coe protein

Overview
Namecoe protein (AGZ94924.1)
Smed IDSMED30005164
Length (bp)1971
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of coe protein (SMED30005164) t-SNE clustered cells

Violin plots show distribution of expression levels for coe protein (SMED30005164) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of coe protein (SMED30005164) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for coe protein (SMED30005164) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005164

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 24

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30005164SMESG000069088.1 dd_Smed_v4_9893_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30005164SMESG000069088.1 dd_Smed_v4_9893_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30005164SMESG000069088.1 dd_Smed_v4_9893_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30005164SMESG000069088.1 dd_Smed_v4_9893_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30005164SMESG000069088.1 dd_Smed_v4_9893_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30005164SMESG000069088.1 dd_Smed_v4_9893_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30005164SMESG000069088.1 dd_Smed_v6_9893_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30005164SMESG000069088.1 KF487109smed_ncbi_20200123PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
central nervous systemSMED30005164SMESG000069088.1 KF487109smed_ncbi_20200123PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
progenitor cellSMED30005164SMESG000069088.1 KF487109smed_ncbi_20200123PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
stem cellSMED30005164SMESG000069088.1 KF487109smed_ncbi_20200123PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30005164SMESG000069088.1 KF487109smed_ncbi_20200123PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
nervous systemSMED30005164SMESG000069088.1 KF487109smed_ncbi_20200123PMID:25356635
Cowles et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
nervous systemSMED30005164SMESG000069088.1 KF487109smed_ncbi_20200123PMID:25356635
Cowles et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
ventral nerve cordSMED30005164SMESG000069088.1 KF487109smed_ncbi_20200123PMID:25356635
Cowles et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
ventral nerve cordSMED30005164SMESG000069088.1 KF487109smed_ncbi_20200123PMID:25356635
Cowles et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30005164SMESG000069088.1 KF487109smed_ncbi_20200123PMID:25356635
Cowles et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
neuronSMED30005164SMESG000069088.1 KF487109smed_ncbi_20200123PMID:25356635
Cowles et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30005164SMESG000069088.1 KF487109smed_ncbi_20200123PMID:25356635
Cowles et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30005164SMESG000069088.1 KF487109smed_ncbi_20200123PMID:25356635
Cowles et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
neuropilSMED30005164SMESG000069088.1 KF487109smed_ncbi_20200123PMID:25356635
Cowles et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
neuropilSMED30005164SMESG000069088.1 KF487109smed_ncbi_20200123PMID:25356635
Cowles et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
neuropeptidergic neuronSMED30005164SMESG000069088.1 KF487109smed_ncbi_20200123PMID:25356635
Cowles et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
neuropeptidergic neuronSMED30005164SMESG000069088.1 KF487109smed_ncbi_20200123PMID:25356635
Cowles et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of coe protein vs. Ensembl Human
Match: EBF1 (EBF transcription factor 1 [Source:HGNC Symbol;Acc:HGNC:3126])

HSP 1 Score: 567.77 bits (1462), Expect = 0.000e+0
Identity = 274/380 (72.11%), Postives = 317/380 (83.42%), Query Frame = 1
Query:  223 LKEEAISQLAPSQLDLVRSWMQ-PNNLESSVPRLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGD---FPTVTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALY 1350
            +KEE +     S ++ VR+WMQ    L+++      + +  A FE+QPP NLRKSNFFHFV+ALYD+   PVE+ER AF+ FVEK++EA  EKTNNGIHYRL+LL+SNGI+ +Q+ YVRLIDS TKQAI YEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDR+FLKFF+KCNQNCLKNAGNPRDMRRFQV VSTT  VDG +LA+SDNMFVHNNSKHGRRARR DP++G        TP IKAI P+EGWTTGG TVII+GDNFFDGLQV+FGT +VW E++T HAIRVQ+PPRHIPG+ E+TL+YK K FCK  PGRF Y ++ EPTIDYGFQRL K+IPRHPGDP+RLPKE+ILKRAADL EALY
Sbjct:   15 MKEEPLG----SGMNAVRTWMQGAGVLDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVGFVEKEKEANSEKTNNGIHYRLQLLYSNGIRTEQDFYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEGTPSYLEHATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVIFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGTPGRFIYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVILKRAADLVEALY 390          
BLAST of coe protein vs. Ensembl Human
Match: EBF3 (EBF transcription factor 3 [Source:HGNC Symbol;Acc:HGNC:19087])

HSP 1 Score: 567.385 bits (1461), Expect = 0.000e+0
Identity = 273/381 (71.65%), Postives = 320/381 (83.99%), Query Frame = 1
Query:  223 LKEEAISQLAPSQLDLVRSWMQPNNL-ESSVPRLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGDFPT----VTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALY 1350
            +KEE +     S ++ VRSWM    + +++      + +  A FE+QPP NLRKSNFFHFV+ALYD+   PVE+ER AF+DFVEK++E   EKTNNGIHY+L+LL+SNG++ +Q++YVRLIDS TKQAI YEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDR+FLKFF+KCNQNCLKNAGNPRDMRRFQV VSTT  VDG +LA+SDNMFVHNNSKHGRRARR DP++G  P+     TP IKAI P+EGWTTGG TVII+GDNFFDGLQVVFGT +VW E++T HAIRVQ+PPRHIPG+ E+TL+YK K FCK APGRF Y ++ EPTIDYGFQRL K+IPRHPGDP+RLPKE++LKRAADL EALY
Sbjct:   15 MKEEPLG----SGMNPVRSWMHTAGVVDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVDFVEKEKEPNNEKTNNGIHYKLQLLYSNGVRTEQDLYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEGTAPSYLENATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVVFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFVYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVLLKRAADLVEALY 391          
BLAST of coe protein vs. Ensembl Human
Match: EBF1 (EBF transcription factor 1 [Source:HGNC Symbol;Acc:HGNC:3126])

HSP 1 Score: 563.918 bits (1452), Expect = 0.000e+0
Identity = 273/377 (72.41%), Postives = 316/377 (83.82%), Query Frame = 1
Query:  223 LKEEAISQLAPSQLDLVRSWMQ-PNNLESSVPRLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGDFPTVTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALY 1350
            +KEE +     S ++ VR+WMQ    L+++      + +  A FE+QPP NLRKSNFFHFV+ALYD+   PVE+ER AF+ FVEK++EA  EKTNNGIHYRL+LL+SNGI+ +Q+ YVRLIDS TKQAI YEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDR+FLKFF+KCNQNCLKNAGNPRDMRRFQV VSTT  VDG +LA+SDNMFVHNNSKHGRRARR DP++      TP IKAI P+EGWTTGG TVII+GDNFFDGLQV+FGT +VW E++T HAIRVQ+PPRHIPG+ E+TL+YK K FCK  PGRF Y ++ EPTIDYGFQRL K+IPRHPGDP+RLPKE+ILKRAADL EALY
Sbjct:   15 MKEEPLG----SGMNAVRTWMQGAGVLDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVGFVEKEKEANSEKTNNGIHYRLQLLYSNGIRTEQDFYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEA-----TPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVIFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGTPGRFIYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVILKRAADLVEALY 382          
BLAST of coe protein vs. Ensembl Human
Match: EBF3 (EBF transcription factor 3 [Source:HGNC Symbol;Acc:HGNC:19087])

HSP 1 Score: 561.222 bits (1445), Expect = 0.000e+0
Identity = 271/377 (71.88%), Postives = 317/377 (84.08%), Query Frame = 1
Query:  223 LKEEAISQLAPSQLDLVRSWMQPNNL-ESSVPRLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGDFPTVTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALY 1350
            +KEE +     S ++ VRSWM    + +++      + +  A FE+QPP NLRKSNFFHFV+ALYD+   PVE+ER AF+DFVEK++E   EKTNNGIHY+L+LL+SNG++ +Q++YVRLIDS TKQAI YEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDR+FLKFF+KCNQNCLKNAGNPRDMRRFQV VSTT  VDG +LA+SDNMFVHNNSKHGRRARR DP++      TP IKAI P+EGWTTGG TVII+GDNFFDGLQVVFGT +VW E++T HAIRVQ+PPRHIPG+ E+TL+YK K FCK APGRF Y ++ EPTIDYGFQRL K+IPRHPGDP+RLPKE++LKRAADL EALY
Sbjct:   15 MKEEPLG----SGMNPVRSWMHTAGVVDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVDFVEKEKEPNNEKTNNGIHYKLQLLYSNGVRTEQDLYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEA-----TPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVVFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFVYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVLLKRAADLVEALY 382          
BLAST of coe protein vs. Ensembl Human
Match: EBF4 (EBF family member 4 [Source:HGNC Symbol;Acc:HGNC:29278])

HSP 1 Score: 554.673 bits (1428), Expect = 0.000e+0
Identity = 279/385 (72.47%), Postives = 321/385 (83.38%), Query Frame = 1
Query:  202 SLAASGI-LKEEAISQLAPSQLDLVRSWMQPNN-LESSVPRLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGDFPTVTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALY 1350
            +L  SG+ LKEE    L P+ L  VRSWMQ    L++S      + +  A FE+QPP NLRKSNFFHFV+A+YD+   PVEVER AFIDFVEKDRE   EKTNNGIHYRLRL+++NG++ +Q++YVRLIDS +KQAI YEGQDKNPEMCRVLLTHEIMCSRCCD+KSCGNRNETPSDPVIIDR+FLKFF+KCNQNCLKNAGNPRDMRRFQV VSTT  VDG +LA+SDNMFVHNNSKHGRRARR DP++      TP IKAI P EGWTTGG TVI++GDNFFDGLQVVFG  +VW E++T HAIRVQ+PPRHIPG+ E+TL+YK K FCK  PGRF Y ++ EPTIDYGFQRL K+IPRHPGDP+RLPKE++LKRAADLAEALY
Sbjct:   26 ALPRSGLNLKEEP---LLPAGLGSVRSWMQGAGILDASTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLAMYDRQGQPVEVERTAFIDFVEKDREPGAEKTNNGIHYRLRLVYNNGLRTEQDLYVRLIDSMSKQAIIYEGQDKNPEMCRVLLTHEIMCSRCCDRKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVSVDGHVLAVSDNMFVHNNSKHGRRARRLDPSE----AATPCIKAISPGEGWTTGGATVIVIGDNFFDGLQVVFGNVLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGCPGRFVYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVLLKRAADLAEALY 403          
BLAST of coe protein vs. Ensembl Celegans
Match: unc-3 (Transcription factor unc-3 [Source:UniProtKB/Swiss-Prot;Acc:Q93705])

HSP 1 Score: 492.656 bits (1267), Expect = 3.726e-169
Identity = 232/351 (66.10%), Postives = 287/351 (81.77%), Query Frame = 1
Query:  331 EITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTD-------GDFPTVTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGT-SMVWGE---VVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALY 1350
            +I  A FE+ PP NLRKSNFFHFVIALYD+N  P+EVER  F  FVEK++E +G+ T NGIHYRL L+F NGI+ + +++VRLIDSSTKQAI YEGQDKNPEMCRVLLTHE+MCSRCC+KKSCGNRNETPSDPVIIDR+FLKFF+KCNQNCLKNAGNPRDMRRFQV + ++  +DGPLLA+SDNMFVHNNSKHGRR +R+D +D        + P+  P IKA+ P+EGW  GGT V+++G+NFF+GLQV FGT S  WGE   +++ HAIRV +PP+H  G  ++TL YK KT+ +  P RF+YI++ EP I+YGFQRL K++P++PGDP+RLPK+ ILKRAA+LAEALY
Sbjct:   51 QIARAHFEKHPPNNLRKSNFFHFVIALYDRNSQPIEVERTQFAGFVEKEKEVDGQDTRNGIHYRLSLMFQNGIRSEHDLFVRLIDSSTKQAITYEGQDKNPEMCRVLLTHEVMCSRCCEKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVLCSSARIDGPLLAVSDNMFVHNNSKHGRRTKRTDASDDSEYSESAELPSSVPVIKALFPSEGWIQGGTQVVLIGENFFEGLQVAFGTASPNWGESVQLISPHAIRVTTPPKHSAGPVDVTLQYKSKTYSRGTPLRFSYITLAEPGIEYGFQRLQKLLPKYPGDPERLPKDQILKRAAELAEALY 401          
BLAST of coe protein vs. Ensembl Fly
Match: kn (gene:FBgn0001319 transcript:FBtr0329882)

