Neuronal acetylcholine receptor subunit alpha 4

Overview
NameNeuronal acetylcholine receptor subunit alpha 4
Smed IDSMED30005173
Length (bp)1989
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Neuronal acetylcholine receptor subunit alpha 4 (SMED30005173) t-SNE clustered cells

Violin plots show distribution of expression levels for Neuronal acetylcholine receptor subunit alpha 4 (SMED30005173) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Neuronal acetylcholine receptor subunit alpha 4 (SMED30005173) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Neuronal acetylcholine receptor subunit alpha 4 (SMED30005173) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005173

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30005173SMESG000073518.1 SmedASXL_012982SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30005173SMESG000073518.1 dd_Smed_v4_10322_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30005173SMESG000073518.1 dd_Smed_v4_10322_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30005173SMESG000073518.1 dd_Smed_v4_10322_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30005173SMESG000073518.1 dd_Smed_v6_10322_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30005173SMESG000073518.1 OX_Smed_1.0.06260ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Human
Match: CHRNB3 (cholinergic receptor nicotinic beta 3 subunit [Source:HGNC Symbol;Acc:HGNC:1963])

HSP 1 Score: 187.578 bits (475), Expect = 5.689e-52
Identity = 123/362 (33.98%), Postives = 196/362 (54.14%), Query Frame = 3
Query:  111 NADDEFLSKKSVEKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRK-GPMPNYIRKIMIDNIGRLL 1193
            +A   F S    E  LL+ L + Y+ +    RPV  S + I+V +GL + Q++ +D   Q++ TN W +  W D  L W+P DY GI  I++  + +W+PDI LF  AD R +     +V+V ++G+++W P A +KSSC++++++FPFD Q C M FGSWTYD + ++L      N++   VD K +  N EW            +   K +K        N  DG      ++  + Y   LRR P FY   LIIPC+ LS L  +VF+LP++   KL L  ++ V+  + LL+++  IP++ K  PLIG +    MI +TLS  +   VIN + R      PM  +++++ +  + +LL
Sbjct:   17 SATTGFNSIAENEDALLRHLFQGYQKWV---RPVLHSNDTIKVYFGLKISQLVDVDEKNQLMTTNVWLKQEWTDHKLRWNPDDYGGIHSIKVPSESLWLPDIVLFENADGRFEGSLMTKVIVKSNGTVVWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTMVDLI---LINEN---VDRKDFFDNGEW-----------EILNAKGMKG-------NRRDG----VYSYPFITYSFVLRRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIVTVFVINVHHRSSSTYHPMAPWVKRLFLQKLPKLL 347          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Human
Match: CHRNA4 (cholinergic receptor nicotinic alpha 4 subunit [Source:HGNC Symbol;Acc:HGNC:1958])

HSP 1 Score: 191.045 bits (484), Expect = 9.177e-52
Identity = 119/359 (33.15%), Postives = 190/359 (52.92%), Query Frame = 3
Query:  132 SKKSVEKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWH-TDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQ 1205
            ++   E+ LL+KL   Y  +    RPV +  + + V +GL++ Q++ +D   Q++ TN W +  WHD  L WDP DY+ +  IR+  + +W PDI L+N AD    V    +  + +DG + W P A++KSSCS+++++FPFD Q C M FGSWTYD ++++L       +    VD   +  + EW   D     N        +I       Y +IT              Y   +RR P FY   LIIPC+L+S L  +VF+LP+E   K+ L +++ ++  + LLL+   IP+     PLIG +    MI +TLS  +   V+N + R  R   MP ++R++ +D + RLL + +
Sbjct:   32 TRAHAEERLLKKLFSGYNKWS---RPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPADYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAHLFHDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDL------VNMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEI-------YPDIT--------------YAFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPTWVRRVFLDIVPRLLLMKR 360          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Human
Match: CHRNA9 (cholinergic receptor nicotinic alpha 9 subunit [Source:HGNC Symbol;Acc:HGNC:14079])

HSP 1 Score: 185.267 bits (469), Expect = 7.496e-51
Identity = 125/378 (33.07%), Postives = 191/378 (50.53%), Query Frame = 3
Query:   72 CKNFVFIYAFVFINADDEFLSKKSVEKNLLQKLMKS-YEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKE-KNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFV 1199
            C +F +IY      A     + ++ +    QKL    +E Y    RPV D+   + V   + L QI  +D   QIL    W R  WHD  L WD   YDG+D IR+  D +W PDI L+N AD+         VV+  DG I W   A+ KSSC V+++YFPFD Q C + FGSWTY+ +Q+++       ++L   D   +I + EW   G    KN+       +        Y ++T              + + L+R  SFY+  L+IPC+L+S L  + F+LP  S  K+ LG+ I +A  +  L++   +P A +  PLIG ++   M +IT ST L  +V+N +  G    P+P++ R +++  + R+LFV
Sbjct:    7 CISFCWIYF-----AASRLRAAETADGKYAQKLFNDLFEDYSNALRPVEDTDKVLNVTLQITLSQIKDMDERNQILTAYLWIRQIWHDAYLTWDRDQYDGLDSIRIPSDLVWRPDIVLYNKADDESSEPVNTNVVLRYDGLITWDAPAITKSSCVVDVTYFPFDNQQCNLTFGSWTYNGNQVDIF------NALDSGDLSDFIEDVEWEVHGMPAVKNVISYGCCSE-------PYPDVT--------------FTLLLKRRSSFYIVNLLIPCVLISFLAPLSFYLPAASGEKVSLGVTILLAMTVFQLMVAEIMP-ASENVPLIGKYYIATMALITASTALTIMVMNIHFCGAEARPVPHWARVVILKYMSRVLFV 351          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Human
Match: CHRNA6 (cholinergic receptor nicotinic alpha 6 subunit [Source:HGNC Symbol;Acc:HGNC:15963])

HSP 1 Score: 184.111 bits (466), Expect = 2.735e-50
Identity = 112/354 (31.64%), Postives = 189/354 (53.39%), Query Frame = 3
Query:  141 SVEKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWH-TDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFV 1199
            + E+ L  KL   Y  +    RPV +  + + V++ +A+ Q+  +D   QI+ TN W R+ W+D  L WDP +YDGI+ +R+  D +W PDI L+N A    +V  + + ++  +G I W P A+FKSSC ++I++FPFD Q C + FGSWTYD ++++L   G        VD   +  N+EW   D    K+    +  ++I       Y +IT              Y   +RR P FY   LIIPC+ +S L  +VF+LP++   K+ L +++ ++  + LL++  +IP+     PL+G +    MI +TLS  +   V+N + R      MP +++ + +  + ++L +
Sbjct:   32 ATEERLFHKLFSHYNQFI---RPVENVSDPVTVHFEVAITQLANVDEVNQIMETNLWLRHIWNDYKLRWDPMEYDGIETLRVPADKIWKPDIVLYNNAVGDFQVEGKTKALLKYNGMITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWTYDKAEIDLLIIG------SKVDMNDFWENSEWEIIDASGYKHDIKYNCCEEI-------YTDIT--------------YSFYIRRLPMFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVVPLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPTTHTMPRWVKTVFLKLLPQVLLM 355          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Human
Match: CHRNA5 (cholinergic receptor nicotinic alpha 5 subunit [Source:HGNC Symbol;Acc:HGNC:1959])

HSP 1 Score: 181.8 bits (460), Expect = 1.005e-49
Identity = 120/350 (34.29%), Postives = 185/350 (52.86%), Query Frame = 3
Query:  147 EKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRK-GPMPNYIRKIMIDNIGRLL 1193
            E +LL+ L + YE +    RPV    +KI++ +GLA+ Q++ +D   Q++ TN W +  W D  L W+P DY GI  IR+  D +W PDI LF+ AD R +     + V+  +G++ W P A +KSSC++++++FPFD+Q C M FGSWTYD SQ+++       D    VD + +  N EW         I     +K  ++     Y  +T              Y   ++R P FY   LIIPCI LS L  +VF+LP+    K+ L  ++ V+  + LL+++  IP++ K  PLIG +    MI +TLS  +    IN + R       M   +RKI +  + +LL
Sbjct:   47 EDSLLKDLFQDYERWV---RPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTPDIVLFDNADGRFE-GTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFDLQNCSMKFGSWTYDGSQVDI----ILEDQ--DVDKRDFFDNGEWE--------IVSATGSKGNRTDSCCWYPYVT--------------YSFVIKRLPLFYTLFLIIPCIGLSFLTVLVFYLPSNEGEKICLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLVFTMIFVTLSIMVTVFAINIHHRSSSTHNAMAPLVRKIFLHTLPKLL 364          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Celegans
Match: acr-3 (Acetylcholine receptor subunit beta-type acr-3 [Source:UniProtKB/Swiss-Prot;Acc:Q93149])

HSP 1 Score: 182.956 bits (463), Expect = 1.984e-50
Identity = 118/356 (33.15%), Postives = 188/356 (52.81%), Query Frame = 3
Query:  141 SVEKNLLQKLMKSYEFYGVNG--RPV-NDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFV 1199
            S E+ LL     SY F G N   RPV N S   I V + LA V ++ +D   QI++TN W    W+D  + WDP+++DGI  IR+  D +W+PDI LFN AD    V   + VVV + G +LWVP A++KSSC +++ +FPFD Q+C + FGSWT+   +L+L           Y+  K ++  N++   G                        ++ D   ++      + Y+I++RR   FY  ILI+P +L++ L  +VF+LP ES  K+ L ++I +A  + LL++   +P      PL+  +  +  IM  ++  +  I+IN Y RG     MPN+++ + +  +  +LFV
Sbjct:   24 SAEERLL-----SYIFDGYNSLIRPVLNASSPPIEVFFSLAFVLLINVDEKNQIMQTNVWPTMKWNDYQMQWDPREFDGIKTIRVPPDKVWLPDIVLFNNADGNYLVSFYSNVVVEHTGDMLWVPPAVYKSSCLIDVEFFPFDEQVCSLTFGSWTFRKDELQLS----------YLSGKRHVELNDYLPSG----------------------VWDLIDAPGLLIDERSKISYQIKIRRKALFYTVILIMPTVLMAFLSMMVFYLPAESSEKITLAISILLALVVFLLVVSKILPPTSSTIPLMAKYLLMTFIMNMITIMVSVIIINVYFRGPATHIMPNWVKTVFLKFLP-VLFV 341          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Celegans
Match: lev-1 (Acetylcholine receptor subunit beta-type lev-1 [Source:UniProtKB/Swiss-Prot;Acc:Q27218])

HSP 1 Score: 168.318 bits (425), Expect = 4.821e-45
Identity = 107/339 (31.56%), Postives = 179/339 (52.80%), Query Frame = 3
Query:  186 FYGVNG--RPV-NDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLL 1193
            F G N   +PV N S   + V  G+ LV ++ +D   Q++ TN W    W D  L WDP+DY  I QIR+  + +W+PDI LFN AD   +V     V++ + G++LWVP A++KSSC +++ +FPFD Q+C + FGSWTY+  +++L +      +   VDF  Y  ++ W                            ++ DG  ++      + ++IR+RR   FY  +LI+P +L++ L   VF+LPT S  K+ L MN+ ++  + LLL+   +P    + PL+  +  L  ++  ++  + TI+ N Y R      +P ++RK+ +D +  L+
Sbjct:   46 FRGYNSLVQPVRNRSELPMIVKIGMQLVLLINVDEKEQVMHTNVWLTMKWDDFQLKWDPRDYANITQIRVAPEKVWLPDIVLFNNADGNYEVSFMCNVLILSTGTVLWVPPAIYKSSCIIDVEFFPFDDQLCSLTFGSWTYNRDEIKLDFL-----TSDRVDFSEYSTSSIW----------------------------DMMDGPAVLTSDRSRIEFQIRIRRKTLFYTVVLILPTVLMAFLNVTVFYLPTASGEKMGLTMNVLLSIVVFLLLVSKILPPTSSSIPLVAKYLLLTFVLNIITIMVTTIICNIYFRSPITHRLPPWVRKVFLDILPLLM 351          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Celegans
Match: acr-11 (AcetylCholine Receptor [Source:UniProtKB/TrEMBL;Acc:P91197])

HSP 1 Score: 167.162 bits (422), Expect = 5.296e-45
Identity = 104/355 (29.30%), Postives = 173/355 (48.73%), Query Frame = 3
Query:  147 EKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRL--EKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQ 1205
            E  L   L+K Y       RPV +S   + V   L L QIL +D   QI+  N W  YTW D  L W+PK Y GI  IR     D++W PD+ L+N A E      ++ ++  + G+++W+P  + K  C +++++FPFD Q+C M FGSWT+    ++L      N +   +D   Y+ N EW       K +   ++                       + +  + Y + +RR   +Y F LIIP +L+SL+  + F  P ++  K+ L + I +A    L ++    P   +A PLIG FF   M++++ S     +V+N + R      M   +R+++++ +  LLF+S+
Sbjct:   26 ETKLFTDLLKGYNPLE---RPVQNSSQPLEVKIKLFLQQILDVDEKNQIVSVNAWLSYTWFDHKLQWEPKKYGGIQDIRFPGSSDHIWKPDVLLYNSAAEDFDSTFKSNLLTYHTGTVVWIPPGVLKFVCQLDVTWFPFDDQVCEMKFGSWTFHGYAIDLQIDDDTNGT-QSMDLSTYLVNGEWQVISTNAKRVVSYYKC--------------------CPEPYPTVNYYLHIRRRTLYYGFNLIIPSLLISLMAILGFMFPPDAGEKITLEVTILLAIVFFLSMVSEMTPPTSEAVPLIGVFFSCCMLVVSASVVFTIVVLNLHFRSADSHEMNPLVRRVLLEFLPWLLFMSR 356          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Celegans
Match: unc-38 (Acetylcholine receptor subunit alpha-type unc-38 [Source:UniProtKB/Swiss-Prot;Acc:Q23022])

HSP 1 Score: 164.851 bits (416), Expect = 9.669e-44
Identity = 104/343 (30.32%), Postives = 177/343 (51.60%), Query Frame = 3
Query:  189 YGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPY---VDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHV-LRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQ 1205
            Y  + RP       + +   L L QI+ +    QI+  + W + TW D  L+WDP +Y G++ + +  + +W+PDI L+N AD    +    +  +   G + W P A+FKS C +++ +FPFD Q C + FGSWT+  + L +        SL Y   +D K  I N     DG    ++S  + + +   +  +  +   +      ++ ++ + Y ++LRR P FY   L+ PC+ +S L  +VF+LP++S  K+ L ++I VA  I  LLL   IP      PLIG +    M+M+TLS  +  I +N + R      MPN+++K+ +  + +LLF+ +
Sbjct:   38 YNRHRRPSTSPNKPLTIKLKLRLSQIIDVHEIDQIMTCSVWLKQTWIDRKLSWDPVNYGGVNVLYVPYEMIWVPDIVLYNNADSNYNITISTKATLHYTGEVTWEPPAIFKSMCQIDVRWFPFDEQQCHLKFGSWTFSENLLSVE---LNEPSLRYEEEIDEKGIIDNVTVAEDG---IDLSDYYPSVEWDIMSRVAKRRAKNYPSCCPQSAYIDVTYYLQLRRKPLFYTVNLVFPCVGISFLTILVFYLPSDSGEKVTLCISILVALTIFFLLLTEIIPATSITLPLIGKYLLFTMVMVTLSVVVTVISLNLHFRTPTTHLMPNWVKKVFLKWLPKLLFMRR 374          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Celegans
Match: acr-8 (AcetylCholine Receptor [Source:UniProtKB/TrEMBL;Acc:Q23355])

HSP 1 Score: 163.31 bits (412), Expect = 5.366e-43
Identity = 105/375 (28.00%), Postives = 190/375 (50.67%), Query Frame = 3
Query:   84 VFIYAFVFINADDEFLSKKSVEKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQ--IKSLRFLRYQNITDGDEIIQKTFHV-LRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFV 1199
            +F+YA +F   +    + +  E  L         +Y  N RP+ ++   ++V +G +L++I+ +D   Q+L TN W    W D  L WDP  +  I ++ +  D +W+PDI L+N AD    +   +  +V  +G ++W P +++KS CS++I YFP+D Q C M FG WTY+   L++         LP  ++   +   +         +IS   R+ +  +  L   R++ I  G     + F++ + ++I +RR   FY   L+IPC + ++L +IVF++P     K+   ++I V   +  L+L   +P      PLIG +    M ++++S  L  I +NFY R     PMP++++ + I  + R + +
Sbjct:    9 IFVYAGLFFYVNPNRYADQMYEDLLY--------YYNKNVRPIKNASESVKVKFGSSLIRIIDVDEVNQVLTTNLWLEMQWFDYRLMWDPGRWGKIRKLHVPVDQIWIPDILLYNNADGEPHITIMSDAIVYYNGLVVWKPPSIYKSFCSIDIEYFPYDTQTCWMKFGGWTYNGFLLDVR-------QLPVEEWTLVVTTRKLQVCAHAS-SISFFFRSLEWDLMELNSARHEKIYAG--CCGQDFYIDITFKIEIRRKTLFYTINLMIPCTMFAILTSIVFYVPPIE-HKMTFSISILVTLTVFYLILIDLVPPTSLVIPLIGKYLLFTMFLVSISIMLSVISLNFYRRDGSSFPMPHWMKVVFIHTLPRYICI 364          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Fly
Match: nAChRbeta1 (gene:FBgn0000038 transcript:FBtr0073299)

HSP 1 Score: 199.134 bits (505), Expect = 8.112e-56
Identity = 128/380 (33.68%), Postives = 199/380 (52.37%), Query Frame = 3
Query:   66 ILCKNFVFIYAFVFINADDEFLSKKSVEKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQ 1205
            +LC   V + AF  ++A ++       E+ L++ L + Y       RPV +   K+ V +GLA VQ++ ++   QI+++N W R  W+D  L WD  DY GI  +RL  D +W PDI LFN AD   +V  ++ V++   G +LWVP A+++SSC+++++YFPFD Q C M FGSWT++  Q+ L  Y   N    +VD   Y  +  W                     +    Y N+ +GD     T   + + I +RR   FY   LI+P +L+S L  +VF+LP E+  K+ LG++I ++  + LLL+   +P      PLI  +     IM T+S  +  I+IN+  RG R   MP YIR I +  +   LF+ +
Sbjct:    9 LLCSILVLV-AFSLVSASED-------EERLVRDLFRGYNKLI---RPVQNMTQKVGVRFGLAFVQLINVNEKNQIMKSNVWLRLVWYDYQLQWDEADYGGIGVLRLPPDKVWKPDIVLFNNADGNYEVRYKSNVLIYPTGEVLWVPPAIYQSSCTIDVTYFPFDQQTCIMKFGSWTFNGDQVSLALYNNKN----FVDLSDYWKSGTWDI-------------------IEVPAYLNVYEGDS-NHPTETDITFYIIIRRKTLFYTVNLILPTVLISFLCVLVFYLPAEAGEKVTLGISILLSLVVFLLLVSKILPPTSLVLPLIAKYLLFTFIMNTVSILVTVIIINWNFRGPRTHRMPMYIRSIFLHYLPAFLFMKR 353          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Fly
Match: nAChRalpha5 (gene:FBgn0028875 transcript:FBtr0474155)

