Failed axon connections homolog

Overview
NameFailed axon connections homolog
Smed IDSMED30005161
Length (bp)1209
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Failed axon connections homolog (SMED30005161) t-SNE clustered cells

Violin plots show distribution of expression levels for Failed axon connections homolog (SMED30005161) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Failed axon connections homolog (SMED30005161) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Failed axon connections homolog (SMED30005161) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005161

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30005161h1SMcG0010669 Contig5171GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30005161h1SMcG0015363 Contig5171GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Smed sexual biotypeSMED30005161h1SMcG0010669 Contig51837uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005161h1SMcG0010669 Contig51837newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30005161h1SMcG0010669 dd_Smed_v4_1736_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005161h1SMcG0010669 dd_Smed_v4_1736_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Failed axon connections homolog vs. Ensembl Human
Match: FAXC (failed axon connections homolog, metaxin like GST domain containing [Source:HGNC Symbol;Acc:HGNC:20742])

HSP 1 Score: 144.05 bits (362), Expect = 2.325e-38
Identity = 79/241 (32.78%), Postives = 140/241 (58.09%), Query Frame = 2
Query:  383 KDIVYLFQFPSSRN-ISCISPFAVKIETYLKLKNIPYKSIRTIKQWSSKSQIPFIEWNGQQIADSNFILDFLVDKFQTQ--DNISDFEKGLSRAVEMMLDNQTVWSYFYYRYVEKASDF--INSWTFTTPFRRKI--IGFFFPRGFKNRSYH-HGIGRHSPSEIYEIGKKDLMAISNILGDRKFLLGDKMTTVDCYIFGHLCQILYIPSVNYPHIEFLKTDCKNLVEFTHRIIDKLWPEWN 1081
            KD + L QF    N +  +SPF +K+ETYL++ ++PY++    K  S++ ++P+IE+N ++++ + FI+DFL +K       N+   E+ +SRAV  M++    W+  Y ++V+  ++   + S +   PF   +  +     +G   R  H HGIGR S  EIY + +KD+ +++ +LGD+K+++G K++T+D  +FGHL Q ++      P    +K +  NL  +  RI  K WPEW+
Sbjct:   97 KDAIILHQFARPNNGVPSLSPFCLKMETYLRMADLPYQNYFGGKL-SAQGKMPWIEYNHEKVSGTEFIIDFLEEKLGVNLNKNLGPHERAISRAVTKMVEEHFYWTLAYCQWVDNLNETRKMLSLSGGGPFSNLLRWVVCHITKGIVKREMHGHGIGRFSEEEIYMLMEKDMRSLAGLLGDKKYIMGPKLSTLDATVFGHLAQAMWTLPGTRPE-RLIKGELINLAMYCERIRRKFWPEWH 335          
BLAST of Failed axon connections homolog vs. Ensembl Celegans
Match: Y57A10A.26 (pep chromosome:WBcel235:II:12264166:12266033:1 gene:WBGene00013266.1 transcript:Y57A10A.26.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y57A10A.26)

HSP 1 Score: 155.992 bits (393), Expect = 1.364e-44
Identity = 90/261 (34.48%), Postives = 142/261 (54.41%), Query Frame = 2
Query:  371 QNFEKDIVYLFQFPSSRNISCISPFAVKIETYLKLKNIPYKSIRT-IKQWSSKSQIPFIEWNGQQIADSNFILDFLVDKFQTQD--NISDFEKGLSRAVEMMLDNQTVWSYFYYRYVEKASDFINSWTFT-TPFRRKIIGF-----------FFPRGFKNRSYHHGIGRHSPSEIYEIGKKDLMAISNILGDRKFLLGDKMTTVDCYIFGHLCQILYIPSVNYPHIEFLKTDCKNLVEFTHRIIDKLWPEWNEFSHIIPIS 1108
            +++EKD VYL QFP +  I   SP+A K+ET+L++ +IPY +I    K+ S++ QIPFIE NG+Q ADS  I+D L + F   D  ++S  +K ++RA   +L++   W   Y R      DF   W  T T F R + G             F +  + R+   G+G  S  E+ +  KKDL AIS  LGD+ +L G  + T+D   F HL +++Y P  +     ++     N++E+  RI +K WP+W E ++ + ++
Sbjct:    9 RDWEKDHVYLVQFPRAGCIPSPSPYAFKVETFLRVADIPYTNINNEFKKMSARGQIPFIELNGRQHADSTIIIDNLTEHFHKSDLEDLSASDKAIARAFFALLEHHLCWVSLYSR----GQDF--GWLATDTGFGRLLTGIKGFAFKNFIVKSFTKKVRGRAAAQGMGTFSREEVLDQAKKDLDAISTQLGDKPYLFGSSIKTIDVTAFAHLAELIYTPQFSPEIRAYIDEKVPNVMEYVIRIKEKYWPDWEETTNTMNMA 263          
BLAST of Failed axon connections homolog vs. Ensembl Celegans
Match: Y57A10A.26 (pep chromosome:WBcel235:II:12264192:12266105:1 gene:WBGene00013266.1 transcript:Y57A10A.26.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y57A10A.26)

HSP 1 Score: 155.992 bits (393), Expect = 1.364e-44
Identity = 90/261 (34.48%), Postives = 142/261 (54.41%), Query Frame = 2
Query:  371 QNFEKDIVYLFQFPSSRNISCISPFAVKIETYLKLKNIPYKSIRT-IKQWSSKSQIPFIEWNGQQIADSNFILDFLVDKFQTQD--NISDFEKGLSRAVEMMLDNQTVWSYFYYRYVEKASDFINSWTFT-TPFRRKIIGF-----------FFPRGFKNRSYHHGIGRHSPSEIYEIGKKDLMAISNILGDRKFLLGDKMTTVDCYIFGHLCQILYIPSVNYPHIEFLKTDCKNLVEFTHRIIDKLWPEWNEFSHIIPIS 1108
            +++EKD VYL QFP +  I   SP+A K+ET+L++ +IPY +I    K+ S++ QIPFIE NG+Q ADS  I+D L + F   D  ++S  +K ++RA   +L++   W   Y R      DF   W  T T F R + G             F +  + R+   G+G  S  E+ +  KKDL AIS  LGD+ +L G  + T+D   F HL +++Y P  +     ++     N++E+  RI +K WP+W E ++ + ++
Sbjct:    9 RDWEKDHVYLVQFPRAGCIPSPSPYAFKVETFLRVADIPYTNINNEFKKMSARGQIPFIELNGRQHADSTIIIDNLTEHFHKSDLEDLSASDKAIARAFFALLEHHLCWVSLYSR----GQDF--GWLATDTGFGRLLTGIKGFAFKNFIVKSFTKKVRGRAAAQGMGTFSREEVLDQAKKDLDAISTQLGDKPYLFGSSIKTIDVTAFAHLAELIYTPQFSPEIRAYIDEKVPNVMEYVIRIKEKYWPDWEETTNTMNMA 263          
BLAST of Failed axon connections homolog vs. Ensembl Celegans
Match: Y48C3A.3 (pep chromosome:WBcel235:II:13309290:13311488:1 gene:WBGene00012987.1 transcript:Y48C3A.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y48C3A.3)

HSP 1 Score: 150.214 bits (378), Expect = 6.982e-42
Identity = 93/278 (33.45%), Postives = 145/278 (52.16%), Query Frame = 2
Query:  320 FIYYYVFHGKRRQKIFIQNFEKDIVYLFQFPSSRNISCISPFAVKIETYLKLKNIPYK-SIRTIKQWSSKSQIPFIEWNGQQIADSNFIL---DFLVDKFQTQDNISDFEKGLSRAVEMMLDNQTVWSYFYYRY--VEKASD---------------FINSWTFTTPFRRKIIGFFFPRGFKNRSYHHGIGRHSPSEIYEIGKKDLMAISNILGDRKFLLGDKMTTVDCYIFGHLCQILYIPSVNYPHIEFLKTDCKNLVEFTHRIIDKLWPEWNEFS 1090
            +I Y     + R+    +N++ D+VYL+QFP +R +  +SPF +K+ET+L++ +I Y+    ++   S +  +PF+E NG++  DS+FIL   D ++      D++S  +K  SRA E M +     S  YYR   VEK  D                I S T+ +   R+I G               IG HS  +I  IG +DL AIS  LG++ +  G K T VD  IF HLCQI Y P  +  H + +  +CKNL E+  RI ++ +P+W++ +
Sbjct:   35 YIPYKFMATRPRKSPLNENWKPDVVYLYQFPRARLLPNLSPFCMKVETWLRMSDITYEIPPCSLSTRSQEGTLPFVELNGKEYYDSSFILRDIDQVIKHTSLDDHLSAEQKATSRAFEAMSEKSLAISACYYRMENVEKMLDQFDPKLFGIFGFLFKLIGSRTYVSALLRRITG-------------SDIGFHSREDIINIGSEDLKAISKYLGNKHYFHGFKPTKVDACIFSHLCQIYYAPYTS-EHRDLIDGECKNLAEYVERIKNRFYPDWDDVT 298          
BLAST of Failed axon connections homolog vs. Ensembl Celegans
Match: C25H3.7 (pep chromosome:WBcel235:II:5666756:5668930:-1 gene:WBGene00016116.1 transcript:C25H3.7a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C25H3.7)

HSP 1 Score: 131.339 bits (329), Expect = 3.198e-35
Identity = 78/243 (32.10%), Postives = 132/243 (54.32%), Query Frame = 2
Query:  374 NFEKDIVYLFQFPSSRNISC-ISPFAVKIETYLKLKNIPYKSIRT--IKQWSSKSQIPFIEWNGQQIADSNFILDFLVDKFQTQDNISDFEKGLSRAVEMMLDNQTVWSYFYYRYVEKASDFINSWTFTTPFRRKIIGFFFPRGFKN--RSYHHGI-GRHSPSEIYEIGKKDLMAISNILGDRKFLLGDKMTTVDCYIFGHLCQILYIPSVNYPHIEFLKTDCKNLVEFTHRIIDKLWPEWNE 1084
            N+++++VYL+QFP   N    +SP+ +KIET+L+   I ++ + T    + S +  +PFIE NGQQI+DS  I+  L   F   D +   ++G +RAVE M+D  T ++    + V  A   +       P     +  +  +GF    R   +G+ G+   +E  E+ ++D+ AI +ILGD+KFL GD++T+VDC +FG +  + Y+P       + L+ D   +  +  RI    +PEW +
Sbjct:   34 NWKENVVYLYQFPRPANRQPNLSPYCLKIETFLRANRIKHEVVGTWLTLRQSPRGLLPFIELNGQQISDSQVIVWKLQKHFDLDDKLEGSDRGTARAVERMIDLSTNYALLVDKTVNNAHLLLARQVSNLPLP-SFLTNYLAKGFSQTARKRVNGVLGKLDVAEQKELLRRDIRAIDDILGDKKFLFGDRITSVDCSVFGQIGAVFYLPYRQQIS-DLLEDDFPRVRAYCDRIRQHYYPEWRD 274          
BLAST of Failed axon connections homolog vs. Ensembl Celegans
Match: cdr-4 (CaDmium Responsive; Cadmium-inducible lysosomal protein CDR-4 [Source:UniProtKB/TrEMBL;Acc:G5EDZ7])

