Alpha-L-fucosidase

Overview
NameAlpha-L-fucosidase
Smed IDSMED30005168
Length (bp)1541
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Alpha-L-fucosidase (SMED30005168) t-SNE clustered cells

Violin plots show distribution of expression levels for Alpha-L-fucosidase (SMED30005168) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Alpha-L-fucosidase (SMED30005168) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Alpha-L-fucosidase (SMED30005168) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005168

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30005168SMESG000024118.1 PL05010A1G12ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30005168SMESG000024118.1 PL04010A2C07ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30005168SMESG000024118.1 dd_Smed_v4_8422_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005168SMESG000024118.1 dd_Smed_v4_8422_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Alpha-L-fucosidase vs. Ensembl Human
Match: FUCA2 (alpha-L-fucosidase 2 [Source:HGNC Symbol;Acc:HGNC:4008])

HSP 1 Score: 504.982 bits (1299), Expect = 4.460e-176
Identity = 256/450 (56.89%), Postives = 325/450 (72.22%), Query Frame = 1
Query:  115 NAVRYSPDWKSLDSRPLPSWYDQAKIGIFIHWGVFSVPGFGDFTHAGEWFWWYWQGVNMTNYEKFMANNYPPSFTYASFAKEFRAERFDPDQWADLFNASGAKYVVLTSKHHEGFCXXXXXXXXXXXXVDIGPNMDLVEKLGTSIRNRTKLIFGLYHSLFEWFNPLYLTDKNNKFKTNLFVRDKTLPELYEIVKRYKPDVIWSDGDWEAIDAYWNSTEFLAWLYNDSPVKNTVVTNDRWGIDTACKHGGFYTCQDRYNPGKLVNHKWENCFTLDKYSWGFRKEMNAADVMSIEEIVSQIASTVSCGGNVLINIGPTGYGTIPSIFQERLLQLGNWLGVNGESIYNTKPWSHQNDTISKNVWYTSKTVVNTNYVYAIILKFPDDGKLKLGSIVFPVKSLKTEQIELLGFGK----LSYQKQGNYTLITLPVNALLQL--KWAWTLKISGMI 1446
            +A R+ P W+SLD+R LP+W+DQAK GIFIHWGVFSVP FG      EWFWWYWQ   +  Y +FM +NYPPSF Y  F   F A+ F+ +QWAD+F ASGAKY+VLTSKHHEGF  W S+YSWNWN++D GP  D+V++L  +IRNRT L FGLY+SLFEWF+PL+L D+++ F    F   KTLPELYE+V  Y+P+V+WSDGD  A D YWNST FLAWLYN+SPV+ TVVTNDRWG  + CKHGGFYTC DRYNPG L+ HKWENC T+DK SWG+R+E   +D ++IEE+V Q+  TVSCGGN+L+NIGPT  GTI  +F+ERL Q+G+WL VNGE+IY T  W  QNDT++ +VWYTSK       VYAI LK+P  G+L LG    P   L   +++LLG G+    +S ++ G   ++ LP   + Q+  KW W L ++ +I
Sbjct:   30 SATRFDPTWESLDARQLPAWFDQAKFGIFIHWGVFSVPSFGS-----EWFWWYWQKEKIPKYVEFMKDNYPPSFKYEDFGPLFTAKFFNANQWADIFQASGAKYIVLTSKHHEGFTLWGSEYSWNWNAIDEGPKRDIVKELEVAIRNRTDLRFGLYYSLFEWFHPLFLEDESSSFHKRQFPVSKTLPELYELVNNYQPEVLWSDGDGGAPDQYWNSTGFLAWLYNESPVRGTVVTNDRWGAGSICKHGGFYTCSDRYNPGHLLPHKWENCMTIDKLSWGYRREAGISDYLTIEELVKQLVETVSCGGNLLMNIGPTLDGTISVVFEERLRQMGSWLKVNGEAIYETHTWRSQNDTVTPDVWYTSKP--KEKLVYAIFLKWPTSGQLFLGH---PKAILGATEVKLLGHGQPLNWISLEQNG--IMVELPQLTIHQMPCKWGWALALTNVI 467          
BLAST of Alpha-L-fucosidase vs. Ensembl Human
Match: FUCA1 (alpha-L-fucosidase 1 [Source:HGNC Symbol;Acc:HGNC:4006])

HSP 1 Score: 482.256 bits (1240), Expect = 4.612e-167
Identity = 245/444 (55.18%), Postives = 319/444 (71.85%), Query Frame = 1
Query:  124 RYSPDWKSLDSRPLPSWYDQAKIGIFIHWGVFSVPGFGDFTHAGEWFWWYWQGVNMTNYEKFMANNYPPSFTYASFAKEFRAERFDPDQWADLFNASGAKYVVLTSKHHEGFCXXXXXXXXXXXXVDIGPNMDLVEKLGTSIRNRTKLIFGLYHSLFEWFNPLYLTDKNNKFKTNLFVRDKTLPELYEIVKRYKPDVIWSDGDWEAIDAYWNSTEFLAWLYNDSPVKNTVVTNDRWGIDTACKHGGFYTCQDRYNPGKLVNHKWENCFTLDKYSWGFRKEMNAADVMSIEEIVSQIASTVSCGGNVLINIGPTGYGTIPSIFQERLLQLGNWLGVNGESIYNTKPWSHQNDTISKNVWYTSKTVVNTNYVYAIILKFPDDGKLKLGSIVFPVKSLKTEQIELLGF-GKLSYQKQGNYTL-ITLP--VNALLQLKWAWTLKISGM 1443
            RY+PDW SLDSRPLP+W+D+AK G+FIHWGVFSVP +G      EWFWW+WQG     Y++FM +NYPP F+YA F  +F A  F P++WADLF A+GAKYVVLT+KHHEGF NW S  SWNWNS D+GP+ DLV +LGT++R R  + +GLYHSL EWF+PLYL DK N FKT  FV  KT+PELY++V  YKPD+IWSDG+WE  D YWNST FL+WLYNDSPVK+ VV NDRWG + +C HGG+Y C+D++ P  L +HKWE C ++DK+SWG+R++M  +DV    EI+S++  TVS GGN L+NIGPT  G I  IFQERLL +G WL +NGE+IY +KPW  Q +  + +VWYTSK       VYAI L +P++G L L S +    +  T +I +LG  G L +    +  L I+LP    + +  ++AWT+K++G+
Sbjct:   36 RYTPDWPSLDSRPLPAWFDEAKFGVFIHWGVFSVPAWG-----SEWFWWHWQGEGRPQYQRFMRDNYPPGFSYADFGPQFTARFFHPEEWADLFQAAGAKYVVLTTKHHEGFTNWPSPVSWNWNSKDVGPHRDLVGELGTALRKRN-IRYGLYHSLLEWFHPLYLLDKKNGFKTQHFVSAKTMPELYDLVNSYKPDLIWSDGEWECPDTYWNSTNFLSWLYNDSPVKDEVVVNDRWGQNCSCHHGGYYNCEDKFKPQSLPDHKWEMCTSIDKFSWGYRRDMALSDVTEESEIISELVQTVSLGGNYLLNIGPTKDGLIVPIFQERLLAVGKWLSINGEAIYASKPWRVQWEKNTTSVWYTSKGSA----VYAIFLHWPENGVLNLESPI----TTSTTKITMLGIQGDLKWSTDPDKGLFISLPQLPPSAVPAEFAWTIKLTGV 465          
BLAST of Alpha-L-fucosidase vs. Ensembl Human
Match: FUCA2 (alpha-L-fucosidase 2 [Source:HGNC Symbol;Acc:HGNC:4008])

HSP 1 Score: 110.538 bits (275), Expect = 1.651e-28
Identity = 54/92 (58.70%), Postives = 67/92 (72.83%), Query Frame = 1
Query: 1006 QIASTVSCGGNVLINIGPTGYGTIPSIFQERLLQLGNWLGVNGESIYNTKPWSHQNDTISKNVWYTSKTVVNTNYVYAIILKFPDDGKLKLG 1281
            Q+  TVSCGGN+L+NIGPT  GTI  +F+ERL Q+G+WL VNGE+IY T  W  QNDT++ +VWYTSK       VYAI LK+P  G+L LG
Sbjct:    1 QLVETVSCGGNLLMNIGPTLDGTISVVFEERLRQMGSWLKVNGEAIYETHTWRSQNDTVTPDVWYTSKP--KEKLVYAIFLKWPTSGQLFLG 90          
BLAST of Alpha-L-fucosidase vs. Ensembl Celegans
Match: W03G11.3 (Putative alpha-L-fucosidase [Source:UniProtKB/Swiss-Prot;Acc:P49713])

HSP 1 Score: 401.364 bits (1030), Expect = 1.586e-135
Identity = 197/379 (51.98%), Postives = 267/379 (70.45%), Query Frame = 1
Query:   79 IVTLIFT-LYTHCNAVRYSPDWKSLDSRPLPSWYDQAKIGIFIHWGVFSVPGFGDFTHAGEWFWWYWQGVNM-TNYEKFMANNYPPSFTYASFAKEFRAERFDPDQWADLFNASGAKYVVLTSKHHEGFCXXXXXXXXXXXXVDIGPNMDLVEKLGTSIRNRTKLIFGLYHSLFEWFNPLYLTDKNNKFKTNLFVRDKTLPELYEIVKRYKPDVIWSDGDWEAIDAYWNSTEFLAWLYNDSPVKNTVVTNDRWGIDTACKHGGFYTCQDRYNPGKLVNHKWENCFTLDKYSWGFRKEMNAADVMSIEEIVSQIASTVSCGGNVLINIGPTGYGTIPSIFQERLLQLGNWLGVNGESIYNTKPWSHQNDTISKNVWYTSK 1209
            ++ LIF+ L+ H     Y+PDW+SLD+RPLPSWYD +K GIF HWG++SVP F       EW WWYW+G     +   F+  NY P  TYA FAK+F AE F+ +Q+A+    SGA+Y V TSKHHEGF  W S+ SWNWNS+DIGP  D+V +L  + + +T + FGLY S FEWF+P++L D   KF T  +    + P++ +IV +Y P+V+WSDG+W+  D YW + EFLAWLYN SPVK+ VV NDRWG  T  KHGGF T  D Y+PGKL+  KWENC TLDK+SWG R++M A++V +  EI+ Q+A T++C GN+L+N+GP  +G IP+IF++RL ++G ++ +  E+I+ T+PW HQNDT + NVWYTSK
Sbjct:    1 MIFLIFSILFLHLANCDYTPDWESLDNRPLPSWYDDSKFGIFCHWGLYSVPAF-----RSEWMWWYWKGTQPDKDVVNFVDKNYKPGTTYADFAKDFTAEYFNANQFAETVKTSGARYFVFTSKHHEGFTMWPSRTSWNWNSMDIGPKRDIVGELRDAFK-KTDVHFGLYFSQFEWFHPMFLDD--GKFNTTFYPEQVSYPQMIDIVTKYNPEVVWSDGEWDKSDDYWKAKEFLAWLYNSSPVKDQVVVNDRWGTGTMGKHGGFMTYSDHYDPGKLLEKKWENCMTLDKHSWGNRRDMKASEVNTAYEIIEQLARTIACNGNLLLNVGPNMHGQIPAIFEDRLEEIGRFVNITSEAIFGTRPWIHQNDTSASNVWYTSK 371          
BLAST of Alpha-L-fucosidase vs. Ensembl Fly
Match: Fuca (gene:FBgn0285958 transcript:FBtr0100588)

HSP 1 Score: 442.58 bits (1137), Expect = 2.174e-151
Identity = 218/408 (53.43%), Postives = 277/408 (67.89%), Query Frame = 1
Query:   46 MSTFIMLFSIWIVTLIFTLYTHCNAVRYSPDWKSLDSRPLPSWYDQAKIGIFIHWGVFSVPGFGDFTHAGEWFWWYWQGVNMTNYEKFMANNYPPSFTYASFAKEFRAERFDPDQWADLFNASGAKYVVLTSKHHEGFCXXXXXXXXXXXXVDIGPNMDLVEKLGTSIRNRTKLIFGLYHSLFEWFNPLYLTDKNNKFKTNLFVRDKTLPELYEIVKRYKPDVIWSDGDWEAIDAYWNSTEFLAWLYNDSPVKNTVVTNDRWGIDTACKHGGFYTCQDRYNPGKLVNHKWENCFTLDKYSWGFRKEMNAADVMSIEEIVSQIASTVSCGGNVLINIGPTGYGTIPSIFQERLLQLGNWLGVNGESIYNTKPWSHQNDTISKNVWYTSKTVVNTN--YVYAIILKFPDD 1263
            M   + L  +WI              RY P+W SLD RPLP WYD AK+GIF+H+GV+SVP FG      EWFW  W+ +    Y +FM  NY P FTY  FA +F AE F+  +WA LF  SGA+YVVLTSKHH+GF  W SK S+ WNS+D+GP  D+V++L  +IR  + L FGLY+SLFEWFNPL+  DK +      FV  K  PE  E+V++Y P++IWSDGDWEA   YW S EF+AWLYNDSPV++TVVTNDRWG  TAC HG FY C DR+NPG L  HKWEN FTLD+ SWG R +++ +D M+ +E++ +I +TVSC GNVLIN+GPT +GTI  IF+ERL  +G WL  NGE IY + PW +QNDTI+ NVWYT +   +     +YA +L++P D
Sbjct:    7 MPLLVALIVVWISAAEVDAQVPGPRTRYQPNWASLDQRPLPQWYDDAKVGIFLHYGVYSVPSFG-----SEWFWTNWKNLRNPEYVQFMQRNYKPDFTYQEFASQFTAELFNATKWALLFKDSGARYVVLTSKHHDGFTLWPSKNSYGWNSMDVGPKRDIVKELAAAIRKESDLRFGLYYSLFEWFNPLWTDDKLHLLMQQHFVERKVRPEQMELVQQYLPEIIWSDGDWEAPAKYWRSEEFIAWLYNDSPVRDTVVTNDRWGFGTACMHGDFYNCADRFNPGVLQAHKWENAFTLDRTSWGQRFDVSLSDFMTSKEVIKEIITTVSCNGNVLINVGPTKFGTILPIFEERLRDMGRWLKFNGEGIYGSVPWIYQNDTINGNVWYTRQKEASNGKITIYAFVLEYPYD 409          
BLAST of Alpha-L-fucosidase vs. Ensembl Fly
Match: Fuca (gene:FBgn0285958 transcript:FBtr0346860)

HSP 1 Score: 442.58 bits (1137), Expect = 2.174e-151
Identity = 218/408 (53.43%), Postives = 277/408 (67.89%), Query Frame = 1
Query:   46 MSTFIMLFSIWIVTLIFTLYTHCNAVRYSPDWKSLDSRPLPSWYDQAKIGIFIHWGVFSVPGFGDFTHAGEWFWWYWQGVNMTNYEKFMANNYPPSFTYASFAKEFRAERFDPDQWADLFNASGAKYVVLTSKHHEGFCXXXXXXXXXXXXVDIGPNMDLVEKLGTSIRNRTKLIFGLYHSLFEWFNPLYLTDKNNKFKTNLFVRDKTLPELYEIVKRYKPDVIWSDGDWEAIDAYWNSTEFLAWLYNDSPVKNTVVTNDRWGIDTACKHGGFYTCQDRYNPGKLVNHKWENCFTLDKYSWGFRKEMNAADVMSIEEIVSQIASTVSCGGNVLINIGPTGYGTIPSIFQERLLQLGNWLGVNGESIYNTKPWSHQNDTISKNVWYTSKTVVNTN--YVYAIILKFPDD 1263
            M   + L  +WI              RY P+W SLD RPLP WYD AK+GIF+H+GV+SVP FG      EWFW  W+ +    Y +FM  NY P FTY  FA +F AE F+  +WA LF  SGA+YVVLTSKHH+GF  W SK S+ WNS+D+GP  D+V++L  +IR  + L FGLY+SLFEWFNPL+  DK +      FV  K  PE  E+V++Y P++IWSDGDWEA   YW S EF+AWLYNDSPV++TVVTNDRWG  TAC HG FY C DR+NPG L  HKWEN FTLD+ SWG R +++ +D M+ +E++ +I +TVSC GNVLIN+GPT +GTI  IF+ERL  +G WL  NGE IY + PW +QNDTI+ NVWYT +   +     +YA +L++P D
Sbjct:    7 MPLLVALIVVWISAAEVDAQVPGPRTRYQPNWASLDQRPLPQWYDDAKVGIFLHYGVYSVPSFG-----SEWFWTNWKNLRNPEYVQFMQRNYKPDFTYQEFASQFTAELFNATKWALLFKDSGARYVVLTSKHHDGFTLWPSKNSYGWNSMDVGPKRDIVKELAAAIRKESDLRFGLYYSLFEWFNPLWTDDKLHLLMQQHFVERKVRPEQMELVQQYLPEIIWSDGDWEAPAKYWRSEEFIAWLYNDSPVRDTVVTNDRWGFGTACMHGDFYNCADRFNPGVLQAHKWENAFTLDRTSWGQRFDVSLSDFMTSKEVIKEIITTVSCNGNVLINVGPTKFGTILPIFEERLRDMGRWLKFNGEGIYGSVPWIYQNDTINGNVWYTRQKEASNGKITIYAFVLEYPYD 409          
BLAST of Alpha-L-fucosidase vs. Ensembl Zebrafish
Match: fuca2 (alpha-L-fucosidase 2 [Source:ZFIN;Acc:ZDB-GENE-040822-39])

