WD_REPEATS_REGION domain-containing protein

Overview
NameWD_REPEATS_REGION domain-containing protein
Smed IDSMED30005158
Length (bp)1919
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of WD_REPEATS_REGION domain-containing protein (SMED30005158) t-SNE clustered cells

Violin plots show distribution of expression levels for WD_REPEATS_REGION domain-containing protein (SMED30005158) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of WD_REPEATS_REGION domain-containing protein (SMED30005158) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for WD_REPEATS_REGION domain-containing protein (SMED30005158) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005158

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30005158SMESG000071691.1 SmedASXL_012962SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30005158SMESG000071691.1 dd_Smed_v4_6137_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30005158SMESG000071691.1 dd_Smed_v4_6137_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30005158SMESG000071691.1 dd_Smed_v4_6137_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30005158SMESG000071691.1 dd_Smed_v4_6137_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30005158SMESG000071691.1 dd_Smed_v6_6137_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30005158SMESG000071691.1 dd_Smed_v4_6137_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30005158SMESG000071691.1 dd_Smed_v4_6137_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Human
Match: SPAG16 (sperm associated antigen 16 [Source:HGNC Symbol;Acc:HGNC:23225])

HSP 1 Score: 455.292 bits (1170), Expect = 2.376e-152
Identity = 245/624 (39.26%), Postives = 371/624 (59.46%), Query Frame = 2
Query:   44 ENKYFLEKIEIPVYEESEFDYDFVKSDEILMLEDGTFDSFEHTSKILDELQEDERALEEAIFNNR---PKLTTVPPSMDDYIRSFLLRLGLTRTLDCFQLEWFEKKHKGLLHEEDISEVPDIYVRNQQLDIQVKLMREDRNKYKQAALKAKEMHVKLRGERDYHKLQHRRMVQEKNKLIDEIKRLRDHYASYQPALEQLQQKYQTAMKEKMLSKLERDRICGQMQGLQMTLQSLENSTLPITTDDDGKRLFFRDRSQVSNIHPCRKGGVLTVDKLNRGATQKKLADAREFKSKNDALNGEKENNDTPFPVDKGINEDLLKLRPPPGHLTRVGGFKLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNVTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVWS 1906
            E  Y+LE++ I    E +++Y+ +  D   + E       E  +K +   QE  +A +  I   +   P    VP  ++D++ +FL+++G+TRTLDCFQ EW+E   KG+     +  VPD+Y +   L+ + K +++D   YKQAA KA+E  +K++ ERD+H++ H+R+VQEKNKLI+++K L+ HYASY+P +  L +K+ T +KEKML+ LERD++ GQ+ GLQ TL+ L+             R       Q+   H   K      +    G TQK L +ARE       + G  ++++ P  +    N ++ K    P        +KL N  + HE  V+C+    +K +  +  +D  WK+  L    VL+TG GHT+W+S   F   G+KLAT+SGDTT+K+W+L   +C+ TFEGHS+++WS  WH+   F+A++S DKT K+WD+NS +CR  L GH+DSVNS++F   SN LLTSSADKT+ +WDAR   C QS+ GH +++N A  + +G  IASCDA G  K WD R+L   I +ID+G  P N+V +D+SG  +A +S + VI +++  S  +  L+GHE+   + +F HDGE L S  +D TVR WS
Sbjct:   39 EGAYYLEQVTITEASEDDYEYEEIPDDNFSIPE-----GEEDLAKAIQMAQE--QATDTEILERKTVLPSKHAVPEVIEDFLCNFLIKMGMTRTLDCFQSEWYELIQKGVTELRTVGNVPDVYTQIMLLENENKNLKKDLKHYKQAADKAREDLLKIQKERDFHRMHHKRIVQEKNKLINDLKGLKLHYASYEPTIRVLHEKHHTLLKEKMLTSLERDKVVGQISGLQETLKKLQ-------------RGHSYHGPQIKVDHSREK------ENAPEGPTQKGLREAREQNKCKTKMKGNTKDSEFPIDMQPNPNLNVSKESLSPAKFD----YKLKNIFRLHELPVSCVSMQPHKDILVSCGEDRLWKVLGLPKCNVLLTGFGHTDWLSDCCFHPSGDKLATSSGDTTVKLWDLCKGDCILTFEGHSRAVWSCTWHSCGNFVASSSLDKTSKIWDVNSERCRCTLYGHTDSVNSIEFFPFSNTLLTSSADKTLSIWDARTGICEQSLYGHMHSINDAIFDPRGHMIASCDACGVTKLWDFRKL-LPIVSIDIGPSPGNEVNFDSSGRVLAQASGNGVIHLLDLKSGEIHKLMGHENEAHTVVFSHDGEILFSGGSDGTVRTWS 631          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Human
Match: SPAG16 (sperm associated antigen 16 [Source:HGNC Symbol;Acc:HGNC:23225])

HSP 1 Score: 176.022 bits (445), Expect = 2.762e-49
Identity = 93/235 (39.57%), Postives = 150/235 (63.83%), Query Frame = 2
Query:   44 ENKYFLEKIEIPVYEESEFDYDFVKSDEILMLEDGTFDSFEHTSKILDELQEDERALEEAIFNNR---PKLTTVPPSMDDYIRSFLLRLGLTRTLDCFQLEWFEKKHKGLLHEEDISEVPDIYVRNQQLDIQVKLMREDRNKYKQAALKAKEMHVKLRGERDYHKLQHRRMVQEKNKLIDEIKRLRDHYASYQPALEQLQQKYQTAMKEKMLSKLERDRICGQMQGLQMTLQSLE 739
            E  Y+LE++ I    E +++Y+ +  D   + E       E  +K +   QE  +A +  I   +   P    VP  ++D++ +FL+++G+TRTLDCFQ EW+E   KG+     +  VPD+Y +   L+ + K +++D   YKQAA KA+E  +K++ ERD+H++ H+R+VQEKNKLI+++K L+ HYASY+P +  L +K+ T +KEKML+ LERD++ GQ+ GLQ TL+ L+
Sbjct:   39 EGAYYLEQVTITEASEDDYEYEEIPDDNFSIPE-----GEEDLAKAIQMAQE--QATDTEILERKTVLPSKHAVPEVIEDFLCNFLIKMGMTRTLDCFQSEWYELIQKGVTELRTVGNVPDVYTQIMLLENENKNLKKDLKHYKQAADKAREDLLKIQKERDFHRMHHKRIVQEKNKLINDLKGLKLHYASYEPTIRVLHEKHHTLLKEKMLTSLERDKVVGQISGLQETLKKLQ 266          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Human
Match: SPAG16 (sperm associated antigen 16 [Source:HGNC Symbol;Acc:HGNC:23225])

HSP 1 Score: 176.022 bits (445), Expect = 1.106e-48
Identity = 93/235 (39.57%), Postives = 150/235 (63.83%), Query Frame = 2
Query:   44 ENKYFLEKIEIPVYEESEFDYDFVKSDEILMLEDGTFDSFEHTSKILDELQEDERALEEAIFNNR---PKLTTVPPSMDDYIRSFLLRLGLTRTLDCFQLEWFEKKHKGLLHEEDISEVPDIYVRNQQLDIQVKLMREDRNKYKQAALKAKEMHVKLRGERDYHKLQHRRMVQEKNKLIDEIKRLRDHYASYQPALEQLQQKYQTAMKEKMLSKLERDRICGQMQGLQMTLQSLE 739
            E  Y+LE++ I    E +++Y+ +  D   + E       E  +K +   QE  +A +  I   +   P    VP  ++D++ +FL+++G+TRTLDCFQ EW+E   KG+     +  VPD+Y +   L+ + K +++D   YKQAA KA+E  +K++ ERD+H++ H+R+VQEKNKLI+++K L+ HYASY+P +  L +K+ T +KEKML+ LERD++ GQ+ GLQ TL+ L+
Sbjct:   39 EGAYYLEQVTITEASEDDYEYEEIPDDNFSIPE-----GEEDLAKAIQMAQE--QATDTEILERKTVLPSKHAVPEVIEDFLCNFLIKMGMTRTLDCFQSEWYELIQKGVTELRTVGNVPDVYTQIMLLENENKNLKKDLKHYKQAADKAREDLLKIQKERDFHRMHHKRIVQEKNKLINDLKGLKLHYASYEPTIRVLHEKHHTLLKEKMLTSLERDKVVGQISGLQETLKKLQ 266          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Human
Match: SPAG16 (sperm associated antigen 16 [Source:HGNC Symbol;Acc:HGNC:23225])

HSP 1 Score: 166.777 bits (421), Expect = 1.035e-46
Identity = 78/167 (46.71%), Postives = 121/167 (72.46%), Query Frame = 2
Query:  239 PKLTTVPPSMDDYIRSFLLRLGLTRTLDCFQLEWFEKKHKGLLHEEDISEVPDIYVRNQQLDIQVKLMREDRNKYKQAALKAKEMHVKLRGERDYHKLQHRRMVQEKNKLIDEIKRLRDHYASYQPALEQLQQKYQTAMKEKMLSKLERDRICGQMQGLQMTLQSLE 739
            P    VP  ++D++ +FL+++G+TRTLDCFQ EW+E   KG+     +  VPD+Y +   L+ + K +++D   YKQAA KA+E  +K++ ERD+H++ H+R+VQEKNKLI+++K L+ HYASY+P +  L +K+ T +KEKML+ LERD++ GQ+ GLQ TL+ L+
Sbjct:   69 PSKHAVPEVIEDFLCNFLIKMGMTRTLDCFQSEWYELIQKGVTELRTVGNVPDVYTQIMLLENENKNLKKDLKHYKQAADKAREDLLKIQKERDFHRMHHKRIVQEKNKLINDLKGLKLHYASYEPTIRVLHEKHHTLLKEKMLTSLERDKVVGQISGLQETLKKLQ 235          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Human
Match: SPAG16 (sperm associated antigen 16 [Source:HGNC Symbol;Acc:HGNC:23225])

HSP 1 Score: 166.392 bits (420), Expect = 1.949e-46
Identity = 92/236 (38.98%), Postives = 129/236 (54.66%), Query Frame = 2
Query: 1199 VSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNVTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVWS 1906
            VSC +     + L +   D   K+  L     L T  GH+      DW +   F  +               +CR  L GH+DSVNS++F   SN LLTSSADKT+ +WDAR   C QS+ GH +++N A  + +G  IASCDA G  K WD R+L   I +ID+G  P N+V +D+SG  +A +S + VI +++  S  +  L+GHE+   + +F HDGE L S  +D TVR WS
Sbjct:   41 VSCVSMQPHKDILVSCGEDRLWKVLGLPKCNVLLTGFGHT------DWLSDCCFHPSE--------------RCRCTLYGHTDSVNSIEFFPFSNTLLTSSADKTLSIWDARTGICEQSLYGHMHSINDAIFDPRGHMIASCDACGVTKLWDFRKL-LPIVSIDIGPSPGNEVNFDSSGRVLAQASGNGVIHLLDLKSGEIHKLMGHENEAHTVVFSHDGEILFSGGSDGTVRTWS 255          

HSP 2 Score: 59.3066 bits (142), Expect = 3.943e-9
Identity = 61/259 (23.55%), Postives = 99/259 (38.22%), Query Frame = 2
Query:  947 DTPFPVDKGINEDL--LKLRPPPGHLTRVGGFKLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDND----------------------GEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFW 1651
            D+ FP+D   N +L   K    P        +KL N  + HE  V+C+    +K +  +  +D  WK+  L    VL+TG GHT+W+S   F                            L T+S D TL IW+     C  +  GH  SI    +      +A+       K+WD   L     +       N V F  +  +L  +S +  + L D +       + GH+   ++   +  G  + S  + G ++ W
Sbjct:    1 DSEFPIDMQPNPNLNVSKESLSPAKFD----YKLKNIFRLHELPVSCVSMQPHKDILVSCGEDRLWKVLGLPKCNVLLTGFGHTDWLSDCCFHPSERCRCTLYGHTDSVNSIEFFPFSNTLLTSSADKTLSIWDARTGICEQSLYGHMHSINDAIFDPRGHMIASCDACGVTKLWDFRKLLPIVSIDIGPSPGNEVNFDSSGRVLAQASGNGVIHLLDLKSGEI-HKLMGHENEAHTVVFSHDGEILFSGGSDGTVRTW 254          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Celegans
Match: wdr-5.1 (WD repeat-containing protein wdr-5.1 [Source:UniProtKB/Swiss-Prot;Acc:Q17963])

HSP 1 Score: 117.857 bits (294), Expect = 1.577e-28
Identity = 70/252 (27.78%), Postives = 133/252 (52.78%), Query Frame = 2
Query: 1163 QVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVE-TASFNVTSLVGHEDSVQSAMFDH----DGEFLISASADCTVRVW 1903
            +++ T +GHT  +S A F   G+ L T+S D T+KIWN+    C  T  GH   +  + W + +  + +AS DKT+K++++ + +    L+GH++ V    F   S+++++ S D++V +WD +   C +++  H   V++ + N  G+ IAS    G ++ WD          +D    P   V++  +G  +  S+ DS +K+ + +    +    GHE+S +  +F +     G+++IS S DC + +W
Sbjct:   78 KLMCTLEGHTKSISSAKFSPCGKYLGTSSADKTVKIWNMDHMICERTLTGHKLGVNDIAWSSDSRCVVSASDDKTLKIFEIVTSRMTKTLKGHNNYVFCCNFNPQSSLVVSGSFDESVRIWDVKTGMCIKTLPAHSDPVSAVSFNRDGSLIASGSYDGLVRIWDTANGQCIKTLVDDENPPVAFVKFSPNGKYILASNLDSTLKLWDFSKGKTLKQYTGHENS-KYCIFANFSVTGGKWIISGSEDCKIYIW 328          

HSP 2 Score: 55.8398 bits (133), Expect = 4.873e-8
Identity = 45/203 (22.17%), Postives = 98/203 (48.28%), Query Frame = 2
Query: 1037 KLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTF-EGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNI-------LLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIAS 1621
            ++T T+K H   V C   +    +  + S D+S ++W + +   + T   H++ VS  +F+ DG  +A+ S D  ++IW+ +  +C+ T  +  +  +  V +  +  ++  ++ D T+K+WD +  K      GH +S    ++ + +N        +++ S D  + +W+ +     Q + GH   V +++ +     IAS
Sbjct:  162 RMTKTLKGHNNYVFCCNFNPQSSLVVSGSFDESVRIWDVKTGMCIKTLPAHSDPVSAVSFNRDGSLIASGSYDGLVRIWDTANGQCIKTLVDDENPPVAFVKFSPNGKYILASNLDSTLKLWDFSKGKTLKQYTGHENS----KYCIFANFSVTGGKWIISGSEDCKIYIWNLQTREIVQCLEGHTQPVLASDCHPVQNIIAS 360          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Celegans
Match: wdr-5.1 (WD repeat-containing protein wdr-5.1 [Source:UniProtKB/Swiss-Prot;Acc:Q17963])

HSP 1 Score: 117.857 bits (294), Expect = 1.577e-28
Identity = 70/252 (27.78%), Postives = 133/252 (52.78%), Query Frame = 2
Query: 1163 QVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVE-TASFNVTSLVGHEDSVQSAMFDH----DGEFLISASADCTVRVW 1903
            +++ T +GHT  +S A F   G+ L T+S D T+KIWN+    C  T  GH   +  + W + +  + +AS DKT+K++++ + +    L+GH++ V    F   S+++++ S D++V +WD +   C +++  H   V++ + N  G+ IAS    G ++ WD          +D    P   V++  +G  +  S+ DS +K+ + +    +    GHE+S +  +F +     G+++IS S DC + +W
Sbjct:   78 KLMCTLEGHTKSISSAKFSPCGKYLGTSSADKTVKIWNMDHMICERTLTGHKLGVNDIAWSSDSRCVVSASDDKTLKIFEIVTSRMTKTLKGHNNYVFCCNFNPQSSLVVSGSFDESVRIWDVKTGMCIKTLPAHSDPVSAVSFNRDGSLIASGSYDGLVRIWDTANGQCIKTLVDDENPPVAFVKFSPNGKYILASNLDSTLKLWDFSKGKTLKQYTGHENS-KYCIFANFSVTGGKWIISGSEDCKIYIW 328          

HSP 2 Score: 55.8398 bits (133), Expect = 4.873e-8
Identity = 45/203 (22.17%), Postives = 98/203 (48.28%), Query Frame = 2
Query: 1037 KLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTF-EGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNI-------LLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIAS 1621
            ++T T+K H   V C   +    +  + S D+S ++W + +   + T   H++ VS  +F+ DG  +A+ S D  ++IW+ +  +C+ T  +  +  +  V +  +  ++  ++ D T+K+WD +  K      GH +S    ++ + +N        +++ S D  + +W+ +     Q + GH   V +++ +     IAS
Sbjct:  162 RMTKTLKGHNNYVFCCNFNPQSSLVVSGSFDESVRIWDVKTGMCIKTLPAHSDPVSAVSFNRDGSLIASGSYDGLVRIWDTANGQCIKTLVDDENPPVAFVKFSPNGKYILASNLDSTLKLWDFSKGKTLKQYTGHENS----KYCIFANFSVTGGKWIISGSEDCKIYIWNLQTREIVQCLEGHTQPVLASDCHPVQNIIAS 360          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Celegans
Match: wdr-5.3 (WD repeat-containing protein wdr-5.3 [Source:UniProtKB/Swiss-Prot;Acc:Q23256])

HSP 1 Score: 103.219 bits (256), Expect = 4.710e-23
Identity = 67/251 (26.69%), Postives = 115/251 (45.82%), Query Frame = 2
Query: 1166 VLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNVTSLVGHEDSVQSAMFDHD----GEFLISASADCTVRVWS 1906
            ++ T  GHT  VS   F   G+ L T S D  +K+WN      L T   H   I    W +++ F+A+AS D T+K++D+ S  C   +RGH++ V    F   S+++ ++  D+TV +WD +   C + I  H   + S + N  G  +A+    G ++ WD    +     +D    P   V +  +G  +  +  DS +K+ +              + +  +F +     G+ +IS S D  + VWS
Sbjct:  205 LVKTISGHTKSVSVIKFSYCGKYLGTGSADKQIKVWNTVDMTYLQTLASHQLGINDFSWSSNSQFIASASDDTTVKIFDVISGACLRTMRGHTNYVFCCSFNPQSSLIASAGFDETVRVWDFKTGLCVKCIPAHSDPITSISYNHDGNTMATSSYDGCIRVWDAASGSCLKTLVDTDHAPVTFVCFSPNGKYLLSAQLDSSLKLWDPKKAKPLKYYNGHKNKKYCLFANMSVPLGKHIISGSEDGRILVWS 455          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Celegans
Match: wdr-5.2 (WD repeat-containing protein wdr-5.2 [Source:UniProtKB/Swiss-Prot;Acc:Q93847])

HSP 1 Score: 99.3673 bits (246), Expect = 3.720e-22
Identity = 67/245 (27.35%), Postives = 116/245 (47.35%), Query Frame = 2
Query: 1187 HTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLY--TFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNV-TSLVGHEDS---VQSAMFDHDGEFLISASADCTVRVW 1903
            H   +S   F  DG  + + S D ++KIW +   + +Y  T  GH   I    W + +  + + S DK +KV+D++S +C   L+GH++ V    F  +  ++ + S D+T+ +W AR      SI GH+  V+S   N  G  +AS    G ++ WD          ID    P   V++  +G  +  S+ ++ +K+ +     V     GHE+S   V +      G++++S S D  V +W
Sbjct:  106 HKKSISGIKFSPDGRYMGSGSADCSIKIWRM---DFVYEKTLMGHRLGINEFSWSSDSKLIVSCSDDKLVKVFDVSSGRCVKTLKGHTNYVFCCCFNPSGTLIASGSFDETIRIWCARNGNTIFSIPGHEDPVSSVCFNRDGAYLASGSYDGIVRIWDSTTGTCVKTLIDEEHPPITHVKFSPNGKYILASNLNNTLKLWDYQKLRVLKEYTGHENSKYCVAANFSVTGGKWIVSGSEDHKVYIW 347          

HSP 2 Score: 77.411 bits (189), Expect = 5.649e-15
Identity = 39/137 (28.47%), Postives = 73/137 (53.28%), Query Frame = 2
Query: 1163 QVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKC-RTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQ 1570
            + + T KGHTN+V C  F+  G  +A+ S D T++IW       +++  GH   + SV ++    +LA+ S+D  +++WD  +  C +T++      +  V+F  N   +L S+ + T+ LWD +     +  +GH+
Sbjct:  181 RCVKTLKGHTNYVFCCCFNPSGTLIASGSFDETIRIWCARNGNTIFSIPGHEDPVSSVCFNRDGAYLASGSYDGIVRIWDSTTGTCVKTLIDEEHPPITHVKFSPNGKYILASNLNNTLKLWDYQKLRVLKEYTGHE 317          

HSP 3 Score: 70.4774 bits (171), Expect = 9.930e-13
Identity = 40/162 (24.69%), Postives = 84/162 (51.85%), Query Frame = 2
Query: 1184 GHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQY-AVNSANINEQGTNIASCDAFGFLKFWDCRQL 1666
            GH   ++  ++ +D + + + S D  +K++++S+  C+ T +GH+  ++   ++ S   +A+ S D+TI++W   +      + GH D V+SV F  +   L + S D  V +WD+   TC +++   ++  +     +  G  I + +    LK WD ++L
Sbjct:  146 GHRLGINEFSWSSDSKLIVSCSDDKLVKVFDVSSGRCVKTLKGHTNYVFCCCFNPSGTLIASGSFDETIRIWCARNGNTIFSIPGHEDPVSSVCFNRDGAYLASGSYDGIVRIWDSTTGTCVKTLIDEEHPPITHVKFSPNGKYILASNLNNTLKLWDYQKL 307          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Celegans
Match: prp-4 (Yeast PRP (Splicing factor) related [Source:UniProtKB/TrEMBL;Acc:Q93339])

HSP 1 Score: 94.3597 bits (233), Expect = 4.373e-20
Identity = 69/252 (27.38%), Postives = 113/252 (44.84%), Query Frame = 2
Query: 1184 GHTNWVSCAAF--------DNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPA--NDVRYDTSGSCVAMSSSDSVIKMVETASFN-VTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVWS 1906
            GH++   CA F        D     + + S D T+ +W+LS    +   E H Q +  V +H +   LATA  D T +++DL + K      GHS SV  V F  + ++ LT   D    +WD R   C   + GH   ++S      G  + +  +   +K WD R      NT  +  H +    VR D +G  +  +S D  +KM  T  +  +  L GH+  +       DG+++ S++ D T ++W+
Sbjct:  244 GHSSQAGCARFHPGAFTQNDYSSLNVVSCSYDGTVLLWSLSQESPIGELEQHPQRVSKVAFHPNGHHLATACFDSTWRMYDLTTKKELLYQEGHSKSVADVAFHPDGSVALTGGHDCYGRVWDMRTGRCIMFLDGHTKEIHSVEWMPNGYEMITGSSDNSMKVWDLRM---RRNTYTMPAHTSVVTRVRADAAGQYLVSASFDCTLKMWSTTGWQPLRQLQGHDTRILCVDISPDGQWMCSSAFDRTFKLWA 492          

HSP 2 Score: 70.4774 bits (171), Expect = 1.405e-12
Identity = 49/200 (24.50%), Postives = 91/200 (45.50%), Query Frame = 2
Query: 1052 IKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFW 1651
            ++ H   V+ +  H N     T   D +W+++ L + + L+  +GH+  V+  AF  DG    T   D   ++W++    C+   +GH++ I SV+W  +   + T S D ++KVWDL   +    +  H+  V  V+       L+++S D T+ +W        + + GH   +   +I+  G  + S       K W
Sbjct:  292 LEQHPQRVSKVAFHPNGHHLATACFDSTWRMYDLTTKKELLYQEGHSKSVADVAFHPDGSVALTGGHDCYGRVWDMRTGRCIMFLDGHTKEIHSVEWMPNGYEMITGSSDNSMKVWDLRMRRNTYTMPAHTSVVTRVRADAAGQYLVSASFDCTLKMWSTTGWQPLRQLQGHDTRILCVDISPDGQWMCSSAFDRTFKLW 491          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Fly
Match: wds (gene:FBgn0040066 transcript:FBtr0308566)

HSP 1 Score: 115.931 bits (289), Expect = 9.098e-28
Identity = 72/249 (28.92%), Postives = 125/249 (50.20%), Query Frame = 2
Query: 1172 MTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFN-VTSLVGHEDSVQSAMFDH----DGEFLISASADCTVRVW 1903
             T  GHT  VS   F  +GE LA++S D  +KIW     +   T  GH   I  V W + +  L + S DKT+KVW+L++ K    L+GHS+ V    F   SN++++ S D++V +WD R   C +++  H   V++ + N  G+ I S    G  + WD          ID    P + V++  +G  +  ++ D+ +K+ + +    + +  GH++  +  +F +     G++++S S D  V +W
Sbjct:   66 FTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNE-KYCIFANFSVTGGKWIVSGSEDNMVYIW 313          

HSP 2 Score: 90.1225 bits (222), Expect = 4.357e-19
Identity = 78/300 (26.00%), Postives = 138/300 (46.00%), Query Frame = 2
Query: 1034 FKLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQS-ISGHQYAVNSANINEQGTNIASCDAFGFLKFWD-----CRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNVTS-LVGHEDSVQSAMFDHDGEFLISASA---DCTVRVW 1903
            + L  T+  H  AV+ ++   N +   ++S D   K+W     +   T  GH   +S  A+ +D   L + S D TLK+W LS  + L T +GHS  ++  +++  +  + + S D+++++WD+ + KC   L  HSD V++V F  + +++++SS D    +WD     C ++ I      V+    +  G  I +      LK WD     C +  T              V   T G  +   S D+++ +    S  V   L GH D+V      H  E +I+++A   D T+++W
Sbjct:   62 YTLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSV---TGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVLCTAC-HPTENIIASAALENDKTIKLW 357          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Fly
Match: wds (gene:FBgn0040066 transcript:FBtr0070438)

HSP 1 Score: 115.931 bits (289), Expect = 9.098e-28
Identity = 72/249 (28.92%), Postives = 125/249 (50.20%), Query Frame = 2
Query: 1172 MTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFN-VTSLVGHEDSVQSAMFDH----DGEFLISASADCTVRVW 1903
             T  GHT  VS   F  +GE LA++S D  +KIW     +   T  GH   I  V W + +  L + S DKT+KVW+L++ K    L+GHS+ V    F   SN++++ S D++V +WD R   C +++  H   V++ + N  G+ I S    G  + WD          ID    P + V++  +G  +  ++ D+ +K+ + +    + +  GH++  +  +F +     G++++S S D  V +W
Sbjct:   66 FTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNE-KYCIFANFSVTGGKWIVSGSEDNMVYIW 313          

HSP 2 Score: 90.1225 bits (222), Expect = 4.357e-19
Identity = 78/300 (26.00%), Postives = 138/300 (46.00%), Query Frame = 2
Query: 1034 FKLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQS-ISGHQYAVNSANINEQGTNIASCDAFGFLKFWD-----CRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNVTS-LVGHEDSVQSAMFDHDGEFLISASA---DCTVRVW 1903
            + L  T+  H  AV+ ++   N +   ++S D   K+W     +   T  GH   +S  A+ +D   L + S D TLK+W LS  + L T +GHS  ++  +++  +  + + S D+++++WD+ + KC   L  HSD V++V F  + +++++SS D    +WD     C ++ I      V+    +  G  I +      LK WD     C +  T              V   T G  +   S D+++ +    S  V   L GH D+V      H  E +I+++A   D T+++W
Sbjct:   62 YTLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSV---TGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVLCTAC-HPTENIIASAALENDKTIKLW 357          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Fly
Match: CG10931 (gene:FBgn0034274 transcript:FBtr0089545)

HSP 1 Score: 106.686 bits (265), Expect = 7.662e-25
Identity = 67/244 (27.46%), Postives = 119/244 (48.77%), Query Frame = 2
Query: 1184 GHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFN-VTSLVGHEDSV---QSAMFDHDGEFLISASADCTVRVW 1903
            GH+  V+   F ++GE L ++SGD  LK+W+LSA  C+ +  GH   +  V W ++A  +A+ S D T+++WD  S  C  +L GHS    S  F   +N+L ++S D+TV LWD R     + +  HQ  + S + +  G    +    G ++ WD          +D+   P   V++  +G  +  S+ ++ +++        + +  GH +      S      G +++S S D T+ +W
Sbjct:   54 GHSGCVTGLKFSSNGENLVSSSGDRLLKLWDLSATRCIQSLAGHGDGVNDVAW-SAAGLIASCSDDMTVRLWDARSKLCVKVLEGHSRYSFSCCFNPQANLLASTSFDETVRLWDVRTGKTLKIVHAHQDPITSVDFHRDGNIFVTSSYDGLVRLWDSSTGHVLKTLVDVDNIPVGYVKFSPNGRYILSSTLNNTLRLWNYKKPKCMRTYRGHLNEFYCSNSNFSTTGGIWIVSGSEDNTLCIW 296          

HSP 2 Score: 81.6481 bits (200), Expect = 2.351e-16
Identity = 56/183 (30.60%), Postives = 100/183 (54.64%), Query Frame = 2
Query:  989 LKLRPPPGHL--TRVGGFKLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDA 1531
            + + P   HL  +   G+ + +++  H G VT ++   N +   ++S D   KLW L + + + +  GH + V+  A+   G  +A+ S D T+++W+  +  C+   EGHS+  +S  ++  A  LA+ S D+T+++WD+ + K   I+  H D + SV F  + NI +TSS D  V LWD+
Sbjct:   29 MPMLPSQFHLENSMSPGYAIKHSLLGHSGCVTGLKFSSNGENLVSSSGDRLLKLWDLSATRCIQSLAGHGDGVNDVAWSAAG-LIASCSDDMTVRLWDARSKLCVKVLEGHSRYSFSCCFNPQANLLASTSFDETVRLWDVRTGKTLKIVHAHQDPITSVDFHRDGNIFVTSSYDGLVRLWDS 210          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Fly
Match: CG7568 (gene:FBgn0039673 transcript:FBtr0330294)

HSP 1 Score: 100.908 bits (250), Expect = 3.356e-22
Identity = 67/230 (29.13%), Postives = 114/230 (49.57%), Query Frame = 2
Query: 1229 EKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWH-TSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSD---SVIKMVETASFNVTSLV-GHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            +K+ T S D T K+W+ ++ + L TF GH+  + + ++H      +ATAS D + +++D+ +      L  H   V + +F  +  +LLT S D +  +WD R  + G  + GH   +++   N  G+ IA+       + WD R+L   +           DV +D +G  +A  SSD    V ++  ++   + SL+ GH D V    F   G  L++ASAD T R+W
Sbjct:  195 DKIVTGSFDGTAKVWSATSGQSLCTFYGHTAELVAAEFHPVDGKSIATASLDGSARIYDVETSHELQQLTHHGAEVIAARFNRDGQMLLTGSFDHSAAIWDVRSKSLGHQLRGHSAELSNCVWNFSGSLIATGSLDNTARIWDTRKLDQELYLAARHSDEVLDVSFDAAGQLLATCSSDCTARVWRLEGSSELEMLSLMAGHSDEVSKVCFSPSGCMLLTASADNTARLW 424          

HSP 2 Score: 74.3294 bits (181), Expect = 9.882e-14
Identity = 62/253 (24.51%), Postives = 118/253 (46.64%), Query Frame = 2
Query: 1163 QVLMTGKGHTNWVSCAAFDN-DGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISG-HQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVR---YDTSGSCVAMSSSDSVIKMVETASFNVTS-LVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            Q L T  GHT  +  A F   DG+ +AT S D + +I+++  +  L     H   + +  ++     L T S D +  +WD+ S      LRGHS  +++  +  + +++ T S D T  +WD R       ++  H   V   + +  G  +A+C +    + W   + ++ +  + L    +++V    +  SG  +  +S+D+  ++  T S   +  L GHE  V S  + + G+ +++AS D + R W
Sbjct:  215 QSLCTFYGHTAELVAAEFHPVDGKSIATASLDGSARIYDVETSHELQQLTHHGAEVIAARFNRDGQMLLTGSFDHSAAIWDVRSKSLGHQLRGHSAELSNCVWNFSGSLIATGSLDNTARIWDTRKLDQELYLAARHSDEVLDVSFDAAGQLLATCSSDCTARVWRL-EGSSELEMLSLMAGHSDEVSKVCFSPSGCMLLTASADNTARLWLTESGQCSQVLAGHEGEVFSCAYSYAGDAILTASKDNSCRFW 466          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Fly
Match: Lis-1 (gene:FBgn0015754 transcript:FBtr0087241)

HSP 1 Score: 99.7525 bits (247), Expect = 3.965e-22
Identity = 67/243 (27.57%), Postives = 117/243 (48.15%), Query Frame = 2
Query: 1181 KGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAA-ECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVE-TASFNVTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            KGHT+ V   AFD  G+ LA+ S D ++K+W+   + EC+ T  GH  ++ SV +  +  ++ +AS D+TIK+W++ +  C     GH + V  V+  +  +I  T S D+T+ +W      C   +  H++ V       +    A  +A G                       A++ +    G  +A  S D  I++ + +    + +L GH++ V+   F   G++L+SAS D T+RVW
Sbjct:  147 KGHTDSVQDVAFDAQGKLLASCSADLSIKLWDFQQSYECIKTMHGHDHNVSSVAFVPAGDYVLSASRDRTIKMWEVATGYCVKTYTGHREWVRMVRVHIEGSIFATCSNDQTIRVWLTNSKDCKVELRDHEHTVECIAWAPEAAASAINEAAG-----------------------ADNKKGHHQGPFLASGSRDKTIRIWDVSVGLCLLTLSGHDNWVRGLAFHPGGKYLVSASDDKTIRVW 366          

HSP 2 Score: 88.5817 bits (218), Expect = 2.146e-18
Identity = 50/182 (27.47%), Postives = 82/182 (45.05%), Query Frame = 2
Query: 1175 TGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDW--------------------HTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCR 1660
            T  GH  WV       +G   AT S D T+++W  ++ +C      H  ++  + W                    H   PFLA+ S DKTI++WD++   C   L GH + V  + F      L+++S DKT+ +WD R   C +++  HQ+   S + ++    + S      +K W+CR
Sbjct:  230 TYTGHREWVRMVRVHIEGSIFATCSNDQTIRVWLTNSKDCKVELRDHEHTVECIAWAPEAAASAINEAAGADNKKGHHQGPFLASGSRDKTIRIWDVSVGLCLLTLSGHDNWVRGLAFHPGGKYLVSASDDKTIRVWDLRNKRCMKTLYAHQHFCTSIDFHKAHPYVISGSVDQTVKVWECR 411          

HSP 3 Score: 85.8853 bits (211), Expect = 1.600e-17
Identity = 58/227 (25.55%), Postives = 96/227 (42.29%), Query Frame = 2
Query: 1163 QVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLV--------------------NSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVE 1783
            + + T  GH + VS  AF   G+ + + S D T+K+W ++   C+ T+ GH + +  V  H      AT S+D+TI+VW  NS  C+  LR H  +V  + +                          L + S DKT+ +WD  +  C  ++SGH   V     +  G  + S      ++ WD R     + T+    H    + +  +   V   S D  +K+ E
Sbjct:  184 ECIKTMHGHDHNVSSVAFVPAGDYVLSASRDRTIKMWEVATGYCVKTYTGHREWVRMVRVHIEGSIFATCSNDQTIRVWLTNSKDCKVELRDHEHTVECIAWAPEAAASAINEAAGADNKKGHHQGPFLASGSRDKTIRIWDVSVGLCLLTLSGHDNWVRGLAFHPGGKYLVSASDDKTIRVWDLRN-KRCMKTLYAHQHFCTSIDFHKAHPYVISGSVDQTVKVWE 409          

HSP 4 Score: 82.0333 bits (201), Expect = 2.692e-16
Identity = 63/224 (28.12%), Postives = 97/224 (43.30%), Query Frame = 2
Query: 1298 YTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARIS-TCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNV-TSLVGHEDSVQSAMFD--------------------HDGEFLISASADCTVRVW 1903
            ++  GH  SI  V +H     + +AS D TI++WD  + +    L+GH+DSV  V F     +L + SAD ++ LWD + S  C +++ GH + V+S      G  + S      +K W+       + T          VR    GS  A  S+D  I++  T S +    L  HE +V+   +                     H G FL S S D T+R+W
Sbjct:  102 FSLTGHRASITRVIFHPIFALMVSASEDATIRIWDFETGEYERSLKGHTDSVQDVAFDAQGKLLASCSADLSIKLWDFQQSYECIKTMHGHDHNVSSVAFVPAGDYVLSASRDRTIKMWEV-ATGYCVKTYTGHREWVRMVRVHIEGSIFATCSNDQTIRVWLTNSKDCKVELRDHEHTVECIAWAPEAAASAINEAAGADNKKGHHQGPFLASGSRDKTIRIW 324          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Zebrafish
Match: wdr5 (WD repeat domain 5 [Source:ZFIN;Acc:ZDB-GENE-040426-2082])

HSP 1 Score: 119.013 bits (297), Expect = 6.753e-29
Identity = 73/249 (29.32%), Postives = 126/249 (50.60%), Query Frame = 2
Query: 1172 MTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFN-VTSLVGHEDSVQSAMFDH----DGEFLISASADCTVRVW 1903
             T  GHT  VS   F   GE LA++S D  +KIW     +   T  GH   I  V W + +  L +AS DKT+K+WD++S KC   L+GHS+ V    F   SN++++ S D++V +WD +   C +++  H   V++ + N  G+ I S    G  + WD          ID    P + V++  +G  +  ++ D+ +K+ + +    + +  GH++  +  +F +     G++++S S D  V +W
Sbjct:   39 FTLAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNE-KYCIFANFSVTGGKWIVSGSEDNMVYIW 286          

HSP 2 Score: 90.8929 bits (224), Expect = 1.990e-19
Identity = 79/301 (26.25%), Postives = 143/301 (47.51%), Query Frame = 2
Query: 1034 FKLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQS-ISGHQYAVNSANINEQGTNIASCDAFGFLKFWD-----CRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKM--VETASFNVTSLVGHEDSVQSAMFDHDGEFLISASA---DCTVRVW 1903
            + L  T+  H  AV+ ++   + +   ++S D   K+W     +   T  GH   +S  A+ +D   L + S D TLKIW++S+ +CL T +GHS  ++  +++  +  + + S D+++++WD+ + KC   L  HSD V++V F  + +++++SS D    +WD     C ++ I      V+    +  G  I +      LK WD     C +  T              V   T G  +   S D+++ +  ++T    V  L GH D V S    H  E +I+++A   D T+++W
Sbjct:   35 YTLKFTLAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSV---TGGKWIVSGSEDNMVYIWNLQTKEI-VQKLQGHTDVVISTAC-HPTENIIASAALENDKTIKLW 330          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Zebrafish
Match: daw1 (dynein assembly factor with WDR repeat domains 1 [Source:NCBI gene;Acc:556760])

HSP 1 Score: 120.168 bits (300), Expect = 9.235e-29
Identity = 93/295 (31.53%), Postives = 147/295 (49.83%), Query Frame = 2
Query: 1034 FKLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDND-GEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDC---RQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFN-VTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            F L   ++AH   +T +  +K+   F T S D + K+W   S + L T +GH N V   AF+N  G+K+AT S D T K+W+    +C YTF GH+  I  + ++  +  +AT S D T K+WD+ S +  + L GH   + S+ F    + L+T S D T  LWD         +SGH+  ++    N   + IA+       K WD    + LAT +   D       DV ++ +G  +A +S+D   ++  T +F  +  L GH+  +    F+  G  +++AS D T RVW
Sbjct:   82 FYLFRALQAHILPLTNVAFNKSGSCFITGSYDRTCKIWDTASGEELHTLEGHRNVVYAIAFNNPYGDKVATGSFDKTCKLWSAETGKCFYTFRGHTAEIVCLAFNPQSTLVATGSMDTTAKLWDVESGEEVSTLAGHFAEIISLCFNTTGDRLVTGSFDHTAILWDVPSGRKVHVLSGHRGEISCVQFNWDCSLIATASLDKSCKVWDAEGGQCLATLLGHND----EVLDVCFNYTGQLIATASADGTSRVFSTDTFQCLCQLEGHKGEISKVCFNAQGSRVLTASVDKTSRVW 372          

HSP 2 Score: 96.2857 bits (238), Expect = 9.524e-21
Identity = 70/241 (29.05%), Postives = 121/241 (50.21%), Query Frame = 2
Query: 1163 QVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSD--SVIKMVETASFNVTSLVGHEDSVQSAMFDHDGEFLISAS 1879
            +   T +GHT  + C AF+     +AT S DTT K+W++ + E + T  GH   I S+ ++T+   L T S D T  +WD+ S +   +L GH   ++ VQF  + +++ T+S DK+  +WDA    C  ++ GH   V     N  G  IA+  A G  + +        +  ++      + V ++  GS V  +S D  S +  V+T +  +  L GH D + S  F+++G+ +I+ +
Sbjct:  168 KCFYTFRGHTAEIVCLAFNPQSTLVATGSMDTTAKLWDVESGEEVSTLAGHFAEIISLCFNTTGDRLVTGSFDHTAILWDVPSGRKVHVLSGHRGEISCVQFNWDCSLIATASLDKSCKVWDAEGGQCLATLLGHNDEVLDVCFNYTGQLIATASADGTSRVFSTDTFQ-CLCQLEGHKGEISKVCFNAQGSRVLTASVDKTSRVWCVKTGA-CLQVLEGHSDEIFSCAFNYEGDTIITGN 406          

HSP 3 Score: 69.3218 bits (168), Expect = 4.551e-12
Identity = 46/150 (30.67%), Postives = 77/150 (51.33%), Query Frame = 2
Query: 1046 NTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLT 1495
            + +  H G ++C++ + +  +  T S D S K+W  +  Q L T  GH + V    F+  G+ +AT S D T ++++    +CL   EGH   I  V ++     + TAS DKT +VW + +  C  +L GHSD + S  F    + ++T
Sbjct:  255 HVLSGHRGEISCVQFNWDCSLIATASLDKSCKVWDAEGGQCLATLLGHNDEVLDVCFNYTGQLIATASADGTSRVFSTDTFQCLCQLEGHKGEISKVCFNAQGSRVLTASVDKTSRVWCVKTGACLQVLEGHSDEIFSCAFNYEGDTIIT 404          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Zebrafish
Match: daw1 (dynein assembly factor with WDR repeat domains 1 [Source:NCBI gene;Acc:556760])

HSP 1 Score: 119.398 bits (298), Expect = 1.585e-28
Identity = 93/295 (31.53%), Postives = 147/295 (49.83%), Query Frame = 2
Query: 1034 FKLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDND-GEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDC---RQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFN-VTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            F L   ++AH   +T +  +K+   F T S D + K+W   S + L T +GH N V   AF+N  G+K+AT S D T K+W+    +C YTF GH+  I  + ++  +  +AT S D T K+WD+ S +  + L GH   + S+ F    + L+T S D T  LWD         +SGH+  ++    N   + IA+       K WD    + LAT +   D       DV ++ +G  +A +S+D   ++  T +F  +  L GH+  +    F+  G  +++AS D T RVW
Sbjct:   82 FYLFRALQAHILPLTNVAFNKSGSCFITGSYDRTCKIWDTASGEELHTLEGHRNVVYAIAFNNPYGDKVATGSFDKTCKLWSAETGKCFYTFRGHTAEIVCLAFNPQSTLVATGSMDTTAKLWDVESGEEVSTLAGHFAEIISLCFNTTGDRLVTGSFDHTAILWDVPSGRKVHVLSGHRGEISCVQFNWDCSLIATASLDKSCKVWDAEGGQCLATLLGHND----EVLDVCFNYTGQLIATASADGTSRVFSTDTFQCLCQLEGHKGEISKVCFNAQGSRVLTASVDKTSRVW 372          

HSP 2 Score: 105.916 bits (263), Expect = 5.046e-24
Identity = 75/249 (30.12%), Postives = 126/249 (50.60%), Query Frame = 2
Query: 1163 QVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSD--SVIKMVETASFNVTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            +   T +GHT  + C AF+     +AT S DTT K+W++ + E + T  GH   I S+ ++T+   L T S D T  +WD+ S +   +L GH   ++ VQF  + +++ T+S DK+  +WDA    C  ++ GH   V     N  G  IA+  A G  + +        +  ++      + V ++  GS V  +S D  S +  V+T +  +  L GH D + S  F+++G+ +I+ S D T R+W
Sbjct:  168 KCFYTFRGHTAEIVCLAFNPQSTLVATGSMDTTAKLWDVESGEEVSTLAGHFAEIISLCFNTTGDRLVTGSFDHTAILWDVPSGRKVHVLSGHRGEISCVQFNWDCSLIATASLDKSCKVWDAEGGQCLATLLGHNDEVLDVCFNYTGQLIATASADGTSRVFSTDTFQ-CLCQLEGHKGEISKVCFNAQGSRVLTASVDKTSRVWCVKTGA-CLQVLEGHSDEIFSCAFNYEGDTIITGSKDNTCRIW 414          

HSP 3 Score: 76.2554 bits (186), Expect = 2.503e-14
Identity = 50/160 (31.25%), Postives = 82/160 (51.25%), Query Frame = 2
Query: 1046 NTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLW 1525
            + +  H G ++C++ + +  +  T S D S K+W  +  Q L T  GH + V    F+  G+ +AT S D T ++++    +CL   EGH   I  V ++     + TAS DKT +VW + +  C  +L GHSD + S  F    + ++T S D T  +W
Sbjct:  255 HVLSGHRGEISCVQFNWDCSLIATASLDKSCKVWDAEGGQCLATLLGHNDEVLDVCFNYTGQLIATASADGTSRVFSTDTFQCLCQLEGHKGEISKVCFNAQGSRVLTASVDKTSRVWCVKTGACLQVLEGHSDEIFSCAFNYEGDTIITGSKDNTCRIW 414          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Zebrafish
Match: pafah1b1b (platelet-activating factor acetylhydrolase 1b, regulatory subunit 1b [Source:NCBI gene;Acc:394247])

HSP 1 Score: 117.087 bits (292), Expect = 8.156e-28
Identity = 69/260 (26.54%), Postives = 128/260 (49.23%), Query Frame = 2
Query: 1184 GHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFW-----DCR-------QLATSINTIDLGFHP-------ANDVRYDTSGSCVAMSSSDSVIKMVETAS-FNVTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            GH + V+   F      + + S D T+K+W+  A +   T +GH+ S+  + +  +   LA+ S D TIK+WD    +C   + GH  +V+SV  + N + ++++S DKT+ +W+     C ++ +GH+  V     N+ GT +ASC     ++ W     +C+        +   I+      HP       + + +    G  +   S D  IKM + ++   + +LVGH++ V+  +F   G F++S + D T+R+W
Sbjct:  106 GHRSPVTRVIFHPVFSLMVSASEDATIKVWDYEAGDFERTLKGHTDSVQDISFDQTGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTMKMWEVATGYCVKTFTGHREWVRMVRPNQDGTLLASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESAHPTISEATGSENKKSGKPGPFLLSGSRDKTIKMWDISTGMCLMTLVGHDNWVRGVLFHPGGRFVVSCADDKTLRIW 365          

HSP 2 Score: 97.0561 bits (240), Expect = 4.737e-21
Identity = 59/230 (25.65%), Postives = 105/230 (45.65%), Query Frame = 2
Query: 1031 GFKLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSA--------------------PFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCR 1660
            GF+   T+  H+  V+ +    N     + S D + K+W + +   + T  GH  WV     + DG  LA+ S D T+++W ++  EC      H   +  + W   +                    PFL + S DKTIK+WD+++  C   L GH + V  V F      +++ + DKT+ +WD +   C +++S H++ V S + ++    + +      +K W+CR
Sbjct:  181 GFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTMKMWEVATGYCVKTFTGHREWVRMVRPNQDGTLLASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESAHPTISEATGSENKKSGKPGPFLLSGSRDKTIKMWDISTGMCLMTLVGHDNWVRGVLFHPGGRFVVSCADDKTLRIWDYKNKRCMKTLSAHEHFVTSLDFHKTSPYVVTGSVDQTVKVWECR 410          

HSP 3 Score: 88.1965 bits (217), Expect = 3.953e-18
Identity = 67/265 (25.28%), Postives = 115/265 (43.40%), Query Frame = 2
Query: 1049 TIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNS--------------------NILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVE 1783
            T+K H  +V  I   +  K+  + S D + KLW     + + T  GH + VS  A   +G+ + + S D T+K+W ++   C+ TF GH + +  V  +     LA+ S+D+T++VW + + +C+  LR H   V  + +   S                      LL+ S DKT+ +WD     C  ++ GH   V     +  G  + SC     L+ WD +     + T+    H    + +  +   V   S D  +K+ E
Sbjct:  145 TLKGHTDSVQDISFDQTGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTMKMWEVATGYCVKTFTGHREWVRMVRPNQDGTLLASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESAHPTISEATGSENKKSGKPGPFLLSGSRDKTIKMWDISTGMCLMTLVGHDNWVRGVLFHPGGRFVVSCADDKTLRIWDYKN-KRCMKTLSAHEHFVTSLDFHKTSPYVVTGSVDQTVKVWE 408          

HSP 4 Score: 86.2705 bits (212), Expect = 1.579e-17
Identity = 59/203 (29.06%), Postives = 85/203 (41.87%), Query Frame = 2
Query: 1298 YTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETAS-FNVTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            Y   GH   +  V +H     + +AS D TIKVWD  +      L+GH+DSV  + F     +L + SAD T+ LWD +   C +++ GH + V+S  I   G +I S                                           +S D  +KM E A+ + V +  GH + V+    + DG  L S S D TVRVW
Sbjct:  102 YALSGHRSPVTRVIFHPVFSLMVSASEDATIKVWDYEAGDFERTLKGHTDSVQDISFDQTGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVS-------------------------------------------ASRDKTMKMWEVATGYCVKTFTGHREWVRMVRPNQDGTLLASCSNDQTVRVW 261          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Zebrafish
Match: pafah1b1b (platelet-activating factor acetylhydrolase 1b, regulatory subunit 1b [Source:NCBI gene;Acc:394247])

HSP 1 Score: 117.087 bits (292), Expect = 8.156e-28
Identity = 69/260 (26.54%), Postives = 128/260 (49.23%), Query Frame = 2
Query: 1184 GHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFW-----DCR-------QLATSINTIDLGFHP-------ANDVRYDTSGSCVAMSSSDSVIKMVETAS-FNVTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            GH + V+   F      + + S D T+K+W+  A +   T +GH+ S+  + +  +   LA+ S D TIK+WD    +C   + GH  +V+SV  + N + ++++S DKT+ +W+     C ++ +GH+  V     N+ GT +ASC     ++ W     +C+        +   I+      HP       + + +    G  +   S D  IKM + ++   + +LVGH++ V+  +F   G F++S + D T+R+W
Sbjct:  106 GHRSPVTRVIFHPVFSLMVSASEDATIKVWDYEAGDFERTLKGHTDSVQDISFDQTGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTMKMWEVATGYCVKTFTGHREWVRMVRPNQDGTLLASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESAHPTISEATGSENKKSGKPGPFLLSGSRDKTIKMWDISTGMCLMTLVGHDNWVRGVLFHPGGRFVVSCADDKTLRIW 365          

HSP 2 Score: 97.0561 bits (240), Expect = 4.737e-21
Identity = 59/230 (25.65%), Postives = 105/230 (45.65%), Query Frame = 2
Query: 1031 GFKLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSA--------------------PFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCR 1660
            GF+   T+  H+  V+ +    N     + S D + K+W + +   + T  GH  WV     + DG  LA+ S D T+++W ++  EC      H   +  + W   +                    PFL + S DKTIK+WD+++  C   L GH + V  V F      +++ + DKT+ +WD +   C +++S H++ V S + ++    + +      +K W+CR
Sbjct:  181 GFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTMKMWEVATGYCVKTFTGHREWVRMVRPNQDGTLLASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESAHPTISEATGSENKKSGKPGPFLLSGSRDKTIKMWDISTGMCLMTLVGHDNWVRGVLFHPGGRFVVSCADDKTLRIWDYKNKRCMKTLSAHEHFVTSLDFHKTSPYVVTGSVDQTVKVWECR 410          

HSP 3 Score: 88.1965 bits (217), Expect = 3.953e-18
Identity = 67/265 (25.28%), Postives = 115/265 (43.40%), Query Frame = 2
Query: 1049 TIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNS--------------------NILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVE 1783
            T+K H  +V  I   +  K+  + S D + KLW     + + T  GH + VS  A   +G+ + + S D T+K+W ++   C+ TF GH + +  V  +     LA+ S+D+T++VW + + +C+  LR H   V  + +   S                      LL+ S DKT+ +WD     C  ++ GH   V     +  G  + SC     L+ WD +     + T+    H    + +  +   V   S D  +K+ E
Sbjct:  145 TLKGHTDSVQDISFDQTGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTMKMWEVATGYCVKTFTGHREWVRMVRPNQDGTLLASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESAHPTISEATGSENKKSGKPGPFLLSGSRDKTIKMWDISTGMCLMTLVGHDNWVRGVLFHPGGRFVVSCADDKTLRIWDYKN-KRCMKTLSAHEHFVTSLDFHKTSPYVVTGSVDQTVKVWE 408          

HSP 4 Score: 86.2705 bits (212), Expect = 1.579e-17
Identity = 59/203 (29.06%), Postives = 85/203 (41.87%), Query Frame = 2
Query: 1298 YTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETAS-FNVTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            Y   GH   +  V +H     + +AS D TIKVWD  +      L+GH+DSV  + F     +L + SAD T+ LWD +   C +++ GH + V+S  I   G +I S                                           +S D  +KM E A+ + V +  GH + V+    + DG  L S S D TVRVW
Sbjct:  102 YALSGHRSPVTRVIFHPVFSLMVSASEDATIKVWDYEAGDFERTLKGHTDSVQDISFDQTGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVS-------------------------------------------ASRDKTMKMWEVATGYCVKTFTGHREWVRMVRPNQDGTLLASCSNDQTVRVW 261          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Xenopus
Match: SPAG16 (sperm associated antigen 16 [Source:NCBI gene;Acc:100498138])

HSP 1 Score: 275.018 bits (702), Expect = 2.714e-85
Identity = 140/317 (44.16%), Postives = 202/317 (63.72%), Query Frame = 2
Query:  989 LKLRPPPGHLTRVGGFKLTNTIKAHEGAVTC-----------IRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNVTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVWS 1906
            LK  PPP  +  +  + L N +  ++   T            +  H  K++  TTSDD  WK+W + S  ++MTG+GHT+W++   F   G KLAT SGD T+++W+ S +EC+ T EGH+Q++W   WH+   FLA+ S D   K+WDLNS +CR  +RGH DSVNS++FL  SNI+LTSSADKT+ LWDAR+  C Q+  GH ++ N A  N +G  IASCD++G LK WD R+ A ++ ++D G HP N V +  SG  V+++S+D  +K++   S  + SL GHED VQ  +F H+G++LIS  +D TVR+WS
Sbjct:  108 LKKDPPPSTIDLLFVYCLHNMMILNDYCGTSQLHKIFFLLGSLALHPRKEILVTTSDDRLWKMWDIPSGNIIMTGEGHTDWLAGCCFHPKGTKLATVSGDKTVRLWDFSKSECILTLEGHTQAVWGCSWHSCGDFLASCSLDGNSKIWDLNSERCRYTMRGHMDSVNSIEFLPYSNIVLTSSADKTLSLWDARMGLCAQTFYGHLHSCNHATFNMKGDTIASCDSYGVLKLWDVRK-AVAMLSVDAGPHPGNQVAFHPSGQSVSLASNDGSVKLLALPSGQLESLDGHEDDVQCVIFSHNGDYLISGGSDGTVRIWS 423          

HSP 2 Score: 130.183 bits (326), Expect = 6.366e-32
Identity = 126/424 (29.72%), Postives = 189/424 (44.58%), Query Frame = 2
Query:  479 KAKEMHVKLRGERDYHKLQHRRMVQEKNKLIDEIKRLRDHYASYQPALEQLQQKYQTAMKEKMLSKLERDRICGQMQGLQMTLQSLENS-------------------------TLPITTDDDG----KRLFFRDRSQVSNIHPCRKGGVLTVDKLNRGATQKKLADAREFKSKNDALNGEKENNDTPFPVDKGINEDLLKLRPPPGHLT-RVGGFKLTN---TIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQS-----------------------IW---------SVD----------WHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLW 1525
            KAKE  +KL  ERD+HK+ H+R+ QEKNKLI++IK+L++HY SY+P L QL +KY+T +++KML  LERDR  G++ GLQ TL++LE+                           + I  D  G     ++FF   S    +HP ++  V T D         +L    +  S N  + GE     T +      +    KL    G  T R+  F  +    T++ H  AV     H       + S D + K+W L+S +   T +GH + V+   F      + T+S D TL +W+     C  TF GH  S                       +W         SVD          +H S   ++ AS+D ++K+  L S +  + L GH D V  V F  N + L++  +D TV +W
Sbjct:   13 KAKEAMIKLYKERDFHKMHHKRVAQEKNKLINDIKKLKEHYTSYEPLLRQLHEKYETVLRQKMLISLERDRAVGEVTGLQATLRNLESGHKIDVSLKKDPPPSTIDLLFVYCLHNMMILNDYCGTSQLHKIFFLLGSLA--LHPRKEILVTTSD--------DRLWKMWDIPSGNIIMTGEGH---TDWLAGCCFHPKGTKLATVSGDKTVRLWDFSKSECILTLEGHTQAVWGCSWHSCGDFLASCSLDGNSKIWDLNSERCRYTMRGHMDSVNSIEFLPYSNIVLTSSADKTLSLWDARMGLCAQTFYGHLHSCNHATFNMKGDTIASCDSYGVLKLWDVRKAVAMLSVDAGPHPGNQVAFHPSGQSVSLASNDGSVKLLALPSGQLES-LDGHEDDVQCVIFSHNGDYLISGGSDGTVRIW 422          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Xenopus
Match: daw1 (dynein assembly factor with WDR repeat domains 1 [Source:NCBI gene;Acc:394975])

HSP 1 Score: 122.865 bits (307), Expect = 1.810e-29
Identity = 89/292 (30.48%), Postives = 147/292 (50.34%), Query Frame = 2
Query: 1034 FKLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDND-GEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFN-VTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            F L   ++AH   +T +  +K+   F T S D + K+W   S + L T +GH N V    F+N  G+K+AT S D T K+W+    +C +TF GH+  I  + ++  +  +AT S D T K+WD+ S +    L GH+  + S+ F    + L+T S D TV +W+        ++ GH+  ++SA  N   + IA+       K WD       + T+        DV +D++G  VA +S+D   ++   +S   +  L GHE  +    F+  G  +++AS+D T R+W
Sbjct:  102 FYLFKVLRAHILPLTNVAFNKSGSSFITGSYDRTCKVWDTASGEELHTLEGHRNVVYAIQFNNPYGDKIATGSFDKTCKLWSAETGKCYHTFRGHTAEIVCLAFNPQSTLIATGSMDTTAKLWDIQSGEEALTLSGHAAEIISLSFNTTGDRLITGSFDHTVSVWEIPSGRRNHTLIGHRGEISSAQFNWDCSLIATASMDKSCKLWDSLN-GKCVATLTGHEDEVLDVTFDSTGQLVATASADGTARVYSASSRKCLAKLEGHEGEISKICFNAQGNRILTASSDKTSRLW 392          

HSP 2 Score: 109.768 bits (273), Expect = 5.605e-25
Identity = 72/247 (29.15%), Postives = 127/247 (51.42%), Query Frame = 2
Query: 1175 TGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTI-DLGFHPA--NDVRYDTSGSCVAMSSSDSVIKMVETASFN-VTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            T +GHT  + C AF+     +AT S DTT K+W++ + E   T  GH+  I S+ ++T+   L T S D T+ VW++ S +    L GH   ++S QF  + +++ T+S DK+  LWD+    C  +++GH+  V     +  G  +A+  A G  + +     A+S   +  L  H    + + ++  G+ +  +SSD   ++    +   +  L GH D + S  F+++G  +I+ S D T R+W
Sbjct:  192 TFRGHTAEIVCLAFNPQSTLIATGSMDTTAKLWDIQSGEEALTLSGHAAEIISLSFNTTGDRLITGSFDHTVSVWEIPSGRRNHTLIGHRGEISSAQFNWDCSLIATASMDKSCKLWDSLNGKCVATLTGHEDEVLDVTFDSTGQLVATASADGTARVYS----ASSRKCLAKLEGHEGEISKICFNAQGNRILTASSDKTSRLWNPHTGECLQVLKGHTDEIFSCAFNYEGNTIITGSKDNTCRIW 434          

HSP 3 Score: 76.6406 bits (187), Expect = 3.529e-14
Identity = 49/160 (30.63%), Postives = 87/160 (54.37%), Query Frame = 2
Query: 1046 NTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLW 1525
            +T+  H G ++  + + +  +  T S D S KLW   + + + T  GH + V    FD+ G+ +AT S D T ++++ S+ +CL   EGH   I  + ++     + TAS DKT ++W+ ++ +C  +L+GH+D + S  F    N ++T S D T  +W
Sbjct:  275 HTLIGHRGEISSAQFNWDCSLIATASMDKSCKLWDSLNGKCVATLTGHEDEVLDVTFDSTGQLVATASADGTARVYSASSRKCLAKLEGHEGEISKICFNAQGNRILTASSDKTSRLWNPHTGECLQVLKGHTDEIFSCAFNYEGNTIITGSKDNTCRIW 434          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Xenopus
Match: daw1 (dynein assembly factor with WDR repeat domains 1 [Source:NCBI gene;Acc:394975])

HSP 1 Score: 122.865 bits (307), Expect = 2.409e-29
Identity = 89/292 (30.48%), Postives = 147/292 (50.34%), Query Frame = 2
Query: 1034 FKLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDND-GEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFN-VTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            F L   ++AH   +T +  +K+   F T S D + K+W   S + L T +GH N V    F+N  G+K+AT S D T K+W+    +C +TF GH+  I  + ++  +  +AT S D T K+WD+ S +    L GH+  + S+ F    + L+T S D TV +W+        ++ GH+  ++SA  N   + IA+       K WD       + T+        DV +D++G  VA +S+D   ++   +S   +  L GHE  +    F+  G  +++AS+D T R+W
Sbjct:  106 FYLFKVLRAHILPLTNVAFNKSGSSFITGSYDRTCKVWDTASGEELHTLEGHRNVVYAIQFNNPYGDKIATGSFDKTCKLWSAETGKCYHTFRGHTAEIVCLAFNPQSTLIATGSMDTTAKLWDIQSGEEALTLSGHAAEIISLSFNTTGDRLITGSFDHTVSVWEIPSGRRNHTLIGHRGEISSAQFNWDCSLIATASMDKSCKLWDSLN-GKCVATLTGHEDEVLDVTFDSTGQLVATASADGTARVYSASSRKCLAKLEGHEGEISKICFNAQGNRILTASSDKTSRLW 396          

HSP 2 Score: 68.9366 bits (167), Expect = 1.094e-11
Identity = 35/111 (31.53%), Postives = 63/111 (56.76%), Query Frame = 2
Query: 1163 QVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLT 1495
            + + T  GH + V    FD+ G+ +AT S D T ++++ S+ +CL   EGH   I  + ++     + TAS DKT ++W+ ++ +C  +L+GH+D + S  F    N ++T
Sbjct:  318 KCVATLTGHEDEVLDVTFDSTGQLVATASADGTARVYSASSRKCLAKLEGHEGEISKICFNAQGNRILTASSDKTSRLWNPHTGECLQVLKGHTDEIFSCAFNYEGNTIIT 428          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Xenopus
Match: daw1 (dynein assembly factor with WDR repeat domains 1 [Source:NCBI gene;Acc:394975])

HSP 1 Score: 122.479 bits (306), Expect = 2.628e-29
Identity = 89/292 (30.48%), Postives = 147/292 (50.34%), Query Frame = 2
Query: 1034 FKLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDND-GEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFN-VTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            F L   ++AH   +T +  +K+   F T S D + K+W   S + L T +GH N V    F+N  G+K+AT S D T K+W+    +C +TF GH+  I  + ++  +  +AT S D T K+WD+ S +    L GH+  + S+ F    + L+T S D TV +W+        ++ GH+  ++SA  N   + IA+       K WD       + T+        DV +D++G  VA +S+D   ++   +S   +  L GHE  +    F+  G  +++AS+D T R+W
Sbjct:   99 FYLFKVLRAHILPLTNVAFNKSGSSFITGSYDRTCKVWDTASGEELHTLEGHRNVVYAIQFNNPYGDKIATGSFDKTCKLWSAETGKCYHTFRGHTAEIVCLAFNPQSTLIATGSMDTTAKLWDIQSGEEALTLSGHAAEIISLSFNTTGDRLITGSFDHTVSVWEIPSGRRNHTLIGHRGEISSAQFNWDCSLIATASMDKSCKLWDSLN-GKCVATLTGHEDEVLDVTFDSTGQLVATASADGTARVYSASSRKCLAKLEGHEGEISKICFNAQGNRILTASSDKTSRLW 389          

HSP 2 Score: 68.9366 bits (167), Expect = 1.126e-11
Identity = 45/150 (30.00%), Postives = 82/150 (54.67%), Query Frame = 2
Query: 1046 NTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLT 1495
            +T+  H G ++  + + +  +  T S D S KLW   + + + T  GH + V    FD+ G+ +AT S D T ++++ S+ +CL   EGH   I  + ++     + TAS DKT ++W+ ++ +C  +L+GH+D + S  F    N ++T
Sbjct:  272 HTLIGHRGEISSAQFNWDCSLIATASMDKSCKLWDSLNGKCVATLTGHEDEVLDVTFDSTGQLVATASADGTARVYSASSRKCLAKLEGHEGEISKICFNAQGNRILTASSDKTSRLWNPHTGECLQVLKGHTDEIFSCAFNYEGNTIIT 421          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Xenopus
Match: daw1 (dynein assembly factor with WDR repeat domains 1 [Source:NCBI gene;Acc:394975])

HSP 1 Score: 122.094 bits (305), Expect = 3.610e-29
Identity = 89/292 (30.48%), Postives = 147/292 (50.34%), Query Frame = 2
Query: 1034 FKLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDND-GEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFN-VTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            F L   ++AH   +T +  +K+   F T S D + K+W   S + L T +GH N V    F+N  G+K+AT S D T K+W+    +C +TF GH+  I  + ++  +  +AT S D T K+WD+ S +    L GH+  + S+ F    + L+T S D TV +W+        ++ GH+  ++SA  N   + IA+       K WD       + T+        DV +D++G  VA +S+D   ++   +S   +  L GHE  +    F+  G  +++AS+D T R+W
Sbjct:   85 FYLFKVLRAHILPLTNVAFNKSGSSFITGSYDRTCKVWDTASGEELHTLEGHRNVVYAIQFNNPYGDKIATGSFDKTCKLWSAETGKCYHTFRGHTAEIVCLAFNPQSTLIATGSMDTTAKLWDIQSGEEALTLSGHAAEIISLSFNTTGDRLITGSFDHTVSVWEIPSGRRNHTLIGHRGEISSAQFNWDCSLIATASMDKSCKLWDSLN-GKCVATLTGHEDEVLDVTFDSTGQLVATASADGTARVYSASSRKCLAKLEGHEGEISKICFNAQGNRILTASSDKTSRLW 375          

HSP 2 Score: 68.5514 bits (166), Expect = 1.442e-11
Identity = 45/150 (30.00%), Postives = 82/150 (54.67%), Query Frame = 2
Query: 1046 NTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLT 1495
            +T+  H G ++  + + +  +  T S D S KLW   + + + T  GH + V    FD+ G+ +AT S D T ++++ S+ +CL   EGH   I  + ++     + TAS DKT ++W+ ++ +C  +L+GH+D + S  F    N ++T
Sbjct:  258 HTLIGHRGEISSAQFNWDCSLIATASMDKSCKLWDSLNGKCVATLTGHEDEVLDVTFDSTGQLVATASADGTARVYSASSRKCLAKLEGHEGEISKICFNAQGNRILTASSDKTSRLWNPHTGECLQVLKGHTDEIFSCAFNYEGNTIIT 407          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Mouse
Match: Spag16 (sperm associated antigen 16 [Source:MGI Symbol;Acc:MGI:1913972])

HSP 1 Score: 437.187 bits (1123), Expect = 2.177e-145
Identity = 244/629 (38.79%), Postives = 366/629 (58.19%), Query Frame = 2
Query:   44 ENKYFLEKIEIPVYEESEFDYDFVKSDEILMLEDGTFDSFEHTSKILDELQEDERALEEAIFNNRPKLTTVPPSMDDYIRSFLLRLGLTRTLDCFQLEWFEKKHKGLLHEEDISEVPDIYVRNQQLDIQVKLMREDRNKYKQAALKAKEMHVKLRGERDYHKLQHRRMVQEKNKLIDEIKRLRDHYASYQPALEQLQQKYQTAMKEKMLSKLERDRICGQMQGLQMTLQSLE--NSTLPITTDDDGKRLFFRDRSQVSNIHPCRKGGVLTVDKLNRGATQKKLADAREFKSKNDALNGEKENNDTPFPVDKGINEDLLKLRPPPGHLTRVGG-------FKLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNVTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            E  Y+LE++ I    E E +Y+ +  D   + E    +  E    I+ E   D   LE+      P    +  +++D++ +FL+++G+TRTLDCFQ EW+E   K     + +  VPD+Y +   L+ + K ++++   +KQAA KAKE  ++ + ERD+H++ H+R+VQEKNKLI ++K L+ HYASY+P +  L +K+   +KEKML+ LERDR  G++ GLQ TL++++  +  +P+           R+    +  H C K      +  + G TQK L +ARE       L  EK+  D+ FPVD         ++P P   +           +KL N  + HE  V+CI  H  +    + S+D  WK+  L    VL+TG GHT+W+S   F   G KLAT+SGD+T+K+W+L+  EC  T EGH+ ++WS  WH+   F+A+AS D T K+WD+NS +CR  L GH+DSVNS++F   SNILLT+SADKT+ +WDAR   C QS+ GH ++VN A    +G  IASCDA G  K WD R+L   I +ID+G    N+V +D SG  +A +S++ +I +++  S  +  LVGHE  V S +F H GE L S  +D T+R+W
Sbjct:   33 EGAYYLEQVTITETSEDECEYEEIPDDNFSIPEGE--EDLEKAIHIIGEQARDIHILEQQTI--LPARNVMQEAIEDFLCNFLIKMGMTRTLDCFQAEWYELIQKKGSDFKGLGNVPDVYSQVMLLETENKNLKKELKHFKQAAEKAKEDLLRTQKERDFHRMHHKRIVQEKNKLIADLKGLKLHYASYEPTIRVLHEKHHALLKEKMLTSLERDRAVGKISGLQATLKNIDMGHIQVPVIKGSYESASITRESGDRAG-HSCEK------ENSSEGPTQKSLREAREEVGYKSKLKNEKK--DSEFPVD---------MQPDPNVTSCTENVSAAKFDYKLNNIFRLHELPVSCIVMHPCRDYLISCSEDRLWKMVGLPQGNVLLTGSGHTDWLSGCCFHPSGSKLATSSGDSTIKLWDLNKGECTLTLEGHNHAVWSCTWHSCGDFVASASLDMTSKIWDVNSERCRYTLYGHTDSVNSIEFFPFSNILLTASADKTLSVWDARTGKCEQSLYGHMHSVNDATFTPRGHIIASCDARGVTKLWDFRKL-IPIVSIDVGPSSGNEVNFDQSGRVLAQASANGIIHLLDLKSGQIHKLVGHESEVHSVVFSHLGENLYSGGSDGTIRLW 638          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Mouse
Match: Spag16 (sperm associated antigen 16 [Source:MGI Symbol;Acc:MGI:1913972])

HSP 1 Score: 172.17 bits (435), Expect = 3.439e-47
Identity = 115/356 (32.30%), Postives = 188/356 (52.81%), Query Frame = 2
Query:   44 ENKYFLEKIEIPVYEESEFDYDFVKSDEILMLEDGTFDSFEHTSKILDELQEDERALEEAIFNNRPKLTTVPPSMDDYIRSFLLRLGLTRTLDCFQLEWFEKKHKGLLHEEDISEVPDIYVRNQQLDIQVKLMREDRNKYKQAALKAKEMHVKLRGERDYHKLQHRRMVQEKNKLIDEIKRLRDHYASYQPALEQLQQKYQTAMKEKMLSKLERDRICGQMQGLQMTLQSLE--NSTLPITTDDDGKRLFFRDRSQVSNIHPCRKGGVLTVDKLNRGATQKKLADAREFKSKNDALNGEKENNDT------PFPVDKG-INEDLLKLRPPPG--HLTRVGGFKLTNTIKAHEGAVT 1078
            E  Y+LE++ I    E E +Y+ +  D    + +G  D  E    I+ E   D   LE+      P    +  +++D++ +FL+++G+TRTLDCFQ EW+E   K     + +  VPD+Y +   L+ + K ++++   +KQAA KAKE  ++ + ERD+H++ H+R+VQEKNKLI ++K L+ HYASY+P +  L +K+   +KEKML+ LERDR  G++ GLQ TL++++  +  +P+           R+    +  H C K      +  + G TQK L +ARE       L  EK+ + T      P P +   ++     L P P        G F   N I   +G+++
Sbjct:   33 EGAYYLEQVTITETSEDECEYEEIPDDN-FSIPEGEED-LEKAIHIIGEQARDIHILEQQTI--LPARNVMQEAIEDFLCNFLIKMGMTRTLDCFQAEWYELIQKKGSDFKGLGNVPDVYSQVMLLETENKNLKKELKHFKQAAEKAKEDLLRTQKERDFHRMHHKRIVQEKNKLIADLKGLKLHYASYEPTIRVLHEKHHALLKEKMLTSLERDRAVGKISGLQATLKNIDMGHIQVPVIKGSYESASITRESGDRAG-HSCEK------ENSSEGPTQKSLREAREEVGYKSKLKNEKKPSSTESKRVQPSPTESHMVSSRSSSLYPTPSFHQQQSRGNFPTWNKITPQQGSIS 377          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Mouse
Match: Wdr5b (WD repeat domain 5B [Source:MGI Symbol;Acc:MGI:1916794])

HSP 1 Score: 120.553 bits (301), Expect = 1.459e-29
Identity = 75/248 (30.24%), Postives = 125/248 (50.40%), Query Frame = 2
Query: 1172 MTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFN-VTSLVGH--EDSVQSAMFDHDG-EFLISASADCTVRVW 1903
            +T  GH+  +S   F  +GE LA+++ D  + IW      C  T  GHS  I  V W + +  L +AS DKT+KVWD+ S KC   L+GHSD V    F   SN++++ S D++V +W+ +   C +++S H   +++ N N  G+ I S    G  + WD           D G  P + V++  +G  +  ++ D+ +K+ + +    + +  GH  E     A F   G ++++S S D  V +W
Sbjct:   33 LTLAGHSAAISSVKFSPNGEWLASSAADALIIIWGAYDGNCKKTLYGHSLEISDVAWSSDSSRLVSASDDKTLKVWDMRSGKCLKTLKGHSDFVFCCDFNPPSNLIVSGSFDESVKIWEVKTGKCLKTLSAHSDPISAVNFNCNGSLIVSGSYDGLCRIWDAASGQCLRTLADEGNPPVSFVKFSPNGKYILTATLDNTLKLWDYSRGRCLKTYTGHKNEKYCLFASFSVTGRKWVVSGSEDNMVYIW 280          

HSP 2 Score: 79.7221 bits (195), Expect = 1.080e-15
Identity = 42/137 (30.66%), Postives = 76/137 (55.47%), Query Frame = 2
Query: 1163 QVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKC-RTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQ 1570
            + L T KGH+++V C  F+     + + S D ++KIW +   +CL T   HS  I +V+++ +   + + S+D   ++WD  S +C RT+    +  V+ V+F  N   +LT++ D T+ LWD     C ++ +GH+
Sbjct:  114 KCLKTLKGHSDFVFCCDFNPPSNLIVSGSFDESVKIWEVKTGKCLKTLSAHSDPISAVNFNCNGSLIVSGSYDGLCRIWDAASGQCLRTLADEGNPPVSFVKFSPNGKYILTATLDNTLKLWDYSRGRCLKTYTGHK 250          

HSP 3 Score: 62.3882 bits (150), Expect = 4.920e-10
Identity = 42/165 (25.45%), Postives = 74/165 (44.85%), Query Frame = 2
Query: 1421 RTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQ---LATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFN-VTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            R  L GHS +++SV+F  N   L +S+AD  + +W A    C +++ GH   ++    +   + + S      LK WD R    L T     D  F       ++   + +   S D  +K+ E  +   + +L  H D + +  F+ +G  ++S S D   R+W
Sbjct:   32 RLTLAGHSAAISSVKFSPNGEWLASSAADALIIIWGAYDGNCKKTLYGHSLEISDVAWSSDSSRLVSASDDKTLKVWDMRSGKCLKTLKGHSDFVFC----CDFNPPSNLIVSGSFDESVKIWEVKTGKCLKTLSAHSDPISAVNFNCNGSLIVSGSYDGLCRIW 192          

HSP 4 Score: 55.4546 bits (132), Expect = 9.690e-8
Identity = 53/197 (26.90%), Postives = 89/197 (45.18%), Query Frame = 2
Query: 1004 PPGHLTRVGGF------------KLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNW-VSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQ------SIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSA--DKTVCLWDA 1531
            PP +L   G F            K   T+ AH   ++ +  + N  +  + S D   ++W   S Q L T     N  VS   F  +G+ + T + D TLK+W+ S   CL T+ GH        + +SV   T   ++ + S D  + +W+L + +    L+GH+D V S       NI+ +++   DKT+ +W +
Sbjct:  133 PPSNLIVSGSFDESVKIWEVKTGKCLKTLSAHSDPISAVNFNCNGSLIVSGSYDGLCRIWDAASGQCLRTLADEGNPPVSFVKFSPNGKYILTATLDNTLKLWDYSRGRCLKTYTGHKNEKYCLFASFSV---TGRKWVVSGSEDNMVYIWNLQTKEIVQRLQGHTDVVISAACHPTKNIIASAALENDKTIKVWSS 326          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Mouse
Match: Wdr5 (WD repeat domain 5 [Source:MGI Symbol;Acc:MGI:2155884])

HSP 1 Score: 119.783 bits (299), Expect = 3.878e-29
Identity = 73/249 (29.32%), Postives = 127/249 (51.00%), Query Frame = 2
Query: 1172 MTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFN-VTSLVGHEDSVQSAMFDH----DGEFLISASADCTVRVW 1903
             T  GHT  VS   F  +GE LA++S D  +KIW     +   T  GH   I  V W + +  L +AS DKT+K+WD++S KC   L+GHS+ V    F   SN++++ S D++V +WD +   C +++  H   V++ + N  G+ I S    G  + WD          ID    P + V++  +G  +  ++ D+ +K+ + +    + +  GH++  +  +F +     G++++S S D  V +W
Sbjct:   39 FTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNE-KYCIFANFSVTGGKWIVSGSEDNLVYIW 286          

HSP 2 Score: 93.5893 bits (231), Expect = 2.885e-20
Identity = 81/305 (26.56%), Postives = 144/305 (47.21%), Query Frame = 2
Query: 1034 FKLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQS-ISGHQYAVNSANINEQGTNIASCDAFGFLKFWD-----CRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKM--VETASFNVTSLVGHEDSVQSAMFDHDGEFLISASA---DCTVRVWS*IC 1915
            + L  T+  H  AV+ ++   N +   ++S D   K+W     +   T  GH   +S  A+ +D   L + S D TLKIW++S+ +CL T +GHS  ++  +++  +  + + S D+++++WD+ + KC   L  HSD V++V F  + +++++SS D    +WD     C ++ I      V+    +  G  I +      LK WD     C +  T              V   T G  +   S D+++ +  ++T    V  L GH D V S    H  E +I+++A   D T+++W   C
Sbjct:   35 YALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSV---TGGKWIVSGSEDNLVYIWNLQTKEI-VQKLQGHTDVVISTAC-HPTENIIASAALENDKTIKLWKSDC 334          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Mouse
Match: Pafah1b1 (platelet-activating factor acetylhydrolase, isoform 1b, subunit 1 [Source:MGI Symbol;Acc:MGI:109520])

HSP 1 Score: 116.316 bits (290), Expect = 1.794e-27
Identity = 71/260 (27.31%), Postives = 127/260 (48.85%), Query Frame = 2
Query: 1184 GHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFW---------DCRQLATSINTIDLGFHPANDVRYDTSGSCVAMS----------SSDSVIKMVETAS-FNVTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            GH + V+   F      + + S D T+K+W+    +   T +GH+ S+  + +  S   LA+ S D TIK+WD    +C   + GH  +V+SV  + N + ++++S DKT+ +W+ +   C ++ +GH+  V     N+ GT IASC     ++ W         + R+    +  I      +     + +GS    S          S D  IKM + ++   + +LVGH++ V+  +F   G+F++S + D T+RVW
Sbjct:  106 GHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVW 365          

HSP 2 Score: 95.1301 bits (235), Expect = 2.126e-20
Identity = 58/230 (25.22%), Postives = 105/230 (45.65%), Query Frame = 2
Query: 1031 GFKLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSA--------------------PFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCR 1660
            GF+   T+  H+  V+ +    N     + S D + K+W + +   + T  GH  WV     + DG  +A+ S D T+++W ++  EC      H   +  + W   +                    PFL + S DKTIK+WD+++  C   L GH + V  V F      +L+ + DKT+ +WD +   C ++++ H++ V S + ++    + +      +K W+CR
Sbjct:  181 GFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWECR 410          
BLAST of WD_REPEATS_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8N0X2|SPG16_HUMAN (Sperm-associated antigen 16 protein OS=Homo sapiens OX=9606 GN=SPAG16 PE=1 SV=2)

HSP 1 Score: 455.292 bits (1170), Expect = 1.141e-151
Identity = 245/624 (39.26%), Postives = 371/624 (59.46%), Query Frame = 2
Query:   44 ENKYFLEKIEIPVYEESEFDYDFVKSDEILMLEDGTFDSFEHTSKILDELQEDERALEEAIFNNR---PKLTTVPPSMDDYIRSFLLRLGLTRTLDCFQLEWFEKKHKGLLHEEDISEVPDIYVRNQQLDIQVKLMREDRNKYKQAALKAKEMHVKLRGERDYHKLQHRRMVQEKNKLIDEIKