P + L A+ W PE
Sbjct:   52 SGFNSDQENTEKTFCPFSRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEAFEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSLQRNYQKEP-PKKIILKDRTGG-------------VAHSLSW--YRKGDRYPGSKLYARTWTPE 202          
BLAST of ptf-4 protein vs. Ensembl Fly
Match: Fer2 (gene:FBgn0038402 transcript:FBtr0301709)

HSP 1 Score: 88.1965 bits (217), Expect = 2.191e-20
Identity = 40/61 (65.57%), Postives = 53/61 (86.89%), Query Frame = 3
Query:  372 FQRQAANLRERRRMQS-INEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTE 551
             QRQAAN+RER+R+QS IN AF+ LR H+PT PYEKRLSK+DTLRLAI YI+ L+++++T+
Sbjct:  147 MQRQAANVRERKRIQSSINSAFDELRVHVPTFPYEKRLSKIDTLRLAIAYISLLREVLQTD 207          
BLAST of ptf-4 protein vs. Ensembl Fly
Match: Fer2 (gene:FBgn0038402 transcript:FBtr0344012)

HSP 1 Score: 88.1965 bits (217), Expect = 2.247e-20
Identity = 40/61 (65.57%), Postives = 53/61 (86.89%), Query Frame = 3
Query:  372 FQRQAANLRERRRMQS-INEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTE 551
             QRQAAN+RER+R+QS IN AF+ LR H+PT PYEKRLSK+DTLRLAI YI+ L+++++T+
Sbjct:  147 MQRQAANVRERKRIQSSINSAFDELRVHVPTFPYEKRLSKIDTLRLAIAYISLLREVLQTD 207          
BLAST of ptf-4 protein vs. Ensembl Fly
Match: Fer2 (gene:FBgn0038402 transcript:FBtr0344010)

HSP 1 Score: 86.2705 bits (212), Expect = 1.332e-19
Identity = 40/66 (60.61%), Postives = 53/66 (80.30%), Query Frame = 3
Query:  372 FQRQAANLRERRRMQ------SINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTE 551
             QRQAAN+RER+R+Q      SIN AF+ LR H+PT PYEKRLSK+DTLRLAI YI+ L+++++T+
Sbjct:  147 MQRQAANVRERKRIQRSAPTGSINSAFDELRVHVPTFPYEKRLSKIDTLRLAIAYISLLREVLQTD 212          
BLAST of ptf-4 protein vs. Ensembl Zebrafish
Match: ptf1a (pancreas associated transcription factor 1a [Source:NCBI gene;Acc:368662])

HSP 1 Score: 125.176 bits (313), Expect = 2.456e-34
Identity = 75/148 (50.68%), Postives = 95/148 (64.19%), Query Frame = 3
Query:  333 RNRNKTRRGQKLVFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTESRIDHYDNDRDEPHS------KKIILTSRTVTSEKGKD-DKEILIVTTHSLSWRNIREPKIGPNNTLAAKIWRPE 755
            + R + R   ++   RQAAN+RERRRMQSIN+AFEGLR+HIPTLPYEKRLSKVDTLRLAIGYINFL +LV+++  I +       PHS      KK+I+  R   S    D D  +  +  HSLSW + ++ K   N    AK+W PE
Sbjct:  102 KRRRRMRSEVEMQQLRQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLAELVQSDMPIRN-------PHSDALNQPKKVIICHRGTRSPSPNDPDYGLPPLAGHSLSWTDEKQLK-DQNIIRTAKVWTPE 241          
BLAST of ptf-4 protein vs. Ensembl Zebrafish
Match: si:dkey-34f9.3 (si:dkey-34f9.3 [Source:ZFIN;Acc:ZDB-GENE-081104-410])

HSP 1 Score: 88.9669 bits (219), Expect = 1.284e-21
Identity = 39/56 (69.64%), Postives = 47/56 (83.93%), Query Frame = 3
Query:  375 QRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLV 542
            QR AAN+RER+RM SIN AFE LR H+PT PYEKRLSK+DTLRLAI YI  L++++
Sbjct:   66 QRHAANIRERKRMLSINSAFEELRCHVPTFPYEKRLSKIDTLRLAIAYIALLREIL 121          
BLAST of ptf-4 protein vs. Ensembl Zebrafish
Match: ferd3l (Fer3-like bHLH transcription factor [Source:ZFIN;Acc:ZDB-GENE-081104-461])

HSP 1 Score: 81.2629 bits (199), Expect = 1.397e-19
Identity = 36/57 (63.16%), Postives = 48/57 (84.21%), Query Frame = 3
Query:  375 QRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVK 545
            QRQAAN+RER+RM S+NEAF+ LR  +PT  YEKRLS+++TLRLAI YI F+ D+++
Sbjct:   25 QRQAANIRERKRMFSLNEAFDRLRRRVPTFAYEKRLSRIETLRLAIVYIAFMTDILE 81          
BLAST of ptf-4 protein vs. Ensembl Zebrafish
Match: twist1b (twist family bHLH transcription factor 1b [Source:ZFIN;Acc:ZDB-GENE-050417-357])

HSP 1 Score: 68.1662 bits (165), Expect = 5.367e-14
Identity = 34/64 (53.12%), Postives = 48/64 (75.00%), Query Frame = 3
Query:  360 QKLVFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTE 551
            ++L  QR  AN+RER+R QS+NEAF  LR  IPTLP +K LSK+ TL+LA  YI+FL  +++++
Sbjct:   71 EELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDK-LSKIQTLKLAARYIDFLCQVLQSD 133          
BLAST of ptf-4 protein vs. Ensembl Zebrafish
Match: twist1b (twist family bHLH transcription factor 1b [Source:ZFIN;Acc:ZDB-GENE-050417-357])

HSP 1 Score: 67.781 bits (164), Expect = 1.202e-13
Identity = 34/64 (53.12%), Postives = 48/64 (75.00%), Query Frame = 3
Query:  360 QKLVFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTE 551
            ++L  QR  AN+RER+R QS+NEAF  LR  IPTLP +K LSK+ TL+LA  YI+FL  +++++
Sbjct:   71 EELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDK-LSKIQTLKLAARYIDFLCQVLQSD 133          
BLAST of ptf-4 protein vs. Ensembl Xenopus
Match: PTF1A (pancreas associated transcription factor 1a [Source:NCBI gene;Acc:100494161])