HSP 1 Score: 109.383 bits (272), Expect = 4.130e-27
Identity = 79/271 (29.15%), Postives = 129/271 (47.60%), Query Frame = 2
Query:  317 GFIYYYVFHG-------KRRQKIFIQNFEKDIVYLFQFPSSRNISCISPFAVKIETYLKLKNIPYKSIRTIKQWSSKSQIPFIEWNGQQIADSNFILDFLVDKFQTQDNISDFEKGLSRAVEMMLDNQTVWSYFYYRYVEKA-----SDFINSWTFTTPFRRKIIGFFFPRGFKNRSYHHGIGRHSPSEIYEIGKKDLMAISN-ILGDRKFLLGDKMTTVDCYIFGHLCQILYIPSVNYPHIEFLKTDCKNLVEFTHRIIDKLWPEWNEFS 1090
            G I Y+++         K +  I   +++KD VYL+QF   ++   +SPF +K+E   +  NIPY+ + T    S    +PFIE NG+ IADS+ I   L   F+   ++ D ++  S A+  M DN   +    Y+    +      D  N  +F  P    ++  FF R    R     IG   P E+ E+  +DL  I + I G+  FL GDK+T  D  +FG L  + Y   +     + L  D   ++E+  R+  +++P  N+F+
Sbjct:   14 GAIAYFIYKKFFTPPTIKPKPAIHKTDYKKDTVYLYQFKRIKSCPNLSPFCMKLEILCRAYNIPYEVVETSMSRSRNGTLPFIELNGEHIADSDLIEIRLRQHFKIP-SLPDEQEAQSVALSRMADNHLFYILIRYKSASDSLYNIFGDLFNLPSFLVPVVIPVVRAFFKRKIYYRCV-GAIGDFEPQELDELLHRDLKVIQDSIKGN--FLFGDKITPADATVFGQLATVYY--PIRSHLTDVLDKDFPKVLEYLERVRKEIYP--NDFT 276          
BLAST of Failed axon connections homolog vs. Ensembl Fly
Match: fax (gene:FBgn0014163 transcript:FBtr0100477)

HSP 1 Score: 144.436 bits (363), Expect = 9.133e-39
Identity = 86/251 (34.26%), Postives = 134/251 (53.39%), Query Frame = 2
Query:  374 NFEKDIVYLFQFPSSRNISCISPFAVKIETYLKLKNIPYKSI-RTIKQWSSKSQIPFIEWNGQQIADSNFILDFLVDKFQT--QDNISDFEKGLSRAVEMMLDNQTVWSYFYYRY-----VEKASDFINSWTFTTPFRRKIIGFFFPRGFKNRSYH----HGIGRHSPSEIYEIGKKDLMAISNILGDRKFLLGDKMTTVDCYIFGHLCQILYIP-SVNYPHIEFLKTDCKNLVEFTHRIIDKLWPEWNEF 1087
            NFEKDI+YL+QF  +  +  +SP+ +K+ET+L+L  + Y+++   ++  S K Q+PFIE NG++IADS  I+  L  K++      ++  ++ +S A   ML+N  +W  FY+R      V K                 I+ FFF   F  +       HGIG HS  EI E GK DL  +S +L  + F  GD+ TT+D   F  L Q+ Y+   + YP  +++   C NL+    R+ DK +P+W+E 
Sbjct:  100 NFEKDIIYLYQFSRTPLLPSLSPYCLKVETWLRLVGLKYENVDHKMRFRSKKGQLPFIELNGEEIADSAIIIKELSSKYEKYLDSGLTAEQRNVSYATIAMLENHLIWIIFYWRAKYPDNVLKGYKVNLQHALGLRLPNSILNFFFKITFGRKGTKKLKAHGIGVHSAEEIEEFGKDDLKVLSEMLDCKPFFFGDEPTTLDVVAFAVLSQLHYLSKDIAYPLRDYMTEKCPNLIGHVSRMKDKCFPDWDEI 350          
BLAST of Failed axon connections homolog vs. Ensembl Fly
Match: fax (gene:FBgn0014163 transcript:FBtr0075412)

HSP 1 Score: 143.28 bits (360), Expect = 2.345e-38
Identity = 86/254 (33.86%), Postives = 135/254 (53.15%), Query Frame = 2
Query:  374 NFEKDIVYLFQFPSSRNISCISPFAVKIETYLKLKNIPYKSI-RTIKQWSSKSQIPFIEWNGQQIADSNFILDFLVDKFQT--QDNISDFEKGLSRAVEMMLDNQTVWSYFYYRY-----VEKASDFINSWTFTTPFRRKIIGFFFPRGFKNRSYH-------HGIGRHSPSEIYEIGKKDLMAISNILGDRKFLLGDKMTTVDCYIFGHLCQILYIP-SVNYPHIEFLKTDCKNLVEFTHRIIDKLWPEWNEF 1087
            NFEKDI+YL+QF  +  +  +SP+ +K+ET+L+L  + Y+++   ++  S K Q+PFIE NG++IADS  I+  L  K++      ++  ++ +S A   ML+N  +W  FY+R      V K                 I+ FFF   F  + +        HGIG HS  EI E GK DL  +S +L  + F  GD+ TT+D   F  L Q+ Y+   + YP  +++   C NL+    R+ DK +P+W+E 
Sbjct:  100 NFEKDIIYLYQFSRTPLLPSLSPYCLKVETWLRLVGLKYENVDHKMRFRSKKGQLPFIELNGEEIADSAIIIKELSSKYEKYLDSGLTAEQRNVSYATIAMLENHLIWIIFYWRAKYPDNVLKGYKVNLQHALGLRLPNSILNFFFKITFGRKWFQGTKKLKAHGIGVHSAEEIEEFGKDDLKVLSEMLDCKPFFFGDEPTTLDVVAFAVLSQLHYLSKDIAYPLRDYMTEKCPNLIGHVSRMKDKCFPDWDEI 353          
BLAST of Failed axon connections homolog vs. Ensembl Fly
Match: fax (gene:FBgn0014163 transcript:FBtr0331175)

HSP 1 Score: 110.923 bits (276), Expect = 1.207e-27
Identity = 68/202 (33.66%), Postives = 100/202 (49.50%), Query Frame = 2
Query:  518 SSKSQIPFIEWNGQQIADSNFILDFLVDKFQT--QDNISDFEKGLSRAVEMMLDNQTVWSYFYYRY-----VEKASDFINSWTFTTPFRRKIIGFFFPRGFKNRSYH----HGIGRHSPSEIYEIGKKDLMAISNILGDRKFLLGDKMTTVDCYIFGHLCQILYIP-SVNYPHIEFLKTDCKNLVEFTHRIIDKLWPEWNEF 1087
            S K Q+PFIE NG++IADS  I+  L  K++      ++  ++ +S A   ML+N  +W  FY+R      V K                 I+ FFF   F  +       HGIG HS  EI E GK DL  +S +L  + F  GD+ TT+D   F  L Q+ Y+   + YP  +++   C NL+    R+ DK +P+W+E 
Sbjct:    5 SKKGQLPFIELNGEEIADSAIIIKELSSKYEKYLDSGLTAEQRNVSYATIAMLENHLIWIIFYWRAKYPDNVLKGYKVNLQHALGLRLPNSILNFFFKITFGRKGTKKLKAHGIGVHSAEEIEEFGKDDLKVLSEMLDCKPFFFGDEPTTLDVVAFAVLSQLHYLSKDIAYPLRDYMTEKCPNLIGHVSRMKDKCFPDWDEI 206          
BLAST of Failed axon connections homolog vs. Ensembl Fly
Match: fax (gene:FBgn0014163 transcript:FBtr0100478)

HSP 1 Score: 110.923 bits (276), Expect = 1.368e-27
Identity = 68/202 (33.66%), Postives = 100/202 (49.50%), Query Frame = 2
Query:  518 SSKSQIPFIEWNGQQIADSNFILDFLVDKFQT--QDNISDFEKGLSRAVEMMLDNQTVWSYFYYRY-----VEKASDFINSWTFTTPFRRKIIGFFFPRGFKNRSYH----HGIGRHSPSEIYEIGKKDLMAISNILGDRKFLLGDKMTTVDCYIFGHLCQILYIP-SVNYPHIEFLKTDCKNLVEFTHRIIDKLWPEWNEF 1087
            S K Q+PFIE NG++IADS  I+  L  K++      ++  ++ +S A   ML+N  +W  FY+R      V K                 I+ FFF   F  +       HGIG HS  EI E GK DL  +S +L  + F  GD+ TT+D   F  L Q+ Y+   + YP  +++   C NL+    R+ DK +P+W+E 
Sbjct:   13 SKKGQLPFIELNGEEIADSAIIIKELSSKYEKYLDSGLTAEQRNVSYATIAMLENHLIWIIFYWRAKYPDNVLKGYKVNLQHALGLRLPNSILNFFFKITFGRKGTKKLKAHGIGVHSAEEIEEFGKDDLKVLSEMLDCKPFFFGDEPTTLDVVAFAVLSQLHYLSKDIAYPLRDYMTEKCPNLIGHVSRMKDKCFPDWDEI 214          
BLAST of Failed axon connections homolog vs. Ensembl Fly
Match: fax (gene:FBgn0014163 transcript:FBtr0331176)

HSP 1 Score: 109.768 bits (273), Expect = 3.568e-27
Identity = 68/204 (33.33%), Postives = 101/204 (49.51%), Query Frame = 2
Query:  518 SSKSQIPFIEWNGQQIADSNFILDFLVDKFQT--QDNISDFEKGLSRAVEMMLDNQTVWSYFYYRY-----VEKASDFINSWTFTTPFRRKIIGFFFPRGFKNRSYH-------HGIGRHSPSEIYEIGKKDLMAISNILGDRKFLLGDKMTTVDCYIFGHLCQILYIP-SVNYPHIEFLKTDCKNLVEFTHRIIDKLWPEWNE 1084
            S K Q+PFIE NG++IADS  I+  L  K++      ++  ++ +S A   ML+N  +W  FY+R      V K                 I+ FFF   F  + +        HGIG HS  EI E GK DL  +S +L  + F  GD+ TT+D   F  L Q+ Y+   + YP  +++   C NL+    R+ DK +P+W+E
Sbjct:    5 SKKGQLPFIELNGEEIADSAIIIKELSSKYEKYLDSGLTAEQRNVSYATIAMLENHLIWIIFYWRAKYPDNVLKGYKVNLQHALGLRLPNSILNFFFKITFGRKWFQGTKKLKAHGIGVHSAEEIEEFGKDDLKVLSEMLDCKPFFFGDEPTTLDVVAFAVLSQLHYLSKDIAYPLRDYMTEKCPNLIGHVSRMKDKCFPDWDE 208          
BLAST of Failed axon connections homolog vs. Ensembl Zebrafish
Match: faxca (failed axon connections homolog, metaxin like GST domain containing a [Source:ZFIN;Acc:ZDB-GENE-100422-7])

HSP 1 Score: 143.28 bits (360), Expect = 2.420e-38
Identity = 77/238 (32.35%), Postives = 133/238 (55.88%), Query Frame = 2
Query:  383 KDIVYLFQFPSSR-NISCISPFAVKIETYLKLKNIPYKSIRTIKQWSSKSQIPFIEWNGQQIADSNFILDFLVDKFQTQDN--ISDFEKGLSRAVEMMLDNQTVWSYFYYRYVEKASDFINSWTFTTPFR---RKIIGFFFPRGFKNRSYHHGIGRHSPSEIYEIGKKDLMAISNILGDRKFLLGDKMTTVDCYIFGHLCQILYIPSVNYPHIEFLKTDCKNLVEFTHRIIDKLWPEW 1078
            +D + L QF   +  +  +SPF +KIETYL++ ++PY++     Q S + ++P+I +N +Q+  + FI+DFL ++     N  +S  EK +SRA+  M++    W+  Y ++V+   +     +   P     R+I+G       K   Y HGIGR S  E+Y++ +KD+  ++ +LG++K+L+G   +TVD  +FGHL Q ++      P  + +K +  NL  +  RI  K WPEW
Sbjct:   95 EDTIILHQFARPKTGVPSLSPFCLKIETYLRMADLPYQNYFD-GQLSPQGKMPWIAYNKEQVCGTEFIIDFLEEQLGVNLNSSLSPQEKAISRAITKMVEEHFYWTIAYCQWVDNVEETQKMLSTNGPLSDLLRQILGQVTGGIVKREMYGHGIGRFSRDEVYKLMEKDMRTLATLLGNKKYLMGQTFSTVDAAVFGHLAQAMWTLPGTRPE-QLIKGEFINLAMYCERIRRKFWPEW 330          
BLAST of Failed axon connections homolog vs. Ensembl Zebrafish
Match: faxcb (failed axon connections homolog, metaxin like GST domain containing b [Source:ZFIN;Acc:ZDB-GENE-100922-19])

HSP 1 Score: 135.191 bits (339), Expect = 2.130e-35
Identity = 72/238 (30.25%), Postives = 131/238 (55.04%), Query Frame = 2
Query:  383 KDIVYLFQFPSSRN-ISCISPFAVKIETYLKLKNIPYKSIRTIKQWSSKSQIPFIEWNGQQIADSNFILDFLVDKFQTQDN--ISDFEKGLSRAVEMMLDNQTVWSYFYYRYVEKASDFINSWTFTTPFR---RKIIGFFFPRGFKNRSYHHGIGRHSPSEIYEIGKKDLMAISNILGDRKFLLGDKMTTVDCYIFGHLCQILYIPSVNYPHIEFLKTDCKNLVEFTHRIIDKLWPEW 1078
            KD + L QF   +N +  +SPF +K+ETYL++ ++PY+        S++ ++P+IE+N +Q+  + FI++FL +K     N  +S  E+ +++A+  M++    WS  Y ++V+   +         P     + I+        K   Y HGIG  +  E+Y + +KD+  ++ +LGD+K+++G K+++VD  +FGHL Q ++      P  + +K +  NL  +  RI  K WPEW
Sbjct:   95 KDAIILHQFSRPKNGVPSLSPFCLKMETYLRMLDLPYQCYFD-GSLSAQGKMPWIEYNYEQVCGTEFIIEFLEEKLGMSLNKSLSAQEQAVAQAITTMVEEHLYWSIAYCQWVDNVQETQRMLDLPGPLSDLLKWILCQLTGGMVKREMYCHGIGSFTKDEVYSLMEKDMRTLATLLGDKKYIMGPKLSSVDATVFGHLAQAMWTLPGTRPE-QLIKGELINLAMYCERIRRKFWPEW 330          
BLAST of Failed axon connections homolog vs. Ensembl Zebrafish
Match: CR848729.3 (pep chromosome:GRCz11:CHR_ALT_CTG16_1_15:32650215:32656501:-1 gene:ENSDARG00000114322.1 transcript:ENSDART00000190786.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR848729.3)

HSP 1 Score: 64.3142 bits (155), Expect = 1.234e-11
Identity = 33/105 (31.43%), Postives = 64/105 (60.95%), Query Frame = 2
Query:  383 KDIVYLFQFPSSRN-ISCISPFAVKIETYLKLKNIPYKSIRTIKQWSSKSQIPFIEWNGQQIADSNFILDFLVDKFQTQDN--ISDFEKGLSRAVEMMLDNQTVW 688
            KD + L QF   +N +  +SPF +K+ETYL++ ++PY+        S++ ++P+IE+N +Q+  + FI++FL +K     N  +S  E+ +++A+  M++    W
Sbjct:   95 KDAIILHQFSRPKNGVPSLSPFCLKMETYLRMLDLPYQCYFD-GSLSAQGKMPWIEYNYEQVCGTEFIIEFLEEKLGMSLNKSLSAQEQAVAQAITTMVEEHLYW 198          
BLAST of Failed axon connections homolog vs. Ensembl Zebrafish
Match: mtx2 (metaxin 2 [Source:ZFIN;Acc:ZDB-GENE-021210-2])

HSP 1 Score: 57.3806 bits (137), Expect = 7.025e-9
Identity = 48/213 (22.54%), Postives = 105/213 (49.30%), Query Frame = 2
Query:  437 SPFAVKIETYLKLKNIPYK-SIRTIKQWSSKS-QIPFIEWNGQQIADSNFILDFLVDKFQT-QDNISDFEKGLSRAVEMMLDNQTVWSYFYYRYVEK-ASDFINSWTFTTPFRRKIIGFF-FPRGFKNRSYHHGIGRHSPS--EIYEIGKKDLMAISNILGDRKFLLGDKMTTVDCYIFGHLCQILYIPSVNYPHIEFLKTDCKNLVEFTHRI 1054
            S  ++ ++T+L++  +P + S R   ++ S S ++PFI+   Q +++   I+ F   K  +  D + D ++   +A   +++N  + +  Y ++ +   +  I+   +++P+   +     + + ++ R   + IG    S  ++YE   +   A+S  LG + +    + T +D  +FGHL  IL     +   +E +K+   NL+ F HRI
Sbjct:   38 SASSLAVQTFLRMCGLPVQVSCRANAEYMSPSGKVPFIQVGNQVVSELGPIVQFTKAKGHSLSDGLDDVQRAEMKAYMELVNNMLLTAELYIQWCDDFTATEISRPRYSSPYSWPLNHILAYQKQWEVRRKMNAIGWSGKSLEQVYEDVSQCCQALSQRLGTQPYFFNKQPTELDALVFGHLFTILTTQLTSDELVEKVKS-YSNLLSFCHRI 249          
BLAST of Failed axon connections homolog vs. Ensembl Xenopus
Match: lzts1 (leucine zipper, putative tumor suppressor 1 [Source:Xenbase;Acc:XB-GENE-960311])

HSP 1 Score: 141.739 bits (356), Expect = 1.247e-37
Identity = 81/240 (33.75%), Postives = 134/240 (55.83%), Query Frame = 2
Query:  383 KDIVYLFQFPSSRN-ISCISPFAVKIETYLKLKNIPYKSIRTIKQWSSKSQIPFIEWNGQQIADSNFILDFLVDKFQTQDN--ISDFEKGLSRAVEMMLDNQTVWSYFYYRYVEKASDFINSWTFTTPFRR--KIIGFFFPRGFKNRS-YHHGIGRHSPSEIYEIGKKDLMAISNILGDRKFLLGDKMTTVDCYIFGHLCQILYIPSVNYPHIEFLKTDCKNLVEFTHRIIDKLWPEWNE 1084
            KD + L QF    N +  +SPF +KIETYL++ ++PY++    K  S + ++P+IE+N  +++ + FI+DFL +K     N  ++  ++ +SRAV  M++    W+  Y ++VE   +       T P     K I     +G   R  Y  GIGR S  EIY + +KD+ +++ +LGD+K+L+G K +T+D  +FGHL Q ++      P    +K +  NL  +  RI  K WPEW++
Sbjct:   96 KDAIILHQFSRPNNGVPSLSPFCLKIETYLRMADLPYQNYFDGKL-SPQGKMPWIEYNHTRVSGTEFIIDFLEEKLGVNLNKHLNPHQRAVSRAVTKMVEEHFYWTLAYCQWVENLDETQKLLNITGPLSDLLKWILCHLTKGIVKREMYGQGIGRFSEEEIYRLMEKDMRSLAGLLGDKKYLMGPKFSTLDATVFGHLAQAMWTLPGTRPE-RLIKGELINLAMYCERIRRKFWPEWHD 333          
BLAST of Failed axon connections homolog vs. Ensembl Mouse
Match: Faxc (failed axon connections homolog [Source:MGI Symbol;Acc:MGI:1923382])