HSP 1 Score: 549.666 bits (1415), Expect = 0.000e+0
Identity = 270/369 (73.17%), Postives = 308/369 (83.47%), Query Frame = 1
Query:  328 MEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGDF---PTVTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALYSSVPRHYQTGSMASNLSLGACASQI 1425
            + I  A FE+QPP NLRKSNFFHFVIALYD+   P+E+ER AFI F+EKD E++  KTNNGI YRL+LL++NG +Q+Q+++VRLIDS TKQAI YEGQDKNPEMCRVLLTHE+MCSRCCDKKSCGNRNETPSDPVIIDR+FLKFF+KCNQNCLKNAGNPRDMRRFQVA      VDGPLLAISDNMFVHNNSKHGRRA+R D T+G +   P  TP IKAI P+EGWTTGG TVIIVGDNFFDGLQVVFGT +VW E++TSHAIRVQ+PPRHIPG+ E+TL+YK K FCK +PGRF Y+S+ EPTIDYGFQRL K+IPRHPGDP++L KEIILKRAADL EALY S+P     GS   N   G  A  +
Sbjct:   57 LGIGRAHFEKQPPSNLRKSNFFHFVIALYDRAGQPIEIERTAFIGFIEKDSESDATKTNNGIQYRLQLLYANGARQEQDIFVRLIDSVTKQAIIYEGQDKNPEMCRVLLTHEVMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVA------VDGPLLAISDNMFVHNNSKHGRRAKRLDTTEGLYPPLPVATPCIKAISPSEGWTTGGATVIIVGDNFFDGLQVVFGTMLVWSELITSHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGSPGRFVYVSLNEPTIDYGFQRLQKLIPRHPGDPEKLQKEIILKRAADLVEALY-SMPSRSPGGSTGFNSYAGQLAVSV 418          
BLAST of coe protein vs. Ensembl Fly
Match: kn (gene:FBgn0001319 transcript:FBtr0301400)

HSP 1 Score: 549.28 bits (1414), Expect = 0.000e+0
Identity = 267/370 (72.16%), Postives = 304/370 (82.16%), Query Frame = 1
Query:  328 MEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGD------------------------FPTVTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALYSSVPR 1365
            + I  A FE+QPP NLRKSNFFHFVIALYD+   P+E+ER AFI F+EKD E++  KTNNGI YRL+LL++NG +Q+Q+++VRLIDS TKQAI YEGQDKNPEMCRVLLTHE+MCSRCCDKKSCGNRNETPSDPVIIDR+FLKFF+KCNQNCLKNAGNPRDMRRFQV +ST   VDGPLLAISDNMFVHNNSKHGRRA+R D T+G                          P  TP IKAI P+EGWTTGG TVIIVGDNFFDGLQVVFGT +VW E++TSHAIRVQ+PPRHIPG+ E+TL+YK K FCK +PGRF Y+S+ EPTIDYGFQRL K+IPRHPGDP++L KEIILKRAADL EALY S+PR
Sbjct:   63 LGIGRAHFEKQPPSNLRKSNFFHFVIALYDRAGQPIEIERTAFIGFIEKDSESDATKTNNGIQYRLQLLYANGARQEQDIFVRLIDSVTKQAIIYEGQDKNPEMCRVLLTHEVMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVISTQVAVDGPLLAISDNMFVHNNSKHGRRAKRLDTTEGTGNTSLSISGHPLAPDSTYDGLYPPLPVATPCIKAISPSEGWTTGGATVIIVGDNFFDGLQVVFGTMLVWSELITSHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGSPGRFVYVSLNEPTIDYGFQRLQKLIPRHPGDPEKLQKEIILKRAADLVEALY-SMPR 431          
BLAST of coe protein vs. Ensembl Fly
Match: kn (gene:FBgn0001319 transcript:FBtr0112810)

HSP 1 Score: 545.043 bits (1403), Expect = 0.000e+0
Identity = 267/371 (71.97%), Postives = 304/371 (81.94%), Query Frame = 1
Query:  328 MEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGD------------------------FPTVTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYIS-MTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALYSSVPR 1365
            + I  A FE+QPP NLRKSNFFHFVIALYD+   P+E+ER AFI F+EKD E++  KTNNGI YRL+LL++NG +Q+Q+++VRLIDS TKQAI YEGQDKNPEMCRVLLTHE+MCSRCCDKKSCGNRNETPSDPVIIDR+FLKFF+KCNQNCLKNAGNPRDMRRFQV +ST   VDGPLLAISDNMFVHNNSKHGRRA+R D T+G                          P  TP IKAI P+EGWTTGG TVIIVGDNFFDGLQVVFGT +VW E++TSHAIRVQ+PPRHIPG+ E+TL+YK K FCK +PGRF Y+S + EPTIDYGFQRL K+IPRHPGDP++L KEIILKRAADL EALY S+PR
Sbjct:  195 LGIGRAHFEKQPPSNLRKSNFFHFVIALYDRAGQPIEIERTAFIGFIEKDSESDATKTNNGIQYRLQLLYANGARQEQDIFVRLIDSVTKQAIIYEGQDKNPEMCRVLLTHEVMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVISTQVAVDGPLLAISDNMFVHNNSKHGRRAKRLDTTEGTGNTSLSISGHPLAPDSTYDGLYPPLPVATPCIKAISPSEGWTTGGATVIIVGDNFFDGLQVVFGTMLVWSELITSHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGSPGRFVYVSALNEPTIDYGFQRLQKLIPRHPGDPEKLQKEIILKRAADLVEALY-SMPR 564          
BLAST of coe protein vs. Ensembl Fly
Match: kn (gene:FBgn0001319 transcript:FBtr0087465)

HSP 1 Score: 544.658 bits (1402), Expect = 0.000e+0
Identity = 267/371 (71.97%), Postives = 304/371 (81.94%), Query Frame = 1
Query:  328 MEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGD------------------------FPTVTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYIS-MTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALYSSVPR 1365
            + I  A FE+QPP NLRKSNFFHFVIALYD+   P+E+ER AFI F+EKD E++  KTNNGI YRL+LL++NG +Q+Q+++VRLIDS TKQAI YEGQDKNPEMCRVLLTHE+MCSRCCDKKSCGNRNETPSDPVIIDR+FLKFF+KCNQNCLKNAGNPRDMRRFQV +ST   VDGPLLAISDNMFVHNNSKHGRRA+R D T+G                          P  TP IKAI P+EGWTTGG TVIIVGDNFFDGLQVVFGT +VW E++TSHAIRVQ+PPRHIPG+ E+TL+YK K FCK +PGRF Y+S + EPTIDYGFQRL K+IPRHPGDP++L KEIILKRAADL EALY S+PR
Sbjct:   63 LGIGRAHFEKQPPSNLRKSNFFHFVIALYDRAGQPIEIERTAFIGFIEKDSESDATKTNNGIQYRLQLLYANGARQEQDIFVRLIDSVTKQAIIYEGQDKNPEMCRVLLTHEVMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVISTQVAVDGPLLAISDNMFVHNNSKHGRRAKRLDTTEGTGNTSLSISGHPLAPDSTYDGLYPPLPVATPCIKAISPSEGWTTGGATVIIVGDNFFDGLQVVFGTMLVWSELITSHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGSPGRFVYVSALNEPTIDYGFQRLQKLIPRHPGDPEKLQKEIILKRAADLVEALY-SMPR 432          
BLAST of coe protein vs. Ensembl Fly
Match: kn (gene:FBgn0001319 transcript:FBtr0112809)

HSP 1 Score: 544.273 bits (1401), Expect = 0.000e+0
Identity = 267/371 (71.97%), Postives = 304/371 (81.94%), Query Frame = 1
Query:  328 MEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGD------------------------FPTVTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYIS-MTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALYSSVPR 1365
            + I  A FE+QPP NLRKSNFFHFVIALYD+   P+E+ER AFI F+EKD E++  KTNNGI YRL+LL++NG +Q+Q+++VRLIDS TKQAI YEGQDKNPEMCRVLLTHE+MCSRCCDKKSCGNRNETPSDPVIIDR+FLKFF+KCNQNCLKNAGNPRDMRRFQV +ST   VDGPLLAISDNMFVHNNSKHGRRA+R D T+G                          P  TP IKAI P+EGWTTGG TVIIVGDNFFDGLQVVFGT +VW E++TSHAIRVQ+PPRHIPG+ E+TL+YK K FCK +PGRF Y+S + EPTIDYGFQRL K+IPRHPGDP++L KEIILKRAADL EALY S+PR
Sbjct:   63 LGIGRAHFEKQPPSNLRKSNFFHFVIALYDRAGQPIEIERTAFIGFIEKDSESDATKTNNGIQYRLQLLYANGARQEQDIFVRLIDSVTKQAIIYEGQDKNPEMCRVLLTHEVMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVISTQVAVDGPLLAISDNMFVHNNSKHGRRAKRLDTTEGTGNTSLSISGHPLAPDSTYDGLYPPLPVATPCIKAISPSEGWTTGGATVIIVGDNFFDGLQVVFGTMLVWSELITSHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGSPGRFVYVSALNEPTIDYGFQRLQKLIPRHPGDPEKLQKEIILKRAADLVEALY-SMPR 432          
BLAST of coe protein vs. Ensembl Zebrafish
Match: ebf3a (EBF transcription factor 3a [Source:NCBI gene;Acc:567751])

HSP 1 Score: 560.451 bits (1443), Expect = 0.000e+0
Identity = 270/377 (71.62%), Postives = 316/377 (83.82%), Query Frame = 1
Query:  223 LKEEAISQLAPSQLDLVRSWMQPNNL-ESSVPRLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGDFPTVTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALY 1350
            +KEE +     S ++ VRSWM    + ++       + +  A +E+QPP NLRKSNFFHFV+ALYD+   PVE+ER AF+DFVEK++E   EKTNNGIHY+L+LL+SNG++ +Q++YVRLIDS TKQAI YEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDR+FLKFF+KCNQNCLKNAGNPRDMRRFQV VSTT  VDG +LA+SDNMFVHNNSKHGRRARR DP++      TP IKAI P+EGWTTGG TVII+GDNFFDGLQVVFGT +VW E++T HAIRVQ+PPRHIPG+ E+TL+YK K FCK APGRF Y ++ EPTIDYGFQRL K+IPRHPGDP+RLPKE++LKRAADL EALY
Sbjct:   15 MKEEPLG----SGMNPVRSWMHTAGVVDAHTAAQSGVGLARAHYEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVDFVEKEKEPNSEKTNNGIHYKLQLLYSNGVRTEQDLYVRLIDSMTKQAIIYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEA----ATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVVFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFVYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVLLKRAADLVEALY 383          
BLAST of coe protein vs. Ensembl Zebrafish
Match: ebf3a (EBF transcription factor 3a [Source:NCBI gene;Acc:567751])

HSP 1 Score: 559.681 bits (1441), Expect = 0.000e+0
Identity = 270/377 (71.62%), Postives = 316/377 (83.82%), Query Frame = 1
Query:  223 LKEEAISQLAPSQLDLVRSWMQPNNL-ESSVPRLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGDFPTVTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALY 1350
            +KEE +     S ++ VRSWM    + ++       + +  A +E+QPP NLRKSNFFHFV+ALYD+   PVE+ER AF+DFVEK++E   EKTNNGIHY+L+LL+SNG++ +Q++YVRLIDS TKQAI YEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDR+FLKFF+KCNQNCLKNAGNPRDMRRFQV VSTT  VDG +LA+SDNMFVHNNSKHGRRARR DP++      TP IKAI P+EGWTTGG TVII+GDNFFDGLQVVFGT +VW E++T HAIRVQ+PPRHIPG+ E+TL+YK K FCK APGRF Y ++ EPTIDYGFQRL K+IPRHPGDP+RLPKE++LKRAADL EALY
Sbjct:   15 MKEEPLG----SGMNPVRSWMHTAGVVDAHTAAQSGVGLARAHYEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVDFVEKEKEPNSEKTNNGIHYKLQLLYSNGVRTEQDLYVRLIDSMTKQAIIYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEA----ATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVVFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFVYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVLLKRAADLVEALY 383          
BLAST of coe protein vs. Ensembl Zebrafish
Match: ebf3a (EBF transcription factor 1a [Source:NCBI gene;Acc:565310])

HSP 1 Score: 554.288 bits (1427), Expect = 0.000e+0
Identity = 273/380 (71.84%), Postives = 318/380 (83.68%), Query Frame = 1
Query:  223 LKEEAISQLAPSQLDLVRSWMQPNN-LESSVPRLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGD---FPTVTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALY 1350
            +KEE I     + ++ VR+WMQ    L+++      + +  A FE+QPP NLRKSNFFHFV+ALYD+   PVE+ER +F+ FVEK++E+ GEKTNNGIHYRL+LL+SNGI+ +Q+ YVRLIDS TKQAI YEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDR+FLKFF+KCNQNCLKNAGNPRDMRRFQV VSTT  VDG +LA+SDNMFVHNNSKHGRRARR DP++G        TP IKAI P+EGWTTGG TVII+GDNFFDGLQV+FGT +VW E++T HAIRVQ+PPRHIPG+ E+TL+YK K FCK  PGRF Y ++ EPTIDYGFQRL K+IPRHPGDP+RLPKE+ILKRAADL EALY
Sbjct:   15 MKEEPIG----AGMNAVRTWMQGAGVLDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTSFVGFVEKEKESTGEKTNNGIHYRLQLLYSNGIRTEQDFYVRLIDSMTKQAIIYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVSVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEGTPSYLEHATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVIFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGTPGRFIYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVILKRAADLVEALY 390          
BLAST of coe protein vs. Ensembl Zebrafish
Match: ebf3a (EBF transcription factor 1a [Source:NCBI gene;Acc:565310])

HSP 1 Score: 553.903 bits (1426), Expect = 0.000e+0
Identity = 273/380 (71.84%), Postives = 318/380 (83.68%), Query Frame = 1
Query:  223 LKEEAISQLAPSQLDLVRSWMQPNN-LESSVPRLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGD---FPTVTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALY 1350
            +KEE I     + ++ VR+WMQ    L+++      + +  A FE+QPP NLRKSNFFHFV+ALYD+   PVE+ER +F+ FVEK++E+ GEKTNNGIHYRL+LL+SNGI+ +Q+ YVRLIDS TKQAI YEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDR+FLKFF+KCNQNCLKNAGNPRDMRRFQV VSTT  VDG +LA+SDNMFVHNNSKHGRRARR DP++G        TP IKAI P+EGWTTGG TVII+GDNFFDGLQV+FGT +VW E++T HAIRVQ+PPRHIPG+ E+TL+YK K FCK  PGRF Y ++ EPTIDYGFQRL K+IPRHPGDP+RLPKE+ILKRAADL EALY
Sbjct:   15 MKEEPIG----AGMNAVRTWMQGAGVLDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTSFVGFVEKEKESTGEKTNNGIHYRLQLLYSNGIRTEQDFYVRLIDSMTKQAIIYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVSVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEGTPSYLEHATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVIFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGTPGRFIYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVILKRAADLVEALY 390          
BLAST of coe protein vs. Ensembl Zebrafish
Match: ebf3a (EBF transcription factor 1a [Source:NCBI gene;Acc:565310])

HSP 1 Score: 553.132 bits (1424), Expect = 0.000e+0
Identity = 273/382 (71.47%), Postives = 319/382 (83.51%), Query Frame = 1
Query:  223 LKEEAISQLAPSQLDLVRSWMQPNN-LESSVPRLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDG-----DFPTVTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALY 1350
            +KEE I     + ++ VR+WMQ    L+++      + +  A FE+QPP NLRKSNFFHFV+ALYD+   PVE+ER +F+ FVEK++E+ GEKTNNGIHYRL+LL+SNGI+ +Q+ YVRLIDS TKQAI YEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDR+FLKFF+KCNQNCLKNAGNPRDMRRFQV VSTT  VDG +LA+SDNMFVHNNSKHGRRARR DP++G     +    TP IKAI P+EGWTTGG TVII+GDNFFDGLQV+FGT +VW E++T HAIRVQ+PPRHIPG+ E+TL+YK K FCK  PGRF Y ++ EPTIDYGFQRL K+IPRHPGDP+RLPKE+ILKRAADL EALY
Sbjct:   15 MKEEPIG----AGMNAVRTWMQGAGVLDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTSFVGFVEKEKESTGEKTNNGIHYRLQLLYSNGIRTEQDFYVRLIDSMTKQAIIYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVSVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEGTPSYLEHGESTPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVIFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGTPGRFIYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVILKRAADLVEALY 392          
BLAST of coe protein vs. Ensembl Xenopus
Match: EBF3 (EBF transcription factor 3 [Source:NCBI gene;Acc:100135240])

HSP 1 Score: 567 bits (1460), Expect = 0.000e+0
Identity = 273/381 (71.65%), Postives = 319/381 (83.73%), Query Frame = 1
Query:  223 LKEEAISQLAPSQLDLVRSWMQPNNL-ESSVPRLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGDFPT----VTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALY 1350
            +KEE +       ++ VRSWM    + +++      + +  A FE+QPP NLRKSNFFHFV+ALYD+   PVE+ER AF+DFVEKD+E   EKTNNGIHY+L+LL+SNG++ +Q++YVRLIDS TKQAI YEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDR+FLKFF+KCNQNCLKNAGNPRDMRRFQV VSTT  VDG +LA+SDNMFVHNNSKHGRRARR DP++G  P+     TP IKAI P+EGWTTGG TVII+GDNFFDGLQVVFGT +VW E++T HAIRVQ+PPRHIPG+ E+TL+YK K FCK APGRF Y ++ EPTIDYGFQRL K+IPRHPGDP+RLPKE++LKRAADL EALY
Sbjct:   15 MKEEPLG----GGMNPVRSWMHTAGVVDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVDFVEKDKEPNSEKTNNGIHYKLQLLYSNGVRTEQDLYVRLIDSMTKQAIIYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEGTAPSYLENATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVVFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFVYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVLLKRAADLVEALY 391          
BLAST of coe protein vs. Ensembl Xenopus
Match: EBF1 (EBF family member 4 [Source:NCBI gene;Acc:100492234])

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 273/380 (71.84%), Postives = 315/380 (82.89%), Query Frame = 1
Query:  223 LKEEAISQLAPSQLDLVRSWMQ-PNNLESSVPRLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGD---FPTVTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALY 1350
            +KEE +S      ++ VR+WMQ    L+++      + +  A FE+QPP NLRKSNFFHFV+ALYD+   PVE+ER AF+ FVEKD+E   EKTNNGIHYRL+LL+SNGI+ +Q+ YVRLIDS TKQ I YEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDR+FLKFF+KCNQNCLKNAGNPRDMRRFQV VSTT  VDG +LA+SDNMFVHNNSKHGRRARR DP+DG        TP IKAI P+EGWTTGG TVI++GDNFFDGLQV+FGT +VW E++T HAIRVQ+PPRHIPG+ E+TL+YK K FCK  PGRF Y ++ EPTIDYGFQRL K+IPRHPGDP+RLPKE+ILKRAADL EALY
Sbjct:   15 MKEEPLS----GGMNAVRTWMQGAGVLDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVGFVEKDKETSSEKTNNGIHYRLQLLYSNGIRTEQDFYVRLIDSMTKQPIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTINVDGHVLAVSDNMFVHNNSKHGRRARRLDPSDGTPSYLEHATPCIKAISPSEGWTTGGATVIVIGDNFFDGLQVIFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGTPGRFIYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVILKRAADLVEALY 390          
BLAST of coe protein vs. Ensembl Xenopus
Match: EBF1 (EBF family member 4 [Source:NCBI gene;Acc:100492234])

HSP 1 Score: 566.229 bits (1458), Expect = 0.000e+0
Identity = 274/382 (71.73%), Postives = 317/382 (82.98%), Query Frame = 1
Query:  223 LKEEAISQLAPSQLDLVRSWMQPNN-LESSVPRLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGDFPT-----VTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALY 1350
            +KEE +S      ++ VR+WMQ    L+++      + +  A FE+QPP NLRKSNFFHFV+ALYD+   PVE+ER AF+ FVEKD+E   EKTNNGIHYRL+LL+SNGI+ +Q+ YVRLIDS TKQ I YEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDR+FLKFF+KCNQNCLKNAGNPRDMRRFQV VSTT  VDG +LA+SDNMFVHNNSKHGRRARR DP+DG  P+      TP IKAI P+EGWTTGG TVI++GDNFFDGLQV+FGT +VW E++T HAIRVQ+PPRHIPG+ E+TL+YK K FCK  PGRF Y ++ EPTIDYGFQRL K+IPRHPGDP+RLPKE+ILKRAADL EALY
Sbjct:   15 MKEEPLS----GGMNAVRTWMQGAGVLDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVGFVEKDKETSSEKTNNGIHYRLQLLYSNGIRTEQDFYVRLIDSMTKQPIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTINVDGHVLAVSDNMFVHNNSKHGRRARRLDPSDGT-PSYLEHAATPCIKAISPSEGWTTGGATVIVIGDNFFDGLQVIFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGTPGRFIYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVILKRAADLVEALY 391          
BLAST of coe protein vs. Ensembl Xenopus
Match: EBF1 (EBF family member 4 [Source:NCBI gene;Acc:100492234])

HSP 1 Score: 566.229 bits (1458), Expect = 0.000e+0
Identity = 277/390 (71.03%), Postives = 321/390 (82.31%), Query Frame = 1
Query:  202 SLAASGI-LKEEAISQLAPSQLDLVRSWMQ-PNNLESSVPRLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGDFPT-----VTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALY 1350
            S+  SG  +KEE +S      ++ VR+WMQ    L+++      + +  A FE+QPP NLRKSNFFHFV+ALYD+   PVE+ER AF+ FVEKD+E   EKTNNGIHYRL+LL+SNGI+ +Q+ YVRLIDS TKQ I YEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDR+FLKFF+KCNQNCLKNAGNPRDMRRFQV VSTT  VDG +LA+SDNMFVHNNSKHGRRARR DP+DG  P+      TP IKAI P+EGWTTGG TVI++GDNFFDGLQV+FGT +VW E++T HAIRVQ+PPRHIPG+ E+TL+YK K FCK  PGRF Y ++ EPTIDYGFQRL K+IPRHPGDP+RLPKE+ILKRAADL EALY
Sbjct:    7 SIQRSGTSMKEEPLS----GGMNAVRTWMQGAGVLDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVGFVEKDKETSSEKTNNGIHYRLQLLYSNGIRTEQDFYVRLIDSMTKQPIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTINVDGHVLAVSDNMFVHNNSKHGRRARRLDPSDGT-PSYLEHAATPCIKAISPSEGWTTGGATVIVIGDNFFDGLQVIFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGTPGRFIYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVILKRAADLVEALY 391          
BLAST of coe protein vs. Ensembl Xenopus
Match: EBF3 (EBF transcription factor 3 [Source:NCBI gene;Acc:100135240])

HSP 1 Score: 565.844 bits (1457), Expect = 0.000e+0
Identity = 273/381 (71.65%), Postives = 319/381 (83.73%), Query Frame = 1
Query:  223 LKEEAISQLAPSQLDLVRSWMQPNNL-ESSVPRLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGDFPT----VTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALY 1350
            +KEE +       ++ VRSWM    + +++      + +  A FE+QPP NLRKSNFFHFV+ALYD+   PVE+ER AF+DFVEKD+E   EKTNNGIHY+L+LL+SNG++ +Q++YVRLIDS TKQAI YEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDR+FLKFF+KCNQNCLKNAGNPRDMRRFQV VSTT  VDG +LA+SDNMFVHNNSKHGRRARR DP++G  P+     TP IKAI P+EGWTTGG TVII+GDNFFDGLQVVFGT +VW E++T HAIRVQ+PPRHIPG+ E+TL+YK K FCK APGRF Y ++ EPTIDYGFQRL K+IPRHPGDP+RLPKE++LKRAADL EALY
Sbjct:   15 MKEEPLG----GGMNPVRSWMHTAGVVDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVDFVEKDKEPNSEKTNNGIHYKLQLLYSNGVRTEQDLYVRLIDSMTKQAIIYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEGTAPSYLENATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVVFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFVYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVLLKRAADLVEALY 391          
BLAST of coe protein vs. Ensembl Mouse
Match: Ebf1 (early B cell factor 1 [Source:MGI Symbol;Acc:MGI:95275])

HSP 1 Score: 567.77 bits (1462), Expect = 0.000e+0
Identity = 274/380 (72.11%), Postives = 317/380 (83.42%), Query Frame = 1
Query:  223 LKEEAISQLAPSQLDLVRSWMQ-PNNLESSVPRLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGD---FPTVTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALY 1350
            +KEE +     S ++ VR+WMQ    L+++      + +  A FE+QPP NLRKSNFFHFV+ALYD+   PVE+ER AF+ FVEK++EA  EKTNNGIHYRL+LL+SNGI+ +Q+ YVRLIDS TKQAI YEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDR+FLKFF+KCNQNCLKNAGNPRDMRRFQV VSTT  VDG +LA+SDNMFVHNNSKHGRRARR DP++G        TP IKAI P+EGWTTGG TVII+GDNFFDGLQV+FGT +VW E++T HAIRVQ+PPRHIPG+ E+TL+YK K FCK  PGRF Y ++ EPTIDYGFQRL K+IPRHPGDP+RLPKE+ILKRAADL EALY
Sbjct:   15 MKEEPLG----SGMNAVRTWMQGAGVLDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVGFVEKEKEANSEKTNNGIHYRLQLLYSNGIRTEQDFYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEGTPSYLEHATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVIFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGTPGRFIYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVILKRAADLVEALY 390          
BLAST of coe protein vs. Ensembl Mouse
Match: Ebf3 (early B cell factor 3 [Source:MGI Symbol;Acc:MGI:894289])

HSP 1 Score: 567.385 bits (1461), Expect = 0.000e+0
Identity = 273/381 (71.65%), Postives = 320/381 (83.99%), Query Frame = 1
Query:  223 LKEEAISQLAPSQLDLVRSWMQPNNL-ESSVPRLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGDFPT----VTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALY 1350
            +KEE +     S ++ VRSWM    + +++      + +  A FE+QPP NLRKSNFFHFV+ALYD+   PVE+ER AF+DFVEK++E   EKTNNGIHY+L+LL+SNG++ +Q++YVRLIDS TKQAI YEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDR+FLKFF+KCNQNCLKNAGNPRDMRRFQV VSTT  VDG +LA+SDNMFVHNNSKHGRRARR DP++G  P+     TP IKAI P+EGWTTGG TVII+GDNFFDGLQVVFGT +VW E++T HAIRVQ+PPRHIPG+ E+TL+YK K FCK APGRF Y ++ EPTIDYGFQRL K+IPRHPGDP+RLPKE++LKRAADL EALY
Sbjct:   15 MKEEPLG----SGMNPVRSWMHTAGVVDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVDFVEKEKEPNNEKTNNGIHYKLQLLYSNGVRTEQDLYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEGTAPSYLENATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVVFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFVYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVLLKRAADLVEALY 391          
BLAST of coe protein vs. Ensembl Mouse
Match: Ebf1 (early B cell factor 1 [Source:MGI Symbol;Acc:MGI:95275])

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 273/377 (72.41%), Postives = 316/377 (83.82%), Query Frame = 1
Query:  223 LKEEAISQLAPSQLDLVRSWMQ-PNNLESSVPRLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGDFPTVTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALY 1350
            +KEE +     S ++ VR+WMQ    L+++      + +  A FE+QPP NLRKSNFFHFV+ALYD+   PVE+ER AF+ FVEK++EA  EKTNNGIHYRL+LL+SNGI+ +Q+ YVRLIDS TKQAI YEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDR+FLKFF+KCNQNCLKNAGNPRDMRRFQV VSTT  VDG +LA+SDNMFVHNNSKHGRRARR DP++      TP IKAI P+EGWTTGG TVII+GDNFFDGLQV+FGT +VW E++T HAIRVQ+PPRHIPG+ E+TL+YK K FCK  PGRF Y ++ EPTIDYGFQRL K+IPRHPGDP+RLPKE+ILKRAADL EALY
Sbjct:   15 MKEEPLG----SGMNAVRTWMQGAGVLDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVGFVEKEKEANSEKTNNGIHYRLQLLYSNGIRTEQDFYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEA----ATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVIFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGTPGRFIYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVILKRAADLVEALY 383          
BLAST of coe protein vs. Ensembl Mouse
Match: Ebf1 (early B cell factor 1 [Source:MGI Symbol;Acc:MGI:95275])

HSP 1 Score: 566.229 bits (1458), Expect = 0.000e+0
Identity = 275/382 (71.99%), Postives = 319/382 (83.51%), Query Frame = 1
Query:  223 LKEEAISQLAPSQLDLVRSWMQPNN-LESSVPRLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGDFPT-----VTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALY 1350
            +KEE +     S ++ VR+WMQ    L+++      + +  A FE+QPP NLRKSNFFHFV+ALYD+   PVE+ER AF+ FVEK++EA  EKTNNGIHYRL+LL+SNGI+ +Q+ YVRLIDS TKQAI YEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDR+FLKFF+KCNQNCLKNAGNPRDMRRFQV VSTT  VDG +LA+SDNMFVHNNSKHGRRARR DP++G  P+      TP IKAI P+EGWTTGG TVII+GDNFFDGLQV+FGT +VW E++T HAIRVQ+PPRHIPG+ E+TL+YK K FCK  PGRF Y ++ EPTIDYGFQRL K+IPRHPGDP+RLPKE+ILKRAADL EALY
Sbjct:   15 MKEEPLG----SGMNAVRTWMQGAGVLDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVGFVEKEKEANSEKTNNGIHYRLQLLYSNGIRTEQDFYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEGT-PSYLEHAATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVIFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGTPGRFIYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVILKRAADLVEALY 391          
BLAST of coe protein vs. Ensembl Mouse
Match: Ebf3 (early B cell factor 3 [Source:MGI Symbol;Acc:MGI:894289])

HSP 1 Score: 562.762 bits (1449), Expect = 0.000e+0
Identity = 271/377 (71.88%), Postives = 317/377 (84.08%), Query Frame = 1
Query:  223 LKEEAISQLAPSQLDLVRSWMQPNNL-ESSVPRLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGDFPTVTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALY 1350
            +KEE +     S ++ VRSWM    + +++      + +  A FE+QPP NLRKSNFFHFV+ALYD+   PVE+ER AF+DFVEK++E   EKTNNGIHY+L+LL+SNG++ +Q++YVRLIDS TKQAI YEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDR+FLKFF+KCNQNCLKNAGNPRDMRRFQV VSTT  VDG +LA+SDNMFVHNNSKHGRRARR DP++      TP IKAI P+EGWTTGG TVII+GDNFFDGLQVVFGT +VW E++T HAIRVQ+PPRHIPG+ E+TL+YK K FCK APGRF Y ++ EPTIDYGFQRL K+IPRHPGDP+RLPKE++LKRAADL EALY
Sbjct:   15 MKEEPLG----SGMNPVRSWMHTAGVVDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVDFVEKEKEPNNEKTNNGIHYKLQLLYSNGVRTEQDLYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEA-----TPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVVFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFVYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVLLKRAADLVEALY 382          
BLAST of coe protein vs. UniProt/SwissProt
Match: sp|Q07802|COE1_MOUSE (Transcription factor COE1 OS=Mus musculus OX=10090 GN=Ebf1 PE=1 SV=1)

HSP 1 Score: 567.77 bits (1462), Expect = 0.000e+0
Identity = 274/380 (72.11%), Postives = 317/380 (83.42%), Query Frame = 1
Query:  223 LKEEAISQLAPSQLDLVRSWMQ-PNNLESSVPRLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGD---FPTVTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALY 1350
            +KEE +     S ++ VR+WMQ    L+++      + +  A FE+QPP NLRKSNFFHFV+ALYD+   PVE+ER AF+ FVEK++EA  EKTNNGIHYRL+LL+SNGI+ +Q+ YVRLIDS TKQAI YEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDR+FLKFF+KCNQNCLKNAGNPRDMRRFQV VSTT  VDG +LA+SDNMFVHNNSKHGRRARR DP++G        TP IKAI P+EGWTTGG TVII+GDNFFDGLQV+FGT +VW E++T HAIRVQ+PPRHIPG+ E+TL+YK K FCK  PGRF Y ++ EPTIDYGFQRL K+IPRHPGDP+RLPKE+ILKRAADL EALY
Sbjct:   15 MKEEPLG----SGMNAVRTWMQGAGVLDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVGFVEKEKEANSEKTNNGIHYRLQLLYSNGIRTEQDFYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEGTPSYLEHATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVIFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGTPGRFIYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVILKRAADLVEALY 390          
BLAST of coe protein vs. UniProt/SwissProt
Match: sp|Q9UH73|COE1_HUMAN (Transcription factor COE1 OS=Homo sapiens OX=9606 GN=EBF1 PE=1 SV=2)

HSP 1 Score: 567.77 bits (1462), Expect = 0.000e+0
Identity = 274/380 (72.11%), Postives = 317/380 (83.42%), Query Frame = 1
Query:  223 LKEEAISQLAPSQLDLVRSWMQ-PNNLESSVPRLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGD---FPTVTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALY 1350
            +KEE +     S ++ VR+WMQ    L+++      + +  A FE+QPP NLRKSNFFHFV+ALYD+   PVE+ER AF+ FVEK++EA  EKTNNGIHYRL+LL+SNGI+ +Q+ YVRLIDS TKQAI YEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDR+FLKFF+KCNQNCLKNAGNPRDMRRFQV VSTT  VDG +LA+SDNMFVHNNSKHGRRARR DP++G        TP IKAI P+EGWTTGG TVII+GDNFFDGLQV+FGT +VW E++T HAIRVQ+PPRHIPG+ E+TL+YK K FCK  PGRF Y ++ EPTIDYGFQRL K+IPRHPGDP+RLPKE+ILKRAADL EALY
Sbjct:   15 MKEEPLG----SGMNAVRTWMQGAGVLDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVGFVEKEKEANSEKTNNGIHYRLQLLYSNGIRTEQDFYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEGTPSYLEHATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVIFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGTPGRFIYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVILKRAADLVEALY 390          
BLAST of coe protein vs. UniProt/SwissProt
Match: sp|O08791|COE3_MOUSE (Transcription factor COE3 OS=Mus musculus OX=10090 GN=Ebf3 PE=1 SV=1)

HSP 1 Score: 567.385 bits (1461), Expect = 0.000e+0
Identity = 273/381 (71.65%), Postives = 320/381 (83.99%), Query Frame = 1
Query:  223 LKEEAISQLAPSQLDLVRSWMQPNNL-ESSVPRLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGDFPT----VTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALY 1350
            +KEE +     S ++ VRSWM    + +++      + +  A FE+QPP NLRKSNFFHFV+ALYD+   PVE+ER AF+DFVEK++E   EKTNNGIHY+L+LL+SNG++ +Q++YVRLIDS TKQAI YEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDR+FLKFF+KCNQNCLKNAGNPRDMRRFQV VSTT  VDG +LA+SDNMFVHNNSKHGRRARR DP++G  P+     TP IKAI P+EGWTTGG TVII+GDNFFDGLQVVFGT +VW E++T HAIRVQ+PPRHIPG+ E+TL+YK K FCK APGRF Y ++ EPTIDYGFQRL K+IPRHPGDP+RLPKE++LKRAADL EALY
Sbjct:   15 MKEEPLG----SGMNPVRSWMHTAGVVDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVDFVEKEKEPNNEKTNNGIHYKLQLLYSNGVRTEQDLYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEGTAPSYLENATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVVFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFVYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVLLKRAADLVEALY 391          
BLAST of coe protein vs. UniProt/SwissProt
Match: sp|Q9H4W6|COE3_HUMAN (Transcription factor COE3 OS=Homo sapiens OX=9606 GN=EBF3 PE=1 SV=2)

HSP 1 Score: 567.385 bits (1461), Expect = 0.000e+0
Identity = 273/381 (71.65%), Postives = 320/381 (83.99%), Query Frame = 1
Query:  223 LKEEAISQLAPSQLDLVRSWMQPNNL-ESSVPRLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGDFPT----VTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALY 1350
            +KEE +     S ++ VRSWM    + +++      + +  A FE+QPP NLRKSNFFHFV+ALYD+   PVE+ER AF+DFVEK++E   EKTNNGIHY+L+LL+SNG++ +Q++YVRLIDS TKQAI YEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDR+FLKFF+KCNQNCLKNAGNPRDMRRFQV VSTT  VDG +LA+SDNMFVHNNSKHGRRARR DP++G  P+     TP IKAI P+EGWTTGG TVII+GDNFFDGLQVVFGT +VW E++T HAIRVQ+PPRHIPG+ E+TL+YK K FCK APGRF Y ++ EPTIDYGFQRL K+IPRHPGDP+RLPKE++LKRAADL EALY
Sbjct:   15 MKEEPLG----SGMNPVRSWMHTAGVVDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVDFVEKEKEPNNEKTNNGIHYKLQLLYSNGVRTEQDLYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEGTAPSYLENATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVVFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFVYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVLLKRAADLVEALY 391          
BLAST of coe protein vs. UniProt/SwissProt
Match: sp|Q63398|COE1_RAT (Transcription factor COE1 OS=Rattus norvegicus OX=10116 GN=Ebf1 PE=1 SV=2)

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 273/377 (72.41%), Postives = 316/377 (83.82%), Query Frame = 1
Query:  223 LKEEAISQLAPSQLDLVRSWMQ-PNNLESSVPRLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGDFPTVTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALY 1350
            +KEE +     S ++ VR+WMQ    L+++      + +  A FE+QPP NLRKSNFFHFV+ALYD+   PVE+ER AF+ FVEK++EA  EKTNNGIHYRL+LL+SNGI+ +Q+ YVRLIDS TKQAI YEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDR+FLKFF+KCNQNCLKNAGNPRDMRRFQV VSTT  VDG +LA+SDNMFVHNNSKHGRRARR DP++      TP IKAI P+EGWTTGG TVII+GDNFFDGLQV+FGT +VW E++T HAIRVQ+PPRHIPG+ E+TL+YK K FCK  PGRF Y ++ EPTIDYGFQRL K+IPRHPGDP+RLPKE+ILKRAADL EALY
Sbjct:   15 MKEEPLG----SGMNAVRTWMQGAGVLDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVGFVEKEKEANSEKTNNGIHYRLQLLYSNGIRTEQDFYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEA----ATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVIFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGTPGRFIYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVILKRAADLVEALY 383          
BLAST of coe protein vs. TrEMBL
Match: U5YTB8 (Coe protein (Fragment) OS=Schmidtea mediterranea OX=79327 GN=coe PE=2 SV=1)

HSP 1 Score: 1046.19 bits (2704), Expect = 0.000e+0
Identity = 568/573 (99.13%), Postives = 569/573 (99.30%), Query Frame = 1
Query:  187 VLNHASLAASGILKEEAISQLAPSQLDLVRSWMQPNNLESSVPRLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGDFPTVTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALYSSVPRHYQTGSMASNLSLGACASQISSSKCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHNNNIGATTPNGFNVYTANLXXXXXXXXXXXXXXSQWEEVYANAQAACSPRRSLYGSMSQQNHNAASHPGFTNGYSSMTSSGHGSDFLQGMGGFPFAPMNPFSLTTGYTNHPHSGYPSSMVSPTK 1905
            VLNHASLAASGILKEEAISQLAPSQLDLVRSWMQPNNLESSVPRLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFI FVEK+REAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGDFPTVTPTIKAICPNEGWTTGGTTVIIVGDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALYSSVPRHYQTGSMASNLSLGACASQISSSKCSPVSSTASNNPNSSSSTTS LSISSVVSLAHNNNIGATTPNGFNVYTANLGMGMPPPPTHPHMGSQWEEVYANAQAACSPRRSLYGSM QQNHNA SHPGFTNGYSSMTSSGHGSDFLQGMGGFPFAPMNPFSLTTGYTNHPHSGYPSSMVSPTK
Sbjct:    1 VLNHASLAASGILKEEAISQLAPSQLDLVRSWMQPNNLESSVPRLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIGFVEKEREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGDFPTVTPTIKAICPNEGWTTGGTTVIIVGDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALYSSVPRHYQTGSMASNLSLGACASQISSSKCSPVSSTASNNPNSSSSTTSTLSISSVVSLAHNNNIGATTPNGFNVYTANLGMGMPPPPTHPHMGSQWEEVYANAQAACSPRRSLYGSMRQQNHNAVSHPGFTNGYSSMTSSGHGSDFLQGMGGFPFAPMNPFSLTTGYTNHPHSGYPSSMVSPTK 573          
BLAST of coe protein vs. TrEMBL
Match: A0A4S2MNN4 (IPT/TIG domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000031 PE=3 SV=1)

HSP 1 Score: 603.979 bits (1556), Expect = 0.000e+0
Identity = 278/356 (78.09%), Postives = 323/356 (90.73%), Query Frame = 1
Query:  316 RLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGDFPTVTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALYSSVPRHYQTGS 1383
            R PRME+ +ARFE+QPP NLRKSNFFHFVIALYDQNRHP+EVERAAF+DFVEKD+E EGEKTNNGIHYR RL+FSNG+QQDQ++YVRL+DS+TKQ IAYEGQDKNPEMCRVLLTHE+MCSRCC+KKSCGNRNETPSDPV++DRYFLKFFMKCNQNCLKNAGNPRDMRRFQVA+S +P ++  LL ISDNMFVHNNSKHGRR RR DP DG  P VTP IKA+ PNEGW TGG TV ++G+NFF GLQV+FG++ VWGE++T HA+RVQ+PPRH+PGI ++T+AYK+KTFCK+ PGRFAY+S+T+PTI+YGFQRLCKIIPRHPGDP+RLP+EIILKRAADLAEALY+   R+   GS
Sbjct:  275 RPPRMEVVSARFEKQPPNNLRKSNFFHFVIALYDQNRHPIEVERAAFVDFVEKDKEPEGEKTNNGIHYRARLIFSNGLQQDQDLYVRLVDSATKQPIAYEGQDKNPEMCRVLLTHEVMCSRCCEKKSCGNRNETPSDPVVLDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAISCSPAIERKLLCISDNMFVHNNSKHGRRTRRVDPADGVCPPVTPIIKALSPNEGWITGGETVTVIGENFFHGLQVIFGSTAVWGELLTPHAMRVQTPPRHLPGIVDVTMAYKNKTFCKNNPGRFAYMSITDPTIEYGFQRLCKIIPRHPGDPERLPREIILKRAADLAEALYTMPSRNITFGS 630          
BLAST of coe protein vs. TrEMBL
Match: H2KNM1 (Early B-cell factor OS=Clonorchis sinensis OX=79923 GN=CLF_100403 PE=3 SV=1)

HSP 1 Score: 603.979 bits (1556), Expect = 0.000e+0
Identity = 278/356 (78.09%), Postives = 323/356 (90.73%), Query Frame = 1
Query:  316 RLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGDFPTVTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALYSSVPRHYQTGS 1383
            R PRME+ +ARFE+QPP NLRKSNFFHFVIALYDQNRHP+EVERAAF+DFVEKD+E EGEKTNNGIHYR RL+FSNG+QQDQ++YVRL+DS+TKQ IAYEGQDKNPEMCRVLLTHE+MCSRCC+KKSCGNRNETPSDPV++DRYFLKFFMKCNQNCLKNAGNPRDMRRFQVA+S +P ++  LL ISDNMFVHNNSKHGRR RR DP DG  P VTP IKA+ PNEGW TGG TV ++G+NFF GLQV+FG++ VWGE++T HA+RVQ+PPRH+PGI ++T+AYK+KTFCK+ PGRFAY+S+T+PTI+YGFQRLCKIIPRHPGDP+RLP+EIILKRAADLAEALY+   R+   GS
Sbjct:  217 RPPRMEVVSARFEKQPPNNLRKSNFFHFVIALYDQNRHPIEVERAAFVDFVEKDKEPEGEKTNNGIHYRARLIFSNGLQQDQDLYVRLVDSATKQPIAYEGQDKNPEMCRVLLTHEVMCSRCCEKKSCGNRNETPSDPVVLDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAISCSPAIERKLLCISDNMFVHNNSKHGRRTRRVDPADGACPPVTPIIKALSPNEGWITGGETVTVIGENFFHGLQVIFGSTAVWGELLTPHAMRVQTPPRHLPGIVDVTMAYKNKTFCKNNPGRFAYMSITDPTIEYGFQRLCKIIPRHPGDPERLPREIILKRAADLAEALYTMPSRNIAFGS 572          
BLAST of coe protein vs. TrEMBL
Match: A0A3R7ESW6 (Transcription factor COE3 OS=Clonorchis sinensis OX=79923 GN=EBF3 PE=3 SV=1)

HSP 1 Score: 603.979 bits (1556), Expect = 0.000e+0
Identity = 278/356 (78.09%), Postives = 323/356 (90.73%), Query Frame = 1
Query:  316 RLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGDFPTVTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALYSSVPRHYQTGS 1383
            R PRME+ +ARFE+QPP NLRKSNFFHFVIALYDQNRHP+EVERAAF+DFVEKD+E EGEKTNNGIHYR RL+FSNG+QQDQ++YVRL+DS+TKQ IAYEGQDKNPEMCRVLLTHE+MCSRCC+KKSCGNRNETPSDPV++DRYFLKFFMKCNQNCLKNAGNPRDMRRFQVA+S +P ++  LL ISDNMFVHNNSKHGRR RR DP DG  P VTP IKA+ PNEGW TGG TV ++G+NFF GLQV+FG++ VWGE++T HA+RVQ+PPRH+PGI ++T+AYK+KTFCK+ PGRFAY+S+T+PTI+YGFQRLCKIIPRHPGDP+RLP+EIILKRAADLAEALY+   R+   GS
Sbjct:  217 RPPRMEVVSARFEKQPPNNLRKSNFFHFVIALYDQNRHPIEVERAAFVDFVEKDKEPEGEKTNNGIHYRARLIFSNGLQQDQDLYVRLVDSATKQPIAYEGQDKNPEMCRVLLTHEVMCSRCCEKKSCGNRNETPSDPVVLDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAISCSPAIERKLLCISDNMFVHNNSKHGRRTRRVDPADGACPPVTPIIKALSPNEGWITGGETVTVIGENFFHGLQVIFGSTAVWGELLTPHAMRVQTPPRHLPGIVDVTMAYKNKTFCKNNPGRFAYMSITDPTIEYGFQRLCKIIPRHPGDPERLPREIILKRAADLAEALYTMPSRNIAFGS 572          
BLAST of coe protein vs. TrEMBL
Match: A0A1S3IJZ3 (transcription factor COE3 isoform X7 OS=Lingula unguis OX=7574 GN=LOC106164462 PE=3 SV=1)

HSP 1 Score: 603.594 bits (1555), Expect = 0.000e+0
Identity = 342/582 (58.76%), Postives = 400/582 (68.73%), Query Frame = 1
Query:  223 LKEEAISQLAPSQLDLVRSWMQPNNLESSVPRLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGD--------FPTVTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALYSSVPRHYQTGSMASNLSLGACASQISSSKCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHNNNIGATTPNGFNVYTANLXXXXXXXXXXXXXXSQWEEVY-ANAQAACSPRRSLYGSMSQQNHNAASHPGFT--NGY-SSMTSSGH--GSDFLQG----MGGF---PFAPMNPFSLTTGYTNHPHSGYPSSMVSPTK 1905
            LKEE    LA SQL  VRSWM  + +++  P    + +  A FE+QPP NLRKSNFFHFV+ALYD+   P+E+ER A+IDFVEKD E EG+KTNNGIHYRL+LL++NG++Q+Q++YVRLIDS TKQAI YEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDR+FLKFFMKCNQNCLKNAGNPRDMRRFQVA+ T   VDGPLLA+SDNMFVHNNSKHGRRARR DPT+GD        FP  TP IKAICP+EGWT+GGTTV+I+GDNFFDGLQVVFGT +VW E+VTSHAIRVQ+PPRHIPG+ E+TL+YK K FCK APGRF Y ++TEPTIDYGFQRL K++PRHPGDP+RLPKEIILKRAADLAEALY S+PR+ Q       L+L A  S                                      N   G ++   FN YT  L               QWEE Y  ++ ++ SPR   YGS     H++      +  NGY SS+ + G     DFL G    M G    PF+ MNPF  T          YP+S++SP K
Sbjct:   18 LKEEP--SLA-SQLGSVRSWMHSSVVDT--PTSGSVGLGRAHFEKQPPSNLRKSNFFHFVLALYDRQGQPIEIERTAYIDFVEKDLEQEGQKTNNGIHYRLQLLYANGVRQEQDLYVRLIDSVTKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFMKCNQNCLKNAGNPRDMRRFQVAIVTNVSVDGPLLAVSDNMFVHNNSKHGRRARRLDPTEGDMVSKYALYFP-ATPVIKAICPSEGWTSGGTTVMIIGDNFFDGLQVVFGTMLVWSELVTSHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFVYTALTEPTIDYGFQRLMKLVPRHPGDPERLPKEIILKRAADLAEALY-SMPRNNQ-------LALPAPRS-----------------------------------PGMNTGSGMSS---FNTYTGQL-----AVSVPEAANGQWEESYNRSSTSSVSPRG--YGSNGSTPHSSNGSSYSSTMNGYGSSVGNMGMPPNPDFLHGHAARMSGIVSSPFSSMNPFLPTCS-----SQSYPASIISPAK 535          
BLAST of coe protein vs. Ensembl Cavefish
Match: ENSAMXT00000003471.2 (transcription factor COE3-like [Source:NCBI gene;Acc:103022853])

HSP 1 Score: 562.377 bits (1448), Expect = 0.000e+0
Identity = 271/377 (71.88%), Postives = 318/377 (84.35%), Query Frame = 1
Query:  223 LKEEAISQLAPSQLDLVRSWMQPNN-LESSVPRLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGDFPTVTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALY 1350
            +KEE ++    S +  VRSWMQ    L+++      + +  A +E+QPP NLRKSNFFHFV+ALYD+   PVE+ER +++DFVEKD+E  GEKTNNGIHYRL+LL+SNGI+ +Q+++VRLIDS TKQ I YEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDR+FLKFF+KCNQNCLKNAGNPRDMRRFQV +STT  VDG +LA+SDNMFVHNNSKHGRRARR DP++      TP IKAI P+EGWTTGG TVII+GDNFFDGLQVVFGT +VW E++T HAIRVQ+PPRHIPG+ E+TL+YK K FCK APGRF Y ++ EPTIDYGFQRL K+IPRHPGDP+RLPKE++LKRAADL EALY
Sbjct:   15 MKEEPLA----SGMTPVRSWMQSAGILDANTAAQSGVGLARAHYEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTSYVDFVEKDKEYNGEKTNNGIHYRLQLLYSNGIRTEQDLFVRLIDSMTKQPIIYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVISTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEA----ATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVVFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFVYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVLLKRAADLVEALY 383          
BLAST of coe protein vs. Ensembl Cavefish
Match: ENSAMXT00000057798.1 (transcription factor COE3-like [Source:NCBI gene;Acc:103022853])

HSP 1 Score: 560.836 bits (1444), Expect = 0.000e+0
Identity = 271/377 (71.88%), Postives = 318/377 (84.35%), Query Frame = 1
Query:  223 LKEEAISQLAPSQLDLVRSWMQPNN-LESSVPRLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGDFPTVTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALY 1350
            +KEE ++    S +  VRSWMQ    L+++      + +  A +E+QPP NLRKSNFFHFV+ALYD+   PVE+ER +++DFVEKD+E  GEKTNNGIHYRL+LL+SNGI+ +Q+++VRLIDS TKQ I YEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDR+FLKFF+KCNQNCLKNAGNPRDMRRFQV +STT  VDG +LA+SDNMFVHNNSKHGRRARR DP++      TP IKAI P+EGWTTGG TVII+GDNFFDGLQVVFGT +VW E++T HAIRVQ+PPRHIPG+ E+TL+YK K FCK APGRF Y ++ EPTIDYGFQRL K+IPRHPGDP+RLPKE++LKRAADL EALY
Sbjct:   15 MKEEPLA----SGMTPVRSWMQSAGILDANTAAQSGVGLARAHYEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTSYVDFVEKDKEYNGEKTNNGIHYRLQLLYSNGIRTEQDLFVRLIDSMTKQPIIYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVISTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEA-----TPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVVFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFVYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVLLKRAADLVEALY 382          
BLAST of coe protein vs. Ensembl Cavefish
Match: ebf3a (EBF transcription factor 3a [Source:NCBI gene;Acc:567751])

HSP 1 Score: 560.066 bits (1442), Expect = 0.000e+0
Identity = 268/377 (71.09%), Postives = 317/377 (84.08%), Query Frame = 1
Query:  223 LKEEAISQLAPSQLDLVRSWMQPNNL-ESSVPRLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGDFPTVTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALY 1350
            +KEE +     S ++ VRSWM    + +++      + +  A +E+QPP NLRKSNFFHFV+ALYD+   PVE+ER AF+DFVEK++E   EKTNNGIHY+L+LL+SNG++ +Q++YVRLIDS TKQAI YEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDR+FLKFF+KCNQNCLKNAGNPRDMRRFQV +STT  VDG +LA+SDNMFVHNNSKHGRRARR DP++      TP IKAI P+EGWTTGG TVI++GDNFFDGLQVVFGT +VW E++T HAIRVQ+PPRHIPG+ E+TL+YK K FCK APGRF Y ++ EPTIDYGFQRL K+IPRHPGDP+RLPKE++LKRAADL EALY
Sbjct:   15 MKEEPLG----SGMNPVRSWMHTAGVVDANTAAQSGVGLARAHYEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVDFVEKEKEPNSEKTNNGIHYKLQLLYSNGVRTEQDLYVRLIDSMTKQAIIYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVISTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEA-----TPCIKAISPSEGWTTGGATVILIGDNFFDGLQVVFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFVYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVLLKRAADLVEALY 382          
BLAST of coe protein vs. Ensembl Cavefish
Match: ebf3a (EBF transcription factor 3a [Source:NCBI gene;Acc:567751])

HSP 1 Score: 557.755 bits (1436), Expect = 0.000e+0
Identity = 268/377 (71.09%), Postives = 317/377 (84.08%), Query Frame = 1
Query:  223 LKEEAISQLAPSQLDLVRSWMQPNNL-ESSVPRLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGDFPTVTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALY 1350
            +KEE +     S ++ VRSWM    + +++      + +  A +E+QPP NLRKSNFFHFV+ALYD+   PVE+ER AF+DFVEK++E   EKTNNGIHY+L+LL+SNG++ +Q++YVRLIDS TKQAI YEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDR+FLKFF+KCNQNCLKNAGNPRDMRRFQV +STT  VDG +LA+SDNMFVHNNSKHGRRARR DP++      TP IKAI P+EGWTTGG TVI++GDNFFDGLQVVFGT +VW E++T HAIRVQ+PPRHIPG+ E+TL+YK K FCK APGRF Y ++ EPTIDYGFQRL K+IPRHPGDP+RLPKE++LKRAADL EALY
Sbjct:   15 MKEEPLG----SGMNPVRSWMHTAGVVDANTAAQSGVGLARAHYEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVDFVEKEKEPNSEKTNNGIHYKLQLLYSNGVRTEQDLYVRLIDSMTKQAIIYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVISTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEA-----TPCIKAISPSEGWTTGGATVILIGDNFFDGLQVVFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFVYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVLLKRAADLVEALY 382          
BLAST of coe protein vs. Ensembl Cavefish
Match: ebf2 (transcription factor COE2 [Source:NCBI gene;Acc:103023422])

HSP 1 Score: 538.495 bits (1386), Expect = 0.000e+0
Identity = 258/384 (67.19%), Postives = 321/384 (83.59%), Query Frame = 1
Query:  259 QLDLVRSWMQ-PNNLESSVPRLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDP---TDGDFPTVTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALYSSVPR-HYQTGSMASN 1395
            ++D VRSW++    ++++V     + ++ A FE+QPP NLRKSNFFHFV+ALYD++  PVE+ER AF+DFVE ++E  GEKTNNG HY+L+LL+SNG++ +Q++Y RL+DS TKQ I+YEGQ+KNPEMCRVLLTHE+MCSRCC+KKSCGNRNETPSDPVIIDR+FLKFF+KCNQNCLK AGNPRDMRRFQV +S+T  V+G +LA+SDNMFVHNNSKHGRRARR +P    +      TP IKAI P+EGWTTGG  VII+G+NFFDGLQVVFG+ +VW E++T HAIRVQ+PPRHIPG+ E+TL+YK K FCK APGRF Y ++ EPTIDYGFQRL K+IPRHPGDP+RL K+++LKRAAD+AEALY SVPR H Q  ++ S+
Sbjct:   21 EMDSVRSWVRNVGVVDANVAAQSGVALSRAHFEKQPPSNLRKSNFFHFVLALYDRHGQPVEIERTAFVDFVEHEKEQTGEKTNNGTHYKLQLLYSNGVRTEQDLYARLVDSVTKQPISYEGQNKNPEMCRVLLTHEVMCSRCCEKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKTAGNPRDMRRFQVVLSSTVSVEGHVLAVSDNMFVHNNSKHGRRARRLEPGETLENPMEYATPCIKAISPSEGWTTGGAMVIIIGENFFDGLQVVFGSMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFIYTALNEPTIDYGFQRLQKVIPRHPGDPERLAKDMLLKRAADIAEALY-SVPRPHSQLQALPSS 403          
BLAST of coe protein vs. Ensembl Sea Lamprey
Match: ebf2 (EBF transcription factor 2 [Source:NCBI gene;Acc:30692])

HSP 1 Score: 312.768 bits (800), Expect = 3.251e-101
Identity = 164/238 (68.91%), Postives = 186/238 (78.15%), Query Frame = 1
Query:  742 RYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGDFP------TVTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPK----------------------EIILKRAADLAEALYSSVPRHY 1371
            R+FLKFF+KCNQNCLKNAGNPRDMRRFQV VSTT  VDG +LA+SDNMFVHNNSKHGRRARR DP++G  P        TP IKAI P+EGWTTGG TVII+GDNFFDGLQVVFGT +VW E++T HAIRVQ+PPRHIPG+ E+TL+YK K FCK APGRF Y ++ EPTIDYGFQRL K+IPRHPGDP+RLPK                      EIILKRAAD+AEALY SVPR++
Sbjct:    1 RFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVHVDGHVLAVSDNMFVHNNSKHGRRARRIDPSEGTPPPSYLDNAATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVVFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFVYTALNEPTIDYGFQRLQKLIPRHPGDPERLPKVRLLRIHADWTETLIRLPNHSSEIILKRAADIAEALY-SVPRNH 237          
BLAST of coe protein vs. Ensembl Sea Lamprey
Match: si:ch211-51e8.2 (si:ch211-51e8.2 [Source:ZFIN;Acc:ZDB-GENE-091118-125])

HSP 1 Score: 251.521 bits (641), Expect = 2.715e-80
Identity = 120/176 (68.18%), Postives = 139/176 (78.98%), Query Frame = 1
Query:  223 LKEEAISQLAPSQLDLVRSWMQPNNLESSVPRLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMC--SRCCDKKSCGNRNETPSDPVIIDR 744
            LKEE +    P+    VRSWM    +++S      + +  A FE+QPP NLRKSNFFHFV+ALYD+   PVE+ER AF+DFVEKDRE   EKTNNGIHYRL+LL+SNG++ +Q++YVRLIDS  KQAI YEGQDKNPEMCRVLLTHEIMC  SRCCDKKSCGNRNETPSDPVIIDR
Sbjct:   16 LKEEPLGGGMPT----VRSWMHSGVVDASTAAQSGIALARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVDFVEKDREPNSEKTNNGIHYRLQLLYSNGVRTEQDLYVRLIDSMNKQAIVYEGQDKNPEMCRVLLTHEIMCSTSRCCDKKSCGNRNETPSDPVIIDR 187          
BLAST of coe protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004655.1 (pep scaffold:Pmarinus_7.0:GL476361:114832:174911:1 gene:ENSPMAG00000004238.1 transcript:ENSPMAT00000004655.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 196.052 bits (497), Expect = 3.036e-57
Identity = 115/180 (63.89%), Postives = 133/180 (73.89%), Query Frame = 1
Query:  823 QVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGDFPTVTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRV-QSPPRH---IPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALY 1350
            QV +STT  VDG +LA+SDNMFVHNNSKHGRRARR DP++      TP IKAI P+EGWTTGG TVII+GDNFFDGLQVVFGT +VW E  T+  I + QS PR     PG    T     + FC++AP      ++ EPTIDYGFQRL K+IPRHPGDP+RLPKE+ILKRAADL EALY
Sbjct:    5 QVVISTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEA-----TPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVVFGTMLVWSEDYTNPRILMPQSMPRGGGPQPGSVTATTKANSRQFCRAAPPEMFPAALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVILKRAADLVEALY 179          
BLAST of coe protein vs. Ensembl Nematostella
Match: EDO42699 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0M6])

HSP 1 Score: 473.396 bits (1217), Expect = 4.262e-160
Identity = 231/366 (63.11%), Postives = 285/366 (77.87%), Query Frame = 1
Query:  271 VRSWMQPNNLESSVPRLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRAR-RSDPTDGDFPTVTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALYSSVPR 1365
            V   +Q   LE  V       +    FE+QPP NLRKSNFFHFV+A +D N   VE+ERA+FIDF+E     E +   NG+ YR+ LL+SNGI+ +Q+++VRLID++TKQ + YEGQDKNPEM RVLLTHE+MCSRCC+KKSCGN+NETPSDPV++DRY LKFFMKCNQNCLKNAGNP+DMRRFQV VST+      ++A SDNMFVHNNSKHGRR R R+D  + D     P IKAICPNEGWT GG+ VI++GDNFFDGLQVVFG+ +VW E +T HA+RVQ+PP  +PG+ ++ L +K+K +CK AP +F Y ++ EPTIDYGFQRL K+IPRHPGDP+R+PKEI+LKRAADLAE LY  +PR
Sbjct:   19 VVGCLQHRVLEPQVTSTASGLLARCHFEKQPPANLRKSNFFHFVLAFFDHNGQAVEIERASFIDFIE--HLPEDKNVRNGVLYRVLLLYSNGIRTEQDIFVRLIDAATKQIVPYEGQDKNPEMRRVLLTHEVMCSRCCEKKSCGNKNETPSDPVVVDRYCLKFFMKCNQNCLKNAGNPKDMRRFQVHVSTSVDPMYGMIACSDNMFVHNNSKHGRRTRSRADGNEQDTSADDPCIKAICPNEGWTIGGSNVILIGDNFFDGLQVVFGSFIVWSEFITPHALRVQAPPSPMPGVVKVYLMHKEKQYCKYAPAKFGYTALVEPTIDYGFQRLSKLIPRHPGDPERIPKEIVLKRAADLAETLY-QMPR 381          
BLAST of coe protein vs. Ensembl Medaka
Match: ENSORLT00000025297.2 (transcription factor COE3-like [Source:NCBI gene;Acc:101166208])

HSP 1 Score: 562.762 bits (1449), Expect = 0.000e+0
Identity = 266/361 (73.68%), Postives = 310/361 (85.87%), Query Frame = 1
Query:  271 VRSWMQPNNL-ESSVPRLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGDFPTVTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALY 1350
            VRSWM    + +++      + +  A FE+QPP NLRKSNFFHFV+ALYD+   PVE+ER A++DFVEK++E  GEKTNNGIHY+L+LL+SNG++ +Q++YVRLIDS TKQAI YEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDR+FLKFF+KCNQNCLKNAGNPRDMRRFQV VSTT  VDG +LA+SDNMFVHNNSKHGRRARR DP++      TP IKAI P+EGWTTGG TVI++GDNFFDGLQVVFGT +VW E++T HAIRVQ+PPRHIPG+ E+TL+YK K FCK APGRF Y ++ EPTIDYGFQRL K+IPRHPGDP+RLPKE++LKRAADL EALY
Sbjct:   23 VRSWMHAAGVVDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAYVDFVEKEKEPSGEKTNNGIHYKLQLLYSNGVRTEQDLYVRLIDSMTKQAIIYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEA-----TPCIKAISPSEGWTTGGATVILIGDNFFDGLQVVFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFVYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVLLKRAADLVEALY 378          
BLAST of coe protein vs. Ensembl Medaka
Match: ebf3a (EBF transcription factor 3 [Source:NCBI gene;Acc:101169136])

HSP 1 Score: 560.451 bits (1443), Expect = 0.000e+0
Identity = 269/377 (71.35%), Postives = 316/377 (83.82%), Query Frame = 1
Query:  223 LKEEAISQLAPSQLDLVRSWMQPNNL-ESSVPRLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGDFPTVTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALY 1350
            +KEE +  L     + VRSWM    + +++      + +  A +E+QPP NLRKSNFFHFV+ALYD+   PVE+ER AF+DFVEK++E   EKTNNGIHY+L+LL+SNG++ +Q++Y+RLIDS TKQAI YEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDR+FLKFF+KCNQNCLKNAGNPRDMRRFQV VSTT  VDG +LA+SDNMFVHNNSKHGRRARR DP++      TP IKAI P+EGWTTGG TVII+GDNFFDGLQVVFGT +VW E++T HAIRVQ+PPRHIPG+ E+TL+YK K FCK APGRF Y ++ EPTIDYGFQRL K+IPRHPGDP+RLPKE++LKRAADL EALY
Sbjct:   15 MKEEPLGGL-----NSVRSWMHTAGVVDANTAAQSGVGLARAHYEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVDFVEKEKEPTSEKTNNGIHYKLQLLYSNGVRTEQDLYIRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEA----ATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVVFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFVYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVLLKRAADLVEALY 382          
BLAST of coe protein vs. Ensembl Medaka
Match: ENSORLT00000025299.2 (transcription factor COE3 [Source:NCBI gene;Acc:101161695])

HSP 1 Score: 560.066 bits (1442), Expect = 0.000e+0
Identity = 272/377 (72.15%), Postives = 317/377 (84.08%), Query Frame = 1
Query:  223 LKEEAISQLAPSQLDLVRSWMQPNN-LESSVPRLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGDFPTVTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALY 1350
            +KEE +    P+ +  VRSWMQ    L+++      + +  A FE+QPP NLRKSNFFHFV+ALYD+   PVE+ER +++DFVEKD+   GEKTNNGIHYRL+LL+SNGI+ +Q++YVRLIDS TKQ I YEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDR+FLKFF+KCNQNCLKNAGNPRDMRRFQV VSTT  VDG +LA+SDNMFVHNNSKHGRRARR DP++      TP IKAI P+EGWTTGG TVI++GDNFFDGLQVVFGT +VW E++T HAIRVQ+PPRHIPG+ E+TL+YK K FCK APGRF Y ++ EPTIDYGFQRL K+IPRHPGDP+RLPKE++LKRAADL EALY
Sbjct:   15 MKEEPL----PTGMTPVRSWMQGAGILDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTSYVDFVEKDK-YNGEKTNNGIHYRLQLLYSNGIRTEQDLYVRLIDSMTKQPILYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEA----ATPCIKAISPSEGWTTGGATVILIGDNFFDGLQVVFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFVYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVLLKRAADLVEALY 382          
BLAST of coe protein vs. Ensembl Medaka
Match: EBF1 (transcription factor COE1 [Source:NCBI gene;Acc:101175674])

HSP 1 Score: 551.977 bits (1421), Expect = 0.000e+0
Identity = 272/382 (71.20%), Postives = 316/382 (82.72%), Query Frame = 1
Query:  223 LKEEAISQLAPSQLDLVRSWMQPNN-LESSVPRLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGDFPT-----VTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALY 1350
            LKEE +  +       VRSWMQ    L+++      + +  A FE+QPP NLRKSNFFHFV+ALYD+   PVE+ER +F+DF+EK++E  GEKTNNGIHYRL+LL+SNGI+ +Q+ YVRLIDS TKQAI YEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDR+FLKFF+KCNQNCLKNAGNPRDMRRFQV VSTT  V+G +L++SDNMFVHNNSKHGRRARR DP +G  P+       P IKAI P+EGWTTGG TVII+GDNFFDGLQV+FGT +VW E++T HAIRVQ+PPRHIPG+ E+TL+YK K FCK  PGRF Y ++ EPTIDYGFQRL K+IPRHPGDP+RLPKE+ILKRAADL EALY
Sbjct:   15 LKEEPLGGMN------VRSWMQGGGVLDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTSFVDFIEKEKETSGEKTNNGIHYRLQLLYSNGIRTEQDFYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVSVEGHVLSVSDNMFVHNNSKHGRRARRLDPVEGT-PSYLEHGAAPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVIFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGTPGRFIYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVILKRAADLVEALY 389          
BLAST of coe protein vs. Ensembl Medaka
Match: ebf3a (transcription factor COE1 [Source:NCBI gene;Acc:101162765])

HSP 1 Score: 548.51 bits (1412), Expect = 0.000e+0
Identity = 275/387 (71.06%), Postives = 322/387 (83.20%), Query Frame = 1
Query:  196 HASLAASGI-LKEEAISQLAPSQLDLVRSWMQ-PNNLESSVPRLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGDFPTVTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALY 1350
            H S+  SG  +KEE +     + ++ VR+WMQ    L+++      + +  A FE+QPP NLRKSNFFHFV+ALYD+   PVE+ER  F+DFVEK++E  GEKTNNGIHYRL+LL+SNGI+ +Q++YVRLIDS TKQAI YEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDR+FLKFF+KCNQNCLKNAGNPRDMRRFQV VSTT  V+G +LA+SDNMFVHNNSKHGRRARR DP++G     TP IKAI P+EGWTTGG TVII+GDNFFDGLQV+FGT +VW E++T HAIRVQ+PPRHIPG+ E+TL+YK K FCK  PGRF Y ++ EPTIDYGFQRL K+IPRHPGD +RLPKE+ILKRAADL EALY
Sbjct:    5 HESIQRSGSSMKEEPMV----AGMNAVRTWMQGAGVLDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTTFVDFVEKEKETTGEKTNNGIHYRLQLLYSNGIRTEQDLYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVSVEGHVLAVSDNMFVHNNSKHGRRARRLDPSEG-----TP-IKAISPSEGWTTGGATVIIIGDNFFDGLQVIFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGTPGRFIYTALNEPTIDYGFQRLQKVIPRHPGDQERLPKEVILKRAADLVEALY 381          
BLAST of coe protein vs. Planmine SMEST
Match: SMESG000069088.1 (SMESG000069088.1)