HSP 1 Score: 126.331 bits (316), Expect = 4.347e-34
Identity = 73/148 (49.32%), Postives = 96/148 (64.86%), Query Frame = 3
Query:  315 GFSSKYRNRNKTRRGQKLVFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTESRIDHYDNDRDEPHSKKIILTSRTVTSEKGKD-DKEILIVTTHSLSWRNIREPKIGPNNTLAAKIWRPE 755
            G S   + R + R   ++   RQAAN+RERRRMQSIN+AFEGLR+HIPTLPYEKRLSKVDTLRLAIGYINFL +LV+++  + + + D      KK+I+  R   S    D D  +  +  HSLSW + ++ +   N    AK+W PE
Sbjct:  150 GGSLVMKRRRRLRSDAEMQQLRQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSELVQSDLPLRNPNTDSGH-QPKKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWTDEKQLR-DQNVVRTAKVWTPE 295          
BLAST of ptf-4 protein vs. Ensembl Xenopus
Match: ENSXETT00000031930.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:55646956:55647657:1 gene:ENSXETG00000008961.1 transcript:ENSXETT00000031930.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 89.7373 bits (221), Expect = 1.340e-21
Identity = 44/84 (52.38%), Postives = 57/84 (67.86%), Query Frame = 3
Query:  297 IGKLGSGFSSKYRNRNKTRRGQKLVFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKT 548
            +  LG+  +S ++  +      K+   RQAAN+RERRRM SIN AFE LR  +PT PYEKRLSK+DTLRLAI YI  L D++ +
Sbjct:   60 LAGLGAEMNSSFQEESLMEGPCKV--HRQAANIRERRRMLSINSAFEELRGRVPTFPYEKRLSKIDTLRLAIAYIALLSDILSS 141          
BLAST of ptf-4 protein vs. Ensembl Xenopus
Match: ferd3l (Fer3-like bHLH transcription factor [Source:NCBI gene;Acc:100124312])

HSP 1 Score: 79.7221 bits (195), Expect = 2.495e-18
Identity = 35/57 (61.40%), Postives = 49/57 (85.96%), Query Frame = 3
Query:  375 QRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVK 545
            QRQAAN+RER+RM ++NEAF+ LR  +PT  YEKRLS+++TLRLAI YI+F+ +++K
Sbjct:   66 QRQAANIRERKRMFNLNEAFDLLRKKVPTFAYEKRLSRIETLRLAIVYISFMTEMLK 122          
BLAST of ptf-4 protein vs. Ensembl Xenopus
Match: tcf15 (transcription factor 15 [Source:NCBI gene;Acc:549260])

HSP 1 Score: 70.4774 bits (171), Expect = 1.975e-14
Identity = 34/61 (55.74%), Postives = 45/61 (73.77%), Query Frame = 3
Query:  360 QKLVFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLV 542
            Q +V QRQAAN RER R QS+N AF  LR  IPT P +++LSK++TLRLA  YI+ L +++
Sbjct:   58 QPVVKQRQAANARERDRTQSVNTAFTALRTLIPTEPVDRKLSKIETLRLASSYISHLANVL 118          
BLAST of ptf-4 protein vs. Ensembl Xenopus
Match: hnrnpc (heterogeneous nuclear ribonucleoprotein C (C1/C2) [Source:Xenbase;Acc:XB-GENE-489141])

HSP 1 Score: 70.0922 bits (170), Expect = 3.591e-14
Identity = 34/61 (55.74%), Postives = 45/61 (73.77%), Query Frame = 3
Query:  360 QKLVFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLV 542
            Q +V QRQAAN RER R QS+N AF  LR  IPT P +++LSK++TLRLA  YI+ L +++
Sbjct:   58 QPVVKQRQAANARERDRTQSVNTAFTALRTLIPTEPVDRKLSKIETLRLASSYISHLANVL 118          
BLAST of ptf-4 protein vs. Ensembl Mouse
Match: Ptf1a (pancreas specific transcription factor, 1a [Source:MGI Symbol;Acc:MGI:1328312])

HSP 1 Score: 121.709 bits (304), Expect = 2.003e-32
Identity = 70/142 (49.30%), Postives = 88/142 (61.97%), Query Frame = 3
Query:  378 RQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTESRI--------------DHYDNDRDEPHSKKIILTSRTVTSEKGKD-DKEILIVTTHSLSWRNIREPKIGPNNTL-AAKIWRPE 755
            RQAAN+RERRRMQSIN+AFEGLR+HIPTLPYEKRLSKVDTLRLAIGYINFL +LV+ +  +               H   D     ++K+I+  R   S    D D  +  +  HSLSW +  E ++   N +  AK+W PE
Sbjct:  162 RQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSELVQADLPLRGSGAGGCGGPGGSRHLGEDSPGNQAQKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWTD--EKQLKEQNIIRTAKVWTPE 301          
BLAST of ptf-4 protein vs. Ensembl Mouse
Match: Ferd3l (Fer3 like bHLH transcription factor [Source:MGI Symbol;Acc:MGI:2150010])

HSP 1 Score: 79.337 bits (194), Expect = 7.448e-18
Identity = 35/59 (59.32%), Postives = 51/59 (86.44%), Query Frame = 3
Query:  375 QRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTE 551
            QRQAAN+RER+RM ++NEAF+ LR  +PT  YEKRLS+++TLRLAI YI+F+ +L++++
Sbjct:  104 QRQAANIRERKRMFNLNEAFDQLRRKVPTFAYEKRLSRIETLRLAIVYISFMTELLQSK 162          
BLAST of ptf-4 protein vs. Ensembl Mouse
Match: Tcf15 (transcription factor 15 [Source:MGI Symbol;Acc:MGI:104664])

HSP 1 Score: 67.3958 bits (163), Expect = 3.472e-13
Identity = 33/59 (55.93%), Postives = 43/59 (72.88%), Query Frame = 3
Query:  366 LVFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLV 542
            +V QRQAAN RER R QS+N AF  LR  IPT P +++LSK++TLRLA  YI  L +++
Sbjct:   68 VVRQRQAANARERDRTQSVNTAFTALRTLIPTEPVDRKLSKIETLRLASSYIAHLANVL 126          
BLAST of ptf-4 protein vs. Ensembl Mouse
Match: Twist2 (twist basic helix-loop-helix transcription factor 2 [Source:MGI Symbol;Acc:MGI:104685])

HSP 1 Score: 66.2402 bits (160), Expect = 4.046e-13
Identity = 37/72 (51.39%), Postives = 50/72 (69.44%), Query Frame = 3
Query:  360 QKLVFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTESRIDHYDN 575
            ++L  QR  AN+RER+R QS+NEAF  LR  IPTLP +K LSK+ TL+LA  YI+FL  ++++    D  DN
Sbjct:   62 EELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDK-LSKIQTLKLAARYIDFLYQVLQS----DEMDN 128          
BLAST of ptf-4 protein vs. Ensembl Mouse
Match: Twist2 (twist basic helix-loop-helix transcription factor 2 [Source:MGI Symbol;Acc:MGI:104685])