HSP 1 Score: 143.665 bits (361), Expect = 2.479e-38
Identity = 79/241 (32.78%), Postives = 140/241 (58.09%), Query Frame = 2
Query:  383 KDIVYLFQFPSSRN-ISCISPFAVKIETYLKLKNIPYKSIRTIKQWSSKSQIPFIEWNGQQIADSNFILDFLVDKFQTQDN--ISDFEKGLSRAVEMMLDNQTVWSYFYYRYVEKASDF--INSWTFTTPFRRKI--IGFFFPRGFKNRSYH-HGIGRHSPSEIYEIGKKDLMAISNILGDRKFLLGDKMTTVDCYIFGHLCQILYIPSVNYPHIEFLKTDCKNLVEFTHRIIDKLWPEWN 1081
            KD + L QF    N +  +SPF +K+ETYL++ ++PY++    K  S++ ++P+IE+N ++++ + FI+DFL +K     N  +   E+ +SRAV  M++    W+  Y ++V+  ++   + S +   PF   +  +     +G   R  H HGIGR S  EIY + +KD+ +++ +LGD+K+++G K++T+D  +FGHL Q ++      P    +K +  NL  +  RI  K WPEW+
Sbjct:   97 KDAIILHQFARPNNGVPSLSPFCLKMETYLRMADLPYQNYFGGKL-SAQGKMPWIEYNNEKVSGTEFIIDFLEEKLGVNLNKSLGPHERAVSRAVTKMVEEHFYWTLAYCQWVDNLNETRKMLSLSGGGPFSNLLRWVVCHITKGIVKREMHGHGIGRFSEEEIYMLMEKDMRSLAGLLGDKKYIMGPKLSTLDATVFGHLAQAMWTLPGTRPE-RLIKGELINLAMYCERIRRKFWPEWH 335          
BLAST of Failed axon connections homolog vs. UniProt/SwissProt
Match: sp|D3ZAT9|FAXC_RAT (Failed axon connections homolog OS=Rattus norvegicus OX=10116 GN=Faxc PE=3 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 7.188e-38
Identity = 79/241 (32.78%), Postives = 140/241 (58.09%), Query Frame = 2
Query:  383 KDIVYLFQFPSSRN-ISCISPFAVKIETYLKLKNIPYKSIRTIKQWSSKSQIPFIEWNGQQIADSNFILDFLVDKFQTQ--DNISDFEKGLSRAVEMMLDNQTVWSYFYYRYVEKASDF--INSWTFTTPFRRKI--IGFFFPRGFKNRSYH-HGIGRHSPSEIYEIGKKDLMAISNILGDRKFLLGDKMTTVDCYIFGHLCQILYIPSVNYPHIEFLKTDCKNLVEFTHRIIDKLWPEWN 1081
            KD + L QF    N +  +SPF +K+ETYL++ ++PY++    K  S++ ++P+IE+N ++++ + FI+DFL +K       N+   E+ +SRAV  M++    W+  Y ++V+  ++   + S +   PF   +  +     +G   R  H HGIGR S  EIY + +KD+ +++ +LGD+K+++G K++T+D  +FGHL Q ++      P    +K +  NL  +  RI  K WPEW+
Sbjct:   97 KDAIILHQFARPNNGVPSLSPFCLKMETYLRMADLPYQNYFGGKL-SAQGKMPWIEYNNEKVSGTEFIIDFLEEKLGVNLNKNLGPHERAVSRAVTKMVEEHFYWTLAYCQWVDNLNETRKMLSLSGGGPFSNLLRWVVCHITKGIVKREMHGHGIGRFSEEEIYMLMEKDMRSLAGLLGDKKYIMGPKLSTLDATVFGHLAQAMWTLPGTRPE-RLIKGELINLAMYCERIRRKFWPEWH 335          
BLAST of Failed axon connections homolog vs. UniProt/SwissProt
Match: sp|Q5TGI0|FAXC_HUMAN (Failed axon connections homolog OS=Homo sapiens OX=9606 GN=FAXC PE=2 SV=2)

HSP 1 Score: 144.05 bits (362), Expect = 1.117e-37
Identity = 79/241 (32.78%), Postives = 140/241 (58.09%), Query Frame = 2
Query:  383 KDIVYLFQFPSSRN-ISCISPFAVKIETYLKLKNIPYKSIRTIKQWSSKSQIPFIEWNGQQIADSNFILDFLVDKFQTQ--DNISDFEKGLSRAVEMMLDNQTVWSYFYYRYVEKASDF--INSWTFTTPFRRKI--IGFFFPRGFKNRSYH-HGIGRHSPSEIYEIGKKDLMAISNILGDRKFLLGDKMTTVDCYIFGHLCQILYIPSVNYPHIEFLKTDCKNLVEFTHRIIDKLWPEWN 1081
            KD + L QF    N +  +SPF +K+ETYL++ ++PY++    K  S++ ++P+IE+N ++++ + FI+DFL +K       N+   E+ +SRAV  M++    W+  Y ++V+  ++   + S +   PF   +  +     +G   R  H HGIGR S  EIY + +KD+ +++ +LGD+K+++G K++T+D  +FGHL Q ++      P    +K +  NL  +  RI  K WPEW+
Sbjct:   97 KDAIILHQFARPNNGVPSLSPFCLKMETYLRMADLPYQNYFGGKL-SAQGKMPWIEYNHEKVSGTEFIIDFLEEKLGVNLNKNLGPHERAISRAVTKMVEEHFYWTLAYCQWVDNLNETRKMLSLSGGGPFSNLLRWVVCHITKGIVKREMHGHGIGRFSEEEIYMLMEKDMRSLAGLLGDKKYIMGPKLSTLDATVFGHLAQAMWTLPGTRPE-RLIKGELINLAMYCERIRRKFWPEWH 335          
BLAST of Failed axon connections homolog vs. UniProt/SwissProt
Match: sp|Q3UMF9|FAXC_MOUSE (Failed axon connections homolog OS=Mus musculus OX=10090 GN=Faxc PE=2 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 1.734e-37
Identity = 79/241 (32.78%), Postives = 140/241 (58.09%), Query Frame = 2
Query:  383 KDIVYLFQFPSSRN-ISCISPFAVKIETYLKLKNIPYKSIRTIKQWSSKSQIPFIEWNGQQIADSNFILDFLVDKFQTQDN--ISDFEKGLSRAVEMMLDNQTVWSYFYYRYVEKASDF--INSWTFTTPFRRKI--IGFFFPRGFKNRSYH-HGIGRHSPSEIYEIGKKDLMAISNILGDRKFLLGDKMTTVDCYIFGHLCQILYIPSVNYPHIEFLKTDCKNLVEFTHRIIDKLWPEWN 1081
            KD + L QF    N +  +SPF +K+ETYL++ ++PY++    K  S++ ++P+IE+N ++++ + FI+DFL +K     N  +   E+ +SRAV  M++    W+  Y ++V+  ++   + S +   PF   +  +     +G   R  H HGIGR S  EIY + +KD+ +++ +LGD+K+++G K++T+D  +FGHL Q ++      P    +K +  NL  +  RI  K WPEW+
Sbjct:   97 KDAIILHQFARPNNGVPSLSPFCLKMETYLRMADLPYQNYFGGKL-SAQGKMPWIEYNNEKVSGTEFIIDFLEEKLGVNLNKSLGPHERAVSRAVTKMVEEHFYWTLAYCQWVDNLNETRKMLSLSGGGPFSNLLRWVVCHITKGIVKREMHGHGIGRFSEEEIYMLMEKDMRSLAGLLGDKKYIMGPKLSTLDATVFGHLAQAMWTLPGTRPE-RLIKGELINLAMYCERIRRKFWPEWH 335          
BLAST of Failed axon connections homolog vs. UniProt/SwissProt
Match: sp|Q95RI5|FAXC_DROME (Failed axon connections OS=Drosophila melanogaster OX=7227 GN=fax PE=1 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 2.351e-37
Identity = 86/254 (33.86%), Postives = 135/254 (53.15%), Query Frame = 2
Query:  374 NFEKDIVYLFQFPSSRNISCISPFAVKIETYLKLKNIPYKSI-RTIKQWSSKSQIPFIEWNGQQIADSNFILDFLVDKFQT--QDNISDFEKGLSRAVEMMLDNQTVWSYFYYRY-----VEKASDFINSWTFTTPFRRKIIGFFFPRGFKNRSYH-------HGIGRHSPSEIYEIGKKDLMAISNILGDRKFLLGDKMTTVDCYIFGHLCQILYIP-SVNYPHIEFLKTDCKNLVEFTHRIIDKLWPEWNEF 1087
            NFEKDI+YL+QF  +  +  +SP+ +K+ET+L+L  + Y+++   ++  S K Q+PFIE NG++IADS  I+  L  K++      ++  ++ +S A   ML+N  +W  FY+R      V K                 I+ FFF   F  + +        HGIG HS  EI E GK DL  +S +L  + F  GD+ TT+D   F  L Q+ Y+   + YP  +++   C NL+    R+ DK +P+W+E 
Sbjct:  100 NFEKDIIYLYQFSRTPLLPSLSPYCLKVETWLRLVGLKYENVDHKMRFRSKKGQLPFIELNGEEIADSAIIIKELSSKYEKYLDSGLTAEQRNVSYATIAMLENHLIWIIFYWRAKYPDNVLKGYKVNLQHALGLRLPNSILNFFFKITFGRKWFQGTKKLKAHGIGVHSAEEIEEFGKDDLKVLSEMLDCKPFFFGDEPTTLDVVAFAVLSQLHYLSKDIAYPLRDYMTEKCPNLIGHVSRMKDKCFPDWDEI 353          
BLAST of Failed axon connections homolog vs. UniProt/SwissProt
Match: sp|F7E235|FAXC_XENTR (Failed axon connections homolog OS=Xenopus tropicalis OX=8364 GN=faxc PE=3 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 1.236e-35
Identity = 80/240 (33.33%), Postives = 133/240 (55.42%), Query Frame = 2
Query:  383 KDIVYLFQFPSSRN-ISCISPFAVKIETYLKLKNIPYKSIRTIKQWSSKSQIPFIEWNGQQIADSNFILDFLVDKFQTQDN--ISDFEKGLSRAVEMMLDNQTVWSYFYYRYVEKASDFINSWTFTTPFRR--KIIGFFFPRGFKNRS-YHHGIGRHSPSEIYEIGKKDLMAISNILGDRKFLLGDKMTTVDCYIFGHLCQILYIPSVNYPHIEFLKTDCKNLVEFTHRIIDKLWPEWNE 1084
            KD + L QF    N +  +SPF +KIETYL++ ++PY++    K  S + ++P+IE+N  +++ + FI+DFL +K     N  ++  ++ +SRAV  M++    W+  Y ++VE   +       T P     K I     +G   R  Y  GIGR S  EIY + +KD+ +++ +LGD+K+L+G K +T+D  +FGH+   L+     Y   E +  +  NL  +  RI  K WPEW++
Sbjct:   96 KDAIILHQFSRPNNGVPSLSPFCLKIETYLRMADLPYQNYFDGKL-SPQGKMPWIEYNHTRVSGTEFIIDFLEEKLGVNLNKHLNPHQRAVSRAVTKMVEEHFYWTLAYCQWVENLDETQKMLNITGPLSDLLKWILCHLTKGIVKREMYGQGIGRFSEEEIYRLMEKDMRSLAGLLGDKKYLMGPKFSTLDATVFGHIANALWGTQGTYKE-EGIAGELINLAMYCERIRRKFWPEWHD 333          
BLAST of Failed axon connections homolog vs. TrEMBL
Match: A0A267H272 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003243g1 PE=4 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 3.376e-86
Identity = 121/241 (50.21%), Postives = 175/241 (72.61%), Query Frame = 2
Query:  368 IQNFEKDIVYLFQFPSSRNISCISPFAVKIETYLKLKNIPYKSIRTIKQWSSKSQIPFIEWNGQQIADSNFILDFLVDKFQTQDNISDFEKGLSRAVEMMLDNQTVWSYFYYRYVEKASDFINSWTFTTPFRRKIIGFFFPRGFKNRSYHHGIGRHSPSEIYEIGKKDLMAISNILGDRKFLLGDKMTTVDCYIFGHLCQILYIPSVNYPHIEFLKTDCKNLVEFTHRIIDKLWPEWNEFS 1090
            + N+EKD VY+F FPS R I  +SPF +K+ET+L+L  IP+   R I  WS K QIPF+E NGQ+  +SN I+  L + F  +DN++D ++GL+R +EMML+NQTV+SYFYYRYVE   +FIN+W F     R+ + F FPRG+  + ++HGIGR+S +E+Y++G +D+MA+S  LG+++FL GD+ TT DCY FGHL QILYIP +NYPH +F++    NL E+  R+ ++ WP+W++ S
Sbjct:   43 VANYEKDKVYMFNFPSCRTIVSVSPFGLKLETWLRLHKIPHTVTRKIMVWSQKGQIPFVELNGQEYNESNLIIAKLTEHFGVKDNLTDEQEGLARGLEMMLENQTVYSYFYYRYVEDVVNFINTWEFCGYLLRQFLYFTFPRGYGKKVFYHGIGRNSVAEMYDMGFQDIMALSRALGNKQFLFGDEPTTADCYAFGHLAQILYIP-INYPHKKFMRESTPNLCEYVDRMKERFWPDWDKLS 282          
BLAST of Failed axon connections homolog vs. TrEMBL
Match: A0A267DTX1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023210g2 PE=4 SV=1)