HSP 1 Score: 186.422 bits (472), Expect = 1.426e-49
Identity = 157/577 (27.21%), Postives = 258/577 (44.71%), Query Frame = 3
Query:   87 FIYAFVFINADDEFLSKKSVEKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQFIXXXXXXXXNNCNVYITQSPAGKIQHKLYVPELTCNKFMATDIPNIEETSTSQDLSNRNNINKPYSKNFISADKNLNQKYSRNNGHRSHNQKPNSEINNLP-NPGV-----SNSHDSPIMICGGT-------------SSIEKDVIEITRYVRKYIGKQKEAQRKNQLTMEWRTLGLVLDRL-FCIFYMATIV--IAVIIGIP 1751
            +I+  +++N   +       EK LL  L+  Y       RPV +  + +++++GL L+QI+ +D   Q+L TN W +  W+D  L W+  DY G+  +R+    +W PD+ ++N ADE      +  VVV N+GS L+VP  +FKS+C ++I++FPFD Q C M FGSWTYD  QL+L             D  +Y+ N EW   G   K              R   Y N    +  I  TF ++     +RR   +Y F LIIPC+L++ +  + F LP +S  KL LG+ I ++  + L ++  ++P    A PL+G++F   M M+  S     +++N++ R      M  +IR + +  +  +L +S+                    P   +   L  P   C     +D  +  +     D+  +   +K    N +  D +             HN +P +    LP NP           D  I   G T             SS E ++  I + +R    + ++    N +  +W+   +V+DRL   IF M TI+  IAV++  P
Sbjct:  293 WIFLLIYLNLSAKVCLAGYHEKRLLHDLLDPYNTLE---RPVLNESDPLQLSFGLTLMQIIDVDEKNQLLVTNVWLKLEWNDMNLRWNTSDYGGVKDLRIPPHRIWKPDVLMYNSADEGFDGTYQTNVVVRNNGSCLYVPPGIFKSTCKIDITWFPFDDQRCEMKFGSWTYDGFQLDLQLQDETGG-----DISSYVLNGEWELLGVPGK--------------RNEIYYNCCP-EPYIDITFAII-----IRRRTLYYFFNLIIPCVLIASMALLGFTLPPDSGEKLSLGVTILLSLTVFLNMVAETMPATSDAVPLLGTYFNCIMFMVASSVVSTILILNYHHRNADTHEMSEWIRIVFLCWLPWILRMSR--------------------PGRPL--ILEFPTTPC-----SDTSSERKHQILSDVELKERSSKSLLANVLDIDDDFR-----------HNCRPMTPGGTLPHNPAFYRTVYGQGDDGSIGPIGSTRMPDAVTHHTCIKSSTEYELGLILKEIRFITDQLRKDDECNDIANDWKFAAMVVDRLCLIIFTMFTILATIAVLLSAP 803          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Fly
Match: nAChRalpha5 (gene:FBgn0028875 transcript:FBtr0300594)

HSP 1 Score: 186.037 bits (471), Expect = 1.523e-49
Identity = 157/577 (27.21%), Postives = 258/577 (44.71%), Query Frame = 3
Query:   87 FIYAFVFINADDEFLSKKSVEKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQFIXXXXXXXXNNCNVYITQSPAGKIQHKLYVPELTCNKFMATDIPNIEETSTSQDLSNRNNINKPYSKNFISADKNLNQKYSRNNGHRSHNQKPNSEINNLP-NPGV-----SNSHDSPIMICGGT-------------SSIEKDVIEITRYVRKYIGKQKEAQRKNQLTMEWRTLGLVLDRL-FCIFYMATIV--IAVIIGIP 1751
            +I+  +++N   +       EK LL  L+  Y       RPV +  + +++++GL L+QI+ +D   Q+L TN W +  W+D  L W+  DY G+  +R+    +W PD+ ++N ADE      +  VVV N+GS L+VP  +FKS+C ++I++FPFD Q C M FGSWTYD  QL+L             D  +Y+ N EW   G   K              R   Y N    +  I  TF ++     +RR   +Y F LIIPC+L++ +  + F LP +S  KL LG+ I ++  + L ++  ++P    A PL+G++F   M M+  S     +++N++ R      M  +IR + +  +  +L +S+                    P   +   L  P   C     +D  +  +     D+  +   +K    N +  D +             HN +P +    LP NP           D  I   G T             SS E ++  I + +R    + ++    N +  +W+   +V+DRL   IF M TI+  IAV++  P
Sbjct:  293 WIFLLIYLNLSAKVCLAGYHEKRLLHDLLDPYNTLE---RPVLNESDPLQLSFGLTLMQIIDVDEKNQLLVTNVWLKLEWNDMNLRWNTSDYGGVKDLRIPPHRIWKPDVLMYNSADEGFDGTYQTNVVVRNNGSCLYVPPGIFKSTCKIDITWFPFDDQRCEMKFGSWTYDGFQLDLQLQDETGG-----DISSYVLNGEWELLGVPGK--------------RNEIYYNCC-PEPYIDITFAII-----IRRRTLYYFFNLIIPCVLIASMALLGFTLPPDSGEKLSLGVTILLSLTVFLNMVAETMPATSDAVPLLGTYFNCIMFMVASSVVSTILILNYHHRNADTHEMSEWIRIVFLCWLPWILRMSR--------------------PGRPL--ILEFPTTPC-----SDTSSERKHQILSDVELKERSSKSLLANVLDIDDDFR-----------HNCRPMTPGGTLPHNPAFYRTVYGQGDDGSIGPIGSTRMPDAVTHHTCIKSSTEYELGLILKEIRFITDQLRKDDECNDIANDWKFAAMVVDRLCLIIFTMFTILATIAVLLSAP 803          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Fly
Match: nAChRalpha5 (gene:FBgn0028875 transcript:FBtr0080594)

HSP 1 Score: 186.037 bits (471), Expect = 1.523e-49
Identity = 157/577 (27.21%), Postives = 258/577 (44.71%), Query Frame = 3
Query:   87 FIYAFVFINADDEFLSKKSVEKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQFIXXXXXXXXNNCNVYITQSPAGKIQHKLYVPELTCNKFMATDIPNIEETSTSQDLSNRNNINKPYSKNFISADKNLNQKYSRNNGHRSHNQKPNSEINNLP-NPGV-----SNSHDSPIMICGGT-------------SSIEKDVIEITRYVRKYIGKQKEAQRKNQLTMEWRTLGLVLDRL-FCIFYMATIV--IAVIIGIP 1751
            +I+  +++N   +       EK LL  L+  Y       RPV +  + +++++GL L+QI+ +D   Q+L TN W +  W+D  L W+  DY G+  +R+    +W PD+ ++N ADE      +  VVV N+GS L+VP  +FKS+C ++I++FPFD Q C M FGSWTYD  QL+L             D  +Y+ N EW   G   K              R   Y N    +  I  TF ++     +RR   +Y F LIIPC+L++ +  + F LP +S  KL LG+ I ++  + L ++  ++P    A PL+G++F   M M+  S     +++N++ R      M  +IR + +  +  +L +S+                    P   +   L  P   C     +D  +  +     D+  +   +K    N +  D +             HN +P +    LP NP           D  I   G T             SS E ++  I + +R    + ++    N +  +W+   +V+DRL   IF M TI+  IAV++  P
Sbjct:  293 WIFLLIYLNLSAKVCLAGYHEKRLLHDLLDPYNTLE---RPVLNESDPLQLSFGLTLMQIIDVDEKNQLLVTNVWLKLEWNDMNLRWNTSDYGGVKDLRIPPHRIWKPDVLMYNSADEGFDGTYQTNVVVRNNGSCLYVPPGIFKSTCKIDITWFPFDDQRCEMKFGSWTYDGFQLDLQLQDETGG-----DISSYVLNGEWELLGVPGK--------------RNEIYYNCC-PEPYIDITFAII-----IRRRTLYYFFNLIIPCVLIASMALLGFTLPPDSGEKLSLGVTILLSLTVFLNMVAETMPATSDAVPLLGTYFNCIMFMVASSVVSTILILNYHHRNADTHEMSEWIRIVFLCWLPWILRMSR--------------------PGRPL--ILEFPTTPC-----SDTSSERKHQILSDVELKERSSKSLLANVLDIDDDFR-----------HNCRPMTPGGTLPHNPAFYRTVYGQGDDGSIGPIGSTRMPDAVTHHTCIKSSTEYELGLILKEIRFITDQLRKDDECNDIANDWKFAAMVVDRLCLIIFTMFTILATIAVLLSAP 803          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Fly
Match: nAChRalpha5 (gene:FBgn0028875 transcript:FBtr0309867)

HSP 1 Score: 186.037 bits (471), Expect = 1.523e-49
Identity = 157/577 (27.21%), Postives = 258/577 (44.71%), Query Frame = 3
Query:   87 FIYAFVFINADDEFLSKKSVEKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQFIXXXXXXXXNNCNVYITQSPAGKIQHKLYVPELTCNKFMATDIPNIEETSTSQDLSNRNNINKPYSKNFISADKNLNQKYSRNNGHRSHNQKPNSEINNLP-NPGV-----SNSHDSPIMICGGT-------------SSIEKDVIEITRYVRKYIGKQKEAQRKNQLTMEWRTLGLVLDRL-FCIFYMATIV--IAVIIGIP 1751
            +I+  +++N   +       EK LL  L+  Y       RPV +  + +++++GL L+QI+ +D   Q+L TN W +  W+D  L W+  DY G+  +R+    +W PD+ ++N ADE      +  VVV N+GS L+VP  +FKS+C ++I++FPFD Q C M FGSWTYD  QL+L             D  +Y+ N EW   G   K              R   Y N    +  I  TF ++     +RR   +Y F LIIPC+L++ +  + F LP +S  KL LG+ I ++  + L ++  ++P    A PL+G++F   M M+  S     +++N++ R      M  +IR + +  +  +L +S+                    P   +   L  P   C     +D  +  +     D+  +   +K    N +  D +             HN +P +    LP NP           D  I   G T             SS E ++  I + +R    + ++    N +  +W+   +V+DRL   IF M TI+  IAV++  P
Sbjct:  293 WIFLLIYLNLSAKVCLAGYHEKRLLHDLLDPYNTLE---RPVLNESDPLQLSFGLTLMQIIDVDEKNQLLVTNVWLKLEWNDMNLRWNTSDYGGVKDLRIPPHRIWKPDVLMYNSADEGFDGTYQTNVVVRNNGSCLYVPPGIFKSTCKIDITWFPFDDQRCEMKFGSWTYDGFQLDLQLQDETGG-----DISSYVLNGEWELLGVPGK--------------RNEIYYNCC-PEPYIDITFAII-----IRRRTLYYFFNLIIPCVLIASMALLGFTLPPDSGEKLSLGVTILLSLTVFLNMVAETMPATSDAVPLLGTYFNCIMFMVASSVVSTILILNYHHRNADTHEMSEWIRIVFLCWLPWILRMSR--------------------PGRPL--ILEFPTTPC-----SDTSSERKHQILSDVELKERSSKSLLANVLDIDDDFR-----------HNCRPMTPGGTLPHNPAFYRTVYGQGDDGSIGPIGSTRMPDAVTHHTCIKSSTEYELGLILKEIRFITDQLRKDDECNDIANDWKFAAMVVDRLCLIIFTMFTILATIAVLLSAP 803          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Zebrafish
Match: CR847523.3 (neuronal acetylcholine receptor subunit alpha-10-like [Source:NCBI gene;Acc:101882637])

HSP 1 Score: 216.083 bits (549), Expect = 3.534e-62
Identity = 156/524 (29.77%), Postives = 251/524 (47.90%), Query Frame = 3
Query:  204 RPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQFIXXXXXXXXNNCNVYITQSPAGKIQHKLYVPELTCN-KFMATDIPNIEETSTSQDLSNRNNINKPYSKNFISADKNLNQKYSRNNGHRSHNQKPNSEINNLPNPGVSNSHDSP---------IMICGGTSSIEKDVIEITRYVRKYIGKQKEAQRKNQLTMEWRTLGLVLDRLFC-IFYMATIVIAVII 1742
            RPV D+ N I V   + L QI+ +D   QIL T  W R  W D  L W+  DYDG+D IR+   Y+W PD+ L+N AD++     E  VV+ +DG I+W   A+ KSSC V++S+FPFDVQ CR+ FGSWT++ +Q++LH      ++L   D   ++ N EW   G   K                + Y   +D    I  T H       L+R  SFY+F L+IPC+++S L  + F+LP +S  K+ LG+ + +A  +  LL+  S+P + +  PLIG ++   M MIT ST L   ++N +  G    P+P++ R+ +++ + R  FV             +C    T  PA K  +       T N +    D         SQ + ++ N +        S   +  Q+    +G R        EI +  + G +    +          I++       ++ ++    Y+  +  +QK  QR+N    EWR +  V+DR F  IF++   +++++I
Sbjct:   33 RPVEDTNNIINVTLQITLSQIIDMDERNQILTTYLWIRQVWFDAYLTWNTTDYDGLDTIRIPSSYVWRPDVVLYNNADDQFSSSMETNVVIRHDGQIMWDQPAITKSSCKVDVSFFPFDVQHCRLTFGSWTHNGNQMDLH------NALDSADLADFVENVEWEVQGMPAKK-------------NVILYGCCSDPYPDITYTLH-------LKRRASFYIFNLLIPCMMISFLAPLGFYLPADSGEKVSLGVTVLLALTVFQLLVAESMPPS-ENVPLIGKYYIATMTMITASTALTIFIMNIHHCGPEAQPVPSWARRFILNYLARFCFVYDM--------GQSCVSVHTDQPAKKGNN------CTINGQARGEDFALRLHEGCSQKVKDQFNEDA-------SPTLSPQQRKEHQSGWRIGT---FVEIEHGESAGATGETGASRKESVKKREILVESQCLCHQQALLRNVEYIANFYQEQKATQRRNA---EWRKVAKVMDRFFMWIFFIMVFLMSLLI 502          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Zebrafish
Match: chrnb3a (cholinergic receptor, nicotinic, beta polypeptide 3a [Source:ZFIN;Acc:ZDB-GENE-040108-1])

HSP 1 Score: 195.282 bits (495), Expect = 8.704e-55
Identity = 126/367 (34.33%), Postives = 196/367 (53.41%), Query Frame = 3
Query:   96 AFVFINADDEFLSKKSVEKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRK-GPMPNYIRKIMIDNIGRLL 1193
            A+  I A +EF+S   +E  LL+ L + Y+ +    RPV  + + I V +GL + Q++ +D   Q++ TN W    W D  L W+P+DY GI  IR+  + +W+PDI L+  AD R +     + +V  +G+I+W P A +KS+C++++++FPFD Q C M FGSWTYD + ++L           YVD K +  N EW            L+ T Q  S R        DG      ++  L Y   L+R P FY   LIIPC+ LS L  +VF+LP++   KL L  ++ V+  + LL+++  IP++ K  PLIG +    MI +T S  +   VIN + R      PM  +++ + +  + RLL
Sbjct:   15 AYATIEAPEEFVSLAEMEDTLLRNLFRGYQKWV---RPVLHANDTITVRFGLKISQLVDVDEKNQLMTTNVWLWEEWTDYKLRWNPEDYGGITSIRVPSETIWLPDIVLYENADGRFEGSLMTKAIVRFNGTIMWTPPASYKSACTMDVTFFPFDRQNCSMKFGSWTYDGTMVDLTLVD------AYVDRKDFFDNGEWEI----------LNATGQRGSRR--------DG----IYSYPYLTYSFILKRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTFSIIVTVFVINVHHRSSATYHPMAPWVKSLFLQRLPRLL 350          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Zebrafish
Match: CR388402.1 (cholinergic receptor, nicotinic, alpha 9 [Source:NCBI gene;Acc:568807])

HSP 1 Score: 196.052 bits (497), Expect = 1.601e-54
Identity = 157/574 (27.35%), Postives = 280/574 (48.78%), Query Frame = 3
Query:   81 FVFIYAFVFINADDEFLSKKSVEKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVH-REARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKE-KNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQFIXXXXXXXXNNCNVYITQSPAGKIQHKLYVPELTCNKFMATDIPNIEETSTSQ--DLSNRN--NINKPYSKN-FISADKNLNQKYSRNNGHRSHNQKP---------NSEINN---LPNPGVSNSHDSPIMICGGTSSIEKDVIEITRYVRKYIGKQKEAQRKNQLTMEWRTLGLVLDRLFC-IFYMATIVIAVII 1742
            F+ I+  + ++A   F ++    + LL  LM   E Y    RPV D+   + V   + L QI  +D   Q+L T  W R  WHD  L+WD ++YDG++ IR+  + +W PDI L+N ADE       +  VV+  +G I W   A+ KSSC V++SYFPFD Q C + FGSWTY+ +Q+++         +   D   ++ N EW   G    KN+              + Y   +D        +  + Y + L+R  SFY+F L++PC L+S L  + F+LP +S  K+ LG+ + +A  +  L++  S+P + ++ PLIG ++   M MIT ST L   ++N +  G    P+P++ + ++ID + ++ FV + +      P ++   + ++ P   ++   Y      +K    D  +++E   SQ    S+R+  + N  + KN      ++  Q+ +R++ +    QK          N  +N    L + G S +  +   +CG    + +++  I    R+  G Q +         EW+ +  V+DR F  +F++   ++++++
Sbjct:    5 FLVIHISLLLHA--VFSAQGRFAQKLLNDLM---EGYSNALRPVEDTDKALNVTLQITLSQIKDMDERNQVLTTYLWVRQIWHDAYLSWDKEEYDGLEVIRIPSNLVWRPDIVLYNNADEEDSSGPPDTNVVLRYNGEITWDSPAITKSSCKVDVSYFPFDSQECNLTFGSWTYNGNQVDIAM------GMESGDLSDFVDNVEWECHGMPAVKNV--------------IMYGCCSD-------PYPDITYTVLLKRRSSFYIFNLLLPCFLISFLAPLGFYLPADSGEKVSLGVTVLLALTVFQLMVAESMPPS-ESVPLIGKYYIATMTMITASTSLTIFIMNIHFCGAEAKPVPHWAKVLIIDYMSKIFFVYE-VGENCTTPESDRGPFFSEDPLASLERDGYF-----DKGFYEDC-HLDERIRSQFNGYSHRDHRHGNGYHHKNSSYRQHRHEQQRRTRSSSNSPVRQKKINGYTYDQGNGYLNGVGYLHDNGYSKTFGADRCVCGKHQKLVRNIEYIANCFREQRGHQAKGA-------EWKKVAKVMDRFFMWVFFIMVFLMSILV 531          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Zebrafish
Match: chrna3 (cholinergic receptor, nicotinic, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-070822-1])

HSP 1 Score: 194.897 bits (494), Expect = 4.390e-54
Identity = 141/535 (26.36%), Postives = 254/535 (47.48%), Query Frame = 3
Query:  147 EKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWH-TDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQFIXXXXXXXXNNCNVYITQSPAGKIQHKLYVPELTCNKFMATDIPNIEETSTSQDLSNRNNINKPYSKNFISADKNLNQKYSRNNGHRSHNQKPNSEINNLPNPGVSNSHDSPIMICGGTSSIE-KDVIEITRYVRKYIGKQKEAQRKNQLTMEWRTLGLVLDRLFCIFYMATIVIAVIIG 1745
            E  L   +  SY  Y    RPV +  + + V + +++ Q++ +D   QI+ TN W R+ W+D  L WDPKD+ G++ IR+  + +W PDI L+N A    +V  + + ++  +G + W+P A+FKSSC ++++YFPFD Q C M FGSWTYD ++++L   G        ++ K +  + EW   D    K+    +  ++I       Y +IT              Y + +RR P FY   +IIPC+L+S L  +VF+LP++   K+ L +++ ++  + LL++  +IP+     PLIG +    MI +TLS  +   V+N + R  +   MP ++R++ +  + R++F++                        + +    VP   C+                Q L     +N+     F+  + +  +K      H S+     +E    P    S+S      +C    S + ++ IE  +Y+ + +  Q EA+       +W+ + +V+DR+F    +   V+  I+G
Sbjct:   64 EHRLFSVIFSSYNQYI---RPVENVSDPVVVQFEVSMSQLVKVDEVNQIMETNLWLRHIWNDYKLRWDPKDFGGVEFIRVPSNKIWKPDIVLYNNAVGDFQVDDKTKALLRFNGDVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWTYDKAKIDLVLIG------STINLKDFWESGEWTIIDAPGYKHDIKYNCCEEI-------YTDIT--------------YSLYIRRLPLFYTINMIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPKTHTMPCWVRRVFLSLLPRVMFMT------------------------RPEKDQEVPAKQCSVHPPVSSKQTSVCRGPQLLLCPTELNEASRTAFLCREHHCWKK------HISNMTSEGAEDGGSP---CSSSESLDGFLCMSAVSPQVREAIESVKYIAENMRLQNEAKEVQD---DWKYVAMVIDRIF----LWVFVLVCILG 528          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Zebrafish
Match: chrna10a (cholinergic receptor, nicotinic, alpha 10a [Source:ZFIN;Acc:ZDB-GENE-060503-725])