HSP 1 Score: 66.2402 bits (160), Expect = 4.046e-13
Identity = 37/72 (51.39%), Postives = 50/72 (69.44%), Query Frame = 3
Query:  360 QKLVFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTESRIDHYDN 575
            ++L  QR  AN+RER+R QS+NEAF  LR  IPTLP +K LSK+ TL+LA  YI+FL  ++++    D  DN
Sbjct:   62 EELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDK-LSKIQTLKLAARYIDFLYQVLQS----DEMDN 128          
BLAST of ptf-4 protein vs. UniProt/SwissProt
Match: sp|Q4ZHW1|PTF1A_XENLA (Pancreas transcription factor 1 subunit alpha OS=Xenopus laevis OX=8355 GN=ptf1a PE=2 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 1.176e-33
Identity = 72/148 (48.65%), Postives = 97/148 (65.54%), Query Frame = 3
Query:  315 GFSSKYRNRNKTRRGQKLVFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTESRIDHYDNDRDEPHSKKIILTSRTVTSEKGKD-DKEILIVTTHSLSWRNIREPKIGPNNTLAAKIWRPE 755
            G S   + R + R   ++   RQAAN+RERRRMQSIN+AFEGLR+HIPTLPYEKRLSKVDTLRLAIGYINFL ++V+++  + + ++D      KK+I+  R   S    D D  +  +  HSLSW + ++ +   N    AK+W PE
Sbjct:  100 GGSLVMKRRRRLRSDAEMQQLRQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSEMVQSDLPLRNPNSDSGN-QPKKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWTDEKQLR-DQNVVRTAKVWTPE 245          
BLAST of ptf-4 protein vs. UniProt/SwissProt
Match: sp|Q7ZSX3|PTF1A_DANRE (Pancreas transcription factor 1 subunit alpha OS=Danio rerio OX=7955 GN=ptf1a PE=2 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 1.854e-33
Identity = 75/148 (50.68%), Postives = 95/148 (64.19%), Query Frame = 3
Query:  333 RNRNKTRRGQKLVFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTESRIDHYDNDRDEPHS------KKIILTSRTVTSEKGKD-DKEILIVTTHSLSWRNIREPKIGPNNTLAAKIWRPE 755
            + R + R   ++   RQAAN+RERRRMQSIN+AFEGLR+HIPTLPYEKRLSKVDTLRLAIGYINFL +LV+++  I +       PHS      KK+I+  R   S    D D  +  +  HSLSW + ++ K   N    AK+W PE
Sbjct:  102 KRRRRMRSEVEMQQLRQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLAELVQSDMPIRN-------PHSDALNQPKKVIICHRGTRSPSPNDPDYGLPPLAGHSLSWTDEKQLK-DQNIIRTAKVWTPE 241          
BLAST of ptf-4 protein vs. UniProt/SwissProt
Match: sp|Q64305|PTF1A_RAT (Pancreas transcription factor 1 subunit alpha OS=Rattus norvegicus OX=10116 GN=Ptf1a PE=1 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 9.382e-32
Identity = 70/142 (49.30%), Postives = 88/142 (61.97%), Query Frame = 3
Query:  378 RQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTESRI--------------DHYDNDRDEPHSKKIILTSRTVTSEKGKD-DKEILIVTTHSLSWRNIREPKIGPNNTL-AAKIWRPE 755
            RQAAN+RERRRMQSIN+AFEGLR+HIPTLPYEKRLSKVDTLRLAIGYINFL +LV+ +  +               H   D     ++K+I+  R   S    D D  +  +  HSLSW +  E ++   N +  AK+W PE
Sbjct:  164 RQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSELVQADLPLRGSGTGGCGGPGGSRHLGGDSPGNQAQKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWAD--EKQLKEQNIIRTAKVWTPE 303          
BLAST of ptf-4 protein vs. UniProt/SwissProt
Match: sp|Q9QX98|PTF1A_MOUSE (Pancreas transcription factor 1 subunit alpha OS=Mus musculus OX=10090 GN=Ptf1a PE=1 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 1.401e-31
Identity = 70/142 (49.30%), Postives = 88/142 (61.97%), Query Frame = 3
Query:  378 RQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTESRI--------------DHYDNDRDEPHSKKIILTSRTVTSEKGKD-DKEILIVTTHSLSWRNIREPKIGPNNTL-AAKIWRPE 755
            RQAAN+RERRRMQSIN+AFEGLR+HIPTLPYEKRLSKVDTLRLAIGYINFL +LV+ +  +               H   D     ++K+I+  R   S    D D  +  +  HSLSW +  E ++   N +  AK+W PE
Sbjct:  162 RQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSELVQADLPLRGSGAGGCGGPGGSRHLGEDSPGNQAQKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWTD--EKQLKEQNIIRTAKVWTPE 301          
BLAST of ptf-4 protein vs. UniProt/SwissProt
Match: sp|Q7RTS3|PTF1A_HUMAN (Pancreas transcription factor 1 subunit alpha OS=Homo sapiens OX=9606 GN=PTF1A PE=1 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 1.316e-30
Identity = 71/142 (50.00%), Postives = 87/142 (61.27%), Query Frame = 3
Query:  378 RQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTE------------SRIDHYDNDRDEPHS--KKIILTSRTVTSEKGKD-DKEILIVTTHSLSWRNIREPKIGPNNTL-AAKIWRPE 755
            RQAAN+RERRRMQSIN+AFEGLR+HIPTLPYEKRLSKVDTLRLAIGYINFL +LV+ +                      D P S  +K+I+  R   S    D D  +  +  HSLSW +  E ++   N +  AK+W PE
Sbjct:  165 RQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSELVQADLPLRGGGAGGCGGPGGGGRLGGDSPGSQAQKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWTD--EKQLKEQNIIRTAKVWTPE 304          
BLAST of ptf-4 protein vs. TrEMBL
Match: U5YTB4 (Ptf-4 protein (Fragment) OS=Schmidtea mediterranea OX=79327 GN=ptf-4 PE=2 SV=1)