HSP 1 Score: 511.531 bits (1316), Expect = 4.680e-179
Identity = 252/456 (55.26%), Postives = 319/456 (69.96%), Query Frame = 1
Query:   82 VTLIFTLYTHCNAVRYSPDWKSLDSRPLPSWYDQAKIGIFIHWGVFSVPGFGDFTHAGEWFWWYWQGVNMTNYEKFMANNYPPSFTYASFAKEFRAERFDPDQWADLFNASGAKYVVLTSKHHEGFCXXXXXXXXXXXXVDIGPNMDLVEKLGTSIRNRTKLIFGLYHSLFEWFNPLYLTDKNNKFKTNLFVRDKTLPELYEIVKRYKPDVIWSDGDWEAIDAYWNSTEFLAWLYNDSPVKNTVVTNDRWGIDTACKHGGFYTCQDRYNPGKLVNHKWENCFTLDKYSWGFRKEMNAADVMSIEEIVSQIASTVSCGGNVLINIGPTGYGTIPSIFQERLLQLGNWLGVNGESIYNTKPWSHQNDTISKNVWYTSKTVVNTNYVYAIILKFPDDGKLKLGSIVFPVKSLKTEQIELLGFGKLSYQKQGNYTL-ITLPVNALLQLKW--AWTLKISG 1440
            V  +  L   C   +Y P W+S+DSRP+P W+DQAK GIFIHWGVFSVP FG      EWFWW+WQG    +Y KFM  NYPP FTY  FA +F AE FDP++W D+F +SGA+Y+VLT+KHHEGF  W SKYSW WN+V +GP  DLV  + T++R RT L  GLYHSLFEWFNP++ +D +NKFKTN+F   KTLPELYE++  YKPD++WSDGD +A D YWNST FLAWLYN SPV+ TVVTNDRWG  + C HGG+YTC DRYNPG LV HKWENC ++D+ SWG+R+E   +D +S E++++ +  TVSCGGN+L+N+GPT  G I  IF+ERL Q+G WL VNGE+IYN+  W  QNDT +  VWYT      +  +YAI L +P DG + L     PV S    Q+ LLG G +++Q      L + LP     Q+ W  AWTL+++G
Sbjct:    6 VLSVCLLLIGCCVCQYQPTWESIDSRPVPEWFDQAKFGIFIHWGVFSVPSFGS-----EWFWWFWQGQKWPSYVKFMEQNYPPGFTYTDFAPQFTAEFFDPNEWVDIFASSGARYIVLTTKHHEGFTMWGSKYSWTWNAVSVGPKRDLVNDIATALRTRTDLRLGLYHSLFEWFNPMFKSDSDNKFKTNVFPTAKTLPELYELINTYKPDLLWSDGDGDAPDQYWNSTGFLAWLYNQSPVRETVVTNDRWGYGSICNHGGYYTCTDRYNPGHLVKHKWENCLSIDQRSWGYRREAKLSDYLSTEQLIASLVETVSCGGNLLLNVGPTHDGRIVPIFEERLRQMGQWLKVNGEAIYNSSAWRVQNDTATPGVWYTMNK--QSGAIYAIFLSWPSDGIVVLTD---PVVSAAKTQVALLGSGSVTWQSTTPTGLKVKLPPLTPSQMPWSSAWTLRLTG 451          
BLAST of Alpha-L-fucosidase vs. Ensembl Zebrafish
Match: fuca2 (alpha-L-fucosidase 2 [Source:ZFIN;Acc:ZDB-GENE-040822-39])

HSP 1 Score: 511.531 bits (1316), Expect = 4.680e-179
Identity = 252/456 (55.26%), Postives = 319/456 (69.96%), Query Frame = 1
Query:   82 VTLIFTLYTHCNAVRYSPDWKSLDSRPLPSWYDQAKIGIFIHWGVFSVPGFGDFTHAGEWFWWYWQGVNMTNYEKFMANNYPPSFTYASFAKEFRAERFDPDQWADLFNASGAKYVVLTSKHHEGFCXXXXXXXXXXXXVDIGPNMDLVEKLGTSIRNRTKLIFGLYHSLFEWFNPLYLTDKNNKFKTNLFVRDKTLPELYEIVKRYKPDVIWSDGDWEAIDAYWNSTEFLAWLYNDSPVKNTVVTNDRWGIDTACKHGGFYTCQDRYNPGKLVNHKWENCFTLDKYSWGFRKEMNAADVMSIEEIVSQIASTVSCGGNVLINIGPTGYGTIPSIFQERLLQLGNWLGVNGESIYNTKPWSHQNDTISKNVWYTSKTVVNTNYVYAIILKFPDDGKLKLGSIVFPVKSLKTEQIELLGFGKLSYQKQGNYTL-ITLPVNALLQLKW--AWTLKISG 1440
            V  +  L   C   +Y P W+S+DSRP+P W+DQAK GIFIHWGVFSVP FG      EWFWW+WQG    +Y KFM  NYPP FTY  FA +F AE FDP++W D+F +SGA+Y+VLT+KHHEGF  W SKYSW WN+V +GP  DLV  + T++R RT L  GLYHSLFEWFNP++ +D +NKFKTN+F   KTLPELYE++  YKPD++WSDGD +A D YWNST FLAWLYN SPV+ TVVTNDRWG  + C HGG+YTC DRYNPG LV HKWENC ++D+ SWG+R+E   +D +S E++++ +  TVSCGGN+L+N+GPT  G I  IF+ERL Q+G WL VNGE+IYN+  W  QNDT +  VWYT      +  +YAI L +P DG + L     PV S    Q+ LLG G +++Q      L + LP     Q+ W  AWTL+++G
Sbjct:    6 VLSVCLLLIGCCVCQYQPTWESIDSRPVPEWFDQAKFGIFIHWGVFSVPSFGS-----EWFWWFWQGQKWPSYVKFMEQNYPPGFTYTDFAPQFTAEFFDPNEWVDIFASSGARYIVLTTKHHEGFTMWGSKYSWTWNAVSVGPKRDLVNDIATALRTRTDLRLGLYHSLFEWFNPMFKSDSDNKFKTNVFPTAKTLPELYELINTYKPDLLWSDGDGDAPDQYWNSTGFLAWLYNQSPVRETVVTNDRWGYGSICNHGGYYTCTDRYNPGHLVKHKWENCLSIDQRSWGYRREAKLSDYLSTEQLIASLVETVSCGGNLLLNVGPTHDGRIVPIFEERLRQMGQWLKVNGEAIYNSSAWRVQNDTATPGVWYTMNK--QSGAIYAIFLSWPSDGIVVLTD---PVVSAAKTQVALLGSGSVTWQSTTPTGLKVKLPPLTPSQMPWSSAWTLRLTG 451          
BLAST of Alpha-L-fucosidase vs. Ensembl Zebrafish
Match: fuca1.1 (alpha-L-fucosidase 1, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030131-7434])

HSP 1 Score: 471.47 bits (1212), Expect = 2.338e-163
Identity = 245/455 (53.85%), Postives = 305/455 (67.03%), Query Frame = 1
Query:   91 IFTLYTHCNAV---RYSPDWKSLDSRPLPSWYDQAKIGIFIHWGVFSVPGFGDFTHAGEWFWWYWQGVNMTNYEKFMANNYPPSFTYASFAKEFRAERFDPDQWADLFNASGAKYVVLTSKHHEGFCXXXXXXXXXXXXVDIGPNMDLVEKLGTSIRNRTKLIFGLYHSLFEWFNPLYLTDKNNKFKTNLFVRDKTLPELYEIVKRYKPDVIWSDGDWEAIDAYWNSTEFLAWLYNDSPVKNTVVTNDRWGIDTACKHGGFYTCQDRYNPGKLVNHKWENCFTLDKYSWGFRKEMNAADVMSIEEIVSQIASTVSCGGNVLINIGPTGYGTIPSIFQERLLQLGNWLGVNGESIYNTKPWSHQNDTISKNVWYTSKTVVNTNYVYAIILKFPDDGKLKLGSIVFPVKSLKTEQIELLGFGK-LSYQKQGNYTLITLPVNALLQLKWAWTLKISGM 1443
            +F     C +V   RY+PDW SLDSRPLP WYD+ K GIF+HWGVFSVP FG      EWFWWYW+G    +Y +FM  NYPP F+YA FA  F A+ FDPD WAD+F ASGAKYVVLTSKHHEGF NW S  SWNWNSVD GP+ DLV  LG +IR +  L +GLYHSL+EWFNPLYL+DK + FKT  +V  K +PELY++V RYKPD+IWSDGDWEA D YWNSTEFLAWLYNDSPVK+ VV NDRWG    CKHGG+Y C D++NP KL+NHKWE C ++DK SWG+R+ M  +++M + E+V  +   V+ GGN L+NIGPT  G I  +F+ERL  +G WL +NGE+IY T  W  Q +  +  VWYT+K       VYAI    P     +L +      +  +  + LLG  K L +    +  L+ +         +AWTLK+ G+
Sbjct:   10 LFLCLLSCASVIGARYTPDWTSLDSRPLPGWYDEVKFGIFVHWGVFSVPAFGS-----EWFWWYWKGAQNPDYVQFMIKNYPPGFSYADFAPNFHAQFFDPDAWADIFEASGAKYVVLTSKHHEGFTNWGSPTSWNWNSVDDGPHRDLVGDLGNAIRKK-GLHYGLYHSLYEWFNPLYLSDKQSGFKTQEYVARKAMPELYDLVSRYKPDLIWSDGDWEAPDTYWNSTEFLAWLYNDSPVKDIVVVNDRWGNGCYCKHGGYYNCADKFNPQKLLNHKWEKCQSVDKISWGYRRNMKLSELMDLPELVQDLVYIVALGGNYLLNIGPTADGVIAPVFEERLRGIGAWLQINGEAIYGTSFWRVQAENATVPVWYTAKKST----VYAIFTTNPMQNTFQLSA----PNTTDSTVVTLLGSPKPLKWAPLQSSGLMVVLPELPFSPAYAWTLKMEGV 450          
BLAST of Alpha-L-fucosidase vs. Ensembl Zebrafish
Match: fuca1.2 (alpha-L-fucosidase 1, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-040801-78])

HSP 1 Score: 463.766 bits (1192), Expect = 2.596e-160
Identity = 241/455 (52.97%), Postives = 304/455 (66.81%), Query Frame = 1
Query:   91 IFTLYTHCNAV---RYSPDWKSLDSRPLPSWYDQAKIGIFIHWGVFSVPGFGDFTHAGEWFWWYWQGVNMTNYEKFMANNYPPSFTYASFAKEFRAERFDPDQWADLFNASGAKYVVLTSKHHEGFCXXXXXXXXXXXXVDIGPNMDLVEKLGTSIRNRTKLIFGLYHSLFEWFNPLYLTDKNNKFKTNLFVRDKTLPELYEIVKRYKPDVIWSDGDWEAIDAYWNSTEFLAWLYNDSPVKNTVVTNDRWGIDTACKHGGFYTCQDRYNPGKLVNHKWENCFTLDKYSWGFRKEMNAADVMSIEEIVSQIASTVSCGGNVLINIGPTGYGTIPSIFQERLLQLGNWLGVNGESIYNTKPWSHQNDTISKNVWYTSKTVVNTNYVYAIILKFPDDGKLKLGSIVFPVKSLKTEQIELLGFGK-LSYQKQGNYTLITLPVNALLQLKWAWTLKISGM 1443
            +F     C +V   RY+PDW SLDSRPLP WYD+ K GIF+HWGVFSVP FG      EWFWW W+G +   Y  +M  NYPP F+YA FA +F A+ FDPD WA++F ASGAKYVVLTSKHHEGF NW S  SWNWNSVD GP+ DLV  LG ++R R+ L +GLYHSL+EWFNPLYL+DK + FKT  +V  K +PELY++V RYKPD+IWSDGDWEA D YWNSTEFLAWLYNDSPVK+ VV NDRWG    CKHGG+Y C D+++PG+L  HKWE C ++D  SWG+R+ M  +++M +  ++  +  TV+ GGN L+N+GPT  G I  +F+ERL  +G WL +NGE+IY T  W  Q +  +  VWYTSK       VYAI    P+    +L +     K+     + LLG  K L +    +  LI L  +       AWTLK+ G+
Sbjct:   10 LFLCLLSCASVIGARYTPDWTSLDSRPLPGWYDEVKFGIFVHWGVFSVPAFG-----SEWFWWNWKGAHDFKYILYMVKNYPPGFSYADFAPDFHAQFFDPDAWAEIFEASGAKYVVLTSKHHEGFTNWESPTSWNWNSVDNGPHRDLVGDLGNAVRKRS-LHYGLYHSLYEWFNPLYLSDKQSGFKTQEYVARKAMPELYDLVNRYKPDLIWSDGDWEAPDTYWNSTEFLAWLYNDSPVKDIVVVNDRWGNGCYCKHGGYYNCADKFSPGELPKHKWEKCQSVDTISWGYRRNMKLSELMDLPALIKDLVYTVALGGNYLLNVGPTADGVIAPVFEERLRGIGAWLQINGEAIYATSSWRVQAENATVPVWYTSKNST----VYAIFTSSPNQNTFELSA----PKTSDNTVVTLLGNPKPLKWAPLHSSGLILLLPDLPFSPAQAWTLKLEGV 450          
BLAST of Alpha-L-fucosidase vs. Ensembl Xenopus
Match: ca6 (carbonic anhydrase 6 [Source:Xenbase;Acc:XB-GENE-494019])

HSP 1 Score: 498.049 bits (1281), Expect = 3.304e-173
Identity = 250/443 (56.43%), Postives = 315/443 (71.11%), Query Frame = 1
Query:  127 YSPDWKSLDSRPLPSWYDQAKIGIFIHWGVFSVPGFGDFTHAGEWFWWYWQGVNMTNYEKFMANNYPPSFTYASFAKEFRAERFDPDQWADLFNASGAKYVVLTSKHHEGFCXXXXXXXXXXXXVDIGPNMDLVEKLGTSIRNRTKLIFGLYHSLFEWFNPLYLTDKNNKFKTNLFVRDKTLPELYEIVKRYKPDVIWSDGDWEAIDAYWNSTEFLAWLYNDSPVKNTVVTNDRWGIDTACKHGGFYTCQDRYNPGKLVNHKWENCFTLDKYSWGFRKEMNAADVMSIEEIVSQIASTVSCGGNVLINIGPTGYGTIPSIFQERLLQLGNWLGVNGESIYNTKPWSHQNDTISKNVWYTSKTVVNTNYVYAIILKFPDDGKLKLGSIVFPVKSLKTEQIELLGF-GKLSYQKQGNYTLIT-LPVNALLQL--KWAWTLKISGM 1443
            Y P W+SLDSRPLP+W+D  K GIFIHWGVFSVP +G      EWFWWYWQG  + +Y  FM  NYPP F Y  F  +F AE ++P QWA     SGAKYVVLTSKHHEGF  W SK SWNWNSVD+GP  DL+ +L  +IR+ T L FGLYHSLFEWFNPL+L+DKN+ F T  FV  KTLPELYE+V +Y+P+++WSDGD +A   YWNST FLAWLYN+SPV++TVVTNDRWG    CKHGG+YTC DRYNPG L+ HKWENC T+D+YSWG+R+    +++++IEEIV ++  TVSCGGN+L+NIGPT  G IP IF++RL Q+G WL +NGE+IY+TKPW  QNDT++  VWYT +       +YAI L +P   +L LG    P    +  +++L GF  KL++   G   ++  LP  +  Q+   W W LKI G+
Sbjct:   40 YEPTWESLDSRPLPNWFDDVKFGIFIHWGVFSVPSYGS-----EWFWWYWQGSKVASYVNFMKKNYPPDFRYEDFGPQFTAEFYNPLQWAITLEESGAKYVVLTSKHHEGFTLWGSKVSWNWNSVDVGPKRDLIAELVLAIRSTTNLHFGLYHSLFEWFNPLFLSDKNSSFATRRFVDTKTLPELYELVTKYQPEILWSDGDGDAPYTYWNSTGFLAWLYNESPVRDTVVTNDRWGNGCICKHGGYYTCTDRYNPGHLLKHKWENCMTIDRYSWGYRRNALISEMLTIEEIVQELVETVSCGGNLLLNIGPTSDGRIPVIFEQRLKQIGQWLKLNGEAIYSTKPWRAQNDTVTAGVWYTCRP--KEKALYAIFLSWPSKWELVLGE---PKAMTEKTEVQLFGFEKKLNWSSLGEQGMVVHLPALSYSQMPAPWGWVLKIVGL 472          
BLAST of Alpha-L-fucosidase vs. Ensembl Xenopus
Match: fuca1 (alpha-L-fucosidase 1 [Source:NCBI gene;Acc:100497659])