HSP 1 Score: 193.741 bits (491), Expect = 1.238e-53
Identity = 150/546 (27.47%), Postives = 253/546 (46.34%), Query Frame = 3
Query:  162 QKLMKS-YEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQFIXXXXXXXXNNCNVYITQSPAGKIQHKLYVPELTCNKFMATDIPNI-------EETSTSQDLSNRNNINKPYSKNFISADKNLNQKYS--RNNGHRSHNQKPNSEINNLP---NPGVSNSHDSPIMICGGTSSIEKDVIEITRYVRKYIGKQKEAQRKNQLTMEWRTLGLVLDRLF------CIFYMATIVIAVII 1742
            QKL+   +  Y    RPV D+ + + V   + L QI+ +D   QIL    W R  W D+ L W+ ++YDG+D IR+   Y+W PDI L+N AD+      +  VV+ +DG I+W   A+ KSSC V++S+FPFD Q CR+ +GSWTY+ +QL++       +++   D    + N EW   G   K                + Y    D        +  + Y ++L+R  SFYVF L+IPC+++S L  + F+LP +S  K+ LG+ + +A  +  LL+   +P + +  PLIG ++   M MIT ST L   V+N +  G    P+P++ +K ++  + R+ FV +           NC     + P  + Q      +  CN        +        +E ++ + L +R ++++  S    S  K+   +Y   +     S +    +     P          HDS     G  S  + D   + R +       ++ +   + T EW+ +  VLDR F       +F+M+ +++   I
Sbjct:   31 QKLLNDLFNNYTSALRPVEDTEDILNVTLQITLSQIIDMDERNQILTAYLWIRQVWIDKYLTWNKENYDGLDTIRIPGSYVWRPDIVLYNSADDHFTSTMDTNVVIRHDGQIMWDAPAITKSSCKVDVSFFPFDAQQCRLTYGSWTYNGNQLDIL------NAMESADLADLVDNVEWEVLGMPAKR-------------NIILYGCCAD-------PYPDVTYTLKLKRRASFYVFNLLIPCVMISFLAPLGFYLPADSGEKVSLGVTVMLALTVFQLLVAEIMPPS-ENVPLIGKYYIATMTMITASTALTIFVMNIHHCGPDAKPVPDWAKKFILQYLARICFVYEV--------GENCMTPQPEKPDPQPQKP---QDCNCNMNGQAGKDDFVFKFDRNQEATSPKLLEDREDMSQILSPA-CSLGKHPTCRYGVWKEGVFMSMDCGDGAAETGKPIGRGQEGCRDHDS-----GFKSQCKCDQQHLLRNIEYVANCYRDQRATARRTGEWKKVAKVLDRFFMWLFFIMVFFMSLLIMGKAI 532          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Xenopus
Match: CHRNA9 (cholinergic receptor, nicotinic alpha 9 [Source:NCBI gene;Acc:100493319])

HSP 1 Score: 198.364 bits (503), Expect = 9.958e-56
Identity = 155/540 (28.70%), Postives = 252/540 (46.67%), Query Frame = 3
Query:  138 KSVEKNLLQKLMKS-YEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKE-KNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQFIXXXXXXXXNNCNVYITQSPAGKIQHKLYVPELTCNKFMATDIPNIEETSTSQDLSNRNNINKPYSKNFISADKNLNQKYSRNNGHRSHNQKPNSEINNLPNPGVSNSHDSPIMICGGTSSIEKDVIEITRYVRKYIGKQKEAQRKNQLTMEWRTLGLVLDRLF------CIFYMATIVIA 1733
            +S +    Q L +  +E Y    RPV D+   + V+  + L QI  +D   QIL    W R +W+D  L WD  +YDG+D IR+  + +W PDI L+N AD+         VV+  DG I W   A+ KSSC V++SYFPFD Q C + FGSWTY+ +Q+++       +++   D   ++ N EW   G    KN+                   IT G     + +  + + + L+R  SFY+F L+IPC+++S L  + F+LP +S  K+ LG+ + +A  +  L++  S+P + ++ PLIG ++   M MIT ST L  I++N ++ G    P+P + R +++D + ++ FV             NC      SP      K               +P+ E+    Q+  +        S NF S D + N+K    NGH   +     EI        S +H      C    +  + +     Y+  +  +QK    K    +EW+ +  V+DR F       +F+M+ ++IA
Sbjct:    8 ESAKGKYAQMLFRDLFEDYSNALRPVEDTDKALNVSLQITLSQIKDVDERNQILTAYLWIRLSWYDAYLKWDRDEYDGLDSIRIPSNMVWRPDIVLYNKADDEFSEPVNTNVVLRYDGKITWDSPAITKSSCVVDVSYFPFDNQQCNLTFGSWTYNGNQVDII------NTMDSGDLSDFVENVEWEMQGMPAVKNV-------------------ITYG--CCSEPYPDITFTLILKRRSSFYIFNLLIPCVMISFLAPLGFYLPADSGEKVSLGVTVLLALTVFQLMVAESMPPS-ESVPLIGKYYIATMTMITASTALTIIIMNIHLCGPEAKPIPRWARIVILDYMSKIFFVYDV--------GENCT-----SPQSDSDTK-----------SNGSVPSYEDYEKEQEPYSSLGCPLSGSGNF-SCDIDTNKKL---NGHLGGHYALQKEI--------SETH------CCAHCNRYRVLTNNIEYITNWYREQKAISAKG---IEWKKVAKVMDRFFMWVFFSMVFFMSILIIA 474          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Xenopus
Match: CHRNA9 (cholinergic receptor, nicotinic alpha 9 [Source:NCBI gene;Acc:100493319])

HSP 1 Score: 199.134 bits (505), Expect = 1.004e-55
Identity = 157/549 (28.60%), Postives = 254/549 (46.27%), Query Frame = 3
Query:  111 NADDEFLSKKSVEKNLLQKLMKS-YEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKE-KNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQFIXXXXXXXXNNCNVYITQSPAGKIQHKLYVPELTCNKFMATDIPNIEETSTSQDLSNRNNINKPYSKNFISADKNLNQKYSRNNGHRSHNQKPNSEINNLPNPGVSNSHDSPIMICGGTSSIEKDVIEITRYVRKYIGKQKEAQRKNQLTMEWRTLGLVLDRLF------CIFYMATIVIA 1733
            N    F   +S +    Q L +  +E Y    RPV D+   + V+  + L QI  +D   QIL    W R +W+D  L WD  +YDG+D IR+  + +W PDI L+N AD+         VV+  DG I W   A+ KSSC V++SYFPFD Q C + FGSWTY+ +Q+++       +++   D   ++ N EW   G    KN+                   IT G     + +  + + + L+R  SFY+F L+IPC+++S L  + F+LP +S  K+ LG+ + +A  +  L++  S+P + ++ PLIG ++   M MIT ST L  I++N ++ G    P+P + R +++D + ++ FV             NC      SP      K               +P+ E+    Q+  +        S NF S D + N+K    NGH   +     EI        S +H      C    +  + +     Y+  +  +QK    K    +EW+ +  V+DR F       +F+M+ ++IA
Sbjct:   22 NVTSFFKGVESAKGKYAQMLFRDLFEDYSNALRPVEDTDKALNVSLQITLSQIKDVDERNQILTAYLWIRLSWYDAYLKWDRDEYDGLDSIRIPSNMVWRPDIVLYNKADDEFSEPVNTNVVLRYDGKITWDSPAITKSSCVVDVSYFPFDNQQCNLTFGSWTYNGNQVDII------NTMDSGDLSDFVENVEWEMQGMPAVKNV-------------------ITYG--CCSEPYPDITFTLILKRRSSFYIFNLLIPCVMISFLAPLGFYLPADSGEKVSLGVTVLLALTVFQLMVAESMPPS-ESVPLIGKYYIATMTMITASTALTIIIMNIHLCGPEAKPIPRWARIVILDYMSKIFFVYD--------VGENCT-----SPQSDSDTK-----------SNGSVPSYEDYEKEQEPYSSLGCPLSGSGNF-SCDIDTNKKL---NGHLGGHYALQKEI--------SETH------CCAHCNRYRVLTNNIEYITNWYREQKAISAKG---IEWKKVAKVMDRFFMWVFFSMVFFMSILIIA 497          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Xenopus
Match: prepl (prolyl endopeptidase-like [Source:Xenbase;Acc:XB-GENE-981635])

HSP 1 Score: 197.208 bits (500), Expect = 4.279e-55
Identity = 145/515 (28.16%), Postives = 243/515 (47.18%), Query Frame = 3
Query:  204 RPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQFIXXXXXXXXNNCNVYITQSPAGKIQHKLYVPELTCNKFMATDIPNIEETSTSQDLSNRNNINKPYSKNFISADKNLNQKYSRNN-GHRSHNQKPNSEINNLPNPGVSNSHDSPIMICGGTSSIEKDVIEITRYVRKYIGKQKEAQRKNQLTMEWRTLGLVLDRLFC-IFYMATIVIAVII 1742
            RPV D    + V   + L QI+ +D   QIL    W R  W D  L W+ +DYDG+D IR+   Y+W PDI L+N AD++     E  VV+  DG I+W   A+ KSSC V++S+FPFD Q CR+ FGSWTY+ +Q+++       + L   D   ++ N EW   G   K           KS+       IT G     + +  + Y + L+R  SFY+F L++PC+++S L  + F+LP +S  K+ LG+ + +A  +  LL+  S+P + +  PLIG ++   M MIT ST L   ++N +  G    P+P + +K ++  + R+ FV +           +C    T+            PE    +   + +P I+  +  +D++   ++ K   +     DK   ++   +   H   + K           G        I        + K++     Y+      Q+  Q++   T EW+ +  V+DR F  +F++   +++V+I
Sbjct:   41 RPVEDMDKAMNVTLQVTLSQIIDMDERNQILMAYLWIRQVWFDAYLRWNKEDYDGLDTIRIPSSYVWRPDIVLYNNADDQFTGSMETNVVIRYDGQIMWDSPAITKSSCKVDVSFFPFDGQQCRLTFGSWTYNGNQIDIL------NHLDTGDLTDFVENVEWEILGMPAK-----------KSV-------ITYG--CCSEPYPDVTYTLILKRRASFYIFNLLLPCVMISFLAPLGFYLPADSGEKVSLGVTVLLALTVFQLLVAESMPPS-ENVPLIGKYYIATMTMITASTALTIFIMNIHHCGPEAKPVPQWAKKFILQYMSRIFFVYEV--------GESCRRPRTE------------PEPNSER--TSKVPGIDGQAKREDIA---DVVKDCPEKLSPKDKEAKEELEHSKYAHSQESGKYYVSEQGGVGKGFGYEECPKIHCLCHNERLLKNI----EYIANCFRDQRATQKR---TGEWKKVAKVMDRFFMWVFFIMVFLMSVLI 496          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Xenopus
Match: CHRNA2 (cholinergic receptor, nicotinic alpha 2 [Source:NCBI gene;Acc:100495873])

HSP 1 Score: 197.208 bits (500), Expect = 5.821e-55
Identity = 148/570 (25.96%), Postives = 273/570 (47.89%), Query Frame = 3
Query:   45 CF*KEMHILCKNFVFIYAFVFINADDEFLSKKSVEKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPY-VDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQFIXXXXXXXXNNCNVYITQSPAGKIQHKLYVPEL---TCNKFMATDIPNIEETSTSQDLSNRNNINKPYSKNFISADKNLNQKYSRNNGHRSHNQKPNSEINNLPNPGVSNSHDSPIMICGGTSSIEKDVIEITRYVRKYIGKQKEAQRKN-QLTMEWRTLGLVLDRLFCIFYMATIVIAVI 1739
            C  + + ILC    +I  F  ++  +   ++   E+ L ++L   Y  +    RPV ++ + + V +GL++ Q++ +D   Q++ TN W +  W+D  L W+P DYD +  IR+  + +W+PDI L+N AD    +    +  + ++G + WVP A++KSSCS+++++FPFD Q C+M FGSWTYD + L+L       +S+   VD K Y  + EW       K     + +K+      + Y +IT              Y   +RR P FY   LIIPC+L+S L  +VF+LP++   K+ L +++ ++  + LLL+   IP+     PLIG +    MI +TLS  +   V+N + R      MP ++R + +D+I R LF+ +                   +P  ++  +   PEL   T   +M TD+ +      ++       +   + ++  + +++L  +Y  N+ H S  Q      +  P    + + +S  ++        + V         YI     A+  +  +  +W+ + +V+DR+F   ++   ++  +
Sbjct:    4 CMGRTLSILC----WIITFTTVSCMER--TRTHAEERLFKRLFTGYNRWS---RPVPNTSDVVIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWNPADYDNVTSIRVPSEMIWIPDIVLYNNADGEFAITHMTKAHLFHNGKVKWVPPAIYKSSCSIDVTFFPFDQQSCKMKFGSWTYDKAWLDL-------ESMERNVDLKDYWESGEWAIVNAVGK-----YNSKKYDCCTEI-YPDIT--------------YYFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHKMPLWVRSVFLDHIPRWLFMKR-----------------PPAPVEEVVSQYDAPELKLSTSKYWMETDVDDKWAEPEAE-------LQTCHVRHMTTHNQSLQYRYDYNH-HVSGGQ------SQTPRHSSTETAESSFLLSPSVLKALEGV--------HYIANHLRAEDADFSVKEDWKYVAMVIDRIFLWMFIIVCLLGTV 498          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Xenopus
Match: ncaph (non-SMC condensin I complex subunit H [Source:Xenbase;Acc:XB-GENE-5738397])

HSP 1 Score: 194.897 bits (494), Expect = 1.103e-54
Identity = 117/356 (32.87%), Postives = 196/356 (55.06%), Query Frame = 3
Query:  147 EKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWH-TDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQFI 1211
            E+ L QKL+  Y     + RPV +  + + V++ +A+ Q++ +D   QIL TN W R+ W+D  L W+PK+YDGI+ +R+  D +W PDI L+N A    +V  +++ +V  +G I W P A+FKSSC ++I++FPFD Q C M FGSW+YD ++++L   G        VD K +  N+EW   D    K+    +  ++I       Y +IT              Y   +RR P FY   LI+PC+ LS L  +VF+LP++   K+ L +++ ++  + LL++  +IP+     PL+G +    MI +TLS  +   V+N + R      MP +++ + +  + +LL + + +
Sbjct:   22 EEKLFQKLLARY---NQHIRPVENVSDPVMVHFEVAITQLVNVDEVNQILETNLWLRHIWNDYKLQWNPKEYDGIEFMRIPADKIWKPDIVLYNNAVGDFQVEGKSKALVKYNGLITWSPPAIFKSSCPMDITFFPFDHQNCSMKFGSWSYDKAKIDLAIIG------SKVDMKDFWENSEWEIVDASGFKHDIKYNCCEEI-------YTDIT--------------YSFYIRRLPMFYTINLIMPCLFLSFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPTTHKMPMWVKDVFLKRLPKLLMMKKTV 347          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Mouse
Match: Chrna6 (cholinergic receptor, nicotinic, alpha polypeptide 6 [Source:MGI Symbol;Acc:MGI:106213])

HSP 1 Score: 189.889 bits (481), Expect = 1.355e-52
Identity = 138/532 (25.94%), Postives = 231/532 (43.42%), Query Frame = 3
Query:  147 EKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWH-TDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQFIXXXXXXXXNNCNVYITQSPAGKIQHKLYVPELTCNKFMATDIPNIEETSTSQDLSNRNNINKPYSKNFISADKNLNQKYSRNNGHRSHNQKPNSEINNLPNPGVSNSHDSPIMICGGTSSIEKDVIEITRYVRKYIGKQKEAQRKNQLTMEWRTLGLVLDRLFCIFYMATIVIAVI 1739
            E+ L  +L   Y  +    RPV +  + + V++ LA+ Q+  +D   QI+ TN W R+ W D  L WDP +YDGI+ +R+  D +W PDI L+N A    +V  + + ++  DG I W P A+FKSSC ++I++FPFD Q C + FGSWTYD ++++L   G        VD   +  N+EW   D    K+    +  ++I       Y +IT              Y   +RR P FY   LIIPC+ +S L  +VF+LP++   K+ L +++ ++  + LL++  +IP+     PL+G +    MI +TLS  +   V+N + R      MP +++ I +     +L +                    + P  K +                                   +  P S     A      +         H+ + +S+I     PG   S   P       S    DV ++   V+      K     N++  +W+ + +V+DR+F   ++   V   +
Sbjct:   34 EEQLFHRLFAHYNRFI---RPVENVSDPVTVHFELAITQLANVDEVNQIMETNLWLRHIWKDYRLRWDPTEYDGIETLRVPADNIWKPDIVLYNNAVGDFQVEGKTKALLKYDGVITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWTYDKAEIDLLIIG------SKVDMNDFWENSEWEIVDASGYKHDIKYNCCEEI-------YTDIT--------------YSFYIRRLPMFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPATHTMPKWVKTIFLQAFPSILMM--------------------RKPLDKTKEA-------------------------------GGVKDPKSHTKRPAKVKFTHRGESKLLKECHHCQKSSDI----APGKRRSSQQPARWVAENSEHSSDVEDVIESVQFIAENMKSHNETNEVEDDWKYMAMVVDRVFLWVFIIVCVFGTV 480          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Mouse
Match: Chrna4 (cholinergic receptor, nicotinic, alpha polypeptide 4 [Source:MGI Symbol;Acc:MGI:87888])

HSP 1 Score: 192.586 bits (488), Expect = 1.813e-52
Identity = 148/500 (29.60%), Postives = 236/500 (47.20%), Query Frame = 3
Query:  114 ADDEFLSKKSVEKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWH-TDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQFIXXXXXXXXNNCNVYITQSPAGKIQHKL-----YVPELTCNKFMATDIPNIEETSTSQDLSNRNNINKPYSKNFISADKNLNQKYSRNNGHRSHNQKPNSEINN---LPNPGVS---NSHDSPIMICGGTSSIE 1577
            A     ++   E+ LL++L   Y  +    RPV +  + + V +GL++ Q++ +D   Q++ TN W +  WHD  L WDP DY+ +  IR+  + +W PDI L+N AD    V    +  +  DG + W P A++KSSCS+++++FPFD Q C M FGSWTYD ++++L            VD   +  + EW   D     N        +I       Y +IT              Y   +RR P FY   LIIPC+L+S L  +VF+LP+E   K+ L +++ ++  + LLL+   IP+     PLIG +    MI +TLS  +   V+N + R  R   MP ++R++ +D + RLLF+ +     P    +NC   I         HK+     + PE      +  DI N +  S +    NR +                 Q   R+  H+  + K  SE+      P+PG     NS  +P++I   + S++
Sbjct:   28 ASSHIETRAHAEERLLKRLFSGYNKWS---RPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPGDYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAHLFYDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDL------VSMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEI-------YPDIT--------------YAFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKVTLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPAWVRRVFLDIVPRLLFMKR-----PSVVKDNCRRLIES------MHKMANAPRFWPEPESEPGILGDICN-QGLSPAPTFCNRMDTAVE------------TQPTCRSPSHKVPDLK-TSEVEKASPCPSPGSCHPPNSSGAPVLIKARSLSVQ 472          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Mouse
Match: Chrna3 (cholinergic receptor, nicotinic, alpha polypeptide 3 [Source:MGI Symbol;Acc:MGI:87887])