HSP 1 Score: 426.402 bits (1095), Expect = 4.932e-150
Identity = 208/208 (100.00%), Postives = 208/208 (100.00%), Query Frame = 3
Query:   84 LAIRHNSYYNQISGAVGYSPLRLITVPLSNWKSEMPDGALEMEDELSIVDDSNSEKSNPASVLPSPTTSPDIGKLGSGFSSKYRNRNKTRRGQKLVFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTESRIDHYDNDRDEPHSKKIILTSRTVTSEKGKDDKEILIVTTHSLSWRNIREP 707
            LAIRHNSYYNQISGAVGYSPLRLITVPLSNWKSEMPDGALEMEDELSIVDDSNSEKSNPASVLPSPTTSPDIGKLGSGFSSKYRNRNKTRRGQKLVFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTESRIDHYDNDRDEPHSKKIILTSRTVTSEKGKDDKEILIVTTHSLSWRNIREP
Sbjct:    1 LAIRHNSYYNQISGAVGYSPLRLITVPLSNWKSEMPDGALEMEDELSIVDDSNSEKSNPASVLPSPTTSPDIGKLGSGFSSKYRNRNKTRRGQKLVFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTESRIDHYDNDRDEPHSKKIILTSRTVTSEKGKDDKEILIVTTHSLSWRNIREP 208          
BLAST of ptf-4 protein vs. TrEMBL
Match: K1Q6J0 (Pancreas transcription factor 1 subunit alpha OS=Crassostrea gigas OX=29159 GN=CGI_10017809 PE=4 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 1.064e-38
Identity = 78/151 (51.66%), Postives = 100/151 (66.23%), Query Frame = 3
Query:  309 GSGFSSKYRNRNKTRRGQKLVFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTESRIDHYDNDRDEPHSKKIILTSRTVTSEKGKDD--KEILIVTTHSLSWRNIREPKIGPNNTLAAKIWRPE 755
            GS  +S+ + + K       + QR+AANLRER+RMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYI FL +LVK+ +   + +    +   +K+I+     T     DD  +  L +  HSLSWR+ + P +GPN T+ AK W PE
Sbjct:   40 GSIHTSQQKGKRKKDSPFHQIQQREAANLRERKRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYIGFLSELVKSNAGTANSNQTAYKEKHRKVIINCHYTTR---ADDIARGWLPLAGHSLSWRDEKNPGLGPNRTMFAKTWVPE 187          
BLAST of ptf-4 protein vs. TrEMBL
Match: U5YQ65 (Ptf-2 protein (Fragment) OS=Schmidtea mediterranea OX=79327 GN=ptf-2 PE=2 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 1.712e-38
Identity = 74/143 (51.75%), Postives = 97/143 (67.83%), Query Frame = 3
Query:  345 KTRRGQKLVFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTES-RIDHYDNDRDEPHSKKIILTSRTVTSEKGKDDKEIL--IVTTHSLSWRNIREPKIGPNNTLAAKIWRPEILL 764
            K R  Q+ + +RQAAN+RERRRMQSINEAFEGLR HIPT+PYEKRLSKVDTLRLAI YI FLQ+L+K++   ++  D   +   S +  +  + + S K  + K+    ++  HSLSWRN REP      T  A+IW PE++L
Sbjct:   57 KNRNYQRKLAERQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDCGSLEPIDCSGNAIRSAECSIEQKIILSLKHHNSKDFRADVICGHSLSWRNDREPTNIFKRTFKAEIWTPEVVL 199          
BLAST of ptf-4 protein vs. TrEMBL
Match: V4CI15 (BHLH domain-containing protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_66849 PE=4 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 2.726e-36
Identity = 70/130 (53.85%), Postives = 90/130 (69.23%), Query Frame = 3
Query:  375 QRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTESRIDHYDNDRDEPHSKKIILTSRTVTSEKGKDDKE---ILIVTTHSLSWRNIREPKIGPNNTLAAKIWRPE 755
            QR AAN+RER+RMQSIN+AFEGLR HIPTLPYEKRLSKVDTLRLAIGYI FL +LV+++ +      ++     KK+I     +   +G ++ E   +  +  HSLSW + ++P  GPN TL AKIW PE
Sbjct:   61 QRHAANMRERKRMQSINDAFEGLRTHIPTLPYEKRLSKVDTLRLAIGYIGFLAELVESDVQAKENVANQVGEQPKKVI-----IHCHRGNENLEQYGLPPLAGHSLSWTDAKKPNYGPNKTLTAKIWMPE 185          
BLAST of ptf-4 protein vs. TrEMBL
Match: A0A1S3I0M3 (pancreas transcription factor 1 subunit alpha OS=Lingula unguis OX=7574 GN=LOC106159609 PE=4 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 2.999e-36
Identity = 77/147 (52.38%), Postives = 102/147 (69.39%), Query Frame = 3
Query:  327 KYRNRNKTRRGQKLVFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTESRIDHYDNDRDEPHSKKIILTSRTVTSEKGKDDKEILIVTTHSLSWRNIRE-PKI---GPNNTLAAKIWRPE 755
            K R R K   GQ+ VFQRQAANLRER+RMQSINEAFEGLRAHIPTLPYEKRLSKVDTL+LAIGYI+FL ++V+++ +     N ++    +KII+       ++ + +  +  +  HSLSW + ++ P +   GP  T+ AKIW PE
Sbjct:   69 KVRRRRKKGAGQQ-VFQRQAANLRERKRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLKLAIGYISFLTEIVQSDLQSKENINTQNNDQPRKIIIHCHRAFQDECEQNG-LPPLAGHSLSWCDDKKTPCVTQQGPKRTMIAKIWMPE 213          
BLAST of ptf-4 protein vs. Ensembl Cavefish
Match: ptf1a (pancreas associated transcription factor 1a [Source:NCBI gene;Acc:103046795])

HSP 1 Score: 126.716 bits (317), Expect = 4.040e-35
Identity = 71/127 (55.91%), Postives = 88/127 (69.29%), Query Frame = 3
Query:  378 RQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTESRIDHYDNDRDEPHSKKIILTSRTVTSEKGKD-DKEILIVTTHSLSWRNIREPKIGPNNTLAAKIWRPE 755
            RQAAN+RERRRMQSIN+AFEGLR+HIPTLPYEKRLSKVDTLRLAIGYINFL +LV++++ I    ++   P  KKII+  R        D D  +  +  HSLSW + ++ K   N    AK+W PE
Sbjct:   94 RQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLAELVQSDAPIRSSSSEALNP-PKKIIICHRVTRPPSPNDPDYGLPPLAGHSLSWTDEKQLK-DQNIIRTAKVWTPE 218          
BLAST of ptf-4 protein vs. Ensembl Cavefish
Match: si:dkey-34f9.3 (neurogenic differentiation factor 1-like [Source:NCBI gene;Acc:107197807])

HSP 1 Score: 88.9669 bits (219), Expect = 4.727e-21
Identity = 39/58 (67.24%), Postives = 48/58 (82.76%), Query Frame = 3
Query:  375 QRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKT 548
            QR AAN+RER+RM SIN AFE LR H+PT PYEKRLSK+DTLRLAI YI  L++++ +
Sbjct:  121 QRHAANIRERKRMLSINSAFEQLRCHVPTFPYEKRLSKIDTLRLAIAYIALLREILMS 178          
BLAST of ptf-4 protein vs. Ensembl Cavefish
Match: ferd3l (Fer3-like bHLH transcription factor [Source:ZFIN;Acc:ZDB-GENE-081104-461])

HSP 1 Score: 81.6481 bits (200), Expect = 6.648e-20
Identity = 36/55 (65.45%), Postives = 47/55 (85.45%), Query Frame = 3
Query:  375 QRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDL 539
            QRQAAN+RER+RM S+NEAF+ LR  +PT  YEKRLS+++TLRLAI YI+F+ +L
Sbjct:   16 QRQAANIRERKRMFSLNEAFDELRKKVPTFAYEKRLSRIETLRLAIVYISFMTEL 70          
BLAST of ptf-4 protein vs. Ensembl Cavefish
Match: tcf15 (transcription factor 15 [Source:NCBI gene;Acc:103040145])

HSP 1 Score: 73.1738 bits (178), Expect = 1.272e-15
Identity = 41/86 (47.67%), Postives = 55/86 (63.95%), Query Frame = 3
Query:  309 GSGFSSKYRNRNKTRRGQKLVFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTESRIDH 566
            G   S++ R RN T  G  +V QR AAN RER R QS+N AF  LR  IPT P +++LSK++TLRLA  YI+ L +++ T    +H
Sbjct:   41 GCCASAEKRRRNTTG-GVLIVKQRNAANARERDRTQSVNTAFTALRTLIPTEPVDRKLSKIETLRLASSYISHLANVLLTGDAGEH 125          
BLAST of ptf-4 protein vs. Ensembl Cavefish
Match: twist2 (twist2 [Source:ZFIN;Acc:ZDB-GENE-980526-235])