HSP 1 Score: 1043.11 bits (2696), Expect = 0.000e+0
Identity = 571/575 (99.30%), Postives = 571/575 (99.30%), Query Frame = 1
Query:  181 MAVLNHASLAASGILKEEAISQLAPSQLDLVRSWMQPNNLESSVPRLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDGDFPTVTPTIKAICPNEXXXXXXXXXXXXXDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALYSSVPRHYQTGSMASNLSLGACASQISSSKCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHNNNIGATTPNGFNVYTANLXXXXXXXXXXXXXXSQWEEVYANAQAACSPRRSLYGSMSQQNHNAASHPGFTNGYSSMTSSGHGSDFLQGMGGFPFAPMNPFSLTTGYTNHPHSGYPSSMVSPTK 1905
            MAVLNHASLAASGILKEEAISQLAPSQLDLVRSWMQPNNLESSVPRLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDG    VTPTIKAICPNEGWTTGGTTVIIVGDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALYSSVPRHYQTGSMASNLSLGACASQISSSKCSPVSSTASNNPNSSSSTTSALSISSVVSLAHNNNIGATTPNGFNVYTANLGMGMPPPPTHPHMGSQWEEVYANAQAACSPRRSLYGSMSQQNHNAASHPGFTNGYSSMTSSGHGSDFLQGMGGFPFAPMNPFSLTTGYTNHPHSGYPSSMVSPTK
Sbjct:    1 MAVLNHASLAASGILKEEAISQLAPSQLDLVRSWMQPNNLESSVPRLPRMEITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDREAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQNCLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRSDPTDG----VTPTIKAICPNEGWTTGGTTVIIVGDNFFDGLQVVFGTSMVWGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEPTIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALYSSVPRHYQTGSMASNLSLGACASQISSSKCSPVSSTASNNPNSSSSTTSALSISSVVSLAHNNNIGATTPNGFNVYTANLGMGMPPPPTHPHMGSQWEEVYANAQAACSPRRSLYGSMSQQNHNAASHPGFTNGYSSMTSSGHGSDFLQGMGGFPFAPMNPFSLTTGYTNHPHSGYPSSMVSPTK 571          
The following BLAST results are available for this feature:
BLAST of coe protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EBF10.000e+072.11EBF transcription factor 1 [Source:HGNC Symbol;Acc... [more]
EBF30.000e+071.65EBF transcription factor 3 [Source:HGNC Symbol;Acc... [more]
EBF10.000e+072.41EBF transcription factor 1 [Source:HGNC Symbol;Acc... [more]
EBF30.000e+071.88EBF transcription factor 3 [Source:HGNC Symbol;Acc... [more]
EBF40.000e+072.47EBF family member 4 [Source:HGNC Symbol;Acc:HGNC:2... [more]
back to top
BLAST of coe protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
unc-33.726e-16966.10Transcription factor unc-3 [Source:UniProtKB/Swis... [more]
back to top
BLAST of coe protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kn0.000e+073.17gene:FBgn0001319 transcript:FBtr0329882[more]
kn0.000e+072.16gene:FBgn0001319 transcript:FBtr0301400[more]
kn0.000e+071.97gene:FBgn0001319 transcript:FBtr0112810[more]
kn0.000e+071.97gene:FBgn0001319 transcript:FBtr0087465[more]
kn0.000e+071.97gene:FBgn0001319 transcript:FBtr0112809[more]
back to top
BLAST of coe protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ebf3a0.000e+071.62EBF transcription factor 3a [Source:NCBI gene;Acc:... [more]
ebf3a0.000e+071.62EBF transcription factor 3a [Source:NCBI gene;Acc:... [more]
ebf3a0.000e+071.84EBF transcription factor 1a [Source:NCBI gene;Acc:... [more]
ebf3a0.000e+071.84EBF transcription factor 1a [Source:NCBI gene;Acc:... [more]
ebf3a0.000e+071.47EBF transcription factor 1a [Source:NCBI gene;Acc:... [more]
back to top
BLAST of coe protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EBF30.000e+071.65EBF transcription factor 3 [Source:NCBI gene;Acc:1... [more]
EBF10.000e+071.84EBF family member 4 [Source:NCBI gene;Acc:10049223... [more]
EBF10.000e+071.73EBF family member 4 [Source:NCBI gene;Acc:10049223... [more]
EBF10.000e+071.03EBF family member 4 [Source:NCBI gene;Acc:10049223... [more]
EBF30.000e+071.65EBF transcription factor 3 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of coe protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ebf10.000e+072.11early B cell factor 1 [Source:MGI Symbol;Acc:MGI:9... [more]
Ebf30.000e+071.65early B cell factor 3 [Source:MGI Symbol;Acc:MGI:8... [more]
Ebf10.000e+072.41early B cell factor 1 [Source:MGI Symbol;Acc:MGI:9... [more]
Ebf10.000e+071.99early B cell factor 1 [Source:MGI Symbol;Acc:MGI:9... [more]
Ebf30.000e+071.88early B cell factor 3 [Source:MGI Symbol;Acc:MGI:8... [more]
back to top
BLAST of coe protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q07802|COE1_MOUSE0.000e+072.11Transcription factor COE1 OS=Mus musculus OX=10090... [more]
sp|Q9UH73|COE1_HUMAN0.000e+072.11Transcription factor COE1 OS=Homo sapiens OX=9606 ... [more]
sp|O08791|COE3_MOUSE0.000e+071.65Transcription factor COE3 OS=Mus musculus OX=10090... [more]
sp|Q9H4W6|COE3_HUMAN0.000e+071.65Transcription factor COE3 OS=Homo sapiens OX=9606 ... [more]
sp|Q63398|COE1_RAT0.000e+072.41Transcription factor COE1 OS=Rattus norvegicus OX=... [more]
back to top
BLAST of coe protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
U5YTB80.000e+099.13Coe protein (Fragment) OS=Schmidtea mediterranea O... [more]
A0A4S2MNN40.000e+078.09IPT/TIG domain-containing protein OS=Opisthorchis ... [more]
H2KNM10.000e+078.09Early B-cell factor OS=Clonorchis sinensis OX=7992... [more]
A0A3R7ESW60.000e+078.09Transcription factor COE3 OS=Clonorchis sinensis O... [more]
A0A1S3IJZ30.000e+058.76transcription factor COE3 isoform X7 OS=Lingula un... [more]
back to top
BLAST of coe protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000003471.20.000e+071.88transcription factor COE3-like [Source:NCBI gene;A... [more]
ENSAMXT00000057798.10.000e+071.88transcription factor COE3-like [Source:NCBI gene;A... [more]
ebf3a0.000e+071.09EBF transcription factor 3a [Source:NCBI gene;Acc:... [more]
ebf3a0.000e+071.09EBF transcription factor 3a [Source:NCBI gene;Acc:... [more]
ebf20.000e+067.19transcription factor COE2 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of coe protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ebf23.251e-10168.91EBF transcription factor 2 [Source:NCBI gene;Acc:3... [more]
si:ch211-51e8.22.715e-8068.18si:ch211-51e8.2 [Source:ZFIN;Acc:ZDB-GENE-091118-1... [more]
ENSPMAT00000004655.13.036e-5763.89pep scaffold:Pmarinus_7.0:GL476361:114832:174911:1... [more]
back to top
BLAST of coe protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of coe protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO426994.262e-16063.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of coe protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000025297.20.000e+073.68transcription factor COE3-like [Source:NCBI gene;A... [more]
ebf3a0.000e+071.35EBF transcription factor 3 [Source:NCBI gene;Acc:1... [more]
ENSORLT00000025299.20.000e+072.15transcription factor COE3 [Source:NCBI gene;Acc:10... [more]
EBF10.000e+071.20transcription factor COE1 [Source:NCBI gene;Acc:10... [more]
ebf3a0.000e+071.06transcription factor COE1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of coe protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000069088.10.000e+099.30SMESG000069088.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30005164
GenBankAGZ94924.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005164 ID=SMED30005164|Name=coe protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1971bp
TAATAATAATAATAATAATAATACGAATAAAAATAATAATCGTAACTGAA
AAAAAGTAACAAACAAAATTAAACGAAAGAACATAAACAAATAAAAATCA
AAGCCAAAAATAATCGATAATTTGGAAAACCGAATCCAACAACTGCAACG
CTGGATCAACTAAGAGGATTATCGCATAATATGGCCGTTTTGAACCATGC
TTCGTTGGCAGCCTCTGGTATTCTAAAGGAAGAAGCAATCAGCCAATTGG
CGCCAAGTCAATTAGATTTGGTCCGATCTTGGATGCAGCCAAACAACCTG
GAATCCTCGGTTCCAAGACTGCCGAGAATGGAAATCACCACCGCTCGTTT
CGAACGTCAACCGCCGGGGAATTTAAGAAAAAGCAATTTTTTCCACTTTG
TTATTGCACTCTATGATCAAAATCGACACCCAGTTGAAGTCGAGCGCGCG
GCTTTCATCGATTTTGTGGAAAAAGATCGGGAAGCTGAAGGCGAAAAGAC
CAATAATGGAATTCATTATCGATTGAGGCTGTTGTTTTCAAACGGAATAC
AACAAGATCAAAATGTTTATGTTCGATTAATTGATTCATCGACGAAACAA
GCTATAGCTTATGAAGGTCAAGATAAAAATCCAGAAATGTGTCGAGTTTT
ATTAACTCATGAAATAATGTGCAGTCGCTGTTGTGATAAAAAAAGTTGCG
GAAACCGAAATGAAACCCCATCAGATCCAGTAATAATCGACAGATATTTT
CTCAAATTTTTCATGAAATGTAATCAAAATTGTTTAAAAAACGCTGGAAA
CCCACGAGATATGCGCCGATTTCAGGTAGCAGTATCTACAACCCCGTGTG
TTGATGGGCCTCTGCTTGCCATATCAGACAATATGTTTGTACACAATAAT
TCCAAACATGGAAGACGAGCGAGAAGATCCGATCCAACTGACGGAGATTT
TCCAACAGTCACTCCGACGATAAAAGCAATTTGTCCAAACGAAGGTTGGA
CGACTGGTGGTACGACAGTCATCATTGTTGGAGACAATTTCTTCGACGGT
CTGCAAGTCGTTTTCGGGACTTCAATGGTTTGGGGAGAAGTTGTCACATC
ACATGCAATCAGAGTTCAATCACCTCCTAGGCATATTCCGGGTATAACAG
AAATCACACTGGCTTACAAAGACAAAACCTTTTGTAAATCAGCACCCGGA
AGATTTGCATATATTTCCATGACAGAGCCAACCATAGATTATGGATTTCA
AAGACTTTGTAAAATAATTCCCAGACATCCAGGAGATCCTGACCGATTAC
CAAAAGAAATTATTTTGAAAAGAGCTGCTGATTTAGCAGAAGCATTGTAT
AGTTCAGTACCCAGACATTATCAGACTGGATCTATGGCGTCAAATTTATC
ATTGGGTGCATGTGCCTCTCAAATAAGCTCAAGTAAATGTTCACCAGTTT
CATCAACTGCCTCCAACAATCCAAATAGCTCCTCATCCACCACATCAGCT
CTCTCAATATCATCAGTAGTTTCATTAGCGCATAATAACAATATTGGCGC
GACAACACCGAACGGGTTTAATGTTTACACTGCCAATTTGGGAATGGGAA
TGCCTCCACCTCCTACACATCCTCATATGGGTAGTCAGTGGGAAGAAGTA
TATGCCAATGCACAGGCCGCTTGTAGTCCAAGACGGAGTCTGTACGGCTC
AATGAGCCAGCAAAACCACAATGCTGCTAGTCATCCTGGTTTCACAAATG
GCTACTCAAGTATGACTTCATCTGGTCACGGGAGTGACTTTTTGCAAGGC
ATGGGTGGTTTTCCATTCGCACCAATGAATCCATTCTCCCTTACAACCGG
CTATACCAATCATCCACATTCTGGTTATCCAAGCTCGATGGTTTCACCGA
CAAAATGATTTTGAATAAAGTCATGATTAAAACAAATATTTTTATCTCAT
TCTCATGTAAATAAACCTTTA
back to top

protein sequence of SMED30005164-orf-1

>SMED30005164-orf-1 ID=SMED30005164-orf-1|Name=SMED30005164-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=576bp
MAVLNHASLAASGILKEEAISQLAPSQLDLVRSWMQPNNLESSVPRLPRM
EITTARFERQPPGNLRKSNFFHFVIALYDQNRHPVEVERAAFIDFVEKDR
EAEGEKTNNGIHYRLRLLFSNGIQQDQNVYVRLIDSSTKQAIAYEGQDKN
PEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRYFLKFFMKCNQN
CLKNAGNPRDMRRFQVAVSTTPCVDGPLLAISDNMFVHNNSKHGRRARRS
DPTDGDFPTVTPTIKAICPNEGWTTGGTTVIIVGDNFFDGLQVVFGTSMV
WGEVVTSHAIRVQSPPRHIPGITEITLAYKDKTFCKSAPGRFAYISMTEP
TIDYGFQRLCKIIPRHPGDPDRLPKEIILKRAADLAEALYSSVPRHYQTG
SMASNLSLGACASQISSSKCSPVSSTASNNPNSSSSTTSALSISSVVSLA
HNNNIGATTPNGFNVYTANLGMGMPPPPTHPHMGSQWEEVYANAQAACSP
RRSLYGSMSQQNHNAASHPGFTNGYSSMTSSGHGSDFLQGMGGFPFAPMN
PFSLTTGYTNHPHSGYPSSMVSPTK*
back to top
Aliases
The feature 'coe protein' has the following synonyms
Synonym
coe
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
GO:0005515protein binding
GO:0003677DNA binding
GO:0046872metal ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000025nervous system
PLANA:0000097ventral nerve cord
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000103central nervous system
PLANA:0000120progenitor cell
PLANA:0000121stem cell
PLANA:0000418head
PLANA:0000429neoblast
PLANA:0000470neuropil
PLANA:0002062neuropeptidergic neuron
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR038173COE_DBD_sf
IPR036638HLH_DNA-bd_sf
IPR003523Transcription_factor_COE
IPR002909IPT_dom
IPR032200COE_DBD
IPR013783Ig-like_fold
IPR032201COE_HLH
IPR018350Transcription_factor_COE_CS
IPR014756Ig_E-set
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0007275multicellular organism development
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002909IPT domainSMARTSM00429iptmega2coord: 261..345
e-value: 1.3E-5
score: 34.6
IPR002909IPT domainPFAMPF01833TIGcoord: 262..344
e-value: 5.3E-11
score: 42.4
IPR032200Transcription factor COE, DNA-binding domainPFAMPF16422COE1_DBDcoord: 26..249
e-value: 1.1E-126
score: 421.0
IPR032200Transcription factor COE, DNA-binding domainCDDcd11606COE_DBDcoord: 33..249
e-value: 6.48183E-159
score: 450.732
IPR032201Transcription factor COE, helix-loop-helix domainPFAMPF16423COE1_HLHcoord: 347..390
e-value: 3.6E-30
score: 103.4
IPR038173Transcription factor COE, DNA-binding domain superfamilyGENE3DG3DSA:2.60.40.3180coord: 9..249
e-value: 1.2E-125
score: 419.8
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 250..345
e-value: 2.3E-30
score: 106.6
IPR036638Helix-loop-helix DNA-binding domain superfamilyGENE3DG3DSA:4.10.280.10coord: 349..394
e-value: 5.7E-28
score: 98.4
IPR003523Transcription factor COEPANTHERPTHR10747TRANSCRIPTION FACTOR COEcoord: 25..553
IPR018350Transcription factor COE, conserved sitePROSITEPS01345COEcoord: 164..173
IPR014756Immunoglobulin E-setSUPERFAMILYSSF81296E set domainscoord: 262..345