HSP 1 Score: 267.314 bits (682), Expect = 6.757e-84
Identity = 121/240 (50.42%), Postives = 170/240 (70.83%), Query Frame = 2
Query:  368 IQNFEKDIVYLFQFPSSRNISCISPFAVKIETYLKLKNIPYKSIRTIKQWSSKSQIPFIEWNGQQIADSNFILDFLVDKFQTQDNISDFEKGLSRAVEMMLDNQTVWSYFYYRYVEKASDFINSWTFTTPFRRKIIGFFFPRGFKNRSYHHGIGRHSPSEIYEIGKKDLMAISNILGDRKFLLGDKMTTVDCYIFGHLCQILYIPSVNYPHIEFLKTDCKNLVEFTHRIIDKLWPEWNEF 1087
            + N+EK++VYLF FPS R I  ISPF +K+ET+L++  I Y +IR    WS K QIPF+E NGQ+  +SN I+  L   F   D +S+ E+GL+R +EMML+NQTV+SYFYYRYVE A +F+ +W F+    R ++  FFP GF++R  HHGIGR++  EIY +G +D+ A+S +LG +KFL G++MT  DCY FGHL QILY+P V+YPH +F++    NL E+  RI + LWP+W++ 
Sbjct:   42 VANYEKNMVYLFNFPSCRTIVSISPFGLKLETWLRMHQIRYTAIRKTYVWSRKGQIPFVELNGQEYNESNLIIAELQKYFGVDDGLSEQEQGLARGLEMMLENQTVFSYFYYRYVEAAREFVQTWEFSGFLLRWVLYRFFPPGFRHRLKHHGIGRNTVPEIYSMGFEDIRALSRVLGSKKFLFGERMTAADCYAFGHLAQILYVP-VDYPHKQFMREQTPNLCEYVTRIKETLWPDWDQL 280          
BLAST of Failed axon connections homolog vs. TrEMBL
Match: A0A267H7P6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig002469g1 PE=4 SV=1)

HSP 1 Score: 267.314 bits (682), Expect = 7.779e-84
Identity = 121/240 (50.42%), Postives = 170/240 (70.83%), Query Frame = 2
Query:  368 IQNFEKDIVYLFQFPSSRNISCISPFAVKIETYLKLKNIPYKSIRTIKQWSSKSQIPFIEWNGQQIADSNFILDFLVDKFQTQDNISDFEKGLSRAVEMMLDNQTVWSYFYYRYVEKASDFINSWTFTTPFRRKIIGFFFPRGFKNRSYHHGIGRHSPSEIYEIGKKDLMAISNILGDRKFLLGDKMTTVDCYIFGHLCQILYIPSVNYPHIEFLKTDCKNLVEFTHRIIDKLWPEWNEF 1087
            + N+EK++VYLF FPS R I  ISPF +K+ET+L++  I Y +IR    WS K QIPF+E  GQ+  +SN I+  L   F   D +S+ E+GL+R +EMML+NQTV+SYFYYRYVE A +F+ +W F+    R ++  FFP GF++R  HHGIGR++  EIY +G +D+ A+S +LG +KFL G++MTT DCY FGHL QILY+P V+YPH +F++    NL E+  RI + LWP+W++ 
Sbjct:   42 VANYEKNMVYLFNFPSCRTIVSISPFGLKLETWLRMHQIRYTAIRKTYVWSRKGQIPFVELKGQEYNESNLIITELQKYFGVDDGLSEQEQGLARGLEMMLENQTVFSYFYYRYVEAAREFVQTWEFSGFLLRWVLYRFFPPGFRHRLKHHGIGRNTVPEIYSMGFEDIRALSRVLGSKKFLFGERMTTADCYAFGHLAQILYVP-VDYPHKQFMREQTPNLCEYVTRIKETLWPDWDQL 280          
BLAST of Failed axon connections homolog vs. TrEMBL
Match: A0A267FED8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023210g1 PE=4 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 1.573e-83
Identity = 121/240 (50.42%), Postives = 169/240 (70.42%), Query Frame = 2
Query:  368 IQNFEKDIVYLFQFPSSRNISCISPFAVKIETYLKLKNIPYKSIRTIKQWSSKSQIPFIEWNGQQIADSNFILDFLVDKFQTQDNISDFEKGLSRAVEMMLDNQTVWSYFYYRYVEKASDFINSWTFTTPFRRKIIGFFFPRGFKNRSYHHGIGRHSPSEIYEIGKKDLMAISNILGDRKFLLGDKMTTVDCYIFGHLCQILYIPSVNYPHIEFLKTDCKNLVEFTHRIIDKLWPEWNEF 1087
            + N+EK++VYLF FPS R I  ISPF +K+ET+L++  I Y +IR    WS K QIPF+E NGQ+   SN I+  L   F   D +S+ E+GL+R +EMML+NQTV+SYFYYRYVE A +F+ +W F+    R ++  FFP GF++R  HHGIGR++  EIY +G +D+ A+S +LG +KFL G++MT  DCY FGHL QILY+P V+YPH +F++    NL E+  RI + LWP+W++ 
Sbjct:   42 VANYEKNMVYLFNFPSCRTIVSISPFGLKLETWLRMHQIRYTAIRKTYVWSRKGQIPFVELNGQEYNASNLIIAELQKYFGVDDGLSEQEQGLARGLEMMLENQTVFSYFYYRYVEAAREFVQTWEFSGFLLRWVLYRFFPPGFRHRLKHHGIGRNTVPEIYSMGFEDIRALSRVLGSKKFLFGERMTAADCYAFGHLAQILYVP-VDYPHKQFMREQTPNLCEYVTRIKETLWPDWDQL 280          
BLAST of Failed axon connections homolog vs. TrEMBL
Match: A0A267H408 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003243g2 PE=4 SV=1)

HSP 1 Score: 260.766 bits (665), Expect = 5.145e-82
Identity = 115/231 (49.78%), Postives = 167/231 (72.29%), Query Frame = 2
Query:  398 LFQFPSSRNISCISPFAVKIETYLKLKNIPYKSIRTIKQWSSKSQIPFIEWNGQQIADSNFILDFLVDKFQTQDNISDFEKGLSRAVEMMLDNQTVWSYFYYRYVEKASDFINSWTFTTPFRRKIIGFFFPRGFKNRSYHHGIGRHSPSEIYEIGKKDLMAISNILGDRKFLLGDKMTTVDCYIFGHLCQILYIPSVNYPHIEFLKTDCKNLVEFTHRIIDKLWPEWNEFS 1090
            +F FPS R I  +SPF +K+ET+L+L  IP+   R I  WS K QIPF+E NGQ+  +SN I+  L + F  +DN++D ++GL+R +EMML+NQTV+SYFYYRYVE   +FIN+W F     R+ + F FPRG+  + ++HGIGR+S +E+Y++G +D+MA+S  LG+++FL GD+ TT DCY FGHL QILYIP +NYPH +F++    NL E+  R+ ++ WP+W++ S
Sbjct:    1 MFNFPSCRTIVSVSPFGLKLETWLRLHKIPHTVTRKIMVWSQKGQIPFVELNGQEYNESNLIIAKLTEHFGVKDNLTDEQEGLARGLEMMLENQTVYSYFYYRYVEDVVNFINTWEFCGYLLRQFLYFTFPRGYGKKVFYHGIGRNSVAEMYDMGFQDIMALSRALGNKQFLFGDEPTTADCYAFGHLAQILYIP-INYPHKKFMRESTPNLCEYVDRMKERFWPDWDKLS 230          
BLAST of Failed axon connections homolog vs. Ensembl Cavefish
Match: faxcb (failed axon connections homolog, metaxin like GST domain containing [Source:NCBI gene;Acc:103032984])

HSP 1 Score: 131.724 bits (330), Expect = 4.545e-34
Identity = 74/238 (31.09%), Postives = 129/238 (54.20%), Query Frame = 2
Query:  383 KDIVYLFQFPSSRN-ISCISPFAVKIETYLKLKNIPYKSIRTIKQWSSKSQIPFIEWNGQQIADSNFILDFLVDKFQTQDN--ISDFEKGLSRAVEMMLDNQTVWSYFYYRYVEKASDFINSWTFTTPFRRKI---IGFFFPRGFKNRSYHHGIGRHSPSEIYEIGKKDLMAISNILGDRKFLLGDKMTTVDCYIFGHLCQILYIPSVNYPHIEFLKTDCKNLVEFTHRIIDKLWPEW 1078
            KD + L QF   +N +  +SPF +K+ETYL++ ++PY++       S +S +P+IE+N + ++ + FI+DFL +K     N  +S  E  ++RA+  M++    W+  Y ++VE             P    +   +        K   +  GIGR S  EIY + ++D+  ++ +LGD+K+L+G K+++VD  +FGHL Q ++    + P  + +K +  NL  +  RI  K WPEW
Sbjct:   96 KDAIILHQFTRPKNGVPSLSPFCLKMETYLRMVDLPYQNYFD-GSLSPQSTMPWIEYNHECVSGTEFIIDFLEEKLGVSLNKKLSGPELAVARAITKMVEEHLYWAIVYCQWVENVEQTEKMLEVPGPLSDVLKWTLCQLNGGLVKREMFCQGIGRFSRDEIYTLMERDMRTLATLLGDKKYLMGSKVSSVDAAVFGHLAQAMWTLPGSRPE-QLIKGELINLAMYCERIRRKFWPEW 331          
BLAST of Failed axon connections homolog vs. Ensembl Cavefish
Match: mtx2 (metaxin 2 [Source:NCBI gene;Acc:103041144])

HSP 1 Score: 55.8398 bits (133), Expect = 2.012e-8
Identity = 52/215 (24.19%), Postives = 102/215 (47.44%), Query Frame = 2
Query:  431 CISPFAVKIETYLKLKNIPYK-SIRTIKQWSSKS-QIPFIEWNGQQIADSNFILDFLVDKFQT-QDNISDFEKGLSRAVEMMLDNQTVWSYFYYRYVE-KASDFINSWTFTTPFRRKIIGFF-FPRGFKNRSYHHGIGRHSPS--EIYEIGKKDLMAISNILGDRKFLLGDKMTTVDCYIFGHLCQILYIPSVNYPHIEFLKTDCKNLVEFTHRI 1054
            C S  AV  + YL++ N+P + S R   ++ S S ++PFI    Q +++   I+ F   K  +  D + D ++   +A   +++N  + +  Y ++ +   S  I+   +++P+   +     + + ++ R   + IG    S  ++YE   +   A+S  LG + +    + T +D  +FGHL  IL     +    E +K+   NL+ F  RI
Sbjct:   38 CASSLAV--QAYLRMCNLPVRVSCRANAEYMSPSGKVPFIHVGNQVVSELGPIVQFTKAKGHSLSDGLDDVQRAEMKAYMELVNNMLLTAELYIQWCDDTTSSEISRPRYSSPYSWPLNHILAYQKQWEVRRKMNAIGWAGKSLEQVYEDVSQCCQALSQRLGTQPYFFNKQPTELDALVFGHLFTILTTRLTSDELSEKIKS-YSNLLSFCRRI 249          
BLAST of Failed axon connections homolog vs. Ensembl Cavefish
Match: mtx1b (metaxin-1-like [Source:NCBI gene;Acc:103026555])

HSP 1 Score: 51.2174 bits (121), Expect = 7.877e-7
Identity = 52/231 (22.51%), Postives = 98/231 (42.42%), Query Frame = 2
Query:  416 SRNISCISPFAVKIETYLKLKNIPYKSIRTIKQWSSKSQI-PFIEW--NGQQIADSNFILDFLVDKFQTQDNISDFEKGLSRAVEMMLDNQTVWSYFYYRYVEKASDFINS----WTFTTPFRRKIIGFFFPRGFKNRSYHH-GIGRHSPS---------EIYEIGKKDLMAISNILGDRKFLLGDKMTTVDCYIFGHLCQILYIPSVNYPHIEFLKTDCKNLVEFTHRII 1057
            S ++ C++  A     Y K    P K  +    W S + I P ++    G     S  I+     K+    ++S  E   + A   +L+ + + +  Y ++V+ A +++++    +    PF    + F  P     R      + R  P+         E+Y+   + +  +S  LG  KF  GD  +++D Y+FGHL  IL I   N    + + +  +NL +F + I+
Sbjct:   18 SVDVDCLTVLA-----YAKFAGAPLKVHKITNPWRSPTGILPALKTREEGSFSQPSKIIIQLRKQKYNADYDLSAKEGADTLAFVSLLEEKLLPALIYTQWVD-AKNYVDATRRWYAENIPFP---LNFLLPNRMHGRQLERLRLVRGDPALEPGEQLEKELYQDALECMTLLSQRLGSHKFFFGDSPSSLDAYVFGHLAPILKIKLPNNKLQQHINS-LENLRQFCNNIL 238          
BLAST of Failed axon connections homolog vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001951.1 (pep scaffold:Pmarinus_7.0:GL488653:1066:6687:1 gene:ENSPMAG00000001773.1 transcript:ENSPMAT00000001951.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.4622 bits (145), Expect = 1.456e-11
Identity = 30/91 (32.97%), Postives = 50/91 (54.95%), Query Frame = 2
Query:  818 HGIG-RHSPSEIYEIGKKDLMAISNIL---GDRKFLLGDKMTTVDCYIFGHLCQILYIPSVNYPHIEFLKTDCKNLVEFTHRIIDKLWPEW 1078
            HG+     P E +   + D+ A++NIL   G ++++LGD+    D  +F HL   L++   + PH + L  +  +LV F HR+  + WPEW
Sbjct:   42 HGLAWAACPQEAHRAIESDIRAVANILAFPGTKRYMLGDRPGATDACVFAHLSIALWLLPGSRPH-QLLTEELPSLVAFCHRMRKRYWPEW 131          
BLAST of Failed axon connections homolog vs. Ensembl Nematostella
Match: EDO42696 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0L9])

HSP 1 Score: 159.073 bits (401), Expect = 1.859e-46
Identity = 91/225 (40.44%), Postives = 134/225 (59.56%), Query Frame = 2
Query:  425 ISCISPFAVKIETYLKLKNIPYKSIRTIKQWSSKSQIPFIEWNGQQIADSNFILDFLVDKF--QTQDNISDFEKGLSRAVEMMLDNQTVWSYFYYRYVEK--ASDFINSWTFTTP-FRRKIIGFFFPRGFKNRSYHHGIGRHSPSEIYEIGKKDLMAISNILGDRKFLLGDKMTTVDCYIFGHLCQILYIPSVNYPHIEFLKTDCKNLVEFTHRIIDKLWPEWNE 1084
            +  ISPF +K+E+YL+L  IPYK+  +    SSK +IP+IE+NGQ +ADSNF ++FL  +F       +S  ++ ++R + +MLD  T W+  Y+R++EK  AS  ++      P + R  I              HGIGRHS  EIY I  KDL A+S ILGD+ FL+G+K T VD   FG L  IL+   VN P  + ++T+  N+VE+  R+   +WP+W+E
Sbjct:    1 VPSISPFPLKLESYLRLAKIPYKNYFSSTS-SSKGKIPWIEYNGQCVADSNFCVEFLNKEFGVDLDAKLSAKDRAVARTLAVMLDENTYWTMVYFRWIEKNNASKSVDIMFPNVPEWVRTNIARVAKWRVNQYLDGHGIGRHSRDEIYFIALKDLSAVSEILGDKAFLMGNKPTLVDTVAFGLLAVILW-HDVNSPQSQLMRTELTNIVEYCERMKALIWPDWDE 223          
BLAST of Failed axon connections homolog vs. Ensembl Nematostella
Match: EDO34760 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNC8])

HSP 1 Score: 144.05 bits (362), Expect = 2.363e-40
Identity = 78/242 (32.23%), Postives = 138/242 (57.02%), Query Frame = 2
Query:  380 EKDIVYLFQFPSSRNISC--ISPFAVKIETYLKLKNIPYKSIRTIKQWSSKSQIPFIEWNGQQIADSNFILDFLVDKFQTQ--DNISDFEKGLSRAVEMMLDNQTVWSYFYYRY-VEKASDFINSWTFTTPFRRKIIGFF-FPRGFKNRSYHHGIGRHSPSEIYEIGKKDLMAISNILGDRKFLLGDKMTTVDCYIFGHLCQILYIPSVNYPHIEFLKTDCKNLVEFTHRIIDKLWPEWNEF 1087
            +++ V L QFP +  +    ISP  +K+ET++++  IPY  + T  + SSK + P+IE  G+ +ADS F +++L  +F     + +S+ +K ++ A  +ML+  T W++ ++R+    A  F ++   + P   + +GF+ F R        HGIGRH+  EIY +G++DL A+S  LG +KFLLGDK    D  IFG +  IL+  +   P  + ++    NL+    R+ ++ +P+W++ 
Sbjct:    6 DQNPVILHQFPRNPRLPVPNISPPCLKLETWMRMAKIPY-DVNTAFKKSSKGKFPWIEHKGKHVADSQFCIEYLTREFGVDLDEGLSEADKAVATAFRVMLEENTFWTFLHFRFFSPNAPTFRDNMLHSFPALMRHLGFWKFKRTVGGNMNGHGIGRHTEDEIYNLGERDLAALSGFLGSKKFLLGDKPCVTDAAIFGLVANILWT-AQGSPQEKAIRDKMPNLLAHAQRMKEEFYPDWDQL 245          
BLAST of Failed axon connections homolog vs. Ensembl Nematostella
Match: EDO43101 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZI7])

HSP 1 Score: 135.576 bits (340), Expect = 1.159e-37
Identity = 74/235 (31.49%), Postives = 128/235 (54.47%), Query Frame = 2
Query:  392 VYLFQFPSSRNISCISPFAVKIETYLKLKNIPYKSIRTIKQWSSKSQIPFIEWNGQQIADSNFILDFLVDKFQTQDN--ISDFEKGLSRAVEMMLDNQTVWSYFYYRYVEKASDFINSWTFTTPFRRKIIGFFFPRGFKNRS----YHHGIGRHSPSEIYEIGKKDLMAISNILGDRKFLLGDKMTTVDCYIFGHLCQILYIPSVNYPHIEFLKTDCKNLVEFTHRIIDKLWPEW 1078
            V L Q P    I    P ++K+ETYL++  IPY++    K  SSK ++PFIE+ G ++ D+NF + +L  KF    +  +S  +K +  A++ M +  T WS  YYR+V+   +    ++   P  + +     P+  +N+       HGIG+H+  EIY I ++DL A+S +LG+++F +  +  T+DC +FG L   +Y  +   P  + ++ + KNL +F  R+    W +W
Sbjct:    1 VILHQHPPGPTIPGFLPNSLKLETYLRMVKIPYENFYESKLGSSKEKVPFIEYQGDKVQDTNFCIKYLNKKFNVDPDAHLSAEQKAMCHAIQAMAEENTYWSLAYYRWVDNYQETKKYYSNLAPVYKDL----RPKLDQNKCIKCMQAHGIGKHTKEEIYAIAEEDLRAMSALLGEKEFFMDSEPCTLDCTMFGLLACFVY-GTEESPQNKLIREELKNLADFCDRMKLNYWLDW 230          
BLAST of Failed axon connections homolog vs. Ensembl Nematostella
Match: EDO43910 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RX64])

HSP 1 Score: 128.642 bits (322), Expect = 8.427e-35
Identity = 73/233 (31.33%), Postives = 131/233 (56.22%), Query Frame = 2
Query:  410 PSSRNISCISPFAVKIETYLKLKNIPYKSIRTIKQW--SSKSQIPFIEWNGQQIADSNFILDFLVDKF--QTQDNISDFEKGLSRAVEMMLDNQTVWSYFYYRYVEKASDFINSWTFT---TPFRRKIIGFFFPRGFKNRSYHHGIGRHSPSEIYEIGKKDLMAISNILGDRKFLLGDKMTTVDCYIFGHL-CQILYIPSVNYPHIEFLKTDCKNLVEFTHRIIDKLWPEWNE 1084
            P+SR+I+  SPF +K+ET+L++  IPYK   T+  W  SSK ++P+IE+ G+ IADSNF +DFL  +F     ++++  +K ++RAV + L+  T W+  +Y +    ++ +    F+   +P R  ++ +      +     HG+GRH+  EIY I ++DL  IS +LGD+K++ G++   +D  +F  + C I   P    P  + ++    NL+     +    +P+W +
Sbjct:   18 PTSRSIN-PSPFCLKLETFLRMTKIPYK---TVYGWNPSSKGKLPWIEYQGKSIADSNFCVDFLNKEFFVDVDEHLTVEQKAVARAVMVTLEENTYWTLMHYVWCTDHANVVRDEAFSHLPSPIRH-VVFWRVQSACQGYLQAHGMGRHTEEEIYAIAERDLKGISALLGDQKYMFGERPCLLDAVVFAFVSCFIWECP--KSPQAKLIQDQLSNLIAHAQDMRQNYFPDWEK 243          
BLAST of Failed axon connections homolog vs. Ensembl Nematostella
Match: EDO46590 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPK9])

HSP 1 Score: 113.235 bits (282), Expect = 4.838e-29
Identity = 63/242 (26.03%), Postives = 127/242 (52.48%), Query Frame = 2
Query:  377 FEKDIVYLFQFP--SSRNISCISPFAVKIETYLKLKNIPYKSIRTIKQWSSKSQIPFIEWNGQQIADSNFILDFLVDKF--QTQDNISDFEKGLSRAVEMMLDNQTVWSYFYYRYVEK-ASDFINSWTFT-TPFRRKIIGFFFPRGFKNRSYHHGIGRHSPSEIYEIGKKDLMAISNILGDRKFLLGDKMTTVDCYIFGHLCQILYIPSVNYPHIEFLKTDCKNLVEFTHRIIDKLWPEWNE 1084
            F+   + L  FP  +   +  ISP  +K+ETY ++ NI Y  + T  +   K  +P +E++G+ +  S   + +L +++  +   ++S+ +K  +  +  MLD  T W+  Y+R+    A+ F ++  +    F +KI    F    + +    G+GRH+ +E+Y + ++DL A+S +LGD+ +L GD+    D  +FG +  +++    + P  + +  +  NL +   RI  + +P+W+E
Sbjct:    3 FDSKTLVLRIFPRFAKLPVPSISPSCLKLETYARMANIQYH-VNTACENIDKVNMPAVEYDGKVVVHSARCIPYLNERYGVELDRDLSEEQKATATTITAMLDEHTSWTLLYHRWCSDYATQFRDNLMYGFNSFFKKIAFCCFRCDTQKKLQAQGMGRHTEAEVYSLAERDLRAVSTLLGDKPYLFGDRPVEADASLFGIVANVIWTMQES-PQEKLISGELPNLADHAQRIKKEFYPDWDE 242          
BLAST of Failed axon connections homolog vs. Ensembl Medaka
Match: faxcb (failed axon connections homolog, metaxin like GST domain containing [Source:NCBI gene;Acc:101160937])

HSP 1 Score: 148.288 bits (373), Expect = 3.848e-40
Identity = 78/239 (32.64%), Postives = 137/239 (57.32%), Query Frame = 2
Query:  383 KDIVYLFQFPSSRN-ISCISPFAVKIETYLKLKNIPYKSIRTIKQWSSKSQIPFIEWNGQQIADSNFILDFLVDKFQTQ--DNISDFEKGLSRAVEMMLDNQTVWSYFYYRYVEKASDFINSWTFTTPFR---RKIIGFFFPRGFKNRSYHHGIGRHSPSEIYEIGKKDLMAISNILGDRKFLLGDKMTTVDCYIFGHLCQILY-IPSVNYPHIEFLKTDCKNLVEFTHRIIDKLWPEW 1078
            KD + L QF   +N +  +SPF +KIETYL++ ++PY++     + S + ++P+IE+N QQ++ S FI+DFL +K       N++  E+ +SRAV  M++    W+  Y ++V+   +     + + P     + ++        +   Y HGIGR S  E+Y + +KDL  ++ +LGD+K+ +G K++T+D  +FGHL Q ++ +P    P  + +K +  NL  F  R+  + WPEW
Sbjct:   95 KDAIILHQFSRPKNGVPSLSPFCLKIETYLRMADLPYQNYFD-GRLSPQGKMPWIEYNHQQVSGSEFIVDFLEEKLGVNLNKNLTPQERAVSRAVTKMVEEHLYWTIAYCQWVDNLEETQKLLSMSGPLSDTLKWLLSHLNCSMVRREMYGHGIGRFSKEEVYRLMEKDLRTLATLLGDKKYFMGSKISTLDATVFGHLAQAMWTLPGT--PPEQLIKGELINLAMFCERMRRRFWPEW 330          
BLAST of Failed axon connections homolog vs. Ensembl Medaka
Match: ENSORLT00000021183.2 (failed axon connections homolog [Source:NCBI gene;Acc:101168170])

HSP 1 Score: 138.272 bits (347), Expect = 1.413e-36
Identity = 76/238 (31.93%), Postives = 131/238 (55.04%), Query Frame = 2
Query:  383 KDIVYLFQFPSSR-NISCISPFAVKIETYLKLKNIPYKSIRTIKQWSSKSQIPFIEWNGQQIADSNFILDFLVDKFQTQDN--ISDFEKGLSRAVEMMLDNQTVWSYFYYRYVEKASDFINSWTFTTPFRRK---IIGFFFPRGFKNRSYHHGIGRHSPSEIYEIGKKDLMAISNILGDRKFLLGDKMTTVDCYIFGHLCQILYIPSVNYPHIEFLKTDCKNLVEFTHRIIDKLWPEW 1078
            KD + L QF   +     +SPF +K+ETYL++ ++PYK+     + S + ++P+IE+N QQ+  + FI+DFL ++     N  ++  EK +SRA+  ML+    W+  Y ++V+   +     + + P       I+        K   Y HGIGR S  E+Y + +KD+  ++ +LGD+K+L+G K++TVD  +F HL   ++    + P  + +K +  NL  +  RI  + WPEW
Sbjct:   95 KDAIILHQFSRPKCGAPSLSPFCLKLETYLRMVDLPYKN-SFDGRLSPQGKMPWIEYNHQQVFGTEFIIDFLDERLGVSLNKGLTPQEKAMSRAITKMLEEHFYWTIAYCQWVDNLEETQKMLSVSGPLSDLLTWILSHLNSGIVKREMYGHGIGRFSAEEVYTLMEKDMRTLATLLGDKKYLMGSKLSTVDATVFSHLAPAMWTLPGSRPE-QLIKGELINLAMYCERIRRRFWPEW 330          
BLAST of Failed axon connections homolog vs. Ensembl Medaka
Match: ENSORLT00000032142.1 (failed axon connections homolog [Source:NCBI gene;Acc:101168170])

HSP 1 Score: 137.887 bits (346), Expect = 2.133e-36
Identity = 76/238 (31.93%), Postives = 131/238 (55.04%), Query Frame = 2
Query:  383 KDIVYLFQFPSSR-NISCISPFAVKIETYLKLKNIPYKSIRTIKQWSSKSQIPFIEWNGQQIADSNFILDFLVDKFQTQDN--ISDFEKGLSRAVEMMLDNQTVWSYFYYRYVEKASDFINSWTFTTPFRRK---IIGFFFPRGFKNRSYHHGIGRHSPSEIYEIGKKDLMAISNILGDRKFLLGDKMTTVDCYIFGHLCQILYIPSVNYPHIEFLKTDCKNLVEFTHRIIDKLWPEW 1078
            KD + L QF   +     +SPF +K+ETYL++ ++PYK+     + S + ++P+IE+N QQ+  + FI+DFL ++     N  ++  EK +SRA+  ML+    W+  Y ++V+   +     + + P       I+        K   Y HGIGR S  E+Y + +KD+  ++ +LGD+K+L+G K++TVD  +F HL   ++    + P  + +K +  NL  +  RI  + WPEW
Sbjct:   95 KDAIILHQFSRPKCGAPSLSPFCLKLETYLRMVDLPYKN-SFDGRLSPQGKMPWIEYNHQQVFGTEFIIDFLDERLGVSLNKGLTPQEKAMSRAITKMLEEHFYWTIAYCQWVDNLEETQKMLSVSGPLSDLLTWILSHLNSGIVKREMYGHGIGRFSAEEVYTLMEKDMRTLATLLGDKKYLMGSKLSTVDATVFSHLAPAMWTLPGSRPE-QLIKGELINLAMYCERIRRRFWPEW 330          
BLAST of Failed axon connections homolog vs. Ensembl Medaka
Match: mtx1a (metaxin-1 [Source:NCBI gene;Acc:101163689])

HSP 1 Score: 50.447 bits (119), Expect = 1.291e-6
Identity = 54/236 (22.88%), Postives = 91/236 (38.56%), Query Frame = 2
Query:  398 LFQFPSSRNISCISPFAVKIETYLKLKNIPYKSIRTIKQWSSKS-QIPFIEWNGQQIAD--SNFILDFLVDKFQTQDNISDFEKGLSRAVEMMLDNQTVWSYFYYRYVEKAS--DFINSW-TFTTPFRRKIIGFFFPRGFKNRSYHH----------GIGRHSPSEIYEIGKKDLMAISNILGDRKFLLGDKMTTVDCYIFGHLCQILYIPSVNYPHIEFLKTDCKNLVEFTHRII 1057
            LF +     +  +S   + +  Y +    P K  +    W S S  +P    + ++     S+ I+     KF    ++S  E   S A   ++D +   +  Y  ++E  +  D    W     PF    + FF P   +++                G     E+Y    + L  +S  LG +KF  GD  +++D Y+FGHL  IL     N    + LK+   NL  F   I+
Sbjct:    7 LFCWEGDWGLPSVSTDCLVVLAYAQFAGAPLKVRKICNPWRSPSGSLPAFRTSQKETLSRTSDIIIHLRKQKFNADYDLSAKEGADSLAFISLMDEKLKPALIYTFWIEPKNYVDVTRRWFAEHMPFP---LNFFLPGRMQSQQLEKLRLLQGDERLEAGEELEKELYRDATECLNLLSQRLGSQKFFFGDSPSSLDAYVFGHLAPILRCKLPNGKLQQHLKS-LDNLANFCSNIL 238          
BLAST of Failed axon connections homolog vs. Planmine SMEST
Match: SMESG000039746.1 (SMESG000039746.1)

HSP 1 Score: 552.747 bits (1423), Expect = 0.000e+0
Identity = 266/267 (99.63%), Postives = 267/267 (100.00%), Query Frame = 2
Query:  311 GFGFIYYYVFHGKRRQKIFIQNFEKDIVYLFQFPSSRNISCISPFAVKIETYLKLKNIPYKSIRTIKQWSSKSQIPFIEWNGQQIADSNFILDFLVDKFQTQDNISDFEKGLSRAVEMMLDNQTVWSYFYYRYVEKASDFINSWTFTTPFRRKIIGFFFPRGFKNRSYHHGIGRHSPSEIYEIGKKDLMAISNILGDRKFLLGDKMTTVDCYIFGHLCQILYIPSVNYPHIEFLKTDCKNLVEFTHRIIDKLWPEWNEFSHIIPISQ 1111
            GFGFIYYYVFHGKRRQKIFIQNFEKDIVYLFQFPSSRNISCISPFAVKIETYLKLKNIPYKSIRTIKQWSSKSQIPFIEWNGQQIADSNFILDFLVDKFQTQDNISDFEKGLSRA+EMMLDNQTVWSYFYYRYVEKASDFINSWTFTTPFRRKIIGFFFPRGFKNRSYHHGIGRHSPSEIYEIGKKDLMAISNILGDRKFLLGDKMTTVDCYIFGHLCQILYIPSVNYPHIEFLKTDCKNLVEFTHRIIDKLWPEWNEFSHIIPISQ
Sbjct:   17 GFGFIYYYVFHGKRRQKIFIQNFEKDIVYLFQFPSSRNISCISPFAVKIETYLKLKNIPYKSIRTIKQWSSKSQIPFIEWNGQQIADSNFILDFLVDKFQTQDNISDFEKGLSRAIEMMLDNQTVWSYFYYRYVEKASDFINSWTFTTPFRRKIIGFFFPRGFKNRSYHHGIGRHSPSEIYEIGKKDLMAISNILGDRKFLLGDKMTTVDCYIFGHLCQILYIPSVNYPHIEFLKTDCKNLVEFTHRIIDKLWPEWNEFSHIIPISQ 283          
The following BLAST results are available for this feature:
BLAST of Failed axon connections homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
FAXC2.325e-3832.78failed axon connections homolog, metaxin like GST ... [more]
back to top
BLAST of Failed axon connections homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Y57A10A.261.364e-4434.48pep chromosome:WBcel235:II:12264166:12266033:1 gen... [more]
Y57A10A.261.364e-4434.48pep chromosome:WBcel235:II:12264192:12266105:1 gen... [more]
Y48C3A.36.982e-4233.45pep chromosome:WBcel235:II:13309290:13311488:1 gen... [more]
C25H3.73.198e-3532.10pep chromosome:WBcel235:II:5666756:5668930:-1 gene... [more]
cdr-44.130e-2729.15CaDmium Responsive; Cadmium-inducible lysosomal pr... [more]
back to top
BLAST of Failed axon connections homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fax9.133e-3934.26gene:FBgn0014163 transcript:FBtr0100477[more]
fax2.345e-3833.86gene:FBgn0014163 transcript:FBtr0075412[more]
fax1.207e-2733.66gene:FBgn0014163 transcript:FBtr0331175[more]
fax1.368e-2733.66gene:FBgn0014163 transcript:FBtr0100478[more]
fax3.568e-2733.33gene:FBgn0014163 transcript:FBtr0331176[more]
back to top
BLAST of Failed axon connections homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
faxca2.420e-3832.35failed axon connections homolog, metaxin like GST ... [more]
faxcb2.130e-3530.25failed axon connections homolog, metaxin like GST ... [more]
CR848729.31.234e-1131.43pep chromosome:GRCz11:CHR_ALT_CTG16_1_15:32650215:... [more]
mtx27.025e-922.54metaxin 2 [Source:ZFIN;Acc:ZDB-GENE-021210-2][more]
back to top
BLAST of Failed axon connections homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
lzts11.247e-3733.75leucine zipper, putative tumor suppressor 1 [Sourc... [more]
back to top
BLAST of Failed axon connections homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Faxc2.479e-3832.78failed axon connections homolog [Source:MGI Symbol... [more]
back to top
BLAST of Failed axon connections homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|D3ZAT9|FAXC_RAT7.188e-3832.78Failed axon connections homolog OS=Rattus norvegic... [more]
sp|Q5TGI0|FAXC_HUMAN1.117e-3732.78Failed axon connections homolog OS=Homo sapiens OX... [more]
sp|Q3UMF9|FAXC_MOUSE1.734e-3732.78Failed axon connections homolog OS=Mus musculus OX... [more]
sp|Q95RI5|FAXC_DROME2.351e-3733.86Failed axon connections OS=Drosophila melanogaster... [more]
sp|F7E235|FAXC_XENTR1.236e-3533.33Failed axon connections homolog OS=Xenopus tropica... [more]
back to top
BLAST of Failed axon connections homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267H2723.376e-8650.21Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DTX16.757e-8450.42Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267H7P67.779e-8450.42Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FED81.573e-8350.42Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267H4085.145e-8249.78Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Failed axon connections homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
faxcb4.545e-3431.09failed axon connections homolog, metaxin like GST ... [more]
mtx22.012e-824.19metaxin 2 [Source:NCBI gene;Acc:103041144][more]
mtx1b7.877e-722.51metaxin-1-like [Source:NCBI gene;Acc:103026555][more]
back to top
BLAST of Failed axon connections homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000001951.11.456e-1132.97pep scaffold:Pmarinus_7.0:GL488653:1066:6687:1 gen... [more]
back to top
BLAST of Failed axon connections homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Failed axon connections homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO426961.859e-4640.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO347602.363e-4032.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431011.159e-3731.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO439108.427e-3531.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO465904.838e-2926.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Failed axon connections homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
faxcb3.848e-4032.64failed axon connections homolog, metaxin like GST ... [more]
ENSORLT00000021183.21.413e-3631.93failed axon connections homolog [Source:NCBI gene;... [more]
ENSORLT00000032142.12.133e-3631.93failed axon connections homolog [Source:NCBI gene;... [more]
mtx1a1.291e-622.88metaxin-1 [Source:NCBI gene;Acc:101163689][more]
back to top
BLAST of Failed axon connections homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000039746.10.000e+099.63SMESG000039746.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005161 ID=SMED30005161|Name=Failed axon connections homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=1209bp
ATAATTTATAGGTTTTCCAAAGCTTATTCAGTCAGGCGACTTTGTTTTAA
TTTCATTTACATTATTTGGTATTGTGATTACAAATATTGTTATTTTTAGC
ATTGACCATGATTACCAGTTGCTAAATCATTACATTATTGCAGAATTTTG
TATAATATTTGTATATAATCAACCATTTCAAGAAAGGATCAACGGTCAGA
ATCATTTGATGGTGTGAGACTTCAAAATCAAGCAGTCACTTTAAAAAAAT
TTTTGTCAAAAAATGATTTCACTAGTTTCGGTGAGTTCTATATCAAGCCT
AATTTTAGTTGGATTTGGATTCATTTACTATTATGTCTTCCATGGCAAAC
GGCGACAAAAGATTTTCATCCAAAACTTTGAAAAGGACATTGTCTATTTA
TTTCAATTTCCGTCATCGAGAAATATCTCATGCATATCGCCTTTTGCCGT
GAAAATCGAGACGTATTTGAAATTGAAAAACATCCCCTACAAATCCATCA
GAACAATAAAACAATGGTCATCAAAAAGCCAAATCCCATTCATTGAATGG
AACGGTCAGCAAATTGCCGATTCGAATTTTATTTTGGATTTTTTGGTTGA
CAAATTTCAAACTCAAGATAATATTTCAGATTTCGAAAAAGGACTTTCAA
GAGCTGTTGAAATGATGCTAGATAACCAAACGGTGTGGTCGTACTTTTAT
TATCGGTACGTCGAGAAAGCATCTGATTTCATTAATAGCTGGACGTTTAC
AACTCCCTTTCGAAGAAAGATTATTGGGTTTTTCTTTCCAAGAGGATTTA
AAAATCGATCATATCATCATGGAATTGGTAGACATTCTCCTAGTGAAATC
TATGAAATCGGTAAAAAAGATTTAATGGCAATATCAAATATTCTCGGTGA
CCGGAAGTTTCTTCTTGGAGACAAAATGACAACAGTTGATTGCTACATAT
TCGGACATTTGTGTCAAATTCTTTACATTCCAAGCGTCAATTATCCTCAT
ATCGAATTTCTGAAAACCGACTGTAAAAATCTGGTGGAATTTACCCACAG
AATTATAGACAAACTATGGCCCGAATGGAATGAATTCAGTCACATTATAC
CAATCAGCCAATGAAACAAAGCATAACGATTTTTTAATTTTTTTTTAATG
TTAATTATGTCAATGTGTTTTATTTTATAATAGAGAGACTTGTGTGTTTC
TAAAAAAAA
back to top

protein sequence of SMED30005161-orf-1

>SMED30005161-orf-1 ID=SMED30005161-orf-1|Name=SMED30005161-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=284bp
MISLVSVSSISSLILVGFGFIYYYVFHGKRRQKIFIQNFEKDIVYLFQFP
SSRNISCISPFAVKIETYLKLKNIPYKSIRTIKQWSSKSQIPFIEWNGQQ
IADSNFILDFLVDKFQTQDNISDFEKGLSRAVEMMLDNQTVWSYFYYRYV
EKASDFINSWTFTTPFRRKIIGFFFPRGFKNRSYHHGIGRHSPSEIYEIG
KKDLMAISNILGDRKFLLGDKMTTVDCYIFGHLCQILYIPSVNYPHIEFL
KTDCKNLVEFTHRIIDKLWPEWNEFSHIIPISQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005737cytoplasm
GO:0005886plasma membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036249Thioredoxin-like_sf
IPR026928FAX
IPR040079Glutathione_S-Trfase
IPR036282Glutathione-S-Trfase_C_sf
IPR012336Thioredoxin-like_fold
IPR010987Glutathione-S-Trfase_C-like
IPR033468Metaxin_GST
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0007275multicellular organism development
GO:0007409axonogenesis
GO:0019233sensory perception of pain
GO:0022008neurogenesis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR012336Thioredoxin-like foldPFAMPF17172GST_N_4coord: 60..152
e-value: 1.3E-20
score: 74.0
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 55..120
e-value: 1.1E-5
score: 27.6
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 58..136
IPR033468Metaxin, glutathione S-transferase domainPFAMPF17171GST_C_6coord: 200..264
e-value: 4.1E-19
score: 68.1
NoneNo IPR availableGENE3DG3DSA:1.20.1050.10coord: 148..265
e-value: 3.6E-7
score: 32.4
NoneNo IPR availablePANTHERPTHR12289METAXIN RELATEDcoord: 25..276
NoneNo IPR availablePANTHERPTHR12289:SF59FAILED AXON CONNECTIONS HOMOLOGcoord: 25..276
NoneNo IPR availableCDDcd03193GST_C_Metaxincoord: 195..264
e-value: 2.9397E-20
score: 81.1331
NoneNo IPR availableTMHMMTMhelixcoord: 4..26
IPR026928Failed axon connectionsSFLDSFLDG01200SUF1.1coord: 43..274
e-value: 0.0
score: 203.1
IPR040079Glutathione Transferase familySFLDSFLDS00019Glutathione_Transferase_(cytocoord: 43..274
e-value: 0.0
score: 203.1
IPR036282Glutathione S-transferase, C-terminal domain superfamilySUPERFAMILYSSF47616GST C-terminal domain-likecoord: 190..266