HSP 1 Score: 68.5514 bits (166), Expect = 5.653e-14
Identity = 40/88 (45.45%), Postives = 57/88 (64.77%), Query Frame = 3
Query:  288 SPDIGKLGSGFSSKYRNRNKTRRGQKLVFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTE 551
            S D G  GS    K  + ++    ++L  QR  AN+RER+R QS+NEAF  LR  IPTLP +K LSK+ TL+LA  YI+FL  +++++
Sbjct:   46 SSDEGSPGSAKRGKKASPSRAHSYEELQNQRVLANVRERQRTQSLNEAFASLRKIIPTLPSDK-LSKIQTLKLASRYIDFLYQVLQSD 132          
BLAST of ptf-4 protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004072.1 (pep scaffold:Pmarinus_7.0:GL492732:1750:4325:-1 gene:ENSPMAG00000003727.1 transcript:ENSPMAT00000004072.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 116.316 bits (290), Expect = 1.174e-31
Identity = 69/133 (51.88%), Postives = 80/133 (60.15%), Query Frame = 3
Query:  378 RQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTESRIDHYDNDRDEPHSKKIILTSRTVTSEKGK----DDKEILIVTTHSLSW---RNIREPKIGPNNTLAAKIWRPE 755
            RQAAN RERRRMQSIN AFEGLRAHIPTLPYEKRLSKVDTLRLAIGYI+FL +LV +E  +            KKII+  R   S            ++ +  HSLSW   R  RE  +       A++W PE
Sbjct:  133 RQAANQRERRRMQSINAAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYISFLGELVHSERPLRAQAGQPLLSQQKKIIICHRASRSPSAALSPGLSSGLIPLAGHSLSWTDERQRRERHV----VRTARVWTPE 261          
BLAST of ptf-4 protein vs. Ensembl Sea Lamprey
Match: si:dkey-34f9.3 (si:dkey-34f9.3 [Source:ZFIN;Acc:ZDB-GENE-081104-410])

HSP 1 Score: 92.0485 bits (227), Expect = 8.127e-24
Identity = 42/65 (64.62%), Postives = 51/65 (78.46%), Query Frame = 3
Query:  360 QKLVFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTES 554
            Q    QR AAN+RERRRM SIN AFE LR H+PT PYEKRLSK+DTLRLAI YI  L+D++ +++
Sbjct:   29 QPYEVQRTAANVRERRRMLSINSAFEELRCHVPTFPYEKRLSKIDTLRLAIAYIALLRDILLSDT 93          
BLAST of ptf-4 protein vs. Ensembl Sea Lamprey
Match: TWIST1 (twist family bHLH transcription factor 1 [Source:HGNC Symbol;Acc:HGNC:12428])

HSP 1 Score: 65.0846 bits (157), Expect = 5.617e-14
Identity = 36/67 (53.73%), Postives = 47/67 (70.15%), Query Frame = 3
Query:  375 QRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTESRIDHYDN 575
            QR  AN+RER+R QS+NEAF  LR  IPTLP +K LSK+ TL+LA  YI+FL  ++++    D  DN
Sbjct:    9 QRVLANVRERQRTQSLNEAFASLRKIIPTLPSDK-LSKIQTLKLASRYIDFLYQVLQS----DEMDN 70          
BLAST of ptf-4 protein vs. Ensembl Sea Lamprey
Match: TWIST1 (twist family bHLH transcription factor 1 [Source:HGNC Symbol;Acc:HGNC:12428])

HSP 1 Score: 66.6254 bits (161), Expect = 9.020e-14
Identity = 35/67 (52.24%), Postives = 47/67 (70.15%), Query Frame = 3
Query:  357 GQKLVFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTESR 557
            G+++  QR  AN+RER+R QS+NEAF  LR  IPTLP +K LSK+ TL+LA  YI+FL  ++    R
Sbjct:   90 GEEVQQQRFVANVRERQRTQSLNEAFASLRQIIPTLPSDK-LSKIQTLKLATRYIDFLYQVLAERRR 155          
BLAST of ptf-4 protein vs. Ensembl Sea Lamprey
Match: TWIST1 (twist family bHLH transcription factor 1 [Source:HGNC Symbol;Acc:HGNC:12428])

HSP 1 Score: 66.2402 bits (160), Expect = 1.740e-13
Identity = 35/67 (52.24%), Postives = 47/67 (70.15%), Query Frame = 3
Query:  357 GQKLVFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTESR 557
            G+++  QR  AN+RER+R QS+NEAF  LR  IPTLP +K LSK+ TL+LA  YI+FL  ++    R
Sbjct:  108 GEEVQQQRFVANVRERQRTQSLNEAFASLRQIIPTLPSDK-LSKIQTLKLATRYIDFLYQVLAERRR 173          
BLAST of ptf-4 protein vs. Ensembl Nematostella
Match: EDO43849 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXI0])

HSP 1 Score: 105.531 bits (262), Expect = 1.376e-29
Identity = 48/58 (82.76%), Postives = 53/58 (91.38%), Query Frame = 3
Query:  369 VFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLV 542
            + QR AANLRER+RMQSINEAFEGLR HIPTLPYEKRLSKVDTLRLAIGYI FL +++
Sbjct:    1 IVQRHAANLRERKRMQSINEAFEGLRKHIPTLPYEKRLSKVDTLRLAIGYIGFLTEMI 58          
BLAST of ptf-4 protein vs. Ensembl Nematostella
Match: TWIST (Predicted protein; Twist family bHLH transcription factor [Source:UniProtKB/TrEMBL;Acc:Q6S5G7])

HSP 1 Score: 69.3218 bits (168), Expect = 5.471e-15
Identity = 38/67 (56.72%), Postives = 48/67 (71.64%), Query Frame = 3
Query:  342 NKTRRGQKLVFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLV 542
            N+TRRG     QR  AN+RER+R Q++NEAF  LR  IPTLP +K LSK+ TLRLA  YI+FL  ++
Sbjct:   26 NRTRRGGSKNDQRAIANVRERQRTQALNEAFNKLRKIIPTLPSDK-LSKIQTLRLASRYIDFLCQVL 91          
BLAST of ptf-4 protein vs. Ensembl Nematostella
Match: EDO42924 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZZ0])

HSP 1 Score: 64.3142 bits (155), Expect = 7.259e-14
Identity = 31/56 (55.36%), Postives = 39/56 (69.64%), Query Frame = 3
Query:  375 QRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLV 542
            QRQAAN RER R  S+N AF  LR  IPT P +++LSK++TLRLA  YI  L  ++
Sbjct:    2 QRQAANARERNRTHSVNAAFNALRLLIPTEPSDRKLSKIETLRLASSYIAHLSTIL 57          
BLAST of ptf-4 protein vs. Ensembl Nematostella
Match: EDO42907 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S063])