HSP 1 Score: 464.151 bits (1193), Expect = 4.100e-160
Identity = 239/445 (53.71%), Postives = 306/445 (68.76%), Query Frame = 1
Query:  124 RYSPDWKSLDSRPLPSWYDQAKIGIFIHWGVFSVPGFGDFTHAGEWFWWYWQGVNMTNYEKFMANNYPPSFTYASFAKEFRAERFDPDQWADLFNASGAKYVVLTSKHHEGFCXXXXXXXXXXXXVDIGPNMDLVEKLGTSIRNRTKLIFGLYHSLFEWFNPLYLTDKNNKFKTNLFVRDKTLPELYEIVKRYKPDVIWSDGDWEAIDAYWNSTEFLAWLYNDSPVKNTVVTNDRWGIDTACKHGGFYTCQDRYNPGKLVNHKWENCFTLDKYSWGFRKEMNAADVMSIEEIVSQIASTVSCGGNVLINIGPTGYGTIPSIFQERLLQLGNWLGVNGESIYNTKPWSHQNDTISKNVWYTSKTVVNTNYVYAIILKFPDDGKLKLGSIVFPVKSLKTEQIELLGF-GKLSYQKQGNYTLIT----LPVNALLQLKWAWTLKISGM 1443
            RY+P+W+SLD+RPLP W+D+AK GIF+HWGVFSVP FG      EWFWW W   +   Y KFM  NY P FTYA FA +F AE +DPD WA LF A+GAKYVVLT+KHHEGF NW S  SWNWN+VD+GP+ DLV     ++R R  L  GLYHSL EWF+PLYL DK N FKT  FV  KT+PELY++V RYKPD+IWSDGDWE+ D YWNST+FLAWLYNDSPVK+ +V NDRWG + +C HGG+Y C D++ P  L  HKWE C ++D YSWG+R+ M    +MS   I++++  TVS GGN L+N+GP+  G I  IFQERLL +G WL +NGE+IY +KPW  Q +  S  +WYTSK     + VY+I + +P++  LKL S     KS     + LLG  G+L++++  +  LI     LP  A   ++  W L++ G+
Sbjct:   33 RYTPNWESLDARPLPPWFDEAKFGIFLHWGVFSVPSFGS-----EWFWWNWHERS-DAYVKFMEQNYRPGFTYADFAPQFTAEFYDPDAWAQLFQAAGAKYVVLTTKHHEGFTNWGSPVSWNWNAVDVGPHRDLVGDFSDALRKR-NLSVGLYHSLLEWFHPLYLLDKKNGFKTQYFVFSKTMPELYDLVNRYKPDLIWSDGDWESPDTYWNSTDFLAWLYNDSPVKDNIVVNDRWGSNCSCYHGGYYNCADKFTPSSLPTHKWEKCTSVDTYSWGYRRNMQVNQIMSERNIIAELVETVSFGGNYLLNVGPSKEGLIVPIFQERLLAVGKWLKINGEAIYASKPWRVQKENSSVTIWYTSK----GSSVYSIFMSWPENNTLKLQS----PKSTSQTTVTLLGMSGQLTWKQSPDLGLIVSLPPLPPGA-FPVEAGWVLRLEGV 461          
BLAST of Alpha-L-fucosidase vs. Ensembl Xenopus
Match: fuca1 (alpha-L-fucosidase 1 [Source:NCBI gene;Acc:100497659])

HSP 1 Score: 463.766 bits (1192), Expect = 6.932e-160
Identity = 239/445 (53.71%), Postives = 306/445 (68.76%), Query Frame = 1
Query:  124 RYSPDWKSLDSRPLPSWYDQAKIGIFIHWGVFSVPGFGDFTHAGEWFWWYWQGVNMTNYEKFMANNYPPSFTYASFAKEFRAERFDPDQWADLFNASGAKYVVLTSKHHEGFCXXXXXXXXXXXXVDIGPNMDLVEKLGTSIRNRTKLIFGLYHSLFEWFNPLYLTDKNNKFKTNLFVRDKTLPELYEIVKRYKPDVIWSDGDWEAIDAYWNSTEFLAWLYNDSPVKNTVVTNDRWGIDTACKHGGFYTCQDRYNPGKLVNHKWENCFTLDKYSWGFRKEMNAADVMSIEEIVSQIASTVSCGGNVLINIGPTGYGTIPSIFQERLLQLGNWLGVNGESIYNTKPWSHQNDTISKNVWYTSKTVVNTNYVYAIILKFPDDGKLKLGSIVFPVKSLKTEQIELLGF-GKLSYQKQGNYTLIT----LPVNALLQLKWAWTLKISGM 1443
            RY+P+W+SLD+RPLP W+D+AK GIF+HWGVFSVP FG      EWFWW W   +   Y KFM  NY P FTYA FA +F AE +DPD WA LF A+GAKYVVLT+KHHEGF NW S  SWNWN+VD+GP+ DLV     ++R R  L  GLYHSL EWF+PLYL DK N FKT  FV  KT+PELY++V RYKPD+IWSDGDWE+ D YWNST+FLAWLYNDSPVK+ +V NDRWG + +C HGG+Y C D++ P  L  HKWE C ++D YSWG+R+ M    +MS   I++++  TVS GGN L+N+GP+  G I  IFQERLL +G WL +NGE+IY +KPW  Q +  S  +WYTSK     + VY+I + +P++  LKL S     KS     + LLG  G+L++++  +  LI     LP  A   ++  W L++ G+
Sbjct:   35 RYTPNWESLDARPLPPWFDEAKFGIFLHWGVFSVPSFGS-----EWFWWNWHERS-DAYVKFMEQNYRPGFTYADFAPQFTAEFYDPDAWAQLFQAAGAKYVVLTTKHHEGFTNWGSPVSWNWNAVDVGPHRDLVGDFSDALRKR-NLSVGLYHSLLEWFHPLYLLDKKNGFKTQYFVFSKTMPELYDLVNRYKPDLIWSDGDWESPDTYWNSTDFLAWLYNDSPVKDNIVVNDRWGSNCSCYHGGYYNCADKFTPSSLPTHKWEKCTSVDTYSWGYRRNMQVNQIMSERNIIAELVETVSFGGNYLLNVGPSKEGLIVPIFQERLLAVGKWLKINGEAIYASKPWRVQKENSSVTIWYTSK----GSSVYSIFMSWPENNTLKLQS----PKSTSQTTVTLLGMSGQLTWKQSPDLGLIVSLPPLPPGA-FPVEAGWVLRLEGV 463          
BLAST of Alpha-L-fucosidase vs. Ensembl Mouse
Match: Fuca2 (fucosidase, alpha-L- 2, plasma [Source:MGI Symbol;Acc:MGI:1914098])

HSP 1 Score: 508.449 bits (1308), Expect = 1.031e-177
Identity = 258/448 (57.59%), Postives = 324/448 (72.32%), Query Frame = 1
Query:  115 NAVRYSPDWKSLDSRPLPSWYDQAKIGIFIHWGVFSVPGFGDFTHAGEWFWWYWQGVNMTNYEKFMANNYPPSFTYASFAKEFRAERFDPDQWADLFNASGAKYVVLTSKHHEGFCXXXXXXXXXXXXVDIGPNMDLVEKLGTSIRNRTKLIFGLYHSLFEWFNPLYLTDKNNKFKTNLFVRDKTLPELYEIVKRYKPDVIWSDGDWEAIDAYWNSTEFLAWLYNDSPVKNTVVTNDRWGIDTACKHGGFYTCQDRYNPGKLVNHKWENCFTLDKYSWGFRKEMNAADVMSIEEIVSQIASTVSCGGNVLINIGPTGYGTIPSIFQERLLQLGNWLGVNGESIYNTKPWSHQNDTISKNVWYTSKTVVNTNYVYAIILKFPDDGKLKLGSIVFPVKSLKTEQIELLG-FGKLSY-QKQGNYTLITLPVNALLQL--KWAWTLKISGMI 1446
             A+ Y P W+SLD RPLP+W+DQAK GIFIHWGVFSVP FG      EWFWWYWQ      +  FM NNY P F Y  F   F A+ F+ +QWAD+  ASGAKYVV TSKHHEGF  W S  SWNWN+VD GP  D+V++L  ++RNRT L FGLY+SLFEWF+PL+L D+++ F+   F   KTLPELYE+V RY+P+V+WSDGD  A D YWNST FLAWLYN+SPV+ TVVTNDRWG+ + CKHGG+YTC DRYNPG L+ HKWENC T+DK+SWG+R+E   +D ++IEE+V ++  TV+CGGN+L+NIGPTG GTIP IF+ERL Q+G WL VNGE+IY T  W  QNDT++ +VWYTSK       VYAI LK+P  GKL LG    P+ SL   ++ELLG +  L++   Q +   + LP+ ++ Q+  KW WTL +S +I
Sbjct:   24 RALSYDPTWESLDRRPLPAWFDQAKFGIFIHWGVFSVPSFGS-----EWFWWYWQKEKKPQFVDFMNNNYAPGFKYEDFVVLFTAKYFNANQWADILQASGAKYVVFTSKHHEGFTMWGSDRSWNWNAVDEGPKRDIVKELEVAVRNRTGLHFGLYYSLFEWFHPLFLEDQSSSFQKQRFPVSKTLPELYELVNRYQPEVLWSDGDGGAPDHYWNSTGFLAWLYNESPVRKTVVTNDRWGVGSICKHGGYYTCSDRYNPGYLLPHKWENCMTIDKFSWGYRREAEISDYLTIEELVKKLVETVACGGNLLMNIGPTGDGTIPVIFEERLRQMGTWLKVNGEAIYETHTWRSQNDTVTPDVWYTSKP--EKKLVYAIFLKWPISGKLFLGQ---PIGSLGETEVELLGHWQPLTWTSSQPSGITVELPLLSVHQMPCKWGWTLVLSNVI 461          
BLAST of Alpha-L-fucosidase vs. Ensembl Mouse
Match: Fuca2 (fucosidase, alpha-L- 2, plasma [Source:MGI Symbol;Acc:MGI:1914098])

HSP 1 Score: 508.449 bits (1308), Expect = 1.031e-177
Identity = 258/448 (57.59%), Postives = 324/448 (72.32%), Query Frame = 1
Query:  115 NAVRYSPDWKSLDSRPLPSWYDQAKIGIFIHWGVFSVPGFGDFTHAGEWFWWYWQGVNMTNYEKFMANNYPPSFTYASFAKEFRAERFDPDQWADLFNASGAKYVVLTSKHHEGFCXXXXXXXXXXXXVDIGPNMDLVEKLGTSIRNRTKLIFGLYHSLFEWFNPLYLTDKNNKFKTNLFVRDKTLPELYEIVKRYKPDVIWSDGDWEAIDAYWNSTEFLAWLYNDSPVKNTVVTNDRWGIDTACKHGGFYTCQDRYNPGKLVNHKWENCFTLDKYSWGFRKEMNAADVMSIEEIVSQIASTVSCGGNVLINIGPTGYGTIPSIFQERLLQLGNWLGVNGESIYNTKPWSHQNDTISKNVWYTSKTVVNTNYVYAIILKFPDDGKLKLGSIVFPVKSLKTEQIELLG-FGKLSY-QKQGNYTLITLPVNALLQL--KWAWTLKISGMI 1446
             A+ Y P W+SLD RPLP+W+DQAK GIFIHWGVFSVP FG      EWFWWYWQ      +  FM NNY P F Y  F   F A+ F+ +QWAD+  ASGAKYVV TSKHHEGF  W S  SWNWN+VD GP  D+V++L  ++RNRT L FGLY+SLFEWF+PL+L D+++ F+   F   KTLPELYE+V RY+P+V+WSDGD  A D YWNST FLAWLYN+SPV+ TVVTNDRWG+ + CKHGG+YTC DRYNPG L+ HKWENC T+DK+SWG+R+E   +D ++IEE+V ++  TV+CGGN+L+NIGPTG GTIP IF+ERL Q+G WL VNGE+IY T  W  QNDT++ +VWYTSK       VYAI LK+P  GKL LG    P+ SL   ++ELLG +  L++   Q +   + LP+ ++ Q+  KW WTL +S +I
Sbjct:   24 RALSYDPTWESLDRRPLPAWFDQAKFGIFIHWGVFSVPSFGS-----EWFWWYWQKEKKPQFVDFMNNNYAPGFKYEDFVVLFTAKYFNANQWADILQASGAKYVVFTSKHHEGFTMWGSDRSWNWNAVDEGPKRDIVKELEVAVRNRTGLHFGLYYSLFEWFHPLFLEDQSSSFQKQRFPVSKTLPELYELVNRYQPEVLWSDGDGGAPDHYWNSTGFLAWLYNESPVRKTVVTNDRWGVGSICKHGGYYTCSDRYNPGYLLPHKWENCMTIDKFSWGYRREAEISDYLTIEELVKKLVETVACGGNLLMNIGPTGDGTIPVIFEERLRQMGTWLKVNGEAIYETHTWRSQNDTVTPDVWYTSKP--EKKLVYAIFLKWPISGKLFLGQ---PIGSLGETEVELLGHWQPLTWTSSQPSGITVELPLLSVHQMPCKWGWTLVLSNVI 461          
BLAST of Alpha-L-fucosidase vs. Ensembl Mouse
Match: Fuca1 (fucosidase, alpha-L- 1, tissue [Source:MGI Symbol;Acc:MGI:95593])

HSP 1 Score: 483.797 bits (1244), Expect = 4.031e-168
Identity = 246/442 (55.66%), Postives = 315/442 (71.27%), Query Frame = 1
Query:  124 RYSPDWKSLDSRPLPSWYDQAKIGIFIHWGVFSVPGFGDFTHAGEWFWWYWQGVNMTNYEKFMANNYPPSFTYASFAKEFRAERFDPDQWADLFNASGAKYVVLTSKHHEGFCXXXXXXXXXXXXVDIGPNMDLVEKLGTSIRNRTKLIFGLYHSLFEWFNPLYLTDKNNKFKTNLFVRDKTLPELYEIVKRYKPDVIWSDGDWEAIDAYWNSTEFLAWLYNDSPVKNTVVTNDRWGIDTACKHGGFYTCQDRYNPGKLVNHKWENCFTLDKYSWGFRKEMNAADVMSIEEIVSQIASTVSCGGNVLINIGPTGYGTIPSIFQERLLQLGNWLGVNGESIYNTKPWSHQNDTISKNVWYTSKTVVNTNYVYAIILKFPDDGKLKLGSIVFPVKSLKTEQIELLGF-GKLSY-QKQGNYTLITLP--VNALLQLKWAWTLKIS 1437
            R++PDW+SLDSRPLPSW+D+AK G+F+HWGVFSVP +G      EWFWW+WQG  M  Y++FM  NYPP F+YA FA +F A  F PDQWA+LF A+GAKYVVLT+KHHEGF NW S  SWNWNS D+GP+ DLV +LG ++R R  + +GLYHSL EWF+PLYL DK N FKT  FVR KT+PELY++V  YKPD+IWSDG+WE  D YWNST FLAWLYNDSPVK+ V+ NDRWG + +C HGG+Y CQD+Y P  L +HKWE C ++D+ SWG+RK+M  + +    EI+ ++  TVS GGN L+NIGPT  G I  IFQERLL +G WL +NGE+IY +KPW  Q++     VWYT+K       VYA  L +P++G + L S     K+    +I +LG  G LS+ Q      LI+LP     +L +++AWTLK++
Sbjct:   22 RFTPDWQSLDSRPLPSWFDEAKFGVFVHWGVFSVPAWG-----SEWFWWHWQGDRMPAYQRFMTENYPPGFSYADFAPQFTARFFHPDQWAELFQAAGAKYVVLTTKHHEGFTNWPSPVSWNWNSKDVGPHRDLVGELGAAVRKRN-IRYGLYHSLLEWFHPLYLLDKKNGFKTQHFVRAKTMPELYDLVNSYKPDLIWSDGEWECPDTYWNSTSFLAWLYNDSPVKDEVIVNDRWGQNCSCHHGGYYNCQDKYKPQSLPDHKWEMCTSMDRASWGYRKDMTMSTIAKENEIIEELVQTVSLGGNYLLNIGPTKDGLIVPIFQERLLAVGKWLQINGEAIYASKPWRVQSEKNKTVVWYTTKNAT----VYATFLYWPENGIVNLKS----PKTTSATKITMLGLEGDLSWTQDPLEGVLISLPQLPPTVLPVEFAWTLKLT 449          
BLAST of Alpha-L-fucosidase vs. Ensembl Mouse
Match: Fuca2 (fucosidase, alpha-L- 2, plasma [Source:MGI Symbol;Acc:MGI:1914098])

HSP 1 Score: 99.7525 bits (247), Expect = 5.605e-25
Identity = 57/95 (60.00%), Postives = 68/95 (71.58%), Query Frame = 1
Query:  310 MANNYPPSFTYASFAKEFRAERFDPDQWADLFNASGAKYVVLTSKHHEGFCXXXXXXXXXXXXVDIGPNMDLVEKLGTSIRNRTKLIFGLYHSLF 594
            M NNY P F Y  F   F A+ F+ +QWAD+  ASGAKYVV TSKHHEGF  W S  SWNWN+VD GP  D+V++L  ++RNRT L FGLY+SLF
Sbjct:    1 MNNNYAPGFKYEDFVVLFTAKYFNANQWADILQASGAKYVVFTSKHHEGFTMWGSDRSWNWNAVDEGPKRDIVKELEVAVRNRTGLHFGLYYSLF 95          
BLAST of Alpha-L-fucosidase vs. UniProt/SwissProt
Match: sp|Q6AYS4|FUCO2_RAT (Plasma alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca2 PE=2 SV=1)

HSP 1 Score: 513.072 bits (1320), Expect = 1.114e-178
Identity = 260/453 (57.40%), Postives = 327/453 (72.19%), Query Frame = 1
Query:   97 TLYTHCNAVRYSPDWKSLDSRPLPSWYDQAKIGIFIHWGVFSVPGFGDFTHAGEWFWWYWQGVNMTNYEKFMANNYPPSFTYASFAKEFRAERFDPDQWADLFNASGAKYVVLTSKHHEGFCXXXXXXXXXXXXVDIGPNMDLVEKLGTSIRNRTKLIFGLYHSLFEWFNPLYLTDKNNKFKTNLFVRDKTLPELYEIVKRYKPDVIWSDGDWEAIDAYWNSTEFLAWLYNDSPVKNTVVTNDRWGIDTACKHGGFYTCQDRYNPGKLVNHKWENCFTLDKYSWGFRKEMNAADVMSIEEIVSQIASTVSCGGNVLINIGPTGYGTIPSIFQERLLQLGNWLGVNGESIYNTKPWSHQNDTISKNVWYTSKTVVNTNYVYAIILKFPDDGKLKLGSIVFPVKSLKTEQIELLGFGK-LSY-QKQGNYTLITLPVNALLQL--KWAWTLKISGM 1443
            T Y    A+ Y P W+SLD RPLP+W+DQAK GIFIHWGVFSVP FG      EWFWWYWQ      +  FM NNYPP F Y  F   F A+ F+ +QWADL  ASGAKYVVLTSKHHEGF  W S +SWNWN+VD GP  D+V++L  ++RNRT L FGLY+SLFEWF+PL+L D+++ F+   F   KTLPELYE+V +Y+P+V+WSDGD  A D YWNST+FLAWLYN+SPV++TVVTNDRWG  + CKHGG+YTC DRYNPG L+ HKWENC T+DK+SWG+R+E    D ++IEE+V Q+  TVSCGGN+L+NIGPT  G IP IF+ERL Q+G WL VNGE+IY T  W  QNDT++ +VWYTSK       VYAI LK+P  GKL LG    P+ SL   ++ELLG G+ L++   + +  ++ LP  ++ Q+  KW WTL ++ +
Sbjct:   16 TRYRAVTALSYDPTWESLDRRPLPAWFDQAKFGIFIHWGVFSVPSFGS-----EWFWWYWQKERRPKFVDFMDNNYPPGFKYEDFGVLFTAKYFNANQWADLLQASGAKYVVLTSKHHEGFTLWGSAHSWNWNAVDEGPKRDIVKELEVAVRNRTDLHFGLYYSLFEWFHPLFLEDQSSAFQKQRFPVAKTLPELYELVTKYQPEVLWSDGDGGAPDHYWNSTDFLAWLYNESPVRDTVVTNDRWGAGSICKHGGYYTCSDRYNPGHLLPHKWENCMTIDKFSWGYRREAEIGDYLTIEELVKQLVETVSCGGNLLMNIGPTLDGIIPVIFEERLRQMGTWLKVNGEAIYETHTWRSQNDTVTPDVWYTSKP--EKKLVYAIFLKWPISGKLFLGQ---PIGSLGETEVELLGHGRPLTWTSSKPSGIVVELPRLSVHQMPCKWGWTLALTNV 458          
BLAST of Alpha-L-fucosidase vs. UniProt/SwissProt
Match: sp|Q99KR8|FUCO2_MOUSE (Plasma alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca2 PE=1 SV=1)

HSP 1 Score: 508.449 bits (1308), Expect = 7.209e-177
Identity = 258/448 (57.59%), Postives = 324/448 (72.32%), Query Frame = 1
Query:  115 NAVRYSPDWKSLDSRPLPSWYDQAKIGIFIHWGVFSVPGFGDFTHAGEWFWWYWQGVNMTNYEKFMANNYPPSFTYASFAKEFRAERFDPDQWADLFNASGAKYVVLTSKHHEGFCXXXXXXXXXXXXVDIGPNMDLVEKLGTSIRNRTKLIFGLYHSLFEWFNPLYLTDKNNKFKTNLFVRDKTLPELYEIVKRYKPDVIWSDGDWEAIDAYWNSTEFLAWLYNDSPVKNTVVTNDRWGIDTACKHGGFYTCQDRYNPGKLVNHKWENCFTLDKYSWGFRKEMNAADVMSIEEIVSQIASTVSCGGNVLINIGPTGYGTIPSIFQERLLQLGNWLGVNGESIYNTKPWSHQNDTISKNVWYTSKTVVNTNYVYAIILKFPDDGKLKLGSIVFPVKSLKTEQIELLG-FGKLSY-QKQGNYTLITLPVNALLQL--KWAWTLKISGMI 1446
             A+ Y P W+SLD RPLP+W+DQAK GIFIHWGVFSVP FG      EWFWWYWQ      +  FM NNY P F Y  F   F A+ F+ +QWAD+  ASGAKYVV TSKHHEGF  W S  SWNWN+VD GP  D+V++L  ++RNRT L FGLY+SLFEWF+PL+L D+++ F+   F   KTLPELYE+V RY+P+V+WSDGD  A D YWNST FLAWLYN+SPV+ TVVTNDRWG+ + CKHGG+YTC DRYNPG L+ HKWENC T+DK+SWG+R+E   +D ++IEE+V ++  TV+CGGN+L+NIGPTG GTIP IF+ERL Q+G WL VNGE+IY T  W  QNDT++ +VWYTSK       VYAI LK+P  GKL LG    P+ SL   ++ELLG +  L++   Q +   + LP+ ++ Q+  KW WTL +S +I
Sbjct:   24 RALSYDPTWESLDRRPLPAWFDQAKFGIFIHWGVFSVPSFGS-----EWFWWYWQKEKKPQFVDFMNNNYAPGFKYEDFVVLFTAKYFNANQWADILQASGAKYVVFTSKHHEGFTMWGSDRSWNWNAVDEGPKRDIVKELEVAVRNRTGLHFGLYYSLFEWFHPLFLEDQSSSFQKQRFPVSKTLPELYELVNRYQPEVLWSDGDGGAPDHYWNSTGFLAWLYNESPVRKTVVTNDRWGVGSICKHGGYYTCSDRYNPGYLLPHKWENCMTIDKFSWGYRREAEISDYLTIEELVKKLVETVACGGNLLMNIGPTGDGTIPVIFEERLRQMGTWLKVNGEAIYETHTWRSQNDTVTPDVWYTSKP--EKKLVYAIFLKWPISGKLFLGQ---PIGSLGETEVELLGHWQPLTWTSSQPSGITVELPLLSVHQMPCKWGWTLVLSNVI 461          
BLAST of Alpha-L-fucosidase vs. UniProt/SwissProt
Match: sp|Q9BTY2|FUCO2_HUMAN (Plasma alpha-L-fucosidase OS=Homo sapiens OX=9606 GN=FUCA2 PE=1 SV=2)

HSP 1 Score: 504.982 bits (1299), Expect = 2.142e-175
Identity = 256/450 (56.89%), Postives = 325/450 (72.22%), Query Frame = 1
Query:  115 NAVRYSPDWKSLDSRPLPSWYDQAKIGIFIHWGVFSVPGFGDFTHAGEWFWWYWQGVNMTNYEKFMANNYPPSFTYASFAKEFRAERFDPDQWADLFNASGAKYVVLTSKHHEGFCXXXXXXXXXXXXVDIGPNMDLVEKLGTSIRNRTKLIFGLYHSLFEWFNPLYLTDKNNKFKTNLFVRDKTLPELYEIVKRYKPDVIWSDGDWEAIDAYWNSTEFLAWLYNDSPVKNTVVTNDRWGIDTACKHGGFYTCQDRYNPGKLVNHKWENCFTLDKYSWGFRKEMNAADVMSIEEIVSQIASTVSCGGNVLINIGPTGYGTIPSIFQERLLQLGNWLGVNGESIYNTKPWSHQNDTISKNVWYTSKTVVNTNYVYAIILKFPDDGKLKLGSIVFPVKSLKTEQIELLGFGK----LSYQKQGNYTLITLPVNALLQL--KWAWTLKISGMI 1446
            +A R+ P W+SLD+R LP+W+DQAK GIFIHWGVFSVP FG      EWFWWYWQ   +  Y +FM +NYPPSF Y  F   F A+ F+ +QWAD+F ASGAKY+VLTSKHHEGF  W S+YSWNWN++D GP  D+V++L  +IRNRT L FGLY+SLFEWF+PL+L D+++ F    F   KTLPELYE+V  Y+P+V+WSDGD  A D YWNST FLAWLYN+SPV+ TVVTNDRWG  + CKHGGFYTC DRYNPG L+ HKWENC T+DK SWG+R+E   +D ++IEE+V Q+  TVSCGGN+L+NIGPT  GTI  +F+ERL Q+G+WL VNGE+IY T  W  QNDT++ +VWYTSK       VYAI LK+P  G+L LG    P   L   +++LLG G+    +S ++ G   ++ LP   + Q+  KW W L ++ +I
Sbjct:   30 SATRFDPTWESLDARQLPAWFDQAKFGIFIHWGVFSVPSFGS-----EWFWWYWQKEKIPKYVEFMKDNYPPSFKYEDFGPLFTAKFFNANQWADIFQASGAKYIVLTSKHHEGFTLWGSEYSWNWNAIDEGPKRDIVKELEVAIRNRTDLRFGLYYSLFEWFHPLFLEDESSSFHKRQFPVSKTLPELYELVNNYQPEVLWSDGDGGAPDQYWNSTGFLAWLYNESPVRGTVVTNDRWGAGSICKHGGFYTCSDRYNPGHLLPHKWENCMTIDKLSWGYRREAGISDYLTIEELVKQLVETVSCGGNLLMNIGPTLDGTISVVFEERLRQMGSWLKVNGEAIYETHTWRSQNDTVTPDVWYTSKP--KEKLVYAIFLKWPTSGQLFLGH---PKAILGATEVKLLGHGQPLNWISLEQNG--IMVELPQLTIHQMPCKWGWALALTNVI 467          
BLAST of Alpha-L-fucosidase vs. UniProt/SwissProt
Match: sp|Q5RFI5|FUCO2_PONAB (Plasma alpha-L-fucosidase OS=Pongo abelii OX=9601 GN=FUCA2 PE=2 SV=1)

HSP 1 Score: 500.36 bits (1287), Expect = 1.547e-173
Identity = 254/450 (56.44%), Postives = 324/450 (72.00%), Query Frame = 1
Query:  115 NAVRYSPDWKSLDSRPLPSWYDQAKIGIFIHWGVFSVPGFGDFTHAGEWFWWYWQGVNMTNYEKFMANNYPPSFTYASFAKEFRAERFDPDQWADLFNASGAKYVVLTSKHHEGFCXXXXXXXXXXXXVDIGPNMDLVEKLGTSIRNRTKLIFGLYHSLFEWFNPLYLTDKNNKFKTNLFVRDKTLPELYEIVKRYKPDVIWSDGDWEAIDAYWNSTEFLAWLYNDSPVKNTVVTNDRWGIDTACKHGGFYTCQDRYNPGKLVNHKWENCFTLDKYSWGFRKEMNAADVMSIEEIVSQIASTVSCGGNVLINIGPTGYGTIPSIFQERLLQLGNWLGVNGESIYNTKPWSHQNDTISKNVWYTSKTVVNTNYVYAIILKFPDDGKLKLGSIVFPVKSLKTEQIELLGFGK----LSYQKQGNYTLITLPVNALLQL--KWAWTLKISGMI 1446
            +A R+ P W+SLD+R LP+W+DQAK GIFIHWGVFSVP FG      EWFWWYWQ   +  Y +FM +NYPPSF Y  F   F A+ F+ +QWAD+F ASGAKY+VLTSKHH+GF  W S+YSWNWN++D GP  D+V++L  +IRNRT L FGLY+SLFEWF+PL+L D+++ F    F   KTLPELYE+V  Y+P+V+WSDGD  A D YWNST FLAWLYN+SPV+ TVVTNDRWG  +  KHGGFYTC DRYNPG L+ HKWENC T+DK SWG+R+E   +D ++IEE+V Q+  TVSCGGN+L+NIGPT  GTI  +F+ERL Q+G+WL VNGE+IY T  W  QNDT++ +VWYTSK       VYAI LK+P  G+L LG    P   L   +++LLG G+    +S ++ G   ++ LP   + Q+  KW W L ++ +I
Sbjct:   28 SATRFDPTWESLDARQLPAWFDQAKFGIFIHWGVFSVPSFGS-----EWFWWYWQKEKIPKYVEFMKDNYPPSFKYEDFGPLFTAKFFNANQWADIFQASGAKYIVLTSKHHKGFTLWGSEYSWNWNAIDEGPKRDIVKELEVAIRNRTDLRFGLYYSLFEWFHPLFLEDESSSFHKRQFPVSKTLPELYELVNNYQPEVLWSDGDGGAPDQYWNSTGFLAWLYNESPVRETVVTNDRWGAGSIYKHGGFYTCSDRYNPGHLLPHKWENCMTIDKLSWGYRREAGISDYLTIEELVKQLVETVSCGGNLLMNIGPTLDGTISVVFEERLRQMGSWLKVNGEAIYETHTWQSQNDTVTPDVWYTSKP--KEKLVYAIFLKWPTSGQLFLGQ---PKAILGATEVKLLGHGQPLNWISLERNG--IMVELPQLTIHQMPCKWGWALALTNVI 465          
BLAST of Alpha-L-fucosidase vs. UniProt/SwissProt
Match: sp|C3YWU0|FUCO_BRAFL (Alpha-L-fucosidase OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_56888 PE=3 SV=2)

HSP 1 Score: 489.574 bits (1259), Expect = 1.260e-169
Identity = 259/450 (57.56%), Postives = 317/450 (70.44%), Query Frame = 1
Query:  112 CNAVRYSPDWKSLDSRPLPSWYDQAKIGIFIHWGVFSVPGFGDFTHAGEWFWWYWQGVNMTNYEK-FMANNYPPSFTYASFAKEFRAERFDPDQWADLFNASGAKYVVLTSKHHEGFCXXXXXXXXXXXXVDIGPNMDLVEKLGTSIRNRTKLIFGLYHSLFEWFNPLYLTDKNNKFKTNLFVRDKTLPELYEIVKRYKPDVIWSDGDWEAIDAYWNSTEFLAWLYNDSPVKNTVVTNDRWGIDTACKHGGFYTCQDRYNPGKLVNHKWENCFTLDKYSWGFRKEMNAADVMSIEEIVSQIASTVSCGGNVLINIGPTGYGTIPSIFQERLLQLGNWLGVNGESIYNTKPWSHQNDTISKNVWYTSKTVVNTNYVYAIILKFPDDGKLKLGSIVFPVKSLKTEQIELLGFGK-LSYQK-QGNYTLITLPVNALLQL--KWAWTLKISGMI 1446
            C   RY+P W SLD RPLPSWYD+AK GIF+HWGVFSVP FG      EWFWW W+G +  N+ K FM  NYPP F YA FA  F AE ++P QWA++  ASGAKYVVLTSKHHEGF NW SKYSWNWNSVD GP+ DLV +L  +IRN + L FGLY+SLFEWF+PLYL DK NK+ T  + +D  L ELYE+V  Y P+V+WSDGDWEA   YWNST FLAWLYNDSPVK+TVVTNDRWG    C HGG+YTC DRYNPG L  HKWENC T+DK SWGFR+E   AD + ++++V  +A TVSCGGN+L+NIGPT  G I  IF+ERL  +G WL VNG++IY TKPW  QNDT    VWYTSK     + VYAI+L +P+ G+L LG      +S  T  + +LG+   L +    G+   + +P  +  QL  +WAW +++ G++
Sbjct:   13 CFQPRYAPTWDSLDQRPLPSWYDEAKFGIFMHWGVFSVPSFG-----SEWFWWDWKGAHDQNFIKDFMKRNYPPGFRYADFAPMFTAEWYNPLQWAEVLQASGAKYVVLTSKHHEGFTNWPSKYSWNWNSVDNGPHRDLVGELAMAIRNNSDLHFGLYYSLFEWFHPLYLKDKQNKWTTQDYTKDVGLAELYELVNAYHPEVVWSDGDWEAPYTYWNSTNFLAWLYNDSPVKDTVVTNDRWGSGMLCHHGGYYTCSDRYNPGVLQKHKWENCMTIDKKSWGFRREATLADYLDMDDLVKILAETVSCGGNLLMNIGPTHDGRIVPIFEERLRSMGKWLQVNGDAIYATKPWRAQNDTRESGVWYTSK----NDSVYAIVLDWPNSGQLTLGV----PRSSPTTTVTMLGWAAPLKWVAVSGSGITVQMPTASSNQLPCQWAWVIRMKGVM 449          
BLAST of Alpha-L-fucosidase vs. TrEMBL
Match: A0A3M7R5S5 (Plasma alpha-L-fucosidase OS=Brachionus plicatilis OX=10195 GN=BpHYR1_038061 PE=3 SV=1)

HSP 1 Score: 526.168 bits (1354), Expect = 0.000e+0
Identity = 272/471 (57.75%), Postives = 338/471 (71.76%), Query Frame = 1
Query:   61 MLFSIWIVTLIFTLYTHCNAVRYSPDWKSLDSRPLPSWYDQAKIGIFIHWGVFSVPGFGDFTHAGEWFWWYWQGVNMT-NYEKFMANNYPPSFTYASFAKEFRAERFDPDQWADLFNASGAKYVVLTSKHHEGFCXXXXXXXXXXXXVDIGPNMDLVEKLGTSIRNRTKLIFGLYHSLFEWFNPLYLTDKNNKFKTNLFVRDKTLPELYEIVKRYKPDVIWSDGDWEAIDAYWNSTEFLAWLYNDSPVKNTVVTNDRWGIDTACKHGGFYTCQDRYNPGKLVNHKWENCFTLDKYSWGFRKEMNAADVMSIEEIVSQIASTVSCGGNVLINIGPTGYGTIPSIFQERLLQLGNWLGVNGESIYNTKPWSHQNDTISKNVWYTSKTVVNTNYVYAIILKFPDDG-KLKLGSIVFPVKSLKTEQIELLGFG-KLSY--QKQGNYTLITLPVNA-LLQLKWAWTLKISGMIY*K 1455
            M+  I++  LIF L      ++Y+PDW SLD+RPLP WYD AK+GIFIHWGVFSVP F       EWFWW WQG   T +   FM NNYPP+F YA FA EF+AE FDP QW  L NASGAKYVVLTSKHHEG+  W S YSWNWNS D+GP+ DLV  L  +IR  + L FGLYHSLFEWFNPLYL+DKN  FKT  +V++K LP LYEIV +Y+P+V+WSDGDWEA D+YWNST F+AWLYN+SPVK++VV NDRWG    C+HG FYTCQD +NPGKL++HKWENC  LD  SWG+R+ +  +D+++IEE++  +A TVSCGGN+LINIGPT  GTI  IF+ERL QLG WL +NGE+IY +KPW +QNDT + +VWYT+    N + VYAI+LK+P    K++LGS    V+  +  QI +LG   KL +    +G   +    V+A  L  KWAWT K+  + Y K
Sbjct:    1 MIEKIFLSLLIFILINKAENLKYNPDWSSLDTRPLPKWYDDAKVGIFIHWGVFSVPSF-----RSEWFWWDWQGDKPTSDVVDFMKNNYPPNFEYADFAPEFKAEFFDPLQWVSLLNASGAKYVVLTSKHHEGYTLWPSAYSWNWNSNDVGPHKDLVGDLAQAIRTNSSLRFGLYHSLFEWFNPLYLSDKNQSFKTQTYVKEKALPSLYEIVNKYEPEVVWSDGDWEAQDSYWNSTAFIAWLYNESPVKDSVVVNDRWGSGVLCQHGDFYTCQDNFNPGKLLSHKWENCMPLDNNSWGYRRNLKLSDILTIEEVIKSLAETVSCGGNILINIGPTKEGTIAPIFEERLRQLGEWLSINGEAIYESKPWKYQNDTKNSDVWYTT----NGDLVYAILLKYPQSSLKVELGS----VQITEATQINILGNDEKLQWVESPEGGVVIDLHSVDASSLISKWAWTFKLENISYQK 458          
BLAST of Alpha-L-fucosidase vs. TrEMBL
Match: A0A210Q777 (Alpha-L-fucosidase OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT12073 PE=3 SV=1)

HSP 1 Score: 521.161 bits (1341), Expect = 2.707e-179
Identity = 253/457 (55.36%), Postives = 322/457 (70.46%), Query Frame = 1
Query:   79 IVTLIFTLYTHCNAVRYSPDWKSLDSRPLPSWYDQAKIGIFIHWGVFSVPGFGDFTHAGEWFWWYWQGVNMTNYEKFMANNYPPSFTYASFAKEFRAERFDPDQWADLFNASGAKYVVLTSKHHEGFCXXXXXXXXXXXXVDIGPNMDLVEKLGTSIRNRTKLIFGLYHSLFEWFNPLYLTDKNNKFKTNLFVRDKTLPELYEIVKRYKPDVIWSDGDWEAIDAYWNSTEFLAWLYNDSPVKNTVVTNDRWGIDTACKHGGFYTCQDRYNPGKLVNHKWENCFTLDKYSWGFRKEMNAADVMSIEEIVSQIASTVSCGGNVLINIGPTGYGTIPSIFQERLLQLGNWLGVNGESIYNTKPWSHQNDTISKNVWYTSKTVVNTNYVYAIILKFPDDGKLKLGSIVF--PVKSLKTEQIELLGFGKLSYQKQGNYTLITLPVNALLQLKWAWTLKISGM 1443
            ++ ++  L       RY+PDW SLD+RPLP WYD  K+G+FIHWGVFSVP F       EWFWW WQG    +  +FM  NYPP FTY  F  +F A RFD ++WA++ + SGA YVVLTSKHHEG+  W S +SWNWN++D+GP+ DLV +L  ++RN+T + FGLYHSLFEWFNPLYL DK NKF T  FVR+KTLPELYEIV RYKPD+IWSDGDWEA D+YWNST+FLAWLYNDSPVK+TV+TNDRWG    CKHGG++TC DRYNPG L  HKWEN  TLD+ SWG+R++ + +DV++I+E+++ +A TVSCGGN+L+NIGPT  GTIP +F+ERLLQ+G WLGVN ++IY++KPW +QNDT +  VWYT+K +     VYA   K P+ G L LG+ +   P     T Q  +  F   +   QG   +    V       W W   + G+
Sbjct:    8 LIAVLVLLGVCVGGARYTPDWDSLDTRPLPLWYDGTKVGVFIHWGVFSVPAF-----RSEWFWWDWQGAKYNDCIEFMKANYPPGFTYPDFGPKFTASRFDANKWAEVLDKSGAGYVVLTSKHHEGYTMWPSAHSWNWNAMDVGPHRDLVGELANAVRNKTAMFFGLYHSLFEWFNPLYLGDKANKFHTQNFVREKTLPELYEIVNRYKPDIIWSDGDWEAPDSYWNSTQFLAWLYNDSPVKDTVLTNDRWGSGDMCKHGGYFTCSDRYNPGVLQKHKWENAMTLDQKSWGYRRDTDLSDVLTIQELIATLAETVSCGGNLLVNIGPTSDGTIPPVFEERLLQMGQWLGVNADAIYDSKPWHYQNDTHTPGVWYTAKKISMVTIVYAFTQKLPESGYLYLGAPIPGDPSFCQVTLQGTVYTF-PWTTGPQGGMNITVSNVTNATPYSWGWVFSLYGL 458          
BLAST of Alpha-L-fucosidase vs. TrEMBL
Match: A0A267FHX8 (Fucosidase_C domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig021659g2 PE=4 SV=1)

HSP 1 Score: 518.85 bits (1335), Expect = 4.156e-178
Identity = 255/457 (55.80%), Postives = 325/457 (71.12%), Query Frame = 1
Query:   79 IVTLIFTLYTHCNAVRYSPDWKSLDSRPLPSWYDQAKIGIFIHWGVFSVPGFGDFTHAGEWFWWYWQGVN-MTNYEKFMANNYPPSFTYASFAKEFRAERFDPDQWADLFNASGAKYVVLTSKHHEGFCXXXXXXXXXXXXVDIGPNMDLVEKLGTSIRNRTKLIFGLYHSLFEWFNPLYLTDKNNKFKTNLFVRDKTLPELYEIVKRYKPDVIWSDGDWEAIDAYWNSTEFLAWLYNDSPVKNTVVTNDRWGIDTACKHGGFYTCQDRYNPGKLVNHKWENCFTLDKYSWGFRKEMNAADVMSIEEIVSQIASTVSCGGNVLINIGPTGYGTIPSIFQERLLQLGNWLGVNGESIYNTKPWSHQNDTISKNVWYTSKTVVNTNYVYAIILKFPDDGKLKLGSIVFPVKSLKTEQIELLGFGKL-SYQKQGNYTLITLPVNALLQLKWAWTLKISGM 1443
            + +  F L + C   RY+PDW SLDSRPLP+WYDQ+KIGIFIHWGVFSVP     ++  EWFWWYWQG +   +   FM  NYPP FTYA FA +F+A  F+PDQWA+LF+++GAKYVV TSKHHEG+CNW++ YS+NWNS  +GPN DLV  L  +IR R  L FGLYHSL+EWFNPLY  D+ ++FKT  FV  KT+PELYE+V R+KPDV+WSDGDW+A   YWNST FLAWLYNDSPV ++VVTNDRWG    C HGG+YTCQDRYNPG L  HKWENC TLDK SWG+R++   AD ++ +E++S +A+T+SCGGN+L+N+GPT  GTI  + +ERL QLG+WL  NGE++YN+ PWS QNDT +  VWYT +       VYA +L +P + +L LGS+           + LLG  K  ++        + LP      L+WAW L++ G+
Sbjct:   16 VASFAFCLASLCQ-CRYTPDWASLDSRPLPAWYDQSKIGIFIHWGVFSVP-----SYHSEWFWWYWQGTDKQKDVVNFMKQNYPPGFTYADFAPKFKATFFNPDQWAELFDSAGAKYVVFTSKHHEGYCNWDTAYSFNWNSKQVGPNRDLVADLAAAIRKRPGLRFGLYHSLYEWFNPLYQNDQRSQFKTRDFVLSKTMPELYELVNRFKPDVVWSDGDWDAPAEYWNSTGFLAWLYNDSPVNDSVVTNDRWGKGVMCNHGGYYTCQDRYNPGILQPHKWENCMTLDKQSWGYRRDARLADYLTPQELLSTLATTISCGGNLLVNVGPTADGTIDPVMEERLRQLGSWLRTNGEAVYNSTPWSRQNDTATSGVWYTQR----AGSVYAFLLTWPANDRLLLGSVAM------ATNVTLLGHPKRPAFSATPKGLSVALPSLDGTGLRWAWVLRLDGV 456          
BLAST of Alpha-L-fucosidase vs. TrEMBL
Match: A0A1I8H1R1 (Fucosidase_C domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 516.538 bits (1329), Expect = 2.505e-177
Identity = 253/457 (55.36%), Postives = 325/457 (71.12%), Query Frame = 1
Query:   79 IVTLIFTLYTHCNAVRYSPDWKSLDSRPLPSWYDQAKIGIFIHWGVFSVPGFGDFTHAGEWFWWYWQGVN-MTNYEKFMANNYPPSFTYASFAKEFRAERFDPDQWADLFNASGAKYVVLTSKHHEGFCXXXXXXXXXXXXVDIGPNMDLVEKLGTSIRNRTKLIFGLYHSLFEWFNPLYLTDKNNKFKTNLFVRDKTLPELYEIVKRYKPDVIWSDGDWEAIDAYWNSTEFLAWLYNDSPVKNTVVTNDRWGIDTACKHGGFYTCQDRYNPGKLVNHKWENCFTLDKYSWGFRKEMNAADVMSIEEIVSQIASTVSCGGNVLINIGPTGYGTIPSIFQERLLQLGNWLGVNGESIYNTKPWSHQNDTISKNVWYTSKTVVNTNYVYAIILKFPDDGKLKLGSIVFPVKSLKTEQIELLGFGKL-SYQKQGNYTLITLPVNALLQLKWAWTLKISGM 1443
            + +  F L + C   RY+PDW SLDSRPLP+WYDQ+KIGIFIHWGVFSVP     ++  EWFWWYWQG +   +   FM  NYPP FTYA FA +F+A  F+PDQWA+LF+++GAKYVV TSKHHEG+CNW++ YS+NWNS  +GPN DLV  L  +IR R  L FGLYHSL+EWFNPLY  D+ ++FKT  FV  KT+PELYE+V R+KPDV+WSDGDW+A   YWNST FLAWLYNDSPV ++VVTNDRWG    C HGG+YTCQDRYNPG L  HKWENC TLDK SWG+R++   AD ++ +E++S +A+T+SCGGN+L+N+GPT  GTI  + +ERL QLG+WL  NG+++YN+ PW+ QNDT +  VWYT +       VYA +L +P + +L LGS+           + LLG  K  ++        + LP      L+WAW L++ G+
Sbjct:    9 VASFAFCLASLCQ-CRYTPDWASLDSRPLPAWYDQSKIGIFIHWGVFSVP-----SYHSEWFWWYWQGTDKQKDVVNFMKQNYPPGFTYADFAPKFKATFFNPDQWAELFDSAGAKYVVFTSKHHEGYCNWDTAYSFNWNSKQVGPNRDLVADLAAAIRKRPGLRFGLYHSLYEWFNPLYQNDQRSQFKTRDFVLSKTMPELYELVNRFKPDVVWSDGDWDAPAEYWNSTGFLAWLYNDSPVNDSVVTNDRWGKGVMCNHGGYYTCQDRYNPGILQPHKWENCMTLDKLSWGYRRDARLADYLTPQELLSTLATTISCGGNLLVNVGPTADGTIDPVMEERLRQLGSWLRTNGDAVYNSTPWTRQNDTATSGVWYTQR----AGSVYAFLLTWPANDRLLLGSVAM------ATNVTLLGHPKRPAFSATPKGLSVALPSLDGTGLRWAWVLRLDGV 449          
BLAST of Alpha-L-fucosidase vs. TrEMBL
Match: A0A267H3A8 (Fucosidase_C domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034267g2 PE=4 SV=1)

HSP 1 Score: 516.538 bits (1329), Expect = 2.895e-177
Identity = 253/457 (55.36%), Postives = 325/457 (71.12%), Query Frame = 1
Query:   79 IVTLIFTLYTHCNAVRYSPDWKSLDSRPLPSWYDQAKIGIFIHWGVFSVPGFGDFTHAGEWFWWYWQGVN-MTNYEKFMANNYPPSFTYASFAKEFRAERFDPDQWADLFNASGAKYVVLTSKHHEGFCXXXXXXXXXXXXVDIGPNMDLVEKLGTSIRNRTKLIFGLYHSLFEWFNPLYLTDKNNKFKTNLFVRDKTLPELYEIVKRYKPDVIWSDGDWEAIDAYWNSTEFLAWLYNDSPVKNTVVTNDRWGIDTACKHGGFYTCQDRYNPGKLVNHKWENCFTLDKYSWGFRKEMNAADVMSIEEIVSQIASTVSCGGNVLINIGPTGYGTIPSIFQERLLQLGNWLGVNGESIYNTKPWSHQNDTISKNVWYTSKTVVNTNYVYAIILKFPDDGKLKLGSIVFPVKSLKTEQIELLGFGKL-SYQKQGNYTLITLPVNALLQLKWAWTLKISGM 1443
            + +  F L + C   RY+PDW SLDSRPLP+WYDQ+KIGIFIHWGVFSVP     ++  EWFWWYWQG +   +   FM  NYPP FTYA FA +F+A  F+PDQWA+LF+++GAKYVV TSKHHEG+CNW++ YS+NWNS  +GPN DLV  L  +IR R  L FGLYHSL+EWFNPLY  D+ ++FKT  FV  KT+PELYE+V R+KPDV+WSDGDW+A   YWNST FLAWLYNDSPV ++VVTNDRWG    C HGG+YTCQDRYNPG L  HKWENC TLDK SWG+R++   AD ++ +E++S +A+T+SCGGN+L+N+GPT  GTI  + +ERL QLG+WL  NG+++YN+ PW+ QNDT +  VWYT +       VYA +L +P + +L LGS+           + LLG  K  ++        + LP      L+WAW L++ G+
Sbjct:   16 VASFAFCLASLCQ-CRYTPDWASLDSRPLPAWYDQSKIGIFIHWGVFSVP-----SYHSEWFWWYWQGTDKQKDVVNFMKQNYPPGFTYADFAPKFKATFFNPDQWAELFDSAGAKYVVFTSKHHEGYCNWDTAYSFNWNSKQVGPNRDLVADLAAAIRKRPGLRFGLYHSLYEWFNPLYQNDQRSQFKTRDFVLSKTMPELYELVNRFKPDVVWSDGDWDAPAEYWNSTGFLAWLYNDSPVNDSVVTNDRWGKGVMCNHGGYYTCQDRYNPGILQPHKWENCMTLDKLSWGYRRDARLADYLTPQELLSTLATTISCGGNLLVNVGPTADGTIDPVMEERLRQLGSWLRTNGDAVYNSTPWTRQNDTATSGVWYTQR----AGSVYAFLLTWPANDRLLLGSVAM------ATNVTLLGHPKRPAFSATPKGLSVALPSLDGTGLRWAWVLRLDGV 456          
BLAST of Alpha-L-fucosidase vs. Ensembl Cavefish
Match: fuca2 (alpha-L-fucosidase 2 [Source:NCBI gene;Acc:103032153])

