SMED30005172

Overview
NameSMED30005172
Smed IDSMED30005172
Length (bp)960
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30005172 (SMED30005172) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30005172 (SMED30005172) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30005172 (SMED30005172) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30005172 (SMED30005172) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005172

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30005172SMESG000018557.1 dd_Smed_v4_16515_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30005172SMESG000018557.1 dd_Smed_v4_16515_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30005172 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.002137:90171..91007 +2533
Homology
BLAST of SMED30005172 vs. TrEMBL
Match: A0A1I8GV57 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 8.882e-19
Identity = 67/232 (28.88%), Postives = 104/232 (44.83%), Query Frame = 1
Query:  112 MKNLKSFIKFRNLNQKPKFHEVYLSKINDAFIILEEIRMKYRKCAMILSISNLAMIIVSLQFQSQWVKRIGNESL---------WSGLWDLCFLSSNFTFVGAHAQMKENKYNDHKMSICHVKIEYI----QRAVIGSLLAATCSGLIGSLLSIAGFITNNIFKKYYYFHSAAEFFLVSGFAILLVVIIYPISIRHYLDPKEKFILGYGYILCWIAAANYFLGFFIMMLDEF 768
            MK+LK+F+ F+  +       VY     + F   E+ R+++R      S+  L +    L   S W                  WSGLWD CFL            +  NK   H++   H+  E+     Q+A+IG L  +     IGS+L++ G    ++ +K YY+HSA E F VS  A  + V +YP  ++ ++   +    GYGY L W+ A   +L    MMLD+ 
Sbjct:   97 MKSLKNFLSFKVPDNSAYEQRVY----TEDFCFQEKRRLRWRCSGAGASVLALILYANMLHPASHWTAGPAGGGGGEGSGRGSAWSGLWDACFL------------LAFNKTVPHELQ--HISCEHFVPDWQKAIIGLLFFSVLFAAIGSVLAVCGLCAGHLPRKMYYYHSAGEIFFVSAVATTIAVGVYPYVVQRFV--YQSASYGYGYGLGWVTAGLLYLASLSMMLDDL 308          
BLAST of SMED30005172 vs. TrEMBL
Match: A0A1I8IT32 (VWFA domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 9.047e-17
Identity = 64/228 (28.07%), Postives = 99/228 (43.42%), Query Frame = 1
Query:  124 KSFIKFRNLNQKPKFHEVYLSKINDAFIILEEIRMKYRKCAMILSISNLAMIIVSLQFQSQWVKRIGNESL---------WSGLWDLCFLSSNFTFVGAHAQMKENKYNDHKMSICHVKIEYI----QRAVIGSLLAATCSGLIGSLLSIAGFITNNIFKKYYYFHSAAEFFLVSGFAILLVVIIYPISIRHYLDPKEKFILGYGYILCWIAAANYFLGFFIMMLDEF 768
            K+F+ F+  +       VY     + F   E+ R+++R      S+  L +    L   S W                  WS LWD CFL            +  NK   H++   HV  E+     Q+A+IG L  +     IGS+L++ G    ++ +K YY+HSA E F VS  A  + V +YP  ++ ++     +  GYGY L W+ A   +L    MMLD+ 
Sbjct: 1461 KNFLSFKVPDNSAYEQRVY----TEDFCFQEKRRLRWRCSGAGASVLALILYANMLHPASHWTAGPAGGGGGEGSGRGSAWSSLWDACFL------------LAFNKTVPHELQ--HVSCEHFVPDWQKAIIGLLFFSVLFAAIGSVLAVCGLCAGHLPRKMYYYHSAGEIFFVSAVATTIAVGVYPYVVQRFVYQSASY--GYGYGLGWVTAGLLYLASLSMMLDDL 1668          
BLAST of SMED30005172 vs. TrEMBL
Match: A0A1I8HVH0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 2.120e-10
Identity = 42/141 (29.79%), Postives = 66/141 (46.81%), Query Frame = 1
Query:  340 SGLWDLCFLSSNFTFVGAHAQMKENKYNDHKMSICHVKIEYIQRAVIGSLLAATCSGLIGSLLSIAGFITNNIFKKYYYFHSAAEFFLVSGFAILLVVIIYPISIRHYLDPKEKFILGYGYILCWIAAANYFLGFFIMMLD 762
            SGLWD CF +++            +  +D + S+  + +  +   VIGS++A            + GF  + + +K YYFHS+ E F V      +  +IYP S++ +L      + GYGY L W  +    L  F MMLD
Sbjct:  189 SGLWDTCFTANDTCISAFDLPTTNSDASDWQKSVAFLLVSSVLLTVIGSVVA------------LCGFWVSYLPRKIYYFHSSGEIFFVCAMLSTISAVIYPYSLQRFL--LHSIVYGYGYFLGWATSGLQCLAAFCMMLD 315          
BLAST of SMED30005172 vs. TrEMBL
Match: A0A1I8IF80 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 2.943e-10
Identity = 42/141 (29.79%), Postives = 66/141 (46.81%), Query Frame = 1
Query:  340 SGLWDLCFLSSNFTFVGAHAQMKENKYNDHKMSICHVKIEYIQRAVIGSLLAATCSGLIGSLLSIAGFITNNIFKKYYYFHSAAEFFLVSGFAILLVVIIYPISIRHYLDPKEKFILGYGYILCWIAAANYFLGFFIMMLD 762
            SGLWD CF +++            +  +D + S+  + +  +   VIGS++A            + GF  + + +K YYFHS+ E F V      +  +IYP S++ +L      + GYGY L W  +    L  F MMLD
Sbjct:  221 SGLWDTCFTANDTCISAFDLPTTNSDASDWQKSVAFLLVSSVLLTVIGSVVA------------LCGFWVSYLPRKIYYFHSSGEIFFVCAMLSTISAVIYPYSLQRFL--LHSIVYGYGYFLGWATSGLQCLAAFCMMLD 347          
BLAST of SMED30005172 vs. TrEMBL
Match: A0A267EMJ4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029213g1 PE=4 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 2.996e-10
Identity = 42/141 (29.79%), Postives = 66/141 (46.81%), Query Frame = 1
Query:  340 SGLWDLCFLSSNFTFVGAHAQMKENKYNDHKMSICHVKIEYIQRAVIGSLLAATCSGLIGSLLSIAGFITNNIFKKYYYFHSAAEFFLVSGFAILLVVIIYPISIRHYLDPKEKFILGYGYILCWIAAANYFLGFFIMMLD 762
            SGLWD CF +++            +  +D + S+  + +  +   VIGS++A            + GF  + + +K YYFHS+ E F V      +  +IYP S++ +L      + GYGY L W  +    L  F MMLD
Sbjct:  223 SGLWDTCFTANDTCISAFDLPTTNSDASDWQKSVAFLLVSSVLLTVIGSVVA------------LCGFWVSYLPRKIYYFHSSGEIFFVCAMLSTISAVIYPYSLQRFL--LHSIVYGYGYFLGWATSGLQCLAAFCMMLD 349          
BLAST of SMED30005172 vs. Planmine SMEST
Match: SMESG000018557.1 (SMESG000018557.1)