HSP 1 Score: 57.7658 bits (138), Expect = 1.882e-11
Identity = 30/56 (53.57%), Postives = 37/56 (66.07%), Query Frame = 3
Query:  375 QRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLV 542
            QR+ AN RER R+Q +N AFE LR  IP    EK+ SK+DT+RLA  YI  L  L+
Sbjct:    4 QRRTANERERNRVQQVNAAFETLRNKIPLRALEKKPSKIDTIRLATRYIQDLTQLL 59          
BLAST of ptf-4 protein vs. Ensembl Nematostella
Match: EDO40812 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S669])

HSP 1 Score: 56.225 bits (134), Expect = 5.284e-11
Identity = 24/46 (52.17%), Postives = 35/46 (76.09%), Query Frame = 3
Query:  396 RERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQ 533
            +ERRR ++IN AF  LR HIP +P + +LSK+ TL+LA+ YI+ L+
Sbjct:    7 KERRRTENINAAFAELRKHIPNVPSDTKLSKIKTLKLAMSYIHHLE 52          
BLAST of ptf-4 protein vs. Ensembl Medaka
Match: ptf1a (pancreas associated transcription factor 1a [Source:NCBI gene;Acc:101160350])

HSP 1 Score: 126.716 bits (317), Expect = 6.485e-35
Identity = 72/130 (55.38%), Postives = 89/130 (68.46%), Query Frame = 3
Query:  378 RQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTESRIDHYDNDRDEPHSKKIILTSRTVTSEKGKD-DKEILIVTTHSLSW---RNIREPKIGPNNTLAAKIWRPE 755
            RQAAN+RERRRMQSIN+AFEGLR+HIPTLPYEKRLSKVDTLRLAIGYINFL +LV+++  I + ++D      KK+I+  R   S    D D  +  +  HSLSW   + +RE  I       AK+W PE
Sbjct:  120 RQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLAELVQSDLPIRNSNSDA-HAQPKKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWSDEKQLREQNI----IRTAKVWTPE 244          
BLAST of ptf-4 protein vs. Ensembl Medaka
Match: ferd3l (Fer3 like bHLH transcription factor [Source:NCBI gene;Acc:101167882])

HSP 1 Score: 85.5001 bits (210), Expect = 2.657e-21
Identity = 42/68 (61.76%), Postives = 56/68 (82.35%), Query Frame = 3
Query:  345 KTRRGQKL-VFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVK 545
            K+RR + + V QRQAAN+RERRRM S+NEAF+ LR  +PT  YEKRLS+++TLRLAI YI+F+ DL++
Sbjct:    4 KSRRRRIITVVQRQAANVRERRRMFSLNEAFDELRRKVPTFAYEKRLSRIETLRLAIVYISFMTDLLE 71          
BLAST of ptf-4 protein vs. Ensembl Medaka
Match: si:dkey-34f9.3 (si:dkey-34f9.3 [Source:ZFIN;Acc:ZDB-GENE-081104-410])

HSP 1 Score: 87.8113 bits (216), Expect = 8.107e-21
Identity = 39/56 (69.64%), Postives = 47/56 (83.93%), Query Frame = 3
Query:  375 QRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLV 542
            QR AAN+RER+RM SIN AFE LR H+PT PYEKRLSK+DTLRLAI YI  L++++
Sbjct:  125 QRHAANIRERKRMLSINSAFEELRCHVPTFPYEKRLSKIDTLRLAIAYIALLREIL 180          
BLAST of ptf-4 protein vs. Ensembl Medaka
Match: twist1 (twist family bHLH transcription factor 1 [Source:NCBI gene;Acc:100049283])

HSP 1 Score: 67.3958 bits (163), Expect = 1.550e-13
Identity = 34/64 (53.12%), Postives = 48/64 (75.00%), Query Frame = 3
Query:  360 QKLVFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTE 551
            ++L  QR  AN+RER+R QS+NEAF  LR  IPTLP +K LSK+ TL+LA  YI+FL  +++++
Sbjct:   70 EELQSQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDK-LSKIQTLKLAARYIDFLCQVLQSD 132          
BLAST of ptf-4 protein vs. Ensembl Medaka
Match: tcf15 (transcription factor 15 [Source:NCBI gene;Acc:101172734])

HSP 1 Score: 67.3958 bits (163), Expect = 1.843e-13
Identity = 38/81 (46.91%), Postives = 50/81 (61.73%), Query Frame = 3
Query:  312 SGFSSKYRNRNKTRRGQKLVF--QRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKT 548
             G S K R  ++   G   V   QR AAN RER R QS+N AF  LR  IPT P +++LSK++TLRLA  YI+ L +++ T
Sbjct:   40 CGSSEKRRRASRKLEGDTAVVIKQRSAANARERGRTQSVNTAFTALRTLIPTEPVDRKLSKIETLRLASSYISHLANVLLT 120          
BLAST of ptf-4 protein vs. Planmine SMEST
Match: SMESG000079648.1 (SMESG000079648.1)

HSP 1 Score: 484.182 bits (1245), Expect = 5.090e-176
Identity = 235/235 (100.00%), Postives = 235/235 (100.00%), Query Frame = 3
Query:   69 MDCAALAIRHNSYYNQISGAVGYSPLRLITVPLSNWKSEMPDGALEMEDELSIVDDSNSEKSNPASVLPSPTTSPDIGKLGSGFSSKYRNRNKTRRGQKLVFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTESRIDHYDNDRDEPHSKKIILTSRTVTSEKGKDDKEILIVTTHSLSWRNIREPKIGPNNTLAAKIWRPEILLTNT 773
            MDCAALAIRHNSYYNQISGAVGYSPLRLITVPLSNWKSEMPDGALEMEDELSIVDDSNSEKSNPASVLPSPTTSPDIGKLGSGFSSKYRNRNKTRRGQKLVFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTESRIDHYDNDRDEPHSKKIILTSRTVTSEKGKDDKEILIVTTHSLSWRNIREPKIGPNNTLAAKIWRPEILLTNT
Sbjct:    1 MDCAALAIRHNSYYNQISGAVGYSPLRLITVPLSNWKSEMPDGALEMEDELSIVDDSNSEKSNPASVLPSPTTSPDIGKLGSGFSSKYRNRNKTRRGQKLVFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTESRIDHYDNDRDEPHSKKIILTSRTVTSEKGKDDKEILIVTTHSLSWRNIREPKIGPNNTLAAKIWRPEILLTNT 235          
BLAST of ptf-4 protein vs. Planmine SMEST
Match: SMESG000000956.1 (SMESG000000956.1)