HSP 1 Score: 189.504 bits (480), Expect = 1.968e-52
Identity = 138/539 (25.60%), Postives = 248/539 (46.01%), Query Frame = 3
Query:  132 SKKSVEKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQFIXXXXXXXXNNCNVYITQSPAGKIQHKLYVPELTCNKFMATDIPNIEETSTSQDLSNRNNINKPYSKN---FISAD-KNLNQKYSRNNGHRSHNQKPNSEINNLPNPGVSNSHDSPIMICGGTSSIEKDVIEITRYVRKYIGKQKEAQR-KNQLTMEWRTLGLVLDRLFCIFYMATIVIA 1733
            S    E  L Q L   +E Y    RPV +  + + + + +++ Q++ +D   QI+ TN W +  W+D  L W P DY G++ +R+  + +W PDI L+N AD   +V  + + ++   G + W+P A+FKSSC ++++YFPFD Q C M FGSW+YD ++++L   G        ++ K Y  + EW     K     H  +    + +    YQ+IT              Y + +RR P FY   LIIPC+L+S L  +VF+LP++   K+ L +++ ++  + LL++  +IP+     PLIG +    MI +TLS  +   V+N + R      MP +++ + ++ + R++F+++                                                 TST +D     N       N   F  AD K+  + Y   +G   +      +I+N       +S    +      S++  ++ E  + V KYI +  +AQ    ++  +W+ + +V+DR+F   ++   ++ 
Sbjct:   24 SASEAEHRLFQYL---FEDYNEIIRPVANVSHPVIIQFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWKPSDYQGVEFMRVPAEKIWKPDIVLYNNADGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIG------SSMNLKDYWESGEWAII--KAPGYKHEIKYNCCEEI----YQDIT--------------YSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPTWVKAVFLNLLPRVMFMTR------------------------------------------------PTSTEEDAPKTRNFYGAELSNLNCFSRADSKSCKEGYPCQDGTCGYCHHRRVKISNFSANLTRSSSSESVDAVLSLSALSPEIKEAIQSV-KYIAENMKAQNVAKEIQDDWKYVAMVIDRIFLWVFILVCILG 484          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Mouse
Match: Chrna3 (cholinergic receptor, nicotinic, alpha polypeptide 3 [Source:MGI Symbol;Acc:MGI:87887])

HSP 1 Score: 189.504 bits (480), Expect = 2.606e-52
Identity = 138/539 (25.60%), Postives = 248/539 (46.01%), Query Frame = 3
Query:  132 SKKSVEKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQFIXXXXXXXXNNCNVYITQSPAGKIQHKLYVPELTCNKFMATDIPNIEETSTSQDLSNRNNINKPYSKN---FISAD-KNLNQKYSRNNGHRSHNQKPNSEINNLPNPGVSNSHDSPIMICGGTSSIEKDVIEITRYVRKYIGKQKEAQR-KNQLTMEWRTLGLVLDRLFCIFYMATIVIA 1733
            S    E  L Q L   +E Y    RPV +  + + + + +++ Q++ +D   QI+ TN W +  W+D  L W P DY G++ +R+  + +W PDI L+N AD   +V  + + ++   G + W+P A+FKSSC ++++YFPFD Q C M FGSW+YD ++++L   G        ++ K Y  + EW     K     H  +    + +    YQ+IT              Y + +RR P FY   LIIPC+L+S L  +VF+LP++   K+ L +++ ++  + LL++  +IP+     PLIG +    MI +TLS  +   V+N + R      MP +++ + ++ + R++F+++                                                 TST +D     N       N   F  AD K+  + Y   +G   +      +I+N       +S    +      S++  ++ E  + V KYI +  +AQ    ++  +W+ + +V+DR+F   ++   ++ 
Sbjct:   29 SASEAEHRLFQYL---FEDYNEIIRPVANVSHPVIIQFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWKPSDYQGVEFMRVPAEKIWKPDIVLYNNADGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIG------SSMNLKDYWESGEWAII--KAPGYKHEIKYNCCEEI----YQDIT--------------YSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPTWVKAVFLNLLPRVMFMTR------------------------------------------------PTSTEEDAPKTRNFYGAELSNLNCFSRADSKSCKEGYPCQDGTCGYCHHRRVKISNFSANLTRSSSSESVDAVLSLSALSPEIKEAIQSV-KYIAENMKAQNVAKEIQDDWKYVAMVIDRIFLWVFILVCILG 489          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Mouse
Match: Chrna4 (cholinergic receptor, nicotinic, alpha polypeptide 4 [Source:MGI Symbol;Acc:MGI:87888])

HSP 1 Score: 191.815 bits (486), Expect = 3.246e-52
Identity = 148/500 (29.60%), Postives = 236/500 (47.20%), Query Frame = 3
Query:  114 ADDEFLSKKSVEKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWH-TDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQFIXXXXXXXXNNCNVYITQSPAGKIQHKL-----YVPELTCNKFMATDIPNIEETSTSQDLSNRNNINKPYSKNFISADKNLNQKYSRNNGHRSHNQKPNSEINN---LPNPGVS---NSHDSPIMICGGTSSIE 1577
            A     ++   E+ LL++L   Y  +    RPV +  + + V +GL++ Q++ +D   Q++ TN W +  WHD  L WDP DY+ +  IR+  + +W PDI L+N AD    V    +  +  DG + W P A++KSSCS+++++FPFD Q C M FGSWTYD ++++L            VD   +  + EW   D     N        +I       Y +IT              Y   +RR P FY   LIIPC+L+S L  +VF+LP+E   K+ L +++ ++  + LLL+   IP+     PLIG +    MI +TLS  +   V+N + R  R   MP ++R++ +D + RLLF+ +     P    +NC   I         HK+     + PE      +  DI N +  S +    NR +                 Q   R+  H+  + K  SE+      P+PG     NS  +P++I   + S++
Sbjct:   28 ASSHIETRAHAEERLLKRLFSGYNKWS---RPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPGDYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAHLFYDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDL------VSMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEI-------YPDIT--------------YAFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKVTLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPAWVRRVFLDIVPRLLFMKR-----PSVVKDNCRRLIES------MHKMANAPRFWPEPESEPGILGDICN-QGLSPAPTFCNRMDTAVE------------TQPTCRSPSHKVPDLK-TSEVEKASPCPSPGSCHPPNSSGAPVLIKARSLSVQ 472          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. UniProt/SwissProt
Match: sp|P04755|ACH3_DROME (Acetylcholine receptor subunit beta-like 1 OS=Drosophila melanogaster OX=7227 GN=nAChRbeta1 PE=2 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 1.256e-54
Identity = 127/380 (33.42%), Postives = 199/380 (52.37%), Query Frame = 3
Query:   66 ILCKNFVFIYAFVFINADDEFLSKKSVEKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQ 1205
            +LC   V + AF  ++A ++       E+ L++ L + Y       RPV +   K+ V +GLA VQ++ ++   Q++++N W R  W+D  L WD  DY GI  +RL  D +W PDI LFN AD   +V  ++ V++   G +LWVP A+++SSC+++++YFPFD Q C M FGSWT++  Q+ L  Y   N    +VD   Y  +  W                     +    Y N+ +GD     T   + + I +RR   FY   LI+P +L+S L  +VF+LP E+  K+ LG++I ++  + LLL+   +P      PLI  +     IM T+S  +  I+IN+  RG R   MP YIR I +  +   LF+ +
Sbjct:    9 LLCSILVLV-AFSLVSASED-------EERLVRDLFRGYNKLI---RPVQNMTQKVGVRFGLAFVQLINVNEKNQVMKSNVWLRLVWYDYQLQWDEADYGGIGVLRLPPDKVWKPDIVLFNNADGNYEVRYKSNVLIYPTGEVLWVPPAIYQSSCTIDVTYFPFDQQTCIMKFGSWTFNGDQVSLALYNNKN----FVDLSDYWKSGTWDI-------------------IEVPAYLNVYEGDS-NHPTETDITFYIIIRRKTLFYTVNLILPTVLISFLCVLVFYLPAEAGEKVTLGISILLSLVVFLLLVSKILPPTSLVLPLIAKYLLFTFIMNTVSILVTVIIINWNFRGPRTHRMPMYIRSIFLHYLPAFLFMKR 353          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. UniProt/SwissProt
Match: sp|Q9I8C7|ACH10_CHICK (Neuronal acetylcholine receptor subunit alpha-10 OS=Gallus gallus OX=9031 GN=CHRNA10 PE=3 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 1.317e-54
Identity = 121/356 (33.99%), Postives = 190/356 (53.37%), Query Frame = 3
Query:  141 SVEKNLLQKLMKS-YEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQ 1205
            + +  L  KL+   +  Y    RP  D+   + V   + L QI+ +D   Q+L +  W R  W D  L WD   Y GID IR+   Y+W PDI L+N ADER     E  VV+ +DG I+W   A+ KSSC V++SYFPFD Q CR+ FGSWTY+ +Q++L       + L   D   ++ N EW   G        +  T+ +          +T G     + +  + Y + LRR  SFY+F L++PC+++S L  + F+LP +S  K+ LG+ + +A  +  LL+  S+P + ++ PLIG ++   M MIT ST L   ++N +  G    P+P + R++++ ++ R L V +
Sbjct:   26 AAQGRLAHKLLHDLFANYSSALRPAEDTERALNVTLQVTLSQIIDMDERNQVLTSYLWVRQAWLDAHLAWDKDAYGGIDSIRIPSSYVWRPDIVLYNNADERFGGSMETNVVLRSDGHIMWDSPAITKSSCKVDVSYFPFDGQQCRLTFGSWTYNGNQIDL------RNLLDTGDLTDFVENVEWEVLG--------MPATRNV----------VTYG--CCSEPYPDVTYTLLLRRRASFYIFNLLLPCVMISFLAPLGFYLPADSGEKVSLGVTVLLALTVFQLLVAESMPPS-ESVPLIGKYYIATMTMITASTALTIFIMNIHHCGPGARPVPPWARRLILHHLARALCVCE 354          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. UniProt/SwissProt
Match: sp|P18257|ACHN3_CARAU (Neuronal acetylcholine receptor subunit non-alpha-3 OS=Carassius auratus OX=7957 PE=2 SV=1)

HSP 1 Score: 194.512 bits (493), Expect = 1.005e-53
Identity = 125/367 (34.06%), Postives = 196/367 (53.41%), Query Frame = 3
Query:   96 AFVFINADDEFLSKKSVEKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRK-GPMPNYIRKIMIDNIGRLL 1193
            A+  I A +EF+S   +E  LL+ L + Y+ +    RP+  + + I V +GL + Q++ +D    ++ TN W    W D  L W+P+DY GI  IR+  + +W+PDI L+  AD R +     + +V  +G+I+W P A +KSSC++++++FPFD Q C M FGSWTYD + ++L           YVD K +  N EW            L+ T Q  S R        DG      ++  + Y   L+R P FY   LIIPC+ LS L  +VF+LP++   KLLL  ++ V+  + LL+++  IP++ K  PLIG +    MI +T S  +   VIN + R      PM  +++ + +  + RLL
Sbjct:   15 AYATIEAPEEFVSLAEMEDTLLRNLFRGYQKWV---RPILHANDTITVRFGLKISQLVDVDEKNHLMTTNVWLWQEWTDYKLRWNPEDYGGITSIRVPSETIWLPDIVLYENADGRFEGSLMTKAIVRFNGTIMWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTMVDLTLLD------AYVDRKDFFDNGEWEI----------LNATGQRGSRR--------DG----IYSYPYVTYSFILKRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLLLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTFSIIVTLFVINVHHRSSATYHPMAPWVKSLFLQRLPRLL 350          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. UniProt/SwissProt
Match: sp|P09482|ACHA4_CHICK (Neuronal acetylcholine receptor subunit alpha-4 OS=Gallus gallus OX=9031 GN=CHRNA4 PE=1 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 6.478e-53
Identity = 119/376 (31.65%), Postives = 199/376 (52.93%), Query Frame = 3
Query:   78 NFVFIYAFVFINADDEFLSKKSVEKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQ 1205
            N + +       A     ++   E+ LL+KL   Y  +    RPV +  + + V +GL++ Q++ +D   Q++ TN W +  WHD  L WDP++Y+ +  IR+  + +W PDI L+N AD    V    +  +  DG I W+P A++KSSCS+++++FPFD Q C+M FGSWTYD ++++L           +VD   Y  + EW                  + +    +Y+  T+        +  + Y   +RR P FY   LIIPC+L+S L  +VF+LP+E   K+ L +++ ++  + LLL+   IP+     PLIG +    MI +TLS  +   V+N + R  R   MP+++R++ +D + RLLF+ +
Sbjct:    9 NLLLLLCASIFPAFGHVETRAHAEERLLKKLFSGYNKWS---RPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPQEYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAHLFYDGRIKWMPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDL------VSMHSHVDQLDYWESGEWVI-------------INAVGNYNSKKYECCTE-------IYPDITYSFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIIITVFVLNVHHRSPRTHTMPDWVRRVFLDIVPRLLFMKR 355          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. UniProt/SwissProt
Match: sp|P09481|ACHA3_CHICK (Neuronal acetylcholine receptor subunit alpha-3 OS=Gallus gallus OX=9031 GN=CHRNA3 PE=1 SV=2)

HSP 1 Score: 192.2 bits (487), Expect = 1.369e-52
Identity = 143/534 (26.78%), Postives = 260/534 (48.69%), Query Frame = 3
Query:  147 EKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQFIXXXXXXXXNNCNVYITQSPAGKIQHKLYVPELT-CNKFMATDIPNIEETSTSQDLSNRNNINKPYSKNFISADKNLNQKYSRNNGHRSHNQKPNSEINNLPNPGVSNSHDSPIMICGGTSSIEKDVIEITRYVRKYIGKQKEAQRKNQLTMEWRTLGLVLDRLFCIFYMATIVIAVIIG 1745
            E  L   L K+Y  +    RPV ++ + + + + +++ Q++ +D   QI+ TN W ++ W+D  L W+P DY G + IR+    +W PDI L+N A    +V  + + ++   G + W+P A+FKSSC ++++YFPFD Q C M FGSW+YD ++++L   G        ++ K Y  + EW       K   + H  K                    ++ +  + Y + +RR P FY   +IIPC+L+S L  +VF+LP++   K+ L +++ ++  + LL++  +IP+     PLIG +    MI +TLS  +   V+N + R  +   MP ++R I ++ + R++F+++    P     NN      Q P        Y  E +  N F +++I   ++    QD++              S  +    K+S  +G+ + +    S      +P  S S  SP M         +D IE  +Y+ + +  Q EA+   ++  +W+ + +V+DR+F    +   ++  I+G
Sbjct:   26 EHRLYAALFKNYNQFV---RPVKNASDPVIIQFEVSMSQLVKVDEVNQIMETNLWLKHIWNDYKLRWNPVDYGGAEFIRVPSGQIWKPDIVLYNNAVGDFQVDDKTKALLKYTGDVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIG------STMNLKDYWESGEWAII----KAPGYKHDIKY----------------NCCEEIYTDITYSLYIRRLPLFYTINMIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPKTHTMPVWVRTIFLNLLPRIMFMTR----PTSDEENN------QKP-----KPFYTSEFSNLNCFNSSEIKCCKDGFVCQDMA-------------CSCCQYQRMKFSDFSGNLTRSSSSESV-----DPLFSFSVLSPEM---------RDAIESVKYIAENMKMQNEAK---EIQDDWKYVAMVIDRIF----LWVFILVCILG 481          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. TrEMBL
Match: A0A5K3FBT6 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 498.049 bits (1281), Expect = 3.013e-166
Identity = 279/568 (49.12%), Postives = 381/568 (67.08%), Query Frame = 3
Query:  138 KSVEKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSL--PYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQFIXXXXXXXXNNCNVYITQSPAG----KIQHKLYVPELTCNKFMA-TDIPNIEETSTSQDLSN--------RNNINKPYSKN-------------FISADKNLNQKYSRNNGHRSHNQKPNSEINNL--PNPGVSNSHDSPIMICGGTSSIEKDVIEITRYVRKYIGKQKEAQRKNQLTMEWRTLGLVLDRLFCIFYMATIVIAVIIGIP 1751
            KSVEK L++ L++ Y  +GV GRPV+D++  ++VNYGL L+QIL LD N QIL TNCW  Y W+D LL W+P ++  + ++R+    +W PDIQLFNFADER++ HR ARVVV +DGSILWVPQALFKS+C VEI+YFPFD QIC ++FGSWTYD +Q+EL W+   +  +  PYVDF  Y+ +NEW TDGE E++I H +RTKQIK+ +  + +N TDGD +  K + VL YR+RL RNPSFY+FIL++PCILLS L  +VFWLP ESPAK++LGMNIFV FF+LLL+L    P AVK FPLIG++FCLNMIMITLSTFL T+VI+F+ RG R GP+P  I +I+I+ +GRL+ V Q I  P P+     +  +T++ AG      + KL VPEL  +KF+   D+ +  + + +  L N        RN++    S++              +    ++     R+ G        +S ++ +  P  G ++S DSPIM+   T S+E+DV E+ RYVR ++ +QKE  RKN + MEWRT+ LVLDRLF   Y+ATI I V+  +P
Sbjct:   10 KSVEKALIRMLIERYRRFGVIGRPVSDNKIVLKVNYGLQLIQILDLDENKQILHTNCWSMYRWNDTLLQWNPAEHGNVTEVRIFPSQIWTPDIQLFNFADERIREHRIARVVVHSDGSILWVPQALFKSACQVEITYFPFDTQICNLEFGSWTYDRTQMELDWWVTTSSPIPNPYVDFVDYVPSNEWRTDGETERDIVHTNRTKQIKAYKRYQERNQTDGDVVTTKQYTVLCYRVRLHRNPSFYIFILVVPCILLSSLTIVVFWLPPESPAKMMLGMNIFVTFFLLLLVLAGQTPNAVKEFPLIGAYFCLNMIMITLSTFLATLVIHFHYRGARNGPLPAIIHRIIIEGMGRLMLVRQSI--PLPEEKKTLSHVVTRTAAGLGGRHARRKLRVPELHSSKFLGDDDLDDSPQRTATGALPNCIDGGSGWRNHVPMSGSRSGFGPSCAATTCPGCMGLADSVGDLSRRSGGVPGTLDWHSSTVDAVRAPPAGNADSEDSPIMLSSST-SLERDVRELKRYVRMFVNRQKEGSRKNAIAMEWRTMALVLDRLFFFVYIATIGITVVTSLP 574          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. TrEMBL
Match: A0A5K3FFX3 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 497.664 bits (1280), Expect = 9.632e-166
Identity = 279/568 (49.12%), Postives = 381/568 (67.08%), Query Frame = 3
Query:  138 KSVEKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSL--PYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQFIXXXXXXXXNNCNVYITQSPAG----KIQHKLYVPELTCNKFMA-TDIPNIEETSTSQDLSN--------RNNINKPYSKN-------------FISADKNLNQKYSRNNGHRSHNQKPNSEINNL--PNPGVSNSHDSPIMICGGTSSIEKDVIEITRYVRKYIGKQKEAQRKNQLTMEWRTLGLVLDRLFCIFYMATIVIAVIIGIP 1751
            KSVEK L++ L++ Y  +GV GRPV+D++  ++VNYGL L+QIL LD N QIL TNCW  Y W+D LL W+P ++  + ++R+    +W PDIQLFNFADER++ HR ARVVV +DGSILWVPQALFKS+C VEI+YFPFD QIC ++FGSWTYD +Q+EL W+   +  +  PYVDF  Y+ +NEW TDGE E++I H +RTKQIK+ +  + +N TDGD +  K + VL YR+RL RNPSFY+FIL++PCILLS L  +VFWLP ESPAK++LGMNIFV FF+LLL+L    P AVK FPLIG++FCLNMIMITLSTFL T+VI+F+ RG R GP+P  I +I+I+ +GRL+ V Q I  P P+     +  +T++ AG      + KL VPEL  +KF+   D+ +  + + +  L N        RN++    S++              +    ++     R+ G        +S ++ +  P  G ++S DSPIM+   T S+E+DV E+ RYVR ++ +QKE  RKN + MEWRT+ LVLDRLF   Y+ATI I V+  +P
Sbjct:   35 KSVEKALIRMLIERYRRFGVIGRPVSDNKIVLKVNYGLQLIQILDLDENKQILHTNCWSMYRWNDTLLQWNPAEHGNVTEVRIFPSQIWTPDIQLFNFADERIREHRIARVVVHSDGSILWVPQALFKSACQVEITYFPFDTQICNLEFGSWTYDRTQMELDWWVTTSSPIPNPYVDFVDYVPSNEWRTDGETERDIVHTNRTKQIKAYKRYQERNQTDGDVVTTKQYTVLCYRVRLHRNPSFYIFILVVPCILLSSLTIVVFWLPPESPAKMMLGMNIFVTFFLLLLVLAGQTPNAVKEFPLIGAYFCLNMIMITLSTFLATLVIHFHYRGARNGPLPAIIHRIIIEGMGRLMLVRQSI--PLPEEKKTLSHVVTRTAAGLGGRHARRKLRVPELHSSKFLGDDDLDDSPQRTATGALPNCIDGGSGWRNHVPMSGSRSGFGPSCAATTCPGCMGLADSVGDLSRRSGGVPGTLDWHSSTVDAVRAPPAGNADSEDSPIMLSSST-SLERDVRELKRYVRMFVNRQKEGSRKNAIAMEWRTMALVLDRLFFFVYIATIGITVVTSLP 599          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. TrEMBL
Match: A0A3Q0KEK5 (Putative nachr subunit OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 490.345 bits (1261), Expect = 5.794e-163
Identity = 281/572 (49.13%), Postives = 380/572 (66.43%), Query Frame = 3
Query:  129 LSKKSVEKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWY---GFPNDSLPYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQFIXXXXXXXXNNCNVYITQSPAGKIQHKLYVPELTCNKFMATDIPNIEETSTSQDLSNRNNINKPYSKNFISADKNLNQKYS---RNNGHRSHNQKPN--------SEINNLPN-PG------------VSNSHDSPIMICGGTSSIEKDVIEITRYVRKYIGKQKEAQRKNQLTMEWRTLGLVLDRLFCIFYMATIVIAVIIGIPTNAD 1763
            +  KSVEKNL++ L+  YE +GV GRPVNDS+ K+ V YGL L QIL LD N QILRTNCW  Y W D LL W+  DY  I  +R+    +W PDI+L+NFADER++ HR+ARVVVS++G +LWVPQALFKS+C VEI+YFPFD QIC ++FGSWTYD +Q+++ W+     P + +PY+DF  Y+ +NEW TDGEKE+ + H++RT QI+S++  R ++ T G+E+I + + VLRY IRLRRNPSFYVF+L+IPC+LLS L  +VFWLP ESPAK++LGMNIFVAFF+LLLLL  S P+AVK FPLIG +FCLNMIMITLSTFL T+VI+ Y RGDR G +P  +R+I+I+ IGRL  V Q IPLP  + P   ++     P  KIQ    +P ++ NK  A +    E                    +F+  ++ L    S     N HRS  + PN        ++INN+   PG             +N ++SP  +   T+++E+DV E+ +YV+  + +QKE  RK+ + MEWRTL +VLDRLF   Y+ TIVIAV++ +P + +
Sbjct:   32 MKTKSVEKNLIRMLLNRYEQFGVIGRPVNDSKIKVDVRYGLQLFQILDLDENKQILRTNCWSMYKWTDSLLRWNESDYGDIKTVRIFPSQIWTPDIKLYNFADERLREHRDARVVVSSNGEMLWVPQALFKSTCEVEITYFPFDTQICMLEFGSWTYDKTQMDILWWIPDSPPIEEMPYLDFSDYVPSNEWRTDGEKEREVHHVNRTIQIRSVKKHRRRSQTVGNEVITREYPVLRYLIRLRRNPSFYVFMLVIPCVLLSSLTLVVFWLPPESPAKMMLGMNIFVAFFVLLLLLAESTPSAVKNFPLIGVYFCLNMIMITLSTFLATLVIHLYFRGDRNGSVPYVLRRIIIEGIGRLTLVRQRIPLPEMKKPIRPSII---KPHKKIQ----IPGISPNKIPANEETYCENERIRHFGGGAFQQCNMVGSHFLYGEEQLGGAASNWFAPNEHRSVPRYPNQFDSYPTATQINNISQIPGSAGKSSENEPDNTANHNESP-SVLNSTTTLERDVRELKKYVKMLVNRQKETARKSLVAMEWRTLAIVLDRLFFFIYITTIVIAVVVSVPRSTE 595          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. TrEMBL
Match: G7YFG9 (Neuronal acetylcholine receptor subunit alpha-4 OS=Clonorchis sinensis OX=79923 GN=CLF_106664 PE=3 SV=1)