HSP 1 Score: 503.056 bits (1294), Expect = 0.000e+0
Identity = 266/268 (99.25%), Postives = 267/268 (99.63%), Query Frame = 1
Query:  112 MKNLKSFIKFRNLNQKPKFHEVYLSKINDAFIILEEIRMKYRKCAMILSISNLAMIIVSLQFQSQWVKRIGNESLWSGLWDLCFLSSNFTFVGAHAQMKENKYNDHKMSICHVKIEYIQRAVIGSLLAATCSGLIGSLLSIAGFITNNIFKKYYYFHSAAEFFLVSGFAILLVVIIYPISIRHYLDPKEKFILGYGYILCWIAAANYFLGFFIMMLDEFCXXXXXXXXXXXXXXXXXXTYTLNKSKTNTKNSIQNNKESIQTNKENWV 915
            MKNLKSFIKFRNLNQKPKFHEVYLSKINDAFIILEEIRMKYRKCAMILSISNLAMIIVSLQFQSQWVKRIGNESLWSGLWDLCFLSSNFTFVGAHAQMKENKYNDHKMSICHVKIEYIQRAVIGSLLAATCSGLIGSLLSIAGFITNN+FKKYYYFHSAAEFFLVSGFAILLVVIIYPISIRHYLDPKEKFILGYGYILCWIAAANYFL FFIMMLDEFCSASTIKTSSISGSSSNAKTYTLNKSKTNTKNSIQNNKESIQTNKENWV
Sbjct:    1 MKNLKSFIKFRNLNQKPKFHEVYLSKINDAFIILEEIRMKYRKCAMILSISNLAMIIVSLQFQSQWVKRIGNESLWSGLWDLCFLSSNFTFVGAHAQMKENKYNDHKMSICHVKIEYIQRAVIGSLLAATCSGLIGSLLSIAGFITNNLFKKYYYFHSAAEFFLVSGFAILLVVIIYPISIRHYLDPKEKFILGYGYILCWIAAANYFLDFFIMMLDEFCSASTIKTSSISGSSSNAKTYTLNKSKTNTKNSIQNNKESIQTNKENWV 268          
BLAST of SMED30005172 vs. Planmine SMEST
Match: SMESG000069934.1 (SMESG000069934.1)

HSP 1 Score: 54.299 bits (129), Expect = 3.443e-8
Identity = 46/169 (27.22%), Postives = 82/169 (48.52%), Query Frame = 1
Query:  112 MKNLKSFIKFRNLNQKPKFHEVYLSKINDAFIILEEIRMKYRKCAMILSISNLAMIIVSLQFQSQWVKRIGNESLWSGLWDLCFLSSNFTFVGAHAQMKENKY-NDHKMSICH-VKIEYIQRAVIGSLLAATCSGLIGSLLSIAGFITNNIFKKYYYFHSAAEFFLVSG 612
            MK++     F+  + +     +Y    +D F + E  R  +R CA  L + + A++I  L  ++ W+K  G+  ++  LW  C    +    G+ +  K +KY +D     CH   I+      +G +L +     I +LL++ G I  N+ KK YYF+S+ E +LV+ 
Sbjct:   66 MKSMSILSVFKCPDDRSYSRRIY----SDEFQMAEIERKPFRICAFFLGLFSDALLITVLLPETPWLKEHGSSYIYC-LWRSC---EDIVLNGSTSHDKSHKYESDIAGHHCHGFMID------VGLILFSLFFTTIATLLNLMGIIVKNLPKKMYYFNSSYEMYLVTA 220          
BLAST of SMED30005172 vs. Planmine SMEST
Match: SMESG000029557.1 (SMESG000029557.1)

HSP 1 Score: 51.9878 bits (123), Expect = 2.494e-7
Identity = 29/113 (25.66%), Postives = 57/113 (50.44%), Query Frame = 1
Query:  439 ICHVKIE---YIQRAVIGSLLAATCSGLIGSLLSIAGFITNNIFKKYYYFHSAAEFFLVSGFAILLVVIIYPISIRHYLDPKEKFILGYGYILCWIAAANYFLGFFIMMLDEF 768
             C + I+   +++  +  S++ + C+ L+ +    +G    ++ KK YY+HS +EFF V+  +    ++I+ +  ++  +    F  GY Y L WI        F ++ LDEF
Sbjct:  239 TCSLAIQTPNWLKSVIFLSIIGSLCN-LLATFFGFSGVFVKHLPKKLYYYHSGSEFFCVASLSYGSGLLIFTLFSKNQFNKFTWFRYGYAYTLGWIGVLLSMTAFILLKLDEF 350          
BLAST of SMED30005172 vs. Planmine SMEST
Match: SMESG000074883.1 (SMESG000074883.1)

HSP 1 Score: 50.447 bits (119), Expect = 5.914e-7
Identity = 30/99 (30.30%), Postives = 55/99 (55.56%), Query Frame = 1
Query:  469 RAVIGSLLAATCSGLIGSLLSIAGFITNNIFKKYYYFHSAAEFFLVSGFAILLVVIIYPISIRHYLDPKEKFILGYGYILCWIAAANYFLGFFIMMLDE 765
            + +IG +  ++ +GL G +++I G I   I K+ YY+HS+ EF +++   I++ ++I+ IS R  L        G  + +C      YFL F ++ +DE
Sbjct:  170 KLLIGFICLSSLTGLCGLIVAILGCIHKPIHKQMYYYHSSGEFSVIAFAMIMVGLLIFFISDRRTLKFNS---FGLSFWMCLACGFLYFLAFILLTVDE 265          
BLAST of SMED30005172 vs. Planmine SMEST
Match: SMESG000055359.1 (SMESG000055359.1)

HSP 1 Score: 50.8322 bits (120), Expect = 6.574e-7
Identity = 28/113 (24.78%), Postives = 57/113 (50.44%), Query Frame = 1
Query:  439 ICHVKIE---YIQRAVIGSLLAATCSGLIGSLLSIAGFITNNIFKKYYYFHSAAEFFLVSGFAILLVVIIYPISIRHYLDPKEKFILGYGYILCWIAAANYFLGFFIMMLDEF 768
             C + I+   +++  +  S++ + C+ L+ +    +G    ++ KK YY+HS +EF+ V+  +    ++I+ +  ++  +    F  GY Y L WI        F ++ LDEF
Sbjct:  239 TCSLAIQTPNWLKSVIFLSIIGSLCN-LLATFFGFSGVFVKHLPKKLYYYHSGSEFYCVASLSYGSGLLIFTLFSKNQFNKFTWFRYGYAYTLGWIGVLLSMTAFILLKLDEF 350          
The following BLAST results are available for this feature:
BLAST of SMED30005172 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005172 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005172 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005172 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005172 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005172 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005172 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005172 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8GV578.882e-1928.88Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8IT329.047e-1728.07VWFA domain-containing protein OS=Macrostomum lign... [more]
A0A1I8HVH02.120e-1029.79Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8IF802.943e-1029.79Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EMJ42.996e-1029.79Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of SMED30005172 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005172 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005172 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005172 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005172 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005172 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000018557.10.000e+099.25SMESG000018557.1[more]
SMESG000069934.13.443e-827.22SMESG000069934.1[more]
SMESG000029557.12.494e-725.66SMESG000029557.1[more]
SMESG000074883.15.914e-730.30SMESG000074883.1[more]
SMESG000055359.16.574e-724.78SMESG000055359.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005172 ID=SMED30005172|Name=SMED30005172|organism=Schmidtea mediterranea sexual|type=transcript|length=960bp
TCTTTCTTAATAAAGAAGTAAGTCAAAATTGAATTTATAAATGTAACCAG
CAATAATTAGAAATTAAAATGATACATACGCACATTTACTTTCATCCAAT
TATATTTATTAATGAAAAATTTAAAAAGTTTCATAAAATTTCGAAATTTA
AATCAGAAACCAAAGTTTCATGAAGTTTATTTAAGTAAAATTAATGATGC
ATTTATTATTCTTGAAGAAATAAGAATGAAGTATAGGAAATGTGCAATGA
TTTTATCGATAAGTAATTTAGCGATGATAATAGTTTCACTACAGTTTCAA
TCGCAGTGGGTAAAAAGAATTGGTAATGAATCTCTTTGGTCAGGTCTTTG
GGATTTATGTTTTTTATCGAGCAATTTCACATTTGTTGGCGCTCATGCTC
AAATGAAAGAGAATAAGTATAATGATCATAAAATGAGTATTTGTCATGTT
AAAATTGAATATATCCAAAGGGCCGTCATTGGATCACTACTAGCAGCGAC
TTGTTCCGGTCTGATAGGATCACTGCTGTCTATTGCAGGATTTATTACAA
ACAATATATTCAAAAAATATTACTATTTTCATTCGGCGGCAGAATTTTTT
TTAGTATCAGGTTTTGCAATACTTTTAGTTGTAATTATATATCCTATCTC
TATCAGACATTATTTAGATCCGAAAGAAAAGTTTATTTTGGGATATGGAT
ATATTTTATGTTGGATTGCTGCAGCTAATTATTTTCTGGGCTTTTTCATT
ATGATGCTTGATGAGTTTTGTTCAGCTTCAACCATTAAAACTTCGAGTAT
AAGTGGGAGCAGTTCAAATGCTAAAACGTATACACTTAATAAATCAAAAA
CTAATACCAAAAATTCAATTCAAAATAATAAGGAATCAATTCAAACGAAT
AAAGAAAATTGGGTTTAAAATAATTAAAATTAATTCGAAATTGCTTTTGA
TTGCTAGATC
back to top

protein sequence of SMED30005172-orf-1

>SMED30005172-orf-1 ID=SMED30005172-orf-1|Name=SMED30005172-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=269bp
MKNLKSFIKFRNLNQKPKFHEVYLSKINDAFIILEEIRMKYRKCAMILSI
SNLAMIIVSLQFQSQWVKRIGNESLWSGLWDLCFLSSNFTFVGAHAQMKE
NKYNDHKMSICHVKIEYIQRAVIGSLLAATCSGLIGSLLSIAGFITNNIF
KKYYYFHSAAEFFLVSGFAILLVVIIYPISIRHYLDPKEKFILGYGYILC
WIAAANYFLGFFIMMLDEFCSASTIKTSSISGSSSNAKTYTLNKSKTNTK
NSIQNNKESIQTNKENWV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR004031PMP22/EMP/MP20/Claudin
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0000272polysaccharide catabolic process
GO:0005975carbohydrate metabolic process
GO:0008152metabolic process
GO:0030245cellulose catabolic process
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0008810cellulase activity
GO:0016787hydrolase activity
GO:0016798hydrolase activity, acting on glycosyl bonds