HSP 1 Score: 143.28 bits (360), Expect = 1.527e-41
Identity = 74/143 (51.75%), Postives = 97/143 (67.83%), Query Frame = 3
Query:  345 KTRRGQKLVFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTES-RIDHYDNDRDEPHSKKIILTSRTVTSEKGKDDKEIL--IVTTHSLSWRNIREPKIGPNNTLAAKIWRPEILL 764
            K R  Q+ + +RQAAN+RERRRMQSINEAFEGLR HIPT+PYEKRLSKVDTLRLAI YI FLQ+L+K++   ++  D   +   S +  +  + + S K  + K+    ++  HSLSWRN REP      T  A+IW PE++L
Sbjct:   93 KNRNYQRKLAERQAANIRERRRMQSINEAFEGLRCHIPTMPYEKRLSKVDTLRLAISYIGFLQELIKSDCGSLEPIDCSGNAIRSAECSIEQKIILSLKHHNSKDFRADVICGHSLSWRNDREPTNIFKRTFKAEIWTPEVVL 235          
BLAST of ptf-4 protein vs. Planmine SMEST
Match: SMESG000044960.1 (SMESG000044960.1)

HSP 1 Score: 105.145 bits (261), Expect = 1.338e-27
Identity = 47/64 (73.44%), Postives = 57/64 (89.06%), Query Frame = 3
Query:  360 QKLVFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLVKTE 551
            +KL  QRQAAN+RER+RMQSIN+AFE LR HIPT+PYEKRLSKVDTLR+AIGYINFL  +++ +
Sbjct:   42 EKLARQRQAANMRERKRMQSINDAFEKLRVHIPTMPYEKRLSKVDTLRMAIGYINFLGGIMQVD 105          
BLAST of ptf-4 protein vs. Planmine SMEST
Match: SMESG000029000.1 (SMESG000029000.1)

HSP 1 Score: 84.3445 bits (207), Expect = 2.116e-19
Identity = 51/110 (46.36%), Postives = 73/110 (66.36%), Query Frame = 3
Query:  222 SIVDDSNSEKSNPASVLPSPTTSPDIGKL-GSGFSSKYRN-RNKTRRGQ-KLVFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLV 542
            ++++D+NS  S+ +S      TSPD   +  S  +    N  NK +R +   V QR+AAN+RERRRM S+NEAF+ LR  +PT  YEKRLS+++TLRLAI YI F+ +L+
Sbjct:   87 AVMNDNNSRFSSASSEF---YTSPDNKIIIQSNIAENSPNPSNKPKRKRISTVAQRRAANIRERRRMYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELL 193          
BLAST of ptf-4 protein vs. Planmine SMEST
Match: SMESG000029000.1 (SMESG000029000.1)