HSP 1 Score: 488.804 bits (1257), Expect = 2.499e-162
Identity = 281/595 (47.23%), Postives = 379/595 (63.70%), Query Frame = 3
Query:  138 KSVEKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSL---PYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQFIXXXXXXXXNNCNVYITQSPAG---KIQHKLYVPELTCNKFMATDIPNIEETSTSQDLSNRNNINKPYSKNFISAD---------------KNLNQKY--------SRNNGHRSHNQKPNSEINN---------------LPNPG---VSNSHDSPIMICGGTSSIEKDVIEITRYVRKYIGKQKEAQRKNQLTMEWRTLGLVLDRLFCIFYMATIVIAVIIGIPTNAD-LMKME 1778
            KSVEK L++ L+  YE +GV GRPVNDS+ ++ V YGL L QIL LD N QILRTNCW  Y W D LL W+  +Y  I  +R+   Y+W PDI+L+NFADER+K HREARVV+ NDGS+LW+PQALFKS+C VEI+YFPFD Q+C ++FGSWTYD +Q+++ W+   ++     P+VDF  Y+ +NEW TDGE E++++ L R  QI+S++  R +N T G++ + + + VL Y +RLRRNPSFYVF+L+IPC+LLS L  +VFWLP ESPAK++LGMNIFVAFFILLLLL  S P+AV+ FPLIG FFCLNMIMITLSTFL T+VI+ Y RGDR G +P ++R+++I+ IGRL++V Q IPLP  + P   N     SP G   K + K  +PE   NKF     P  E++         NN  +P    FI                  K +   Y            G R   ++P + +N                +P  G      S DSP ++   T ++E+DV E+ RYV+ ++ +QKE  RK+ + MEWRTL LVLDRLF   Y+ TI IAV++ +P + + ++K E
Sbjct:   16 KSVEKTLIRMLLNRYEQFGVVGRPVNDSKIQVVVAYGLQLFQILDLDENKQILRTNCWSMYQWQDSLLTWNHSEYGDIRSVRIFPSYIWTPDIKLYNFADERLKEHREARVVIQNDGSVLWIPQALFKSTCEVEITYFPFDTQVCMLEFGSWTYDKTQMDIIWWTSSDEGAQMSPFVDFSDYVPSNEWRTDGELERDVTPLERKLQIRSVKRYRRRNQTVGNQTLNREYPVLCYLVRLRRNPSFYVFMLVIPCVLLSSLTLVVFWLPPESPAKMMLGMNIFVAFFILLLLLAESTPSAVRNFPLIGVFFCLNMIMITLSTFLATLVIHLYFRGDRNGSVPAFLRRMVIEGIGRLVYVRQRIPLPDVKKPVAPN-----SPRGISVKGRSKPNIPEHVGNKFFLNYTPTAEDSRVG--YYGTNNRLRP---GFIPGSCPQMYGGGPLLPQIGKMMGPTYPSYFDTVTCSCMGSRDGCKQPTA-VNEPVAPQRPLKTNHPGLVPTQGKAQTGESDDSPDLL-ESTVTLERDVREVKRYVKMFVNRQKEIHRKSLIAMEWRTLALVLDRLFFFLYITTIGIAVLVSVPRSTEPVLKAE 598          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. TrEMBL
Match: A0A504YWH1 (Neuronal acetylcholine receptor subunit alpha-4 OS=Fasciola gigantica OX=46835 GN=FGIG_04241 PE=3 SV=1)

HSP 1 Score: 488.419 bits (1256), Expect = 1.027e-161
Identity = 278/623 (44.62%), Postives = 376/623 (60.35%), Query Frame = 3
Query:   84 VFIYAFVFINADDEFLSKK--------SVEKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQFIXXXXXXXXNNCNVYITQSPAGKIQHKLYVPELTCNKFMATDIPNIEETSTSQDLSNRNNINK--------------------PYSKNFISADKNLNQKYSRNNGHRSHNQKPNSEINNLPNPGVSNSHDSPIMICGGTSSIEK-----------------------------------DVIEITRYVRKYIGKQKEAQRKNQLTMEWRTLGLVLDRLFCIFYMATIVIAVIIGIPTNAD 1763
            VF+ A   ++  ++   K         SVEK L++ L+  YE +GV GRPVNDS+ ++ V YGL L QIL LD N QILRTNCW  Y W+D LL W+  +Y  I  +R+    +W PDI+L+NFADER+K HREARVV+ N+G  LWVPQALFKS+C VEI+YFPFD QIC ++FGSWTYD +QL++ W+    D +PY+DF  Y+ +NEW TDGEKE+ + H +RT QI+S++  R +N T G+++I + F VLRY +RLRRNPSFYVF+L+IPC+LLS L  +VFWLP ESPAK++LGMNIFVAFF+LL+LL  S P+AVK FPLIG +FCLNMIMITLSTFL T+VI+ Y RGDR G +P  +R+I+I+ IGRLL V Q IPLP  +     +   T S    + H+    E++ + F+  +    E++ TS  + N +                        PY          +   Y   +G       P +      N G + + D P+    GT ++EK                                   DV E+ RYV+ ++ +QKE QRK+ + MEWRTL LVLDRLF   Y+ TI +AVI+ +P + +
Sbjct:   10 VFMIALATLDISEQIAPKGHPKETKTYSVEKTLIRMLLNRYEQFGVIGRPVNDSKIQVTVRYGLQLFQILDLDENKQILRTNCWSMYAWNDSLLRWNSSEYGDIMTVRIFPSQIWTPDIKLYNFADERLKEHREARVVIDNNGGALWVPQALFKSTCEVEITYFPFDTQICMLEFGSWTYDKTQLDITWWLPDADPMPYLDFSDYVPSNEWRTDGEKEREVHHTNRTLQIRSVKKYRRRNQTVGNQVITRDFPVLRYLVRLRRNPSFYVFMLVIPCVLLSSLTLVVFWLPPESPAKMMLGMNIFVAFFVLLILLAESTPSAVKNFPLIGVYFCLNMIMITLSTFLATLVIHLYFRGDRNGVVPRILRRIIIEGIGRLLLVRQRIPLPDVKKNPTHSSPRTTS---SLPHRR---EMSGSNFLMNESSFGEDSRTSFHVGNAHGPAPAPAPLGLMPGAGYPMFGDQIPYDMRAAGPGGPMPGPYGSASGM-VPKFPPGAGFFEPCNCGAATARDGPVGNLTGTPAMEKDAFGFPAMKDQRENGTPDQDEQAPEWMNSTATLERDVREVKRYVKAFVSRQKEIQRKSFVAMEWRTLALVLDRLFFFLYITTIAVAVIVSVPRSTE 625          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Cavefish
Match: ENSAMXT00000019858.2 (neuronal acetylcholine receptor subunit alpha-10 [Source:NCBI gene;Acc:103033580])

HSP 1 Score: 201.83 bits (512), Expect = 1.563e-57
Identity = 129/378 (34.13%), Postives = 202/378 (53.44%), Query Frame = 3
Query:   75 KNFVFIYAFVFINADDEFLSKKSVEKNLLQKLMKSYEFYGVNG-RPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQ 1205
            K+F+F Y ++  +A   +  K      LL+ L  +Y     N  RPV D+ N I V   + L QI+ +D   QIL T  W R  W D  L W+  DYDG+D IR+   Y+W PDI L+N AD++     E  VV+ +DG I+W   A+ KSSC V++S+FPFD Q CR+ FGSWT++ +Q+++       + +   D   ++ N EW   G   K    L+            Y +IT              Y ++L+R  SFY+F L+IPC+++S L  + F+LP +S  K+ LG+ + +A  +  LL+  S+P + +  PLIG ++   M MIT ST L   ++N +  G    P+P + R+ +++ + R+ FV +
Sbjct:    2 KHFMFRYFYLCWSAQGRYAHK------LLKDLFVNYS----NAVRPVEDTDNIINVTLQITLSQIIDMDERNQILTTYLWIRQVWLDAYLTWNKADYDGLDTIRIPSSYVWRPDIVLYNNADDQFSSSMETNVVIHHDGQIMWDQPAISKSSCKVDVSFFPFDSQKCRLTFGSWTHNGNQMDIL------NGMDSADLADFVENVEWEVLGMPAKKNVILYGCCSEP------YPDIT--------------YTLQLKRRASFYIFNLLIPCMMISFLAPLGFYLPADSGEKVSLGVTVLLALTVFQLLVAESMPPS-ENVPLIGKYYIATMTMITASTALTIFIMNIHHCGSDAQPVPEWARRFILNYLARICFVYE 342          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Cavefish
Match: ENSAMXT00000032409.1 (neuronal acetylcholine receptor subunit alpha-10 [Source:NCBI gene;Acc:103033580])

HSP 1 Score: 203.371 bits (516), Expect = 3.492e-57
Identity = 163/555 (29.37%), Postives = 268/555 (48.29%), Query Frame = 3
Query:  141 SVEKNLLQKLMKS-YEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQ-------FIXXXXXXXXNNCNV---YITQSPAGKIQHKLYVPELTCNKFMATDIPNIEETSTSQDLSNRNNINKPYSKN-----FISAD-KNLNQKYSRNNGHRSHNQKPNSEINNLPNPGVSNSHD---SPIMICGGTSSIEKDVIEITRYVRKYIGKQKEAQRKNQLTMEWRTLGLVLDRLFC-IFYMATIVIAVII 1742
            S +     KL+K  +  Y    RPV D+ N I V   + L QI+ +D   QIL T  W R  W D  L W+  DYDG+D IR+   Y+W PDI L+N AD++     E  VV+ +DG I+W   A+ KSSC V++S+FPFD Q CR+ FGSWT++ +Q+++       + +   D   ++ N EW   G   K    L+            Y +IT              Y ++L+R  SFY+F L+IPC+++S L  + F+LP +S  K+ LG+ + +A  +  LL+  S+P + +  PLIG ++   M MIT ST L   ++N +  G    P+P + R+ +++ + R+ FV +              +  N+C V    I +  A K Q    +   T +  + T++    E   S  +S   N + P S       F++ D ++L+       G R    +  SE        V N        +++ G     ++ +++   Y+     +QK  QR+   T EWR +  V+DR F  +F++   +++++I
Sbjct:   24 SAQGRYAHKLLKDLFVNYSNAVRPVEDTDNIINVTLQITLSQIIDMDERNQILTTYLWIRQVWLDAYLTWNKADYDGLDTIRIPSSYVWRPDIVLYNNADDQFSSSMETNVVIHHDGQIMWDQPAISKSSCKVDVSFFPFDSQKCRLTFGSWTHNGNQMDIL------NGMDSADLADFVENVEWEVLGMPAKKNVILYGCCSEP------YPDIT--------------YTLQLKRRASFYIFNLLIPCMMISFLAPLGFYLPADSGEKVSLGVTVLLALTVFQLLVAESMPPS-ENVPLIGKYYIATMTMITASTALTIFIMNIHHCGSDAQPVPEWARRFILNYLARICFVYEVGESCLTVPTETTSRRGNSCFVNGQAIGEELALKTQGST-LASTTGDLQVPTELKEDVEDDLSPTISPGTN-SSPCSGARKDGVFVNMDHRDLSGIVGGCGGRRGTGGEKESESFR----AVGNKEPVKRKEVLLRGQCMCHQQPLLKNIEYMANCYREQKSTQRR---TGEWRKVAKVMDRFFMWLFFIMVFLMSLLI 542          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Cavefish
Match: CHRNA9 (cholinergic receptor nicotinic alpha 9 subunit [Source:HGNC Symbol;Acc:HGNC:14079])

HSP 1 Score: 192.586 bits (488), Expect = 2.160e-53
Identity = 155/552 (28.08%), Postives = 258/552 (46.74%), Query Frame = 3
Query:  150 KNLLQKLMKSYEFYGVNG-RPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDG-EKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQFIXXXXXXXXNNCNVYITQSPAGKIQHKLYVPELTCNKFMATDIPNIEETSTSQDLSNRNNINKPYSKNFISADKNLN----------QKYSRNNGHRSHNQKPNSEINNLPNPGVSNSHDSP---IMICGGTS--SIEKDVIEITRYVR--KYIGKQKEAQRKNQLTM-EWRTLGLVLDRLFC-IFYMATIVIAVII 1742
            + LL  LM++Y     N  RPV D+   + V   + L QI  +D   Q+L    W R TW+D  L WD ++YDG++ IR+    +W PD+ L+N AD+ +    +  VV+   G I W   ++ KSSC V++SYFPFD Q C + FGSWTY+ +Q+++        ++   D    + N EW   G    KN+              + Y   +D        +  + Y + L+R  SFY+F L++PC L+S L  + F+LP +S  K+ LG+ + +A  +  L++  S+P + ++ PLIG ++   M+MIT ST L   ++N +  G    P+P + + ++ID + ++ FV +              +  T + A  I H   + +    K      P+       Q L   N   KP         K  N          Q   + +G ++     N+  +  P      +   P    +ICGG+S  SI   V   ++ +R  +YI      QR   L + EW+ +  V+DR F  IF++   +++++I
Sbjct:   31 QQLLNDLMENYS----NALRPVEDTDKTLNVTLQITLSQIKDMDEKNQVLIAYLWIRQTWYDAFLKWDKEEYDGLEVIRIPGSLVWRPDLVLYNKADDDLSETVDTNVVLRYTGEITWDAPSITKSSCVVDVSYFPFDSQQCNLTFGSWTYNGNQVDITM------AMDSGDLSDLVENVEWECHGMPAAKNV--------------IMYGCCSD-------PYPDITYTVLLKRRSSFYIFNLLLPCFLISFLAPLGFYLPADSGEKVSLGVTVLLALTVFQLVVAESMPPS-ESVPLIGKYYIATMMMITASTSLTIFIMNIHFCGAEAKPVPQWAKVLIIDYMSKIFFVYE--------------IGETCASASPISHDQDIDDYFGLK------PHKNPEQDRQKLLKPN--GKPREALGPGGRKTQNSKSQPQPQAPQSCRKRDGFQNEALLKNTASSCCPEDEKPPAGALPFDLCIICGGSSTGSILGAVGGDSKVIRNVEYIANCFREQRATCLKVAEWKKVAKVMDRFFMWIFFIMVFLMSILI 528          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Cavefish
Match: chrnb3a (cholinergic receptor, nicotinic, beta polypeptide 3a [Source:ZFIN;Acc:ZDB-GENE-040108-1])

HSP 1 Score: 190.274 bits (482), Expect = 3.948e-53
Identity = 123/368 (33.42%), Postives = 191/368 (51.90%), Query Frame = 3
Query:   93 YAFVFINADDEFLSKKSVEKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRK-GPMPNYIRKIMIDNIGRLL 1193
            + F    A +E++S   +E  LL+ + + Y+ +    RPV  + + I V +GL + Q++ +D   Q++ TN W    W D  L WDP+DY GI  IR+  + +W+PDI L+  AD R +     + +V  DG+I W P A +KSSC++++++FPFD Q C M FGSWTYD + ++L           +VD K +  N EW       +  S   R   I S  F+ Y  I                   L+R P FY   LIIPC+ LS L  +VF+LP++   KL L  ++ V+  + LL+++  IP++ K  PLIG +    MI +T S  +   VIN + R      PM  +++ + +  + RLL
Sbjct:   14 FMFSLSPAPEEYVSLAELEDTLLRNVFRGYQKWV---RPVFHANDTIAVRFGLKISQLVDVDEKNQLMTTNVWLWQEWTDYKLRWDPEDYGGITSIRVPSENIWLPDIVLYENADGRFEGSLMTKAIVKYDGTITWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTMVDLALVD------QHVDRKDFFDNGEWEILDATGRRGS---RRDGIYSYPFVTYSFI-------------------LKRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTFSIIVTVFVINVHHRSSATYHPMAPWVKSLFLQRLPRLL 350          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Cavefish
Match: chrnb3a (cholinergic receptor, nicotinic, beta polypeptide 3a [Source:ZFIN;Acc:ZDB-GENE-040108-1])

HSP 1 Score: 189.504 bits (480), Expect = 6.400e-53
Identity = 122/361 (33.80%), Postives = 189/361 (52.35%), Query Frame = 3
Query:  114 ADDEFLSKKSVEKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRK-GPMPNYIRKIMIDNIGRLL 1193
            A +E++S   +E  LL+ + + Y+ +    RPV  + + I V +GL + Q++ +D   Q++ TN W    W D  L WDP+DY GI  IR+  + +W+PDI L+  AD R +     + +V  DG+I W P A +KSSC++++++FPFD Q C M FGSWTYD + ++L           +VD K +  N EW       +  S   R   I S  F+ Y  I                   L+R P FY   LIIPC+ LS L  +VF+LP++   KL L  ++ V+  + LL+++  IP++ K  PLIG +    MI +T S  +   VIN + R      PM  +++ + +  + RLL
Sbjct:    7 APEEYVSLAELEDTLLRNVFRGYQKWV---RPVFHANDTIAVRFGLKISQLVDVDEKNQLMTTNVWLWQEWTDYKLRWDPEDYGGITSIRVPSENIWLPDIVLYENADGRFEGSLMTKAIVKYDGTITWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTMVDLALVD------QHVDRKDFFDNGEWEILDATGRRGS---RRDGIYSYPFVTYSFI-------------------LKRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTFSIIVTVFVINVHHRSSATYHPMAPWVKSLFLQRLPRLL 336          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Sea Lamprey
Match: chrna3 (cholinergic receptor, nicotinic, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-070822-1])

HSP 1 Score: 191.43 bits (485), Expect = 5.532e-54
Identity = 113/349 (32.38%), Postives = 195/349 (55.87%), Query Frame = 3
Query:  156 LLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWH-TDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFV 1199
            L + L  SY  Y    RPV +  + + V + +++ Q++ LD   QI+ TN W ++TW+D    W+P  ++G++ IR+  D +W PDI L+N AD   +V  + + ++  DG+++W+P A+FKSSC ++++YFPFD Q C M FGSWTYD ++++L   G        ++ K +  + EW   D    K+    +  +QI       Y +IT              Y + +RR P FY   LIIPC+L+S L  +VF+LP++   K+ L +++ ++  + LL++  +IP+     PLIG +    MI +TLS  +   V+N + R      MPN++R++ +D + +++ +
Sbjct:   11 LYKTLFTSYNPYI---RPVFNVSDPVIVRFEVSMSQLVKLDEVNQIMATNLWLKHTWNDYKFQWNPGQFEGMEYIRVPSDKIWKPDIVLYNNADGDFQVEGKTKALLKYDGTVMWMPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWTYDKAKIDLVLVG------TKINLKDFWESGEWVIIDVPGYKHDIKYNCCEQI-------YPDIT--------------YSVYVRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLSISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITIFVLNVHYRTPEAHTMPNWVRRVFLDTLPKIMLL 329          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Sea Lamprey
Match: chrnb3b (cholinergic receptor, nicotinic, beta 3b (neuronal) [Source:ZFIN;Acc:ZDB-GENE-030102-4])

HSP 1 Score: 187.193 bits (474), Expect = 8.859e-53
Identity = 120/356 (33.71%), Postives = 193/356 (54.21%), Query Frame = 3
Query:  129 LSKKSVEKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRK-GPMPNYIRKIMIDNIGRLL 1193
            LS   +E  LL++++K Y+ +    RPV+   + + V +GL + Q++ +D   Q++ TN W +  W D  L W+P DY GI+ IR+    +W+PDI L++ AD R +     + VV +DG I W P A++KSSC++++++FPFD Q C M FGSWTYD + ++L      +D    VD   Y  N EW            L+ T   K +R        DG     + +  + Y   +RR P FY   LI+PC+ LS L   VF+LP++   K+ L  ++ V+  + LL+++  IP++ K  PLIG +    MI +TLS  +   VIN + R      PM  ++R++ +  + ++L
Sbjct:   29 LSLAELEDRLLKRMLKDYQKWV---RPVDKLSDTVEVKFGLGIAQLVDVDEKNQLMTTNVWLKQEWVDINLRWNPDDYGGINSIRVPASSIWLPDIVLYDNADGRFEGSIVTKAVVKHDGRIKWTPPAIYKSSCTIDVTFFPFDQQNCSMKFGSWTYDGTLVDLIMVN--SD----VDRGEYFDNGEWE----------FLNATGN-KGVRL-------DG----HRFYPYITYSFVIRRLPLFYTLFLIVPCLGLSFLTVFVFYLPSDEGEKISLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIITVFVINVHHRSSSTHHPMAPWVRQLFLHKLPKIL 353          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Sea Lamprey
Match: chrna2a (cholinergic receptor, nicotinic, alpha 2a (neuronal) [Source:ZFIN;Acc:ZDB-GENE-040108-2])

HSP 1 Score: 160.614 bits (405), Expect = 1.731e-42
Identity = 103/323 (31.89%), Postives = 164/323 (50.77%), Query Frame = 3
Query:  237 VNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQ 1205
            V Y      +   D   Q++ TN W +  W D  L WDP +Y+ +  IR+  + +W+PDI L+N AD    V    +  + + G + W P A++KSSCS+++++FPFD Q C M FGSWTYD ++++L       D    VD K Y  + EW         I H   T   K              +   + +  + Y   +RR P FY   LIIPC+L+S L  +VF+LP++   K+ L +++ ++  + LLL+   IP+     PLIG +    MI +TLS  +   V+N + R      MP ++R++ +D + R L + +
Sbjct:    1 VRYAEFRTHLCDCDEKNQMMTTNVWLKQEWDDYKLQWDPAEYENVTSIRVPSELIWVPDIVLYNNADGDFAVTHMTKAHLFHTGRVRWKPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDL--VSMARD----VDLKDYWESGEW--------AIVHAVGTYNTKKY------------DCCPQVYPDITYSFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPATHAMPRWVRRVFLDRVPRWLVMRR 297          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Sea Lamprey
Match: chrnb1l (cholinergic receptor, nicotinic, beta 1 (muscle) like [Source:ZFIN;Acc:ZDB-GENE-060811-1])

HSP 1 Score: 140.969 bits (354), Expect = 4.407e-36
Identity = 102/358 (28.49%), Postives = 174/358 (48.60%), Query Frame = 3
Query:  144 VEKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLP----YVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQ 1205
             E+NLL+ L    + Y    RP   +  ++ V  G+ L Q++ L      +  +     +W D  L+WDP++YD +  IRL    +W+PDI L N  D          V+V   G++ WVP ++++SSC +++ YFPFD Q C M F S+TYDTS++ L  Y             +D   +  + EW         I H    K     R   YQ+IT              + + + R P FY+  +++PCIL+++     F+LP ++  K+ L +++ +A  + LLLL   +P      P+I ++    M+++T    L  IV+N + R      MP ++R+I I ++ + L++ +
Sbjct:   23 AEENLLKDLFVVQQ-YKTLVRPARTATGRVTVRLGMTLSQLISLPACQPDMTLSRLISLSWEDPRLSWDPRNYDNLRSIRLSPKRVWLPDIALSNNNDGNFDFGLYVHVLVDYTGAVRWVPPSIYRSSCGMQVKYFPFDWQNCSMVFQSFTYDTSEINLE-YALDEHRQEIRHIIIDESTFPVSGEWQ--------IKHKPSRKNTNP-RDPLYQDIT--------------FYLIMERKPLFYIINIVVPCILITICAVFTFYLPPDAGEKMGLCISVLLALTVFLLLLADKVPETSLGVPVIVNYLMFTMVIVTACVILTVIVLNLHFRSPATHIMPYWVRRIFIHSLPKYLWIER 355          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008550.1 (pep scaffold:Pmarinus_7.0:GL476601:34:38373:1 gene:ENSPMAG00000007717.1 transcript:ENSPMAT00000008550.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 130.183 bits (326), Expect = 6.843e-33
Identity = 112/464 (24.14%), Postives = 206/464 (44.40%), Query Frame = 3
Query:  357 DYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQFIXXXXXXXXNNCNVYITQSPAGKIQHKLY--VPELTCNKFMATDIPNIEETSTSQDLSNRNNINKPYSKNFISADKNLNQKYSRNNGHRSHNQKPNSEINNLPNPGVSNSHDSPIMICGGTSSIEKDVIEITRYVRKYIGKQKEAQRKNQ-LTMEWRTLGLVLDRLFCIFYMATIVIAVI 1739
            ++ G+  +R +   +W PDI L+N ADER        V+V+  G+   +P  + KS+C +++ +FPFDVQ C + FGSWT+D   ++L         +   D   YI N EW                 +I   R   Y +        Q+ +  + Y + +RR   +Y   L++PC+L+S L  +VF LP +S  K+ LG+ + ++  + +LL+   +P    + PLIG +F   MI++  S  +  IV+ ++        MP ++R I++D                      C  ++     G+ +H+L   +  L  N  ++ D+  +    ++  +  + N +  +   F + D    Q  + ++G     +   +       PG +     P    G +S I K +IE+     +YI  +   Q +N+ +  EW+    V+DRL  + +    +I+ I
Sbjct:    2 EHPGVKNLRFQPHQIWTPDILLYNSADERFDATFHTNVLVNYTGNCQHLPPGMLKSTCYIDVRWFPFDVQKCDLKFGSWTHDGWLIDLQ--------MLEADTSGYIANGEWD--------------LVEIPGKRNELYYDCC------QEPYPDVTYTLTIRRRTLYYGLNLLVPCVLISALSLLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIGQYFASTMIIVAFSVVVTVIVLQYHHHNPDGKKMPQWVRVILLD---------------------WCAWFLRMKQPGRERHELARRLSILHRNSMVSLDLALL----SASGIHKKTNGHGVF-IGFTNPDAP-QQPPTSDSGVMCGRETCFNSTGPEEEPGNAQRGMPPDPTAGMSSEITKILIEL-----RYIAGRFRTQDENEAIASEWKFAAAVVDRLCLLAFTLFTIISTI 405          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Nematostella
Match: EDO42054 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2J7])

HSP 1 Score: 180.259 bits (456), Expect = 6.766e-50
Identity = 113/355 (31.83%), Postives = 190/355 (53.52%), Query Frame = 3
Query:  132 SKKSVEKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHRE---ARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGR 1187
            S+++ EK LL  L ++Y+      RPV +  +K+ V + L+L+QI+ ++  +Q++  + W R  W + +L W+   Y GI+ + L    +W+PDI L+N ADE      E     V+ S+DG+  W   A F S+C++ + YFPFD Q C + FGSWTY  ++L +      +DS    D   Y++N EWH      K    L+R           + N        +  F+ +   + ++R P +YVF LIIPC L++ L  I F+LP ES  K+ LG+ + +A  + LLL+  ++P+     PL+G +F   M +  +S     +++NF+ R     PMP++++ I++D + R
Sbjct:   33 SRETAEKRLLADLFRNYD---SEVRPVFNDSDKVNVEFSLSLIQIIAVNSKSQLVTVSVWIRQKWTNPMLAWNTSKYGGIESVNLNPAKVWIPDIILYNNADETYAGGLEKYKTSVIASSDGTQEWNSPASFTSTCNINVRYFPFDSQNCSLKFGSWTYVGNRLTMT---STSDS---ADLSKYVNNGEWHLLAMPAK----LNRV----------FYNCC------KYPFYDVTLYLEIQRKPLYYVFNLIIPCALIATLTLIKFFLPPESGEKVGLGITVLLAMTVFLLLVAETLPSTSDHIPLLGQYFVATMFVTAISLVATCLILNFFHRNPSTSPMPHWVKVIILDYMAR 358          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Nematostella
Match: EDO47969 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKU6])

HSP 1 Score: 172.17 bits (435), Expect = 2.346e-48
Identity = 108/363 (29.75%), Postives = 185/363 (50.96%), Query Frame = 3
Query:  147 EKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFAD-------ERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKG---PMPNYIRKIMIDNIGRLLFVSQ 1205
            E+ L+  L++ Y     N RPV +S + ++V +G+ +VQI+ ++   QI++TN W R  W +ELL W P +Y+G+  +RL+   +W+PDI L++ AD       E+ K H    V++S DGS  W   A F+S+C ++++YFPFD Q C M FGSWTY  + +++     P  S        Y+ + EW          S ++             + I+D           +   + +RR P FY F LI PC+++  ++ + F+LP ES  ++ L + + +A  + L L+  ++P   ++ PL+G F+   M  I +S      V+N + R         MP ++  I++  +  +L V Q
Sbjct:    1 EQRLISDLLQGY---SRNARPVLNSNHTLKVFFGMEIVQIVNVENRNQIIQTNVWIRQRWDNELLTWHPSNYEGVQTVRLDAKSVWIPDIVLYDSADSVFSGGHEKYKTH----VIISKDGSSAWFSPASFRSTCKIDVTYFPFDEQTCYMKFGSWTYTIADVDIQASPAPVKS------SKYLKSAEWDLMSATTSRKSQIYACCP---------EPISD-----------VTIAMTIRRKPLFYAFNLITPCMIMLTMILLGFFLPPESGERITLSITVLLAMAVFLQLVAETLPRNSESIPLLGRFYITIMTEIAVSLMATCWVLNIHHRNSGTTLVVEMPKWVDVIVLRWLAVVLCVRQ 330          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Nematostella
Match: EDO32053 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW63])

HSP 1 Score: 157.918 bits (398), Expect = 2.847e-43
Identity = 104/356 (29.21%), Postives = 179/356 (50.28%), Query Frame = 3
Query:  147 EKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADER---MKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQ 1205
            E  LL+ L+++Y     + RPV +  + +++  G+ L Q++ L+   QIL  N W R  W D LL W+P D+ GI  I +  D +W PD+ L+N  D R   +    +  V+V++DGS  W+  A+ KS C +++ +FPFDVQ C + FGSWT+D  ++++H      +S   +D + +  N EW   G   +    ++                        + +  + Y I LRR   FYVF +++P  +++LL    F+LP  S  ++   + + +A  + L+++  +IP +    PL+  FF  +MI I LS     +VI F      K PM + I+ ++ D +   L + +
Sbjct:    1 EPALLKYLLQNY---SKDARPVLNVNDPVQLKLGIMLRQVIDLNERDQILTINVWIRQYWKDHLLKWNPDDFGGIKSINIAPDRVWKPDVLLYNRTDLRFGSLNNKIDTNVIVNHDGSTTWLAPAIIKSECKIDVRFFPFDVQSCELTFGSWTHDGLKIDIH---LKQES--GIDTENFSDNREWFLKGTSGRRDVKMYIC--------------------CPEPYPTVTYTIILRRRAMFYVFNMVLPTGVIALLSLFSFYLPPNSGERVSFVITVLLAMSVYLIMVTENIPRSTD-IPLVSKFFMASMIQIALSLAATCVVIRF---DTTKKPMSSVIKLVVNDWLATALLMKK 324          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Nematostella
Match: EDO44896 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUG1])

HSP 1 Score: 157.532 bits (397), Expect = 1.723e-41
Identity = 109/362 (30.11%), Postives = 183/362 (50.55%), Query Frame = 3
Query:  147 EKNLLQKLMKSYEFYGVNGRPVND-SRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHRE---ARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWH-TDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVR--GDRKGPMPNYIRKIMIDNIGRLLFVSQFI 1211
            E  LL  L+K Y     +  PV   ++ +  V +GL LVQ++ +D   QI+ TN W R  W + LL WDP  Y GI ++R++   +W+PDI L+N AD       E    RV++++DG   W   A F+S+C +++++FPFD Q C M FGSWT++   L++     P  S        Y+ + EW      K++N+ +              Y   T         F  +      RR P FYVF LI+PC++++ +V + F LP ES  ++ L + + +A  + L L   ++P      P++G F+   M+ + LS      V++ + +  G    P+P++++  M+  +G++L V + I
Sbjct:   12 EHTLLGDLLKGYN---KDAHPVPILNKTQYMVTFGLELVQLVNVDDKNQIITTNVWVRQRWTNLLLKWDPDKYGGITRVRIDASKIWIPDIVLYNSADSEFSGGLEKYKTRVILNHDGVNAWYSPASFRSTCQIDVTFFPFDQQTCFMKFGSWTFEVVDLDIFADKSPLHS------SQYMKSAEWDLIAASKKRNVEY--------------YACCT-------YPFSDVTVTWVFRRKPLFYVFNLIVPCLIITGMVLLGFMLPPESGERITLSITVLLAMAVFLQLAAENLPRNSDNVPVLGIFYITVMVEVALSLIATCYVLHIHHKNSGIAVVPVPHWVQVYMLGYLGKILGVKKPI 343          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Nematostella
Match: EDO40862 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S622])

HSP 1 Score: 150.984 bits (380), Expect = 5.311e-41
Identity = 94/327 (28.75%), Postives = 174/327 (53.21%), Query Frame = 3
Query:  147 EKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMK--VHR-EARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDG-EKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINF 1115
            E+ LL+ L ++Y  Y    RP  +S     V +   L QI+ L  N Q+L+   +    W + +L WDP+DY G+ +I +  + +W+PDI ++N A++ +    H+ +  VV+  +G+ +W+  A+F ++C +++ YFPFD Q C + FGSWT+D+S+L++      N S    +   Y  + EW   G E+++N+ +                      +   K +  + Y + +RR   FY   LI+P +L++ +V + F LP ES  ++ LG+ + +A  + L  +  ++P+   + PL+G F+ + M +I+LS     I++N+
Sbjct:    1 EQRLLRDLFQNYSKYA---RPSIESDAPAIVTFRAKLKQIVDLKDNEQLLKIILYNYMQWENPILTWDPRDYGGVQEINVAPEEVWVPDIVIYNSAEDVLGGLTHKYKTDVVIQANGTNIWLAPAMFLTTCQLDVRYFPFDEQKCLLKFGSWTHDSSRLDMR--TQTNGS----NKDIYTEHGEWQLVGVEQKRNVKYY---------------------DCCPKPYVDISYTVHIRRKSLFYSLYLILPALLITSMVLVGFHLPPESGERMQLGITVLLAMIVFLQFVYQNLPSTSDSAPLLGKFYIVMMFLISLSLGCTCIILNY 297          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Medaka
Match: ENSORLT00000016544.2 (neuronal acetylcholine receptor subunit alpha-10-like [Source:NCBI gene;Acc:101157879])

HSP 1 Score: 206.453 bits (524), Expect = 2.546e-58
Identity = 157/563 (27.89%), Postives = 268/563 (47.60%), Query Frame = 3
Query:  138 KSVEKNLLQKLMKS-YEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDG-EKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQFIXXXXXXXXNNCNVYITQSPAGKIQHKLYVPELTCNKFMATDIPN------------IEETSTSQDLSNRNNINKPY---SKNFISADKNLNQKYSRNNGHRSHNQKPNSEINNLPNPGVSNSHDSPIMICGGTSSIEKDVIEITRYVRK---------YIGKQKEAQRKNQLTM-EWRTLGLVLDRLFC-IFYMATIVIAVII 1742
             + +    QKL+   +  Y    RPV D+ N I V   + L QI+ +D   QIL T  W R  W D  L+W  +DYDG+D IR+    +W PDI L+N A++      E  VV+ NDG ++W   A+ KSSCSV++++FPFDVQ C + FGSWT++ +Q++L       ++L   D   ++ N EW   G   +KN+              + Y   +D        +  + + + L+R  SFY+F L+IPC+++S L  + F+LP +S  K+ LG+ + +A  +  LL+  S+P + ++ PLIG ++   M M+T ST L   ++N +  G    P+P + ++ +++ + R+ F+ +          ++C      S A  ++  L   E       A                 +EE +T   LS   ++ K        F++ D +  +  +   GH+   +K NS        G      S +   GG     ++++  T+ V +         +I    + QR  QL + EWR +  V+DR F  +F++    ++V+I
Sbjct:   22 SAAQGRFAQKLLNDLFSNYTSALRPVEDTDNIINVTLQITLSQIIDMDERNQILTTYLWIRQVWMDAFLSWRKEDYDGLDTIRIPSSLVWRPDIVLYNSANDEFSSSMETNVVLRNDGQVMWDQPAITKSSCSVDVAFFPFDVQQCHLTFGSWTHNGNQMDLF------NALDSADLSDFVPNVEWEVLGMPAKKNV--------------ILYGCCSD-------PYPDITFTLNLKRRASFYIFNLLIPCMMISFLAPLGFYLPADSGEKVSLGVTVLLALTVFQLLVAESMPPS-ESVPLIGKYYIATMTMVTASTALTIFIMNIHHCGSEARPVPQWAQRFVLNFLARICFLRE--------AGDSC-----LSRASSLKQPLSQQESDAPSAGAGTTGTNWDRNGQVWRGKVEEDNTGVSLSTEQDLTKQVIWKEDLFVTIDHSAERGAA--GGHK-EGEKSNSMSAGGVAAGEHAEEKSDVE--GGAQQNRREILVRTQCVCQHQRLRSNVEFIASSYQDQRVAQLRITEWRKVAKVMDRFFMWLFFILFFFMSVLI 538          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Medaka
Match: chrna9 (cholinergic receptor nicotinic alpha 9 subunit [Source:NCBI gene;Acc:101173121])

HSP 1 Score: 193.741 bits (491), Expect = 2.781e-54
Identity = 155/534 (29.03%), Postives = 251/534 (47.00%), Query Frame = 3
Query:  150 KNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLR-FLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQFIXXXXXXXXNNCNVYITQSPAGKIQHKLYVPELTCNKFMATDIPNIEETSTSQDLSNRNNINKPYSKNFISADKNLNQKYSRNNGHRSHNQKPNSEINNLPNPGVSNSHDSPIMICGGTSSIEKDVIEITRYVRKYIGKQKEAQRKNQLTM-EWRTLGLVLDRLFC-IFYMATIVIAVII 1742
            + LL+ LM   E Y  + RPV D+   + V+  + L QI  +D   Q+L T  W R  WHD  L WD +DYD ++ I +  D +W PDI L+N ADE         V +  +G I+W   A+ KSSC V++SYFPFD Q C + FGSWTY+ +Q+++       DS    D   ++ N EW   G              + ++R  + Y   +D        +  + Y + L+R  SFY+F L++PC L+S L  + F+LP +S  K+ LG+ + +A  +  LL+  S+P A ++ P IG ++   M MIT ST L   ++N +  G    P+P++ + ++ID + ++ FV +           NC      +P  K +  LY  E           P   E+    D  +          +F+  D N   KYS  + H+ H  + N  IN        + H   ++       + K++        +YI      QR   + + EW+ +  V+DR F  IF+    +++++I
Sbjct:   20 RKLLKDLM---EDYSSDLRPVEDTDEALNVSLQITLSQIKDMDERNQVLTTYLWIRQVWHDAYLKWDKEDYDDLEMINIPSDRVWKPDIVLYNKADEESSGPSTTNVKLRYNGEIVWDSPAITKSSCVVDVSYFPFDWQSCNLTFGSWTYNGNQVDI---SLGMDS---GDLSDFVENVEWECHG--------------MPAVRNVMMYGCCSD-------PYTEITYTLLLKRRSSFYIFNLLLPCFLISFLAPLGFYLPADSGEKVSLGVTVLLALTVFQLLVAESMPPA-ESMPYIGKYYIATMTMITASTSLTIFIMNIHFCGAEAKPVPHWAKVLIIDYMSKIFFVYE--------VGENCT-----TPESK-RTPLYPEE-----------PMGVESVYYDDCCH---------DSFLHHDSN-PHKYSLQH-HQHHKGQANGSING------CHHHQRLVLTYPSDLQLVKNI--------QYIANCFREQRATCIKVAEWKKVAKVMDRFFMWIFFFMVFLMSILI 472          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Medaka
Match: chrna9 (cholinergic receptor nicotinic alpha 9 subunit [Source:NCBI gene;Acc:101173121])

HSP 1 Score: 193.356 bits (490), Expect = 1.873e-53
Identity = 153/556 (27.52%), Postives = 255/556 (45.86%), Query Frame = 3
Query:  150 KNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLR-FLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQFIXXXXXXXXNNCNVYITQSPAGKIQHKLYVPELTCNKFMATDIPNIEETSTSQDLSNRNNINKP------YSKNFISADKNLNQKYSRNNGHRSHNQKPNSEINNLPNPGVSN----------------SHDSPIMICGGTSSIEKDVIEITRYVRKYIGKQKEAQRKNQLTM-EWRTLGLVLDRLFC-IFYMATIVIAVII 1742
            + LL+ LM   E Y  + RPV D+   + V+  + L QI  +D   Q+L T  W R  WHD  L WD +DYD ++ I +  D +W PDI L+N ADE         V +  +G I+W   A+ KSSC V++SYFPFD Q C + FGSWTY+ +Q+++       DS    D   ++ N EW   G              + ++R  + Y   +D        +  + Y + L+R  SFY+F L++PC L+S L  + F+LP +S  K+ LG+ + +A  +  LL+  S+P A ++ P IG ++   M MIT ST L   ++N +  G    P+P++ + ++ID + ++ FV +              +Y  + P G     +Y  +   + F+  D  N  + S      ++   N        +  N       L +  S  +  + +++ P  E++   +P   N                 HD     C      ++ V  I     +YI      QR   + + EW+ +  V+DR F  IF+    +++++I
Sbjct:   26 RKLLKDLM---EDYSSDLRPVEDTDEALNVSLQITLSQIKDMDERNQVLTTYLWIRQVWHDAYLKWDKEDYDDLEMINIPSDRVWKPDIVLYNKADEESSGPSTTNVKLRYNGEIVWDSPAITKSSCVVDVSYFPFDWQSCNLTFGSWTYNGNQVDI---SLGMDS---GDLSDFVENVEWECHG--------------MPAVRNVMMYGCCSD-------PYTEITYTLLLKRRSSFYIFNLLLPCFLISFLAPLGFYLPADSGEKVSLGVTVLLALTVFQLLVAESMPPA-ESMPYIGKYYIATMTMITASTSLTIFIMNIHFCGAEAKPVPHWAKVLIIDYMSKIFFVYEVGENCTTPESKRTPLY-PEEPMGV--ESVYYDDCCHDSFLHHD-SNPHKYSLQHHQHHKGQANGSINGCHHHRSNQNKNTARLGRGESNQDCTQHYHRIPRGEMDYQASPKPRNHLNGGIKERILYPPEKHHDQSCPCCCPCLQYKQLVKNI-----QYIANCFREQRATCIKVAEWKKVAKVMDRFFMWIFFFMVFLMSILI 541          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Medaka
Match: chrna3 (neuronal acetylcholine receptor subunit alpha-3 [Source:NCBI gene;Acc:101159658])

HSP 1 Score: 192.971 bits (489), Expect = 3.298e-53
Identity = 143/540 (26.48%), Postives = 265/540 (49.07%), Query Frame = 3
Query:  204 RPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWH-TDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQFIXXXXXXXXNNCNVYITQSP-----AGKIQ-HKLYVPELTCNKFMATDIPNIEETSTSQDLSNRNN----INKPYSKNFISADKNLNQKYSRNNGHRSHNQKPNSEINNLPNP---------------GVSNSHDSPIMICGGTSSIEKDVIEITRYVRKYIGKQKEAQRKNQLTMEWRTLGLVLDRLFCIFYMATIVIAVIIG 1745
            RPV +  + + V + +++ Q++ +D   QI+ TN W R+ W+D  L W+PK++ G++ IR+  + +W PDI L+N A    +V  + + ++  +G + W+P A+FKSSC ++++YFPFD Q C M FGSWTYD ++++L   G        ++ K +  + EW   D    K+    +  ++I       Y +IT              Y + +RR P FY   +IIPC+L+S L  +VF+LP++   K+ L +++ ++  + LL++  +IP+     PLIG +    MI +TLS  +   V+N + R  +   MP ++R++ +  + R++F+++    P      +    +   P     +G +Q HK   P       M + + N +    + +LSN NN     N+  S  F  + +  N  + + +G   ++ +  S                         S S D  IM     S   ++ IE  +Y+ + +  Q +A+   ++  +W+ + +V+DR+F    +   V+  I+G
Sbjct:   44 RPVENVSDPVIVQFEVSMSQLVKVDEVNQIMETNLWLRHIWNDYKLKWNPKEFGGVEFIRVPSNRIWKPDIVLYNNAVGDFQVDDKTKALLRFNGDVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWTYDKAKIDLVLIG------STINLKDFWESGEWTIIDAPGYKHDIKYNCCEEI-------YTDIT--------------YSLYIRRLPLFYTINMIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPKTHTMPCWVRRVFLGLLPRVMFMTRPERDPEKVAVGSSVQTVHLRPCTVHSSGTLQKHKARAP----GSSMMSSLTNRQRILNNTELSNLNNRSGDSNRCASSGFPGSGERCNCCWQKRSGKLPYDSEGGSGGLGCLGALSGGGAMGIGGETQFSSSESLDGRIMSLLPLSPEIREAIESVKYIAENMRLQNDAK---EVQDDWKYVAMVIDRIF----LWVFVLVCILG 545          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Medaka
Match: chrnb3a (neuronal acetylcholine receptor subunit non-alpha-3 [Source:NCBI gene;Acc:101168098])

HSP 1 Score: 188.734 bits (478), Expect = 1.692e-52
Identity = 126/356 (35.39%), Postives = 188/356 (52.81%), Query Frame = 3
Query:  129 LSKKSVEKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRK-GPMPNYIRKIMIDNIGRLL 1193
            LS   +E +LL+ L K Y+ +    RPV  + + I V +GL + Q++ +D   Q++ TN W    W D  L W+P DY GI  IR+  + +W+PDI L+  AD R +     + +V  DG+I W P A +KSSC++++++FPFD Q C M FGSWTYD + ++L           YVD K +  N EW            L+ T Q  S R          DE+    F  L Y   L+R P FY   LIIPC+ LS L  +VF+LP++   KL L  ++ V+  + LL+++  IP++ K  PLIG +    MI +T S  +   VIN + R      PM  +++ + +  + RLL
Sbjct:   28 LSLAELEDSLLRNLFKGYQKWV---RPVQHANDTITVRFGLKISQLVDVDEKNQLMTTNVWLWQEWIDVKLKWNPDDYGGITSIRVPSETIWLPDIVLYENADGRFEGSLMTKAIVRWDGTITWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGNMVDLVLVDH------YVDRKDFFDNGEWEI----------LNATGQRGSRR----------DEMYWYPF--LTYSFILKRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTFSIIVTVFVINVHHRSSATYHPMAPWVKSLFLQKLPRLL 352          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Planmine SMEST
Match: SMESG000073518.1 (SMESG000073518.1)

HSP 1 Score: 1151.35 bits (2977), Expect = 0.000e+0
Identity = 583/585 (99.66%), Postives = 585/585 (100.00%), Query Frame = 3
Query:   60 MHILCKNFVFIYAFVFINADDEFLSKKSVEKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQFIXXXXXXXXNNCNVYITQSPAGKIQHKLYVPELTCNKFMATDIPNIEETSTSQDLSNRNNINKPYSKNFISADKNLNQKYSRNNGHRSHNQKPNSEINNLPNPGVSNSHDSPIMICGGTSSIEKDVIEITRYVRKYIGKQKEAQRKNQLTMEWRTLGLVLDRLFCIFYMATIVIAVIIGIPTNADLMKMEVDPPEPSMILIE 1814
            MHILCKNFVFIYAFVFINADDEFLSKKSVEKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFILIIPCILLSLLVNIVFWLPTESPAKLLLGMNIFVAFFILLLLLKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQFIPLPPPQPPNNCNVYITQSPAGKIQHKLYVPELTCNKFMATDIPNIE+TSTSQDLSNRNNINKPYSKNFISADKNLNQKYSRNNGHRSHNQKPNSEINN+PNPGVSNSHDSPIMICGGTSSIEKDVIEITRYVRKYIGKQKEAQRKNQLTMEWRTLGLVLDRLFCIFYMATIVIAVIIGIPTNADLMKMEVDPPEPSMILIE
Sbjct:    1 MHILCKNFVFIYAFVFINADDEFLSKKSVEKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFILIIPCILLSLLVNIVFWLPTESPAKLLLGMNIFVAFFILLLLLKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQFIPLPPPQPPNNCNVYITQSPAGKIQHKLYVPELTCNKFMATDIPNIEQTSTSQDLSNRNNINKPYSKNFISADKNLNQKYSRNNGHRSHNQKPNSEINNIPNPGVSNSHDSPIMICGGTSSIEKDVIEITRYVRKYIGKQKEAQRKNQLTMEWRTLGLVLDRLFCIFYMATIVIAVIIGIPTNADLMKMEVDPPEPSMILIE 585          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Planmine SMEST
Match: SMESG000021568.1 (SMESG000021568.1)

HSP 1 Score: 463.381 bits (1191), Expect = 1.948e-156
Identity = 274/568 (48.24%), Postives = 385/568 (67.78%), Query Frame = 3
Query:   81 FVFIYAFVFINADDEFLSKKSVEKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWY--GFPNDSLPYVDFKAYIHNNEWHTDGEKEKNISHLHRTK-QIKSLRFLRYQ-NITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQFIXXXXXXXXNNCNVYITQSPAGKIQH-KLYVPELTCNKFMATDIPNIEETSTSQDLSNRNNINKPYSKNFISADKNLNQKYSRNNGHRS--HNQKPNSEINNLPNPGVSNSHDSPIMICGGTSSIEKDVIEITRYVRKYIGKQKEAQRKNQLTMEWRTLGLVLDRLFCIFYMATIVIAVIIGIPTNAD 1763
             +F+   +F+    + ++  SVEKNL   ++ +Y+ YG+ GRPV+ S+  ++V YGL L+Q+L LD N QILRTNCW  Y WHD+LL W+P ++ GI +IR+  D +W PDI+L+NFAD R++  R ARVVV + G  LWVPQ++FKS+C+VEI+YFPFD QIC ++FGSW YD  QL++ W+     N S+PY+DF  Y+ +NEW TDGE +  +      K QIKS++  R +  ++   + I K + VLRY +RLRRN SFYV IL+IPCILLS L  +VFWLP ESPAK++LGMNIFVAFF+LLLLL  S P+AVK FPLIG++FCLNMIMITLSTFL  +VIN+Y RGD  GP+P  +R+I+++ +GRLL V Q I  P P   N  +  +T++  G I+  +L +P L  NKF+ + +    E    QDLS RN    P+  N   A+ N+ Q   R     S  +   P + +   PNP ++++ DSP+++   T ++E DV E+ RY+R ++ +QKE  RKN ++MEWRTL LVLDRLF + Y+++I+IAVI  IP++ +
Sbjct:    1 MIFLIFGLFLCRGTDTVNWPSVEKNLTVSILNNYQRYGIFGRPVSHSKELMKVQYGLQLIQLLDLDENKQILRTNCWSMYRWHDKLLEWNPAEHGGITEIRVFPDQIWTPDIKLYNFADVRLREARVARVVVKHTGKTLWVPQSIFKSTCAVEITYFPFDTQICMLEFGSWAYDIHQLDIIWWVPDGTNVSMPYIDFNDYLQSNEWRTDGEVDFQLKLEGDNKTQIKSVKKYRTRVYVSSNGQPINKHYPVLRYLVRLRRNSSFYVLILVIPCILLSSLTLVVFWLPPESPAKMMLGMNIFVAFFVLLLLLAESTPSAVKKFPLIGAYFCLNMIMITLSTFLAALVINYYFRGDFAGPLPILVRRIIVEGLGRLLLVRQHI--PLPDETNLMDRVLTRAENGCIRKCRLKIPNLDSNKFLTSPV-QTAEPPLQQDLSPRN--TNPFINNDELAESNVWQTNVRPLRSYSSVYRNTPQASMTARPNP-ITDTEDSPLLMRCNT-TLENDVRELKRYIRMFVNRQKENNRKNLISMEWRTLALVLDRLFFVLYISSILIAVIACIPSSTE 561          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Planmine SMEST
Match: SMESG000023360.1 (SMESG000023360.1)

HSP 1 Score: 446.432 bits (1147), Expect = 2.832e-150
Identity = 256/553 (46.29%), Postives = 349/553 (63.11%), Query Frame = 3
Query:  138 KSVEKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDS------LPYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEI---IQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQFIXXXXXXXXNNCNVYITQSPAGKIQHKLYVPELTCNKFMATDIPNIEETSTSQDLSNRNNINKPYSKNFISADKNLNQKYSRNNGHRSHNQKPNSEINNLPNP------GVSNSHDSPIMICGGTSSIEKDVIEITRYVRKYIGKQKEAQRKNQLTMEWRTLGLVLDRLFCIFYMATIVIAVIIGIP 1751
            KSVEK L++ L+  Y+ +GV GRPVN S N I V YGLAL+QILGL+ N QILRTNCW RY W D LL WDP +Y GI QIR+    +W PDI+L NFADER+   REARVV+SNDG++LW+PQALFKS+C V I+YFPFD Q+C+++FGSWTYDT+QL L W+   ND       +PYVD+  Y+ +NEW TDG+ EK I    R  QIKS + +R   IT+ + +   I + +H+L Y IR++RN SFYVFIL+IPC+LLS L  ++FWLP ESPAK++LGMNIFVAFFILLLLL  S P++VK FPLIG++FCLNMI+ITLSTFL  +V+N Y RGD KG +P  IR++ ID +G+L+   Q                  Q  +   Q  L+   +   K   + I + E+       + R+ + K                   N G+R  N+    EI+    P      G+SN H   I+        EKD+ +I  ++++++ +QK+   K+ ++ EWR+L L+LDR+F   Y+  I+IA+++ IP
Sbjct:   27 KSVEKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYDRKLQIKSEKKIRM--ITERNHLGQNITRRYHILEYGIRMKRNSSFYVFILVIPCLLLSCLTLVLFWLPPESPAKMMLGMNIFVAFFILLLLLAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQ------------------QEVSTIHQGILFTMNIGKGK---SKIKSTEKNFQINHAAFRSKMRK-----------------QLNTGNRGENE---YEIDGDEKPELNKKDGISN-HSFNIL--------EKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLYVTAILIALVVLIP 527          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Planmine SMEST
Match: SMESG000005358.1 (SMESG000005358.1)

HSP 1 Score: 333.569 bits (854), Expect = 1.046e-106
Identity = 185/381 (48.56%), Postives = 262/381 (68.77%), Query Frame = 3
Query:   66 ILCKNFVFIYA-FVFINADDEFLSKKSVEKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQ 1205
            +L   F+ I+  F  +NA  E    KS+EK+L++ L+  YE +G+ GRPVN+S   I + + L L+QIL LD N QIL TNCW    W D LL WDP+ Y  I  +R+  D++W PDI L+NFADER +  RE RV +  +G +LWVPQ+L+KSSCSVEI+YFPFD Q C+++FGS  YD+++L++ W+   N S  Y+D+  Y+ +NEW   G    +      T++I S +  R+  I++ +   +  + +LRY +RL RNPSFY+ ILI+PC LLSLL  ++FWLP ESPAKL+LG++IFVAFF+LLLLL    P  VK FPLIG++FCLNM+MIT STFL T++IN + +G + GP+P  IR+I+++ +GRL+ + Q
Sbjct:    1 MLMNKFLMIFGLFPVLNALTEV---KSIEKDLIRTLINKYEHHGIFGRPVNNSMETIVIEHKLQLIQILDLDENRQILVTNCWSNLRWKDSLLIWDPQKYGNITTVRVYPDHIWTPDIMLYNFADERSEDRRECRVKIYANGMVLWVPQSLYKSSCSVEITYFPFDTQNCKLEFGSLAYDSTKLDIIWWITENISENYIDYADYMKSNEWEIYGSSIDS----SITEKIFSKKIYRFSQISEKES--KLLYPILRYILRLNRNPSFYITILIVPCTLLSLLTLVIFWLPPESPAKLMLGISIFVAFFVLLLLLADFTPREVKNFPLIGAYFCLNMVMITSSTFLATLIINIHFKGAKTGPIPKTIRRIILEGLGRLVLIRQ 372          

HSP 2 Score: 60.077 bits (144), Expect = 3.535e-9
Identity = 26/61 (42.62%), Postives = 42/61 (68.85%), Query Frame = 3
Query: 1560 GTSSIEKDVIEITRYVRKYIGKQKEAQRKNQLTMEWRTLGLVLDRLFCIFYMATIVIAVII 1742
            G    E+D+ EI+RY+R  + ++K    +N + ME+RTL L+LDRLF I Y++T+  +VI+
Sbjct:  445 GHLEFERDIREISRYIRIIVNREKTEISRNLIAMEYRTLALILDRLFFILYISTMATSVIV 505          
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Planmine SMEST
Match: SMESG000069967.1 (SMESG000069967.1)

HSP 1 Score: 291.582 bits (745), Expect = 3.336e-90
Identity = 195/587 (33.22%), Postives = 311/587 (52.98%), Query Frame = 3
Query:  141 SVEKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQKTFHVLRYRIRLRRNPSFYVFXXXXXXXXXXXXVNIVFWLPTESPAKLLLGMNIFVAFFIXXXXXKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQFIXXXXXXXXNNCNVYITQSPAGKIQHKLYVPELTCNKFMATDIPNIEETSTSQDLSNRNNINKPYSKNFISADKNLNQKYSRNNGHRSHNQ------KPNSEINNLP------------NPGVSNSH---------------------DSPIMICGGTSSI--EKDVIEITRYVRKYIGKQKEAQRKNQLTMEWRTLGLVLDRLFCIFYMATIVIAVII-----GIPTNAD 1763
            S EK L+ K++K Y+  G  GRPV + ++ + V YGLAL+QI+ LD   QIL  N W +YTW DE+L W+PK++  ++++R+  D +W PDI L+N+ADER+   R+  V V+  G I+W+P A+FKS+C ++IS FPFD Q C + FGSWTY   +L++  Y    ++   +D   Y  +NEW            LH+  +    RF+  +N+ D       TF ++     L+RN +++ ++L++PC+LLSLL  ++FWLP ESPAK++LGMNIFVAF +LL LL  + P+A  + P +G ++CLNMI+ITLSTFL  IVIN Y R D++  +P+++RK  ++   ++L + Q I                 S A   +  L   E+  ++     I   +E  T++   +R  I  P S         +  +    +G  S+ Q      + N+++ ++P            NPG S  +                               S+I  EK++ EI + ++  + K  E  R N++  EWR + +VLDRLF   Y   ++++ +I     G+P + D
Sbjct:    2 SGEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLY----ENFSEIDIIDYTESNEWLI----------LHKPAR----RFV-LKNMKDNTSQPDLTFFLI-----LKRNSAYHAYLLVVPCVLLSLLTLVIFWLPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMILITLSTFLSIIVINLYFRCDKRRNLPDWLRK-GVNATSKILGMKQVI-----------------SSASSEKLHLIKSEIKNSR---NHIKRQQEKETTE---SRETIPTPISPRARHKSSKMAMEMQNLSGSSSNYQTRFQYPRQNTDVTDIPYTAHSDIPRNSFNPGYSYEYRYSNAPPPAAPASPLPSSTTKKQTQQKKSNQSAILLEKNLSEIRKALKNLMTKIAEKDRGNRIAKEWRMVAMVLDRLFFWVYFVIVILSGLILLLPRGLPKSMD 540          
The following BLAST results are available for this feature:
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CHRNB35.689e-5233.98cholinergic receptor nicotinic beta 3 subunit [Sou... [more]
CHRNA49.177e-5233.15cholinergic receptor nicotinic alpha 4 subunit [So... [more]
CHRNA97.496e-5133.07cholinergic receptor nicotinic alpha 9 subunit [So... [more]
CHRNA62.735e-5031.64cholinergic receptor nicotinic alpha 6 subunit [So... [more]
CHRNA51.005e-4934.29cholinergic receptor nicotinic alpha 5 subunit [So... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acr-31.984e-5033.15Acetylcholine receptor subunit beta-type acr-3 [S... [more]
lev-14.821e-4531.56Acetylcholine receptor subunit beta-type lev-1 [S... [more]
acr-115.296e-4529.30AcetylCholine Receptor [Source:UniProtKB/TrEMBL;A... [more]
unc-389.669e-4430.32Acetylcholine receptor subunit alpha-type unc-38 ... [more]
acr-85.366e-4328.00AcetylCholine Receptor [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nAChRbeta18.112e-5633.68gene:FBgn0000038 transcript:FBtr0073299[more]
nAChRalpha51.426e-4927.21gene:FBgn0028875 transcript:FBtr0474155[more]
nAChRalpha51.523e-4927.21gene:FBgn0028875 transcript:FBtr0300594[more]
nAChRalpha51.523e-4927.21gene:FBgn0028875 transcript:FBtr0080594[more]
nAChRalpha51.523e-4927.21gene:FBgn0028875 transcript:FBtr0309867[more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CR847523.33.534e-6229.77neuronal acetylcholine receptor subunit alpha-10-l... [more]
chrnb3a8.704e-5534.33cholinergic receptor, nicotinic, beta polypeptide ... [more]
CR388402.11.601e-5427.35cholinergic receptor, nicotinic, alpha 9 [Source:N... [more]
chrna34.390e-5426.36cholinergic receptor, nicotinic, alpha 3 [Source:Z... [more]
chrna10a1.238e-5327.47cholinergic receptor, nicotinic, alpha 10a [Source... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CHRNA99.958e-5628.70cholinergic receptor, nicotinic alpha 9 [Source:NC... [more]
CHRNA91.004e-5528.60cholinergic receptor, nicotinic alpha 9 [Source:NC... [more]
prepl4.279e-5528.16prolyl endopeptidase-like [Source:Xenbase;Acc:XB-G... [more]
CHRNA25.821e-5525.96cholinergic receptor, nicotinic alpha 2 [Source:NC... [more]
ncaph1.103e-5432.87non-SMC condensin I complex subunit H [Source:Xenb... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Chrna61.355e-5225.94cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna41.813e-5229.60cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna31.968e-5225.60cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna32.606e-5225.60cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna43.246e-5229.60cholinergic receptor, nicotinic, alpha polypeptide... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P04755|ACH3_DROME1.256e-5433.42Acetylcholine receptor subunit beta-like 1 OS=Dros... [more]
sp|Q9I8C7|ACH10_CHICK1.317e-5433.99Neuronal acetylcholine receptor subunit alpha-10 O... [more]
sp|P18257|ACHN3_CARAU1.005e-5334.06Neuronal acetylcholine receptor subunit non-alpha-... [more]
sp|P09482|ACHA4_CHICK6.478e-5331.65Neuronal acetylcholine receptor subunit alpha-4 OS... [more]
sp|P09481|ACHA3_CHICK1.369e-5226.78Neuronal acetylcholine receptor subunit alpha-3 OS... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3FBT63.013e-16649.12Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K3FFX39.632e-16649.12Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A3Q0KEK55.794e-16349.13Putative nachr subunit OS=Schistosoma mansoni OX=6... [more]
G7YFG92.499e-16247.23Neuronal acetylcholine receptor subunit alpha-4 OS... [more]
A0A504YWH11.027e-16144.62Neuronal acetylcholine receptor subunit alpha-4 OS... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000019858.21.563e-5734.13neuronal acetylcholine receptor subunit alpha-10 [... [more]
ENSAMXT00000032409.13.492e-5729.37neuronal acetylcholine receptor subunit alpha-10 [... [more]
CHRNA92.160e-5328.08cholinergic receptor nicotinic alpha 9 subunit [So... [more]
chrnb3a3.948e-5333.42cholinergic receptor, nicotinic, beta polypeptide ... [more]
chrnb3a6.400e-5333.80cholinergic receptor, nicotinic, beta polypeptide ... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrna35.532e-5432.38cholinergic receptor, nicotinic, alpha 3 [Source:Z... [more]
chrnb3b8.859e-5333.71cholinergic receptor, nicotinic, beta 3b (neuronal... [more]
chrna2a1.731e-4231.89cholinergic receptor, nicotinic, alpha 2a (neurona... [more]
chrnb1l4.407e-3628.49cholinergic receptor, nicotinic, beta 1 (muscle) l... [more]
ENSPMAT00000008550.16.843e-3324.14pep scaffold:Pmarinus_7.0:GL476601:34:38373:1 gene... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO420546.766e-5031.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479692.346e-4829.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320532.847e-4329.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448961.723e-4130.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO408625.311e-4128.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000016544.22.546e-5827.89neuronal acetylcholine receptor subunit alpha-10-l... [more]
chrna92.781e-5429.03cholinergic receptor nicotinic alpha 9 subunit [So... [more]
chrna91.873e-5327.52cholinergic receptor nicotinic alpha 9 subunit [So... [more]
chrna33.298e-5326.48neuronal acetylcholine receptor subunit alpha-3 [S... [more]
chrnb3a1.692e-5235.39neuronal acetylcholine receptor subunit non-alpha-... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000073518.10.000e+099.66SMESG000073518.1[more]
SMESG000021568.11.948e-15648.24SMESG000021568.1[more]
SMESG000023360.12.832e-15046.29SMESG000023360.1[more]
SMESG000005358.11.046e-10648.56SMESG000005358.1[more]
SMESG000069967.13.336e-9033.22SMESG000069967.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005173 ID=SMED30005173|Name=Neuronal acetylcholine receptor subunit alpha 4|organism=Schmidtea mediterranea sexual|type=transcript|length=1989bp
GAAATTTTGTTCCTATTAATAAAATCGATATTTTTATAATTATATGTTTT
TGAAAAGAAATGCATATTTTATGTAAAAATTTTGTATTTATTTATGCATT
TGTATTTATTAATGCTGATGACGAATTTTTATCTAAAAAATCTGTTGAGA
AGAATCTGCTACAAAAACTTATGAAAAGTTATGAATTTTACGGAGTTAAT
GGACGTCCAGTGAATGATAGTCGAAATAAAATAAGAGTAAATTATGGATT
GGCTTTAGTTCAGATTCTTGGTCTTGATGGAAATACTCAGATTTTACGGA
CTAATTGCTGGGGTCGATATACATGGCATGATGAATTATTGAATTGGGAT
CCCAAAGACTATGATGGAATTGATCAAATTCGTTTAGAAAAGGACTATAT
GTGGATGCCGGATATTCAATTATTTAATTTTGCTGATGAACGAATGAAAG
TGCATAGAGAAGCCAGAGTAGTTGTAAGCAACGATGGCAGCATTCTATGG
GTTCCACAAGCCCTTTTTAAAAGTTCTTGTAGTGTTGAGATATCGTACTT
TCCTTTTGATGTTCAAATTTGCAGAATGGATTTTGGATCATGGACATATG
ATACATCTCAATTAGAGTTGCATTGGTACGGATTTCCTAACGATTCATTG
CCATATGTAGATTTTAAAGCATATATTCACAATAATGAATGGCACACTGA
TGGTGAAAAAGAAAAAAACATTAGTCATTTGCATCGAACTAAACAAATAA
AGTCTCTACGATTTTTGCGATATCAGAATATTACAGATGGAGATGAAATT
ATACAGAAGACATTTCATGTTTTACGATATCGTATAAGATTAAGACGCAA
TCCCAGTTTTTATGTGTTTATTTTAATAATTCCTTGTATATTGCTCTCAC
TATTAGTCAATATCGTATTTTGGTTACCAACAGAATCTCCAGCTAAACTA
CTATTAGGTATGAACATATTTGTAGCATTTTTTATTCTGCTCCTCTTATT
GAAATCATCCATACCAACTGCAGTGAAAGCGTTTCCGTTAATTGGATCTT
TCTTCTGCCTTAACATGATAATGATCACTCTTTCAACATTTTTGGTGACA
ATCGTAATAAATTTTTATGTTCGAGGAGATCGAAAAGGCCCAATGCCAAA
TTACATCAGAAAAATAATGATTGATAACATTGGTCGTCTTTTATTTGTAA
GCCAGTTCATTCCACTTCCTCCTCCACAACCTCCTAATAACTGTAATGTT
TATATTACTCAATCTCCCGCTGGGAAAATTCAGCACAAGTTATATGTACC
TGAATTGACATGCAATAAGTTTATGGCAACTGATATTCCAAATATTGAAG
AAACTTCGACTTCTCAGGATTTGAGTAATAGAAATAATATAAATAAGCCG
TACTCTAAAAATTTTATTTCCGCTGATAAGAATCTTAACCAAAAATATTC
TCGAAATAATGGTCACAGATCACATAATCAGAAGCCGAATTCTGAAATTA
ATAATCTTCCTAACCCAGGAGTGTCGAATTCACATGATTCGCCTATCATG
ATTTGTGGCGGTACTAGTTCAATAGAGAAGGATGTTATAGAAATCACTCG
TTACGTCCGAAAATATATTGGAAAACAAAAAGAAGCACAGCGAAAAAATC
AATTAACAATGGAATGGAGGACTTTAGGGCTCGTGTTAGATAGATTGTTT
TGCATTTTCTATATGGCTACAATTGTTATAGCCGTAATTATTGGGATTCC
TACTAATGCTGATCTTATGAAAATGGAAGTCGACCCACCTGAGCCTAGTA
TGATTCTGATTGAGTAAAACTAAAAAACTTTATTTTTTAATTTTATCTTT
ATTATGTGTAGTTGGATGTAGAAATGTAGTAGTTTTTATAAAAAAATATT
AATTTAGAGTAATTAAAAATTGTATTATTAGAGCATTAGATTGATTTTTT
AGGGTAGAGATTAGTTCAAAGTCTATTGGTTATTTTTTG
back to top

protein sequence of SMED30005173-orf-1

>SMED30005173-orf-1 ID=SMED30005173-orf-1|Name=SMED30005173-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=586bp
MHILCKNFVFIYAFVFINADDEFLSKKSVEKNLLQKLMKSYEFYGVNGRP
VNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKD
YDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQ
ALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDSLPYV
DFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEIIQK
TFHVLRYRIRLRRNPSFYVFILIIPCILLSLLVNIVFWLPTESPAKLLLG
MNIFVAFFILLLLLKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVI
NFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQFIPLPPPQPPNNCNVYIT
QSPAGKIQHKLYVPELTCNKFMATDIPNIEETSTSQDLSNRNNINKPYSK
NFISADKNLNQKYSRNNGHRSHNQKPNSEINNLPNPGVSNSHDSPIMICG
GTSSIEKDVIEITRYVRKYIGKQKEAQRKNQLTMEWRTLGLVLDRLFCIF
YMATIVIAVIIGIPTNADLMKMEVDPPEPSMILIE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004888transmembrane signaling receptor activity
GO:0005216ion channel activity
GO:0004889acetylcholine-activated cation-selective channel activity
GO:0005230extracellular ligand-gated ion channel activity
GO:0022848acetylcholine-gated cation-selective channel activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0002056medial muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR036734Neur_chan_lig-bd_sf
IPR036719Neuro-gated_channel_TM_sf
IPR002394Nicotinic_acetylcholine_rcpt
IPR006201Neur_channel
IPR006202Neur_chan_lig-bd
IPR027361Acetylcholine_rcpt_TM
IPR006029Neurotrans-gated_channel_TM
IPR018000Neurotransmitter_ion_chnl_CS
Vocabulary: cellular component
TermDefinition
GO:0045211postsynaptic membrane
GO:0016021integral component of membrane
GO:0016020membrane
GO:0005886plasma membrane
GO:0030054cell junction
GO:0045202synapse
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0006810transport
GO:0034220ion transmembrane transport
GO:0060078regulation of postsynaptic membrane potential
GO:0060079excitatory postsynaptic potential
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002394Nicotinic acetylcholine receptorPRINTSPR00254NICOTINICRcoord: 101..115
score: 32.07
coord: 137..155
score: 43.16
coord: 119..131
score: 39.49
coord: 67..83
score: 29.67
IPR006201Neurotransmitter-gated ion-channelPRINTSPR00252NRIONCHANNELcoord: 157..171
score: 46.97
coord: 113..124
score: 39.78
coord: 259..271
score: 31.64
coord: 80..96
score: 33.24
IPR006201Neurotransmitter-gated ion-channelPANTHERPTHR18945NEUROTRANSMITTER GATED ION CHANNELcoord: 34..551
IPR006202Neurotransmitter-gated ion-channel ligand-binding domainPFAMPF02931Neur_chan_LBDcoord: 30..223
e-value: 1.8E-52
score: 177.9
IPR006029Neurotransmitter-gated ion-channel transmembrane domainPFAMPF02932Neur_chan_membcoord: 272..557
e-value: 1.1E-32
score: 114.0
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilyGENE3DG3DSA:2.70.170.10coord: 19..230
e-value: 1.4E-57
score: 196.8
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilySUPERFAMILYSSF63712Nicotinic receptor ligand binding domain-likecoord: 30..216
NoneNo IPR availableGENE3DG3DSA:1.20.58.390coord: 231..356
e-value: 1.0E-29
score: 105.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 468..487
NoneNo IPR availablePANTHERPTHR18945:SF783ACETYLCHOLINE RECEPTORcoord: 34..551
NoneNo IPR availableCDDcd19033LGIC_ECD_nAChR_proto-likecoord: 58..264
e-value: 1.90749E-82
score: 254.133
NoneNo IPR availableCDDcd19051LGIC_TM_cationcoord: 266..358
e-value: 2.59892E-25
score: 98.5888
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.522
NoneNo IPR availableTMHMMTMhelixcoord: 267..289
NoneNo IPR availableTMHMMTMhelixcoord: 541..563
NoneNo IPR availableTMHMMTMhelixcoord: 328..350
NoneNo IPR availableTMHMMTMhelixcoord: 296..318
IPR018000Neurotransmitter-gated ion-channel, conserved sitePROSITEPS00236NEUROTR_ION_CHANNELcoord: 157..171
IPR036719Neurotransmitter-gated ion-channel transmembrane domain superfamilySUPERFAMILYSSF90112Neurotransmitter-gated ion-channel transmembrane porecoord: 265..560