HSP 1 Score: 490.73 bits (1262), Expect = 5.961e-171
Identity = 244/457 (53.39%), Postives = 318/457 (69.58%), Query Frame = 1
Query:   82 VTLIFTLYTHCNAVRYSPDWKSLDSRPLPSWYDQAKIGIFIHWGVFSVPGFGDFTHAGEWFWWYWQGVNMTNYEKFMANNYPPSFTYASFAKEFRAERFDPDQWADLFNASGAKYVVLTSKHHEGFCXXXXXXXXXXXXVDIGPNMDLVEKLGTSIRNRTKLIFGLYHSLFEWFNPLYLTDKNNKFKTNLFVRDKTLPELYEIVKRYKPDVIWSDGDWEAIDAYWNSTEFLAWLYNDSPVKNTVVTNDRWGIDTACKHGGFYTCQDRYNPGKLVNHKWENCFTLDKYSWGFRKEMNAADVMSIEEIVSQIASTVSCGGNVLINIGPTGYGTIPSIFQERLLQLGNWLGVNGESIYNTKPWSHQNDTISKNVWYTSKTVVNTNYVYAIILKFPDDGKLKLGSIVFPVKSLKTEQIELLGFGKLSY---QKQGNYTLITLPVNALLQLKWAWTLKISGM 1443
            V  +F L   C   +Y P+W S+DSRP+P W+DQAK+GIFIHWGVFSVP +G      EWFWWYWQG  + +Y  FM  N+ P F Y  FA +F AE FDP QW D+F+ASGAKY+VLTSKHHEG+  W SKYSWNWN+VD+GP  DLV+++ T++R  T L  GLYHS FEWF+PL+  D  N FKTN+F  +K+LPELYE++ +YKP+++WSDGD +A D YWNST FLAWLYN+SPV+ T+VTNDRWG  + C HGG+YTC DRY+PG L+ HKWE+C ++DK SWGFR+E   +D ++IEE++     TVSCGGN+L+N+GPT  G I  +F+ERL Q+G WL VNGE IYNT  W  QND+++  VWYTSK       VYA +L +PD G + L     P+ S  T Q+ L+G   L +   +  G    +       +   WAWTL+++G+
Sbjct:    8 VLSLFLLMGSC-LCQYQPNWDSIDSRPVPEWFDQAKLGIFIHWGVFSVPSYGS-----EWFWWYWQGRKIPDYVSFMTKNFAPGFQYQDFAPKFTAEFFDPKQWMDIFSASGAKYIVLTSKHHEGYTLWGSKYSWNWNAVDVGPKRDLVDEIATALRKNTDLRLGLYHSQFEWFHPLFRADAANNFKTNVFATEKSLPELYELINKYKPELLWSDGDGDAPDQYWNSTGFLAWLYNESPVRETIVTNDRWGKGSICTHGGYYTCTDRYSPGHLLKHKWESCMSIDKRSWGFRREAALSDYLTIEELLKSFIETVSCGGNLLMNVGPTHDGRIVPVFEERLRQMGQWLKVNGEGIYNTTAWRVQNDSVTPGVWYTSKP--QDKAVYAFLLSWPDKGSVVLAD---PIVSAST-QVVLVGNKPLKFDVLKPTGLQVYLPTLTPNEMPCSWAWTLRLTGI 452          
BLAST of Alpha-L-fucosidase vs. Ensembl Cavefish
Match: fuca1.2 (alpha-L-fucosidase 1 [Source:NCBI gene;Acc:103023687])

HSP 1 Score: 467.233 bits (1201), Expect = 1.265e-161
Identity = 241/442 (54.52%), Postives = 298/442 (67.42%), Query Frame = 1
Query:  121 VRYSPDWKSLDSRPLPSWYDQAKIGIFIHWGVFSVPGFGDFTHAGEWFWWYWQGVNMTNYEKFMANNYPPSFTYASFAKEFRAERFDPDQWADLFNASGAKYVVLTSKHHEGFCXXXXXXXXXXXXVDIGPNMDLVEKLGTSIRNRTKLIFGLYHSLFEWFNPLYLTDKNNKFKTNLFVRDKTLPELYEIVKRYKPDVIWSDGDWEAIDAYWNSTEFLAWLYNDSPVKNTVVTNDRWGIDTACKHGGFYTCQDRYNPGKLVNHKWENCFTLDKYSWGFRKEMNAADVMSIEEIVSQIASTVSCGGNVLINIGPTGYGTIPSIFQERLLQLGNWLGVNGESIYNTKPWSHQNDTISKNVWYTSKTVVNTNYVYAIILKFPDDGKLKLGSIVFPVKSLKTEQIELLGF-GKLSYQKQGNYTLITLPVNALLQLKWAWTLKISGM 1443
             RY+PDWKSLD+RPLPSWYDQ+K GIFIHWGVFSVP FG      EWFWWYW+G  +  Y  FM  NYPP F YA FA  F+AE +DPD+WA++F ASGAKY+V TSKHHEGF NW S  SWNWNSVD GP+ D+V +L T++R R  + FGLYHSLFEWF+PLYL+DK + F    FV  K +PE Y++V RYKP++IWSDGDWEA D YWNSTEFLAWLYNDSPVK+ +V NDRWG    CKHGG+Y C D+Y P +   HKWE C ++DKYSWG+R+ M  +DV+ +  I+     TV+ GGN L+NIGP   G IP +F+ERL  +G WL +NGE+IY TKPW    +  +  VWYTS      + VYAI L  P     +L +   PV S KT  + LLG    L +    +  L+ L          AW +K+ G+
Sbjct:   27 ARYTPDWKSLDARPLPSWYDQSKFGIFIHWGVFSVPSFGS-----EWFWWYWKGQKIPGYIWFMDKNYPPGFEYAEFAPGFKAEFWDPDEWAEIFEASGAKYIVFTSKHHEGFTNWGSPTSWNWNSVDNGPHRDIVGELATAVRKRKSVHFGLYHSLFEWFHPLYLSDKASNFTKQDFVSSKVMPEFYDLVTRYKPELIWSDGDWEAPDTYWNSTEFLAWLYNDSPVKDVIVVNDRWGQGCYCKHGGYYNCADKYTPTEPPKHKWEKCNSMDKYSWGYRRNMKFSDVLDLPAIIQDFVYTVALGGNYLLNIGPASDGKIPIVFEERLRSIGAWLKINGEAIYGTKPWRLSTENGTVPVWYTS----TDSAVYAIFLTNPGQYSFQLFT---PVTSEKT-VVTLLGIPDPLKWAPLHSSGLVMLLPELPYTPAQAWVIKMQGV 455          
BLAST of Alpha-L-fucosidase vs. Ensembl Cavefish
Match: fuca1.2 (alpha-L-fucosidase 1 [Source:NCBI gene;Acc:103023687])

HSP 1 Score: 459.144 bits (1180), Expect = 1.981e-158
Identity = 239/444 (53.83%), Postives = 298/444 (67.12%), Query Frame = 1
Query:  115 NAVRYSPDWKSLDSRPLPSWYDQAKIGIFIHWGVFSVPGFGDFTHAGEWFWWYWQGVNMTNYEKFMANNYPPSFTYASFAKEFRAERFDPDQWADLFNASGAKYVVLTSKHHEGFCXXXXXXXXXXXXVDIGPNMDLVEKLGTSIRNRTKLIFGLYHSLFEWFNPLYLTDKNNKFKTNLFVRDKTLPELYEIVKRYKPDVIWSDGDWEAIDAYWNSTEFLAWLYNDSPVKNTVVTNDRWGIDTACKHGGFYTCQDRYNPGKLVNHKWENCFTLDKYSWGFRKEMNAADVMSIEEIVSQIASTVSCGGNVLINIGPTGYGTIPSIFQERLLQLGNWLGVNGESIYNTKPWSHQNDTISKNVWYTSKTVVNTNYVYAIILKFPDDGKLKLGSIVFPVKSLKTEQIELLGF-GKLSYQKQGNYTLITLPVNALLQLKWAWTLKISGM 1443
            +  RY+PDWKSLD+RPLPSWYDQ+K GIFIHWGVFSVP FG      EWFWW W+  N ++Y  FM  NYPP F YA FA  F+AE +D D+WA++F ASGAKY+V TSKHHEGF NW S  SWNWNSVD GP+ D+V +L T++R R  + FGLYHSLFEWF+PLYL+DK + F    FV  K +PE Y++V RYKP++IWSDGDWEA D YWNSTEFLAWLYNDSPVK+ +V NDRWG    CKHGG+Y C D+Y P +   HKWE C ++DKYSWG+R+ M  +DV+ +  I+     TV+ GGN L+NIGP   G IP +F+ERL  +G WL +NGE+IY TKPW    +  +  VWYTS      + VYAI L  P     +L +   PV S KT  + LLG    L +    +  L+ L          AW +K+ G+
Sbjct:   24 STARYTPDWKSLDARPLPSWYDQSKFGIFIHWGVFSVPSFGS-----EWFWWNWKQ-NSSSYVSFMTKNYPPGFEYAEFAPGFKAEFWDADEWAEIFEASGAKYIVFTSKHHEGFTNWGSPTSWNWNSVDNGPHRDIVGELATAVRKRKSVHFGLYHSLFEWFHPLYLSDKASNFTKQDFVSSKVMPEFYDLVTRYKPELIWSDGDWEAPDTYWNSTEFLAWLYNDSPVKDVIVVNDRWGQGCYCKHGGYYNCADKYTPTEPPKHKWEKCNSMDKYSWGYRRNMKFSDVLDLPAIIQDFVYTVALGGNYLLNIGPASDGKIPIVFEERLRSIGAWLKINGEAIYGTKPWRLSTENGTVPVWYTS----TDSAVYAIFLTNPGQYSFQLFT---PVTSEKT-VVTLLGIPDPLKWAPLHSSGLVMLLPELPYTPAQAWVIKMQGV 453          
BLAST of Alpha-L-fucosidase vs. Ensembl Nematostella
Match: EDO47582 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLD1])

HSP 1 Score: 484.182 bits (1245), Expect = 1.114e-168
Identity = 247/460 (53.70%), Postives = 315/460 (68.48%), Query Frame = 1
Query:   70 SIWIVTLIFTLYTHCNAVRYSPDWKSLDSRPLPSWYDQAKIGIFIHWGVFSVPGFGDFTHAGEWFWWYWQGVNMTNYEKFMANNYPPSFTYASFAKEFRAERFDPDQWADLFNASGAKYVVLTSKHHEGFCXXXXXXXXXXXXVDIGPNMDLVEKLGTSIRNRTKLIFGLYHSLFEWFNPLYLTDKNNKFKTNLFVRDKTLPELYEIVKRYKPDVIWSDGDWEAIDAYWNSTEFLAWLYNDSPVKNTVVTNDRWGIDTACKHGGFYTCQDRYNPGKLVNHKWENCFTLDKYSWGFRKEMNAADVMSIEEIVSQIASTVSCGGNVLINIGPTGYGTIPSIFQERLLQLGNWLGVNGESIYNTKPWSHQNDTISKNVWYTSKTVVNTNYVYAIILKFPDDGKLKLGSIVFPVKSLKTEQIELLGFGKLSYQKQGNYTLIT-----LPVNALLQLKWAWTLKI 1434
            SI ++  I       +  +Y P+W SLD+RPLP WYD+AK GI +HWGV+SVP FG    A EWFW YW+      Y  FM  NYPP F+YA FA  F+AE FDPD WA L + SGAKY VLTSKHHEG+ NW S  SWNWNSVD GP+ DL+ +L  S R +T + FGLYHSL+EWFNPLYL DK NKF T+++V+D  +P+L ++V  YKP+ IWSDGDWEA+  YW+S EFLAWL+N+SPVK+TV+ NDRWG + +CKHG  YTC DRYNPG L+ HKWEN  T+DK SWG+R+    +D ++IE++++++ STVSCGGN+L+N+GPT  G I  +FQER+LQ+G WL +NGE IY+TKPW  QNDT +KN+WYTS     T  VYAI L +P  G L LG  +    + K   + +LG         GN   I      +PVN  L  +WAW  K+
Sbjct:    6 SIAVLLSISVFLAPTSDGKYQPNWDSLDTRPLPDWYDRAKFGIIMHWGVYSVPSFG---VAAEWFWNYWKS-GSPQYVDFMKQNYPPGFSYADFAPMFKAEFFDPDIWASLISMSGAKYFVLTSKHHEGWTNWRSNVSWNWNSVDNGPHRDLIGELADSFRTKTNVTFGLYHSLYEWFNPLYLKDKANKFNTSVYVKDILMPQLMDMVNSYKPEYIWSDGDWEALSEYWDSKEFLAWLFNESPVKDTVLVNDRWGSECSCKHGSVYTCSDRYNPGHLIEHKWENAMTVDKLSWGYRRNALFSDFLTIEQLIAELVSTVSCGGNILMNVGPTADGRIAPVFQERMLQMGKWLAINGEGIYDTKPWRAQNDTDTKNIWYTS----TTEAVYAIALDWPSSGHLLLGQPI----TAKDTVVTMLGLSGNFAWTPGNKRGIVIDIPGIPVNK-LPTEWAWVFKL 452          
BLAST of Alpha-L-fucosidase vs. Ensembl Nematostella
Match: EDO49227 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGT0])

HSP 1 Score: 464.922 bits (1195), Expect = 4.026e-161
Identity = 241/463 (52.05%), Postives = 316/463 (68.25%), Query Frame = 1
Query:   61 MLFSIWIVTLIFTLYTHCNAVRYSPDWKSLDSRPLPSWYDQAKIGIFIHWGVFSVPGFGDFTHAGEWFWWYWQGVNMTNYEKFMANNYPPSFTYASFAKEFRAERFDPDQWADLFNASGAKYVVLTSKHHEGFCXXXXXXXXXXXXVDIGPNMDLVEKLGTSIRNRTKLIFGLYHSLFEWFNPLYLTDKNNKFKTNLFVRDKTLPELYEIVKRYKPDVIWSDGDWEAIDAYWNSTEFLAWLYNDSPVKNTVVTNDRWGIDTACKHGGFYTCQDRYNPGKLVNHKWENCFTLDKYSWGFRKEMNAADVMSIEEIVSQIASTVSCGGNVLINIGPTGYGTIPSIFQERLLQLGNWLGVNGESIYNTKPWSHQNDTISKNVWYTSKTVVNTNYVYAIILKFPDDGKLKLGSIVFPVKSLKTEQIELLGFGK-LSYQKQGNYTLI----TLPVNALLQLKWAWTLKI 1434
            M  SI I  L+           Y+  WKSLD+RPLP+WYDQAK GIF+HWGVFSVPGFG      EWFW++W+G++   Y +FM  NY P F+Y  F   F+AE +DP+QWADLF  SGA+YVVLTSKHHEG+  W S  SWNWN+VD GP+ DLV  L  ++R +T + FGLYHSL+EWFNPL+L D+ + + +  +V +    +L +IV  Y+PDV+W+DG       YW S +FLAWLYN SPVK+ VV NDRWG + AC HGGF+TC D YNPGKLV HKWEN   LDK SWG+R  ++  DV +IEE++ Q  STVSCGGN+L+NIGP+  G I  +FQERLLQ+G WL VNGE+IYN++PW  QND++++NVWYTS+  +    VYAI L +P  GKL L     P+ S K   ++LLG+ + L +   G   ++    ++P+N +   KWA+T K+
Sbjct:    1 MRTSIVISLLVIMTLIPLTLCEYNATWKSLDARPLPAWYDQAKFGIFVHWGVFSVPGFGS-----EWFWYFWKGLHRPEYVEFMKKNYRPGFSYPDFGPMFKAEFYDPEQWADLFAKSGARYVVLTSKHHEGWTMWKSNVSWNWNAVDNGPHRDLVGDLAKAVR-KTDVRFGLYHSLYEWFNPLFLKDRESNYTSQYYVEEILQHQLKDIVTTYEPDVVWADGQSGGSSDYWTSKDFLAWLYNSSPVKDKVVVNDRWGEECACHHGGFFTCHDHYNPGKLVGHKWENAMKLDKKSWGYRHNIHIDDVYTIEELLEQFVSTVSCGGNLLLNIGPSSDGLIIPVFQERLLQMGEWLKVNGEAIYNSQPWRAQNDSVTENVWYTSRP-MGMGSVYAIALDWPSTGKLFLRE---PITS-KGTVVKLLGYDQDLLWTAAGEKGILIEIPSIPINKMPS-KWAYTFKM 451          
BLAST of Alpha-L-fucosidase vs. Ensembl Nematostella
Match: EDO36059 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJT4])

HSP 1 Score: 446.432 bits (1147), Expect = 7.967e-154
Identity = 238/473 (50.32%), Postives = 310/473 (65.54%), Query Frame = 1
Query:   46 MSTFIMLFSIWIVTLIFTLYTHCNAVRYSPDWKSLDSRPLPSWYDQAKIGIFIHWGVFSVPGFGDFTHAGEWFWWYWQGVNMTNYEKFMANNYPPSFTYASFAKEFRAERFDPDQWADLFNASGAKYVVLTSKHHEGFCXXXXXXXXXXXXVDIGPNMDLVEKLGTSIRNRTKLIFGLYHSLFEWFNPLYLTDKNNKFKTNLF------VRDKTLPELYEIVKRYKPDVIWSDGDWEAIDAYWNSTEFLAWLYNDSPVKNTVVTNDRWGIDTACKHGGFYTCQDRYNPGKLVNHKWENCFTLDKYSWGFRKEMNAADVMSIEEIVSQIASTVSCGGNVLINIGPTGYGTIPSIFQERLLQLGNWLGVNGESIYNTKPWSHQNDTISKNVWYTSKTVVNTNYVYAIILKFPDDGKLKLGSIVFPVKSLKTEQIELLGF-GKLSYQKQGNYTLITLPVNAL----LQLKWAWTLK 1431
            MS   +LF I +V  +    T C + +Y P W+SLDSRP P WYD+AK GIF+HWG++SVP +GD   A EWFW YW   +  N   FM  N+PP FTYA F   F+AE FDPD +A+L   SGAKY VLTSKHHEG+  W S  SWNWNSVD GP+ DLV +L  SIR +T + FGLYHSL+EWFNPLYL DK N F+TN +       +D   P+L ++V  YKP+ IWSDG+WEA   YW S EFLAWL+N+SPVK+TV+ ND WG +  CKHG  +TC  RY PG L+ HKWEN  ++DK SWG+R+     D  +IEE+++++ +T+SCGGN+L+N+GPT  G I  I QER+LQ+G WL VNGE++Y TKPW  QNDT++KNVWYTS      +  YA +L +P    L LG    P+ +  T Q+ +LG+     +    + + I + + A+    L   WAW  K
Sbjct:    1 MSLRCLLFVIAVVGTV----TPCIS-KYLPTWESLDSRPNPGWYDKAKFGIFMHWGLYSVPSYGD-GEASEWFWKYWHDGSSANVN-FMKKNFPPGFTYADFGPMFKAEFFDPDVFANLIAKSGAKYFVLTSKHHEGWTMWKSNVSWNWNSVDNGPHRDLVGELAKSIRTKTNVTFGLYHSLYEWFNPLYLQDKANDFRTNDYFVLFDLCQDIMTPQLMDLVNSYKPEYIWSDGEWEATSDYWGSKEFLAWLFNESPVKDTVLVNDGWGKNCLCKHGSVWTCSSRYYPGHLLKHKWENAMSVDKGSWGYRRNAGINDYFTIEELIAKLMATISCGGNMLMNVGPTADGRIAPIHQERMLQMGKWLAVNGEAVYETKPWRSQNDTVAKNVWYTS----TADAFYACVLDWPSASHLILGE---PITTTNT-QVTMLGYPTPFRWTAYSSKSGIVIEIPAIPVDKLPTTWAWVFK 458          
BLAST of Alpha-L-fucosidase vs. Ensembl Nematostella
Match: EDO47983 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKH4])

HSP 1 Score: 427.943 bits (1099), Expect = 7.495e-147
Identity = 228/449 (50.78%), Postives = 306/449 (68.15%), Query Frame = 1
Query:  118 AVRYSPDWKSLDSRPLPSWYDQAKIGIFIHWGVFSVPGFGDFTHAGEWFWWYWQGVNMTNYEKFMANNYPPSFTYASFAKEFRAERFDPDQWADLFNASGAKYVVLTSKHHEGFCXXXXXXXXXXXXVDIGPNMDLVEKLGTSIRNRTKLIFGLYHSLFEWFNPLYLTDKNNKFKTNLFVRDKTLPELYEIVKRYKPDVIWSDGDWEAIDAYWNSTEFLAWLYNDSPVKNTVVTNDRWGIDTACKHGGFYTCQDRYNPGKLVNHKWENCFTLDKYSWGFRKEMNAADVMSIEEIVSQIASTVSCGGNVLINIGPTGYGTIPSIFQERLLQLGNWLGVNGESIYNTKPWSHQNDTISKNVWYTSKTVVNTNYVYAIILKFPDDGKLKLGSIVFPVKSLKTEQIELLG------FGKLSYQKQGNYTLITLPVNALLQLKWAWTLKISGMI 1446
            +  Y+P W SLD RP+P+WYD+AK GIF+HWGVFSVP FG      EWFW +W   +   Y  F+ NNYPP ++YA FA +  AE FD ++WADL + SGAKY V TSKHHEG+ NW SK +WNWNSV+ GP+ D+V +L  ++RN+T + FGLY SLFE+++P YL D  N + T+ +V +  LP++Y+++  Y+P  +W+DGDW A + Y+ S EFLAWLYNDSPVK+ VV NDRWG +T   H G YT  D+YNPG L  HK+E+  T+DK SWG+R+EM  +DV +I+E++  + + VSCGGN L+NIGPT  GTIP+IF+ERLLQ+G WL VNGE+IY+T PW  QNDT +  +WYT     +TN VYAI L++P D  LKL S   P+ +  T  + LLG      +   SYQ      L  +P +A L  +WAW  K+  ++
Sbjct:    3 STHYNPTWNSLDKRPIPAWYDKAKFGIFMHWGVFSVPSFG-----SEWFWKFWHDKDKP-YVDFVNNNYPPRWSYADFAPQLTAEFFDANEWADLLSKSGAKYFVFTSKHHEGWTNWPSKQAWNWNSVENGPHRDIVGELAKAVRNKTNVSFGLYFSLFEFYHPYYLEDLKNNYTTHKYVDEVMLPQMYDLINTYEPSYLWTDGDWVAPNEYFRSREFLAWLYNDSPVKDYVVVNDRWGANTRNHHAGVYTGSDKYNPGVLQKHKFEDATTVDKRSWGYRREMKLSDVQTIDELLELMVTVVSCGGNFLLNIGPTKEGTIPTIFEERLLQIGAWLHVNGEAIYDTVPWRVQNDTANVPLWYTRNP--DTNVVYAIALEWPTDPYLKLAS---PITTDAT-IVTLLGNQGEFVWESESYQPGVIINLPYIPASA-LPCQWAWVFKLESVM 438          
BLAST of Alpha-L-fucosidase vs. Ensembl Nematostella
Match: EDO39344 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAB9])

HSP 1 Score: 420.239 bits (1079), Expect = 1.407e-143
Identity = 216/453 (47.68%), Postives = 300/453 (66.23%), Query Frame = 1
Query:  103 YTHCNAVRY--SPDWKSLDSRPLPSWYDQAKIGIFIHWGVFSVPGFGDFTHAGEWFWWYWQGVNMTNYEKFMANNYPPSFTYASFAKEFRAERFDPDQWADLFNASGAKYVVLTSKHHEGFCXXXXXXXXXXXXVDIGPNMDLVEKLGTSIRNRTKLIFGLYHSLFEWFNPLYLTDKNNKFKTNLFVRDKTLPELYEIVKRYKPDVIWSDGDWEAIDAYWNSTEFLAWLYNDSPVKNTVVTNDRWGIDTACKHGGFYTCQDRYNPGKLVNHKWENCFTLDKYSWGFRKEMNAADVMSIEEIVSQIASTVSCGGNVLINIGPTGYGTIPSIFQERLLQLGNWLGVNGESIYNTKPWSHQNDTISKNVWYTSKTVVNTNYVYAIILKFPDDGKLKLGSIVFPVKSLKTEQIELLG-------FGKLSYQKQGNYTLITLPVNALLQLKWAWTLKI 1434
            Y   N + Y  +PDW+SLD+RPLPSWY+ AK GIF+HWG++SVPG G      EWFW++W+        ++M  NYPP F+YA FA + +AE F+   W +L   SGA+Y V T KHH+GF NWN+ YSWNWNSVD GP+ D+V +L +       + FGLY+SL+EWFNPLYL DK   F T+ +V+    P+L E+V +Y PD++W+DGDWEA D+YW S EFL WLYNDSPV +++V NDRWG    C HGG   C DR+NPG +++  WEN  T+DK SWG+R+    ++ +S  +++ ++ASTVSCGGN+L+NI P   G+IP IFQERL ++G+WL  NGE+IY ++PW  QND+ + NVWYT+K      YVYAI+L++P  G L LG+ V P ++     + L G       + K++  ++  + +  +P+  L   K AW  KI
Sbjct:   15 YYELNQIPYYSTPDWESLDARPLPSWYEDAKFGIFVHWGLYSVPGVGS-----EWFWYHWRQ-GYPEIMEYMWRNYPPGFSYADFASKLKAEMFNATAWHELIAKSGARYFVFTGKHHDGFVNWNTSYSWNWNSVDNGPHRDIVGELASVFHMYGDIKFGLYYSLYEWFNPLYLKDKRKNFMTDEYVKTVVKPQLRELVNKYMPDILWADGDWEAKDSYWGSKEFLTWLYNDSPVASSIVVNDRWGRGCGCNHGGVLVCADRFNPGHMMHRPWENAMTIDKKSWGYRRNAKLSEYLSTYDLIRELASTVSCGGNLLMNIAPAPDGSIPLIFQERLEEMGDWLQFNGEAIYGSRPWKAQNDSRNGNVWYTTK----DGYVYAIVLEWPTSGTLLLGAPV-PSQNTTVTMLGLTGEFSWYVHYDKINGAEEIPHEVPAIPIFELPS-KLAWVFKI 455          
BLAST of Alpha-L-fucosidase vs. Ensembl Medaka
Match: fuca2 (alpha-L-fucosidase 2 [Source:NCBI gene;Acc:101157018])

HSP 1 Score: 491.5 bits (1264), Expect = 2.949e-171
Identity = 244/442 (55.20%), Postives = 310/442 (70.14%), Query Frame = 1
Query:  124 RYSPDWKSLDSRPLPSWYDQAKIGIFIHWGVFSVPGFGDFTHAGEWFWWYWQGVNMTNYEKFMANNYPPSFTYASFAKEFRAERFDPDQWADLFNASGAKYVVLTSKHHEGFCXXXXXXXXXXXXVDIGPNMDLVEKLGTSIRNRTKLIFGLYHSLFEWFNPLYLTDKNNKFKTNLFVRDKTLPELYEIVKRYKPDVIWSDGDWEAIDAYWNSTEFLAWLYNDSPVKNTVVTNDRWGIDTACKHGGFYTCQDRYNPGKLVNHKWENCFTLDKYSWGFRKEMNAADVMSIEEIVSQIASTVSCGGNVLINIGPTGYGTIPSIFQERLLQLGNWLGVNGESIYNTKPWSHQNDTISKNVWYTSKTVVNTNYVYAIILKFPDDGKLKLGSIVFPVKSLKTEQIELLGFGKLSYQK-QGNYTLITLPVNALLQL--KWAWTLKISG 1440
            RY P W+S+DSRPLP WYDQAK GIFIHWGVFSVP FG      EWFW+YWQ      Y  FM  NYPP F Y  FA  F AE F+  +W D+  +SGAKY+VLT+KHHEGF  W SK SWNWN+VD+GP  DLV+++ +++R +  +  GLYHSLFEWFNPL+  D  N F TN F   K+LPELYE+V +YKP+V+WSDGD +A   YWNST FLAWLYNDSPV++TVVTNDRWG  + C HGG+YTC DRY PG L+ HKWENC T+D  SWG+R+     D +S E++V  +  TVSCGGN+L+NIGPT  G I  IF+ERL Q+G WL VNGE IYNT  W  QND+++ ++WYT +    T  V+A++L++PD G + L     PV      ++ELLGFG L +Q  + +  L+ LP  ++ Q+  +WAWTLK++G
Sbjct:   20 RYQPTWESIDSRPLPGWYDQAKFGIFIHWGVFSVPSFGS-----EWFWYYWQKQKQPAYVDFMQKNYPPDFKYQDFASSFTAEFFNAKEWTDILASSGAKYIVLTTKHHEGFTLWGSKVSWNWNAVDVGPKRDLVDEIASAVRAQGDMRLGLYHSLFEWFNPLFELDAANLFTTNFFPTSKSLPELYELVVKYKPEVLWSDGDGDAPAKYWNSTGFLAWLYNDSPVRDTVVTNDRWGQGSICTHGGYYTCSDRYQPGHLLKHKWENCMTIDTKSWGYRRNAALKDYLSTEQLVGTLVETVSCGGNLLMNIGPTHDGRIAPIFEERLRQMGQWLKVNGEGIYNTTAWRAQNDSVTPHLWYTYRPQEKT--VFAVLLQWPDKGSVVLTE---PVAVAGVTKVELLGFGVLQWQAMKPSGLLVALPSLSVSQMPCQWAWTLKLTG 451          
BLAST of Alpha-L-fucosidase vs. Ensembl Medaka
Match: fuca1.2 (alpha-L-fucosidase 1 [Source:NCBI gene;Acc:101170940])

HSP 1 Score: 481.1 bits (1237), Expect = 3.470e-167
Identity = 250/458 (54.59%), Postives = 315/458 (68.78%), Query Frame = 1
Query:   79 IVTLIFTLYTHCNAVRYSPDWKSLDSRPLPSWYDQAKIGIFIHWGVFSVPGFGDFTHAGEWFWWYWQGVNMTNYE--KFMANNYPPSFTYASFAKEFRAERFDPDQWADLFNASGAKYVVLTSKHHEGFCXXXXXXXXXXXXVDIGPNMDLVEKLGTSIRNRTKLIFGLYHSLFEWFNPLYLTDKNNKFKTNLFVRDKTLPELYEIVKRYKPDVIWSDGDWEAIDAYWNSTEFLAWLYNDSPVKNTVVTNDRWGIDTACKHGGFYTCQDRYNPGKLVNHKWENCFTLDKYSWGFRKEMNAADVMSIEEIVSQIASTVSCGGNVLINIGPTGYGTIPSIFQERLLQLGNWLGVNGESIYNTKPWSHQNDTISKNVWYTSKTVVNTNYVYAIILKFPDDGKLKLGSIVFPVKSLKTEQIELLGFGKLSYQK-QGNYTLITLPVNALLQLKWAWTLKISGM 1443
            +  L+  + +H +A RYSPDWKSLD RPLP WYD+AK+GIFIHWGVFSVP F       EWFWW+WQG    + +   FM +NYPP F+Y  FA+ F AE F P +WAD+F ASGAKYVVLT+KHHEGF NW S  SWNWNSVD GP+ DLV +LG ++RNR+ L +GLY+SL+EWF+PLYL DK N F+T  FV+ K LPELY +V RY+P++IWSDGDWEA D+YWNS EFLAWLYNDSPVK+TVVTNDRWG   ACKHGG+Y CQD+Y+PG+L  HKWE C ++D  SWG+R+ M   ++M +  I+  + STV+ GGN L+N+GPT  G IP++F+ERL  +G WL VNGE+IY +KPW  Q +  +  VWYTSK     + +YAI+   P    L L   + P  S  TE I L     L +     N  L  L          AWTL++ G+
Sbjct:    4 VFVLLVAVVSH-SAARYSPDWKSLDGRPLPPWYDEAKLGIFIHWGVFSVPAF-----QSEWFWWHWQGQQPPDPKCVSFMTDNYPPGFSYPEFARHFHAEFFSPGEWADIFKASGAKYVVLTAKHHEGFTNWKSVNSWNWNSVDSGPHRDLVGELGEAVRNRS-LHYGLYNSLYEWFHPLYLNDKKNGFRTQDFVKQKLLPELYNMVVRYRPELIWSDGDWEAPDSYWNSAEFLAWLYNDSPVKDTVVTNDRWGAGCACKHGGYYNCQDKYSPGQLPEHKWEKCTSVDTLSWGYRRNMRIMELMDLPTIIEDLVSTVALGGNYLLNVGPTADGMIPAVFEERLRGVGAWLQVNGEAIYASKPWRVQMENTTVPVWYTSK----GSSIYAIVTAAPPTTTLNL---LTPKTSAATEVILLGSPSSLPWAPLYPNAGLAVLLPELPCVPGGAWTLRLDGV 447          
BLAST of Alpha-L-fucosidase vs. Ensembl Medaka
Match: fuca1.2 (alpha-L-fucosidase 1 [Source:NCBI gene;Acc:101170940])

HSP 1 Score: 420.624 bits (1080), Expect = 4.736e-144
Identity = 218/458 (47.60%), Postives = 277/458 (60.48%), Query Frame = 1
Query:   79 IVTLIFTLYTHCNAVRYSPDWKSLDSRPLPSWYDQAKIGIFIHWGVFSVPGFGDFTHAGEWFWWYWQGVNMTNYE--KFMANNYPPSFTYASFAKEFRAERFDPDQWADLFNASGAKYVVLTSKHHEGFCXXXXXXXXXXXXVDIGPNMDLVEKLGTSIRNRTKLIFGLYHSLFEWFNPLYLTDKNNKFKTNLFVRDKTLPELYEIVKRYKPDVIWSDGDWEAIDAYWNSTEFLAWLYNDSPVKNTVVTNDRWGIDTACKHGGFYTCQDRYNPGKLVNHKWENCFTLDKYSWGFRKEMNAADVMSIEEIVSQIASTVSCGGNVLINIGPTGYGTIPSIFQERLLQLGNWLGVNGESIYNTKPWSHQNDTISKNVWYTSKTVVNTNYVYAIILKFPDDGKLKLGSIVFPVKSLKTEQIELLGFGKLSYQK-QGNYTLITLPVNALLQLKWAWTLKISGM 1443
            +  L+  + +H +A RYSPDWKSLD RPLP WYD+AK+GIFIHWGVFSVP F       EWFWW+WQG    + +   FM +NYPP F+Y  FA+ F AE F P +WAD+F ASGAK                                               L +GLY+SL+EWF+PLYL DK N F+T  FV+ K LPELY +V RY+P++IWSDGDWEA D+YWNS EFLAWLYNDSPVK+TVVTNDRWG   ACKHGG+Y CQD+Y+PG+L  HKWE C ++D  SWG+R+ M   ++M +  I+  + STV+ GGN L+N+GPT  G IP++F+ERL  +G WL VNGE+IY +KPW  Q +  +  VWYTSK     + +YAI+   P    L L   + P  S  TE I L     L +     N  L  L          AWTL++ G+
Sbjct:    4 VFVLLVAVVSH-SAARYSPDWKSLDGRPLPPWYDEAKLGIFIHWGVFSVPAF-----QSEWFWWHWQGQQPPDPKCVSFMTDNYPPGFSYPEFARHFHAEFFSPGEWADIFKASGAK----------------------------------------------SLHYGLYNSLYEWFHPLYLNDKKNGFRTQDFVKQKLLPELYNMVVRYRPELIWSDGDWEAPDSYWNSAEFLAWLYNDSPVKDTVVTNDRWGAGCACKHGGYYNCQDKYSPGQLPEHKWEKCTSVDTLSWGYRRNMRIMELMDLPTIIEDLVSTVALGGNYLLNVGPTADGMIPAVFEERLRGVGAWLQVNGEAIYASKPWRVQMENTTVPVWYTSK----GSSIYAIVTAAPPTTTLNL---LTPKTSAATEVILLGSPSSLPWAPLYPNAGLAVLLPELPCVPGGAWTLRLDGV 402          
BLAST of Alpha-L-fucosidase vs. Planmine SMEST
Match: SMESG000024118.1 (SMESG000024118.1)

HSP 1 Score: 924.85 bits (2389), Expect = 0.000e+0
Identity = 462/463 (99.78%), Postives = 463/463 (100.00%), Query Frame = 1
Query:   61 MLFSIWIVTLIFTLYTHCNAVRYSPDWKSLDSRPLPSWYDQAKIGIFIHWGVFSVPGFGDFTHAGEWFWWYWQGVNMTNYEKFMANNYPPSFTYASFAKEFRAERFDPDQWADLFNASGAKYVVLTSKHHEGFCXXXXXXXXXXXXVDIGPNMDLVEKLGTSIRNRTKLIFGLYHSLFEWFNPLYLTDKNNKFKTNLFVRDKTLPELYEIVKRYKPDVIWSDGDWEAIDAYWNSTEFLAWLYNDSPVKNTVVTNDRWGIDTACKHGGFYTCQDRYNPGKLVNHKWENCFTLDKYSWGFRKEMNAADVMSIEEIVSQIASTVSCGGNVLINIGPTGYGTIPSIFQERLLQLGNWLGVNGESIYNTKPWSHQNDTISKNVWYTSKTVVNTNYVYAIILKFPDDGKLKLGSIVFPVKSLKTEQIELLGFGKLSYQKQGNYTLITLPVNALLQLKWAWTLKISGMIY 1449
            MLFSIWIVTLIFTLYTHCNAVRYSPDWKSLD+RPLPSWYDQAKIGIFIHWGVFSVPGFGDFTHAGEWFWWYWQGVNMTNYEKFMANNYPPSFTYASFAKEFRAERFDPDQWADLFNASGAKYVVLTSKHHEGFCNWNSKYSWNWNSVDIGPNMDLVEKLGTSIRNRTKLIFGLYHSLFEWFNPLYLTDKNNKFKTNLFVRDKTLPELYEIVKRYKPDVIWSDGDWEAIDAYWNSTEFLAWLYNDSPVKNTVVTNDRWGIDTACKHGGFYTCQDRYNPGKLVNHKWENCFTLDKYSWGFRKEMNAADVMSIEEIVSQIASTVSCGGNVLINIGPTGYGTIPSIFQERLLQLGNWLGVNGESIYNTKPWSHQNDTISKNVWYTSKTVVNTNYVYAIILKFPDDGKLKLGSIVFPVKSLKTEQIELLGFGKLSYQKQGNYTLITLPVNALLQLKWAWTLKISGMIY
Sbjct:    1 MLFSIWIVTLIFTLYTHCNAVRYSPDWKSLDTRPLPSWYDQAKIGIFIHWGVFSVPGFGDFTHAGEWFWWYWQGVNMTNYEKFMANNYPPSFTYASFAKEFRAERFDPDQWADLFNASGAKYVVLTSKHHEGFCNWNSKYSWNWNSVDIGPNMDLVEKLGTSIRNRTKLIFGLYHSLFEWFNPLYLTDKNNKFKTNLFVRDKTLPELYEIVKRYKPDVIWSDGDWEAIDAYWNSTEFLAWLYNDSPVKNTVVTNDRWGIDTACKHGGFYTCQDRYNPGKLVNHKWENCFTLDKYSWGFRKEMNAADVMSIEEIVSQIASTVSCGGNVLINIGPTGYGTIPSIFQERLLQLGNWLGVNGESIYNTKPWSHQNDTISKNVWYTSKTVVNTNYVYAIILKFPDDGKLKLGSIVFPVKSLKTEQIELLGFGKLSYQKQGNYTLITLPVNALLQLKWAWTLKISGMIY 463          
The following BLAST results are available for this feature:
BLAST of Alpha-L-fucosidase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
FUCA24.460e-17656.89alpha-L-fucosidase 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
FUCA14.612e-16755.18alpha-L-fucosidase 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
FUCA21.651e-2858.70alpha-L-fucosidase 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Alpha-L-fucosidase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
W03G11.31.586e-13551.98Putative alpha-L-fucosidase [Source:UniProtKB/Swi... [more]
back to top
BLAST of Alpha-L-fucosidase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Fuca2.174e-15153.43gene:FBgn0285958 transcript:FBtr0100588[more]
Fuca2.174e-15153.43gene:FBgn0285958 transcript:FBtr0346860[more]
back to top
BLAST of Alpha-L-fucosidase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
fuca24.680e-17955.26alpha-L-fucosidase 2 [Source:ZFIN;Acc:ZDB-GENE-040... [more]
fuca24.680e-17955.26alpha-L-fucosidase 2 [Source:ZFIN;Acc:ZDB-GENE-040... [more]
fuca1.12.338e-16353.85alpha-L-fucosidase 1, tandem duplicate 1 [Source:Z... [more]
fuca1.22.596e-16052.97alpha-L-fucosidase 1, tandem duplicate 2 [Source:Z... [more]
back to top
BLAST of Alpha-L-fucosidase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ca63.304e-17356.43carbonic anhydrase 6 [Source:Xenbase;Acc:XB-GENE-4... [more]
fuca14.100e-16053.71alpha-L-fucosidase 1 [Source:NCBI gene;Acc:1004976... [more]
fuca16.932e-16053.71alpha-L-fucosidase 1 [Source:NCBI gene;Acc:1004976... [more]
back to top
BLAST of Alpha-L-fucosidase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Fuca21.031e-17757.59fucosidase, alpha-L- 2, plasma [Source:MGI Symbol;... [more]
Fuca21.031e-17757.59fucosidase, alpha-L- 2, plasma [Source:MGI Symbol;... [more]
Fuca14.031e-16855.66fucosidase, alpha-L- 1, tissue [Source:MGI Symbol;... [more]
Fuca25.605e-2560.00fucosidase, alpha-L- 2, plasma [Source:MGI Symbol;... [more]
back to top
BLAST of Alpha-L-fucosidase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6AYS4|FUCO2_RAT1.114e-17857.40Plasma alpha-L-fucosidase OS=Rattus norvegicus OX=... [more]
sp|Q99KR8|FUCO2_MOUSE7.209e-17757.59Plasma alpha-L-fucosidase OS=Mus musculus OX=10090... [more]
sp|Q9BTY2|FUCO2_HUMAN2.142e-17556.89Plasma alpha-L-fucosidase OS=Homo sapiens OX=9606 ... [more]
sp|Q5RFI5|FUCO2_PONAB1.547e-17356.44Plasma alpha-L-fucosidase OS=Pongo abelii OX=9601 ... [more]
sp|C3YWU0|FUCO_BRAFL1.260e-16957.56Alpha-L-fucosidase OS=Branchiostoma floridae OX=77... [more]
back to top
BLAST of Alpha-L-fucosidase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3M7R5S50.000e+057.75Plasma alpha-L-fucosidase OS=Brachionus plicatilis... [more]
A0A210Q7772.707e-17955.36Alpha-L-fucosidase OS=Mizuhopecten yessoensis OX=6... [more]
A0A267FHX84.156e-17855.80Fucosidase_C domain-containing protein (Fragment) ... [more]
A0A1I8H1R12.505e-17755.36Fucosidase_C domain-containing protein OS=Macrosto... [more]
A0A267H3A82.895e-17755.36Fucosidase_C domain-containing protein (Fragment) ... [more]
back to top
BLAST of Alpha-L-fucosidase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
fuca25.961e-17153.39alpha-L-fucosidase 2 [Source:NCBI gene;Acc:1030321... [more]
fuca1.21.265e-16154.52alpha-L-fucosidase 1 [Source:NCBI gene;Acc:1030236... [more]
fuca1.21.981e-15853.83alpha-L-fucosidase 1 [Source:NCBI gene;Acc:1030236... [more]
back to top
BLAST of Alpha-L-fucosidase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Alpha-L-fucosidase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Alpha-L-fucosidase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO475821.114e-16853.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492274.026e-16152.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO360597.967e-15450.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479837.495e-14750.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO393441.407e-14347.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Alpha-L-fucosidase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
fuca22.949e-17155.20alpha-L-fucosidase 2 [Source:NCBI gene;Acc:1011570... [more]
fuca1.23.470e-16754.59alpha-L-fucosidase 1 [Source:NCBI gene;Acc:1011709... [more]
fuca1.24.736e-14447.60alpha-L-fucosidase 1 [Source:NCBI gene;Acc:1011709... [more]
back to top
BLAST of Alpha-L-fucosidase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000024118.10.000e+099.78SMESG000024118.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005168 ID=SMED30005168|Name=Alpha-L-fucosidase|organism=Schmidtea mediterranea sexual|type=transcript|length=1541bp
GTTCATTGGACATTGATTTTGCACTTTAAATAGTGATTCATGTTGATGTC
AACATTTATTATGTTATTTTCAATCTGGATAGTTACATTGATATTTACTC
TTTATACCCATTGCAATGCAGTCCGATACTCTCCCGACTGGAAATCTTTG
GATAGTCGACCTCTTCCTAGCTGGTACGATCAAGCCAAAATAGGTATATT
TATCCACTGGGGAGTTTTTTCTGTTCCCGGTTTTGGAGATTTCACACATG
CTGGGGAATGGTTCTGGTGGTACTGGCAAGGAGTTAACATGACAAACTAT
GAAAAGTTTATGGCTAATAATTATCCTCCGTCATTTACATATGCTAGCTT
TGCTAAAGAATTTCGCGCCGAAAGATTCGATCCAGATCAGTGGGCTGATC
TATTTAATGCATCTGGAGCAAAATATGTGGTATTAACTTCGAAACATCAC
GAAGGATTTTGCAATTGGAATTCGAAATATTCCTGGAACTGGAATTCAGT
AGATATTGGACCTAACATGGATTTGGTTGAAAAGCTCGGGACTTCAATAA
GAAATCGGACAAAACTTATTTTTGGATTATATCATTCTCTGTTTGAGTGG
TTTAATCCTCTATATTTAACTGATAAAAACAATAAATTCAAAACAAATCT
ATTTGTCAGAGATAAAACCTTACCAGAACTTTATGAAATCGTAAAGAGAT
ATAAACCTGATGTTATTTGGTCTGATGGAGACTGGGAAGCCATTGATGCT
TACTGGAATTCAACTGAATTTTTAGCTTGGCTTTACAACGACAGTCCAGT
CAAAAATACAGTTGTTACTAATGACAGATGGGGCATTGATACAGCATGTA
AACACGGAGGATTTTATACCTGCCAGGACAGATACAATCCAGGGAAATTA
GTGAACCATAAATGGGAAAACTGTTTTACTCTGGATAAATATTCATGGGG
ATTTAGAAAAGAAATGAATGCTGCCGATGTAATGAGTATAGAAGAAATAG
TCAGTCAAATAGCATCAACAGTGAGTTGCGGGGGTAATGTTCTCATTAAC
ATTGGTCCAACTGGCTACGGAACCATCCCATCTATATTCCAAGAAAGACT
TCTACAATTGGGAAATTGGCTCGGAGTGAATGGAGAATCAATATATAACA
CGAAGCCATGGTCACATCAAAATGACACTATCTCCAAAAACGTTTGGTAC
ACATCTAAAACTGTTGTTAACACCAATTACGTGTATGCCATAATTTTAAA
GTTTCCCGATGATGGAAAACTTAAGTTGGGAAGCATTGTTTTTCCGGTAA
AATCACTGAAAACTGAGCAAATTGAATTATTAGGGTTTGGAAAACTGTCC
TACCAGAAACAAGGAAATTATACTTTGATCACTTTGCCTGTTAATGCTTT
GTTACAGTTAAAATGGGCCTGGACACTGAAAATATCAGGAATGATTTATT
GAAAACACGTATTTTAGTCTTTGAAAACTTTTACATTAATATTTAATAAA
TTCCTTTTCATAGTAAATTTTAAAATTTTACGAAAATAAAC
back to top

protein sequence of SMED30005168-orf-1

>SMED30005168-orf-1 ID=SMED30005168-orf-1|Name=SMED30005168-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=471bp
MLMSTFIMLFSIWIVTLIFTLYTHCNAVRYSPDWKSLDSRPLPSWYDQAK
IGIFIHWGVFSVPGFGDFTHAGEWFWWYWQGVNMTNYEKFMANNYPPSFT
YASFAKEFRAERFDPDQWADLFNASGAKYVVLTSKHHEGFCNWNSKYSWN
WNSVDIGPNMDLVEKLGTSIRNRTKLIFGLYHSLFEWFNPLYLTDKNNKF
KTNLFVRDKTLPELYEIVKRYKPDVIWSDGDWEAIDAYWNSTEFLAWLYN
DSPVKNTVVTNDRWGIDTACKHGGFYTCQDRYNPGKLVNHKWENCFTLDK
YSWGFRKEMNAADVMSIEEIVSQIASTVSCGGNVLINIGPTGYGTIPSIF
QERLLQLGNWLGVNGESIYNTKPWSHQNDTISKNVWYTSKTVVNTNYVYA
IILKFPDDGKLKLGSIVFPVKSLKTEQIELLGFGKLSYQKQGNYTLITLP
VNALLQLKWAWTLKISGMIY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR016286FUC_metazoa-typ
IPR000933Glyco_hydro_29
IPR013781Glyco_hydro_catalytic_dom
IPR031919Fucosidase_C
IPR013780Glyco_hydro_b
IPR018526Glyco_hydro_29_CS
IPR017853Glycoside_hydrolase_SF
Vocabulary: biological process
TermDefinition
GO:0006004fucose metabolic process
GO:0005975carbohydrate metabolic process
GO:0008152metabolic process
GO:0009617response to bacterium
GO:0016139glycoside catabolic process
GO:2000535regulation of entry of bacterium into host cell
Vocabulary: molecular function
TermDefinition
GO:0004560alpha-L-fucosidase activity
GO:0016787hydrolase activity
GO:0016798hydrolase activity, acting on glycosyl bonds
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005615extracellular space
GO:0070062extracellular exosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR016286Alpha-L-fucosidase, metazoa-typePRINTSPR00741GLHYDRLASE29coord: 312..333
score: 56.36
coord: 237..258
score: 79.09
coord: 169..188
score: 72.0
coord: 345..367
score: 58.26
coord: 122..138
score: 80.0
coord: 209..225
score: 63.53
coord: 83..98
score: 55.0
IPR016286Alpha-L-fucosidase, metazoa-typePIRSFPIRSF001092Alpha-L-fucosidasecoord: 1..449
e-value: 4.7E-123
score: 409.1
IPR000933Glycoside hydrolase, family 29SMARTSM00812alpha_l_fucoscoord: 22..409
e-value: 2.1E-218
score: 741.5
IPR000933Glycoside hydrolase, family 29PFAMPF01120Alpha_L_fucoscoord: 16..359
e-value: 4.0E-117
score: 391.6
IPR000933Glycoside hydrolase, family 29PANTHERPTHR10030ALPHA-L-FUCOSIDASEcoord: 7..459
NoneNo IPR availableGENE3DG3DSA:3.20.20.80coord: 18..357
e-value: 4.0E-105
score: 354.2
NoneNo IPR availablePANTHERPTHR10030:SF42ALPHA-L-FUCOSIDASE-RELATEDcoord: 7..459
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.852
IPR013780Glycosyl hydrolase, all-betaGENE3DG3DSA:2.60.40.1180coord: 358..461
e-value: 2.4E-10
score: 42.7
IPR031919Alpha-L-fucosidase, C-terminalPFAMPF16757Fucosidase_Ccoord: 370..458
e-value: 9.1E-20
score: 71.0
IPR018526Glycoside hydrolase, family 29, conserved sitePROSITEPS00385ALPHA_L_FUCOSIDASEcoord: 277..288
IPR017853Glycoside hydrolase superfamilySUPERFAMILYSSF51445(Trans)glycosidasescoord: 22..362