HSP 1 Score: 84.3445 bits (207), Expect = 2.287e-19
Identity = 51/110 (46.36%), Postives = 73/110 (66.36%), Query Frame = 3
Query:  222 SIVDDSNSEKSNPASVLPSPTTSPDIGKL-GSGFSSKYRN-RNKTRRGQ-KLVFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGYINFLQDLV 542
            ++++D+NS  S+ +S      TSPD   +  S  +    N  NK +R +   V QR+AAN+RERRRM S+NEAF+ LR  +PT  YEKRLS+++TLRLAI YI F+ +L+
Sbjct:   94 AVMNDNNSRFSSASSEF---YTSPDNKIIIQSNIAENSPNPSNKPKRKRISTVAQRRAANIRERRRMYSLNEAFDSLRKRVPTFAYEKRLSRIETLRLAITYICFMTELL 200          
The following BLAST results are available for this feature:
BLAST of ptf-4 protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PTF1A2.740e-3150.00pancreas associated transcription factor 1a [Sourc... [more]
FERD3L8.340e-1860.34Fer3 like bHLH transcription factor [Source:HGNC S... [more]
TWIST14.136e-1353.13twist family bHLH transcription factor 1 [Source:H... [more]
TWIST25.893e-1351.39twist family bHLH transcription factor 2 [Source:H... [more]
TWIST25.893e-1351.39twist family bHLH transcription factor 2 [Source:H... [more]
back to top
BLAST of ptf-4 protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hlh-134.510e-2046.39Helix-loop-helix protein 13 [Source:UniProtKB/Swi... [more]
hlh-151.334e-1245.21Helix Loop Helix [Source:UniProtKB/TrEMBL;Acc:Q18... [more]
lin-322.658e-1137.62pep chromosome:WBcel235:X:2229208:2230122:-1 gene:... [more]
hlh-62.897e-1053.70Helix-loop-helix protein 6 [Source:UniProtKB/Swis... [more]
hlh-83.441e-1045.31Twist-related protein [Source:UniProtKB/Swiss-Pro... [more]
back to top
BLAST of ptf-4 protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fer11.375e-3651.23gene:FBgn0037475 transcript:FBtr0081567[more]
Fer14.270e-3449.70gene:FBgn0037475 transcript:FBtr0334670[more]
Fer22.191e-2065.57gene:FBgn0038402 transcript:FBtr0301709[more]
Fer22.247e-2065.57gene:FBgn0038402 transcript:FBtr0344012[more]
Fer21.332e-1960.61gene:FBgn0038402 transcript:FBtr0344010[more]
back to top
BLAST of ptf-4 protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptf1a2.456e-3450.68pancreas associated transcription factor 1a [Sourc... [more]
si:dkey-34f9.31.284e-2169.64si:dkey-34f9.3 [Source:ZFIN;Acc:ZDB-GENE-081104-41... [more]
ferd3l1.397e-1963.16Fer3-like bHLH transcription factor [Source:ZFIN;A... [more]
twist1b5.367e-1453.13twist family bHLH transcription factor 1b [Source:... [more]
twist1b1.202e-1353.13twist family bHLH transcription factor 1b [Source:... [more]
back to top
BLAST of ptf-4 protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PTF1A4.347e-3449.32pancreas associated transcription factor 1a [Sourc... [more]
ENSXETT00000031930.11.340e-2152.38pep primary_assembly:Xenopus_tropicalis_v9.1:9:556... [more]
ferd3l2.495e-1861.40Fer3-like bHLH transcription factor [Source:NCBI g... [more]
tcf151.975e-1455.74transcription factor 15 [Source:NCBI gene;Acc:5492... [more]
hnrnpc3.591e-1455.74heterogeneous nuclear ribonucleoprotein C (C1/C2) ... [more]
back to top
BLAST of ptf-4 protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ptf1a2.003e-3249.30pancreas specific transcription factor, 1a [Source... [more]
Ferd3l7.448e-1859.32Fer3 like bHLH transcription factor [Source:MGI Sy... [more]
Tcf153.472e-1355.93transcription factor 15 [Source:MGI Symbol;Acc:MGI... [more]
Twist24.046e-1351.39twist basic helix-loop-helix transcription factor ... [more]
Twist24.046e-1351.39twist basic helix-loop-helix transcription factor ... [more]
back to top
BLAST of ptf-4 protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q4ZHW1|PTF1A_XENLA1.176e-3348.65Pancreas transcription factor 1 subunit alpha OS=X... [more]
sp|Q7ZSX3|PTF1A_DANRE1.854e-3350.68Pancreas transcription factor 1 subunit alpha OS=D... [more]
sp|Q64305|PTF1A_RAT9.382e-3249.30Pancreas transcription factor 1 subunit alpha OS=R... [more]
sp|Q9QX98|PTF1A_MOUSE1.401e-3149.30Pancreas transcription factor 1 subunit alpha OS=M... [more]
sp|Q7RTS3|PTF1A_HUMAN1.316e-3050.00Pancreas transcription factor 1 subunit alpha OS=H... [more]
back to top
BLAST of ptf-4 protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
U5YTB44.932e-150100.00Ptf-4 protein (Fragment) OS=Schmidtea mediterranea... [more]
K1Q6J01.064e-3851.66Pancreas transcription factor 1 subunit alpha OS=C... [more]
U5YQ651.712e-3851.75Ptf-2 protein (Fragment) OS=Schmidtea mediterranea... [more]
V4CI152.726e-3653.85BHLH domain-containing protein (Fragment) OS=Lotti... [more]
A0A1S3I0M32.999e-3652.38pancreas transcription factor 1 subunit alpha OS=L... [more]
back to top
BLAST of ptf-4 protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptf1a4.040e-3555.91pancreas associated transcription factor 1a [Sourc... [more]
si:dkey-34f9.34.727e-2167.24neurogenic differentiation factor 1-like [Source:N... [more]
ferd3l6.648e-2065.45Fer3-like bHLH transcription factor [Source:ZFIN;A... [more]
tcf151.272e-1547.67transcription factor 15 [Source:NCBI gene;Acc:1030... [more]
twist25.653e-1445.45twist2 [Source:ZFIN;Acc:ZDB-GENE-980526-235][more]
back to top
BLAST of ptf-4 protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004072.11.174e-3151.88pep scaffold:Pmarinus_7.0:GL492732:1750:4325:-1 ge... [more]
si:dkey-34f9.38.127e-2464.62si:dkey-34f9.3 [Source:ZFIN;Acc:ZDB-GENE-081104-41... [more]
TWIST15.617e-1453.73twist family bHLH transcription factor 1 [Source:H... [more]
TWIST19.020e-1452.24twist family bHLH transcription factor 1 [Source:H... [more]
TWIST11.740e-1352.24twist family bHLH transcription factor 1 [Source:H... [more]
back to top
BLAST of ptf-4 protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ptf-4 protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO438491.376e-2982.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
TWIST5.471e-1556.72Predicted protein; Twist family bHLH transcription... [more]
EDO429247.259e-1455.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO429071.882e-1153.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO408125.284e-1152.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ptf-4 protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptf1a6.485e-3555.38pancreas associated transcription factor 1a [Sourc... [more]
ferd3l2.657e-2161.76Fer3 like bHLH transcription factor [Source:NCBI g... [more]
si:dkey-34f9.38.107e-2169.64si:dkey-34f9.3 [Source:ZFIN;Acc:ZDB-GENE-081104-41... [more]
twist11.550e-1353.13twist family bHLH transcription factor 1 [Source:N... [more]
tcf151.843e-1346.91transcription factor 15 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of ptf-4 protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000079648.15.090e-176100.00SMESG000079648.1[more]
SMESG000000956.11.527e-4151.75SMESG000000956.1[more]
SMESG000044960.11.338e-2773.44SMESG000044960.1[more]
SMESG000029000.12.116e-1946.36SMESG000029000.1[more]
SMESG000029000.12.287e-1946.36SMESG000029000.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30005182
GenBankAGZ94919.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005182 ID=SMED30005182|Name=ptf-4 protein|organism=Schmidtea mediterranea sexual|type=transcript|length=777bp
TCGAGACATATTTTTTTCCTCCCAAAGGAATTCTTATAAATTAAAAAATT
TGCCTTTCTTAAAATCTGATGGATTGTGCAGCACTTGCGATTCGTCATAA
CAGTTACTACAATCAAATTTCAGGAGCCGTCGGATATTCACCACTGAGAC
TCATCACTGTTCCGTTGTCAAATTGGAAATCAGAAATGCCAGACGGAGCG
CTTGAAATGGAAGATGAATTGTCGATTGTTGACGATTCCAACAGTGAAAA
ATCCAATCCGGCTTCCGTTTTGCCCTCTCCGACAACTTCTCCAGACATTG
GAAAGCTTGGATCAGGATTTTCCAGCAAATACAGAAATCGAAATAAAACC
CGAAGAGGCCAAAAGTTGGTCTTCCAAAGACAAGCCGCAAACCTAAGAGA
AAGACGACGAATGCAATCAATAAACGAAGCCTTTGAAGGTCTTAGAGCTC
ATATTCCAACTCTTCCTTACGAGAAGCGATTGTCAAAAGTTGACACTTTA
AGATTGGCGATTGGATATATAAACTTTCTACAAGACCTTGTGAAAACCGA
ATCCAGAATTGACCATTACGACAATGATCGGGATGAACCTCATTCAAAAA
AGATCATTTTGACATCAAGAACAGTAACCTCAGAAAAAGGAAAAGATGAC
AAAGAAATCTTAATCGTAACTACTCACAGTTTAAGCTGGAGGAATATCAG
GGAACCGAAAATCGGTCCAAATAATACATTGGCAGCGAAAATTTGGCGGC
CAGAAATTCTTCTAACCAACACCTGAA
back to top

protein sequence of SMED30005182-orf-1

>SMED30005182-orf-1 ID=SMED30005182-orf-1|Name=SMED30005182-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=236bp
MDCAALAIRHNSYYNQISGAVGYSPLRLITVPLSNWKSEMPDGALEMEDE
LSIVDDSNSEKSNPASVLPSPTTSPDIGKLGSGFSSKYRNRNKTRRGQKL
VFQRQAANLRERRRMQSINEAFEGLRAHIPTLPYEKRLSKVDTLRLAIGY
INFLQDLVKTESRIDHYDNDRDEPHSKKIILTSRTVTSEKGKDDKEILIV
TTHSLSWRNIREPKIGPNNTLAAKIWRPEILLTNT*
back to top
Aliases
The feature 'ptf-4 protein' has the following synonyms
Synonym
ptf-4
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000120progenitor cell
PLANA:0000121stem cell
PLANA:0000418head
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR036638HLH_DNA-bd_sf
IPR011598bHLH_dom
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainSMARTSM00353finuluscoord: 108..160
e-value: 1.7E-20
score: 84.1
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainPFAMPF00010HLHcoord: 103..155
e-value: 6.3E-20
score: 70.9
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainPROSITEPS50888BHLHcoord: 102..154
score: 17.371
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainCDDcd00083HLHcoord: 103..159
e-value: 1.40942E-19
score: 77.2543
IPR036638Helix-loop-helix DNA-binding domain superfamilyGENE3DG3DSA:4.10.280.10coord: 101..165
e-value: 1.7E-25
score: 90.3
IPR036638Helix-loop-helix DNA-binding domain superfamilySUPERFAMILYSSF47459HLH, helix-loop-helix DNA-binding domaincoord: 103..160
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 57..88
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 56..93
NoneNo IPR availablePANTHERPTHR23349:SF59PANCREAS TRANSCRIPTION FACTOR 1 SUBUNIT ALPHAcoord: 77..215
NoneNo IPR availablePANTHERPTHR23349BASIC HELIX-LOOP-HELIX TRANSCRIPTION FACTOR, TWISTcoord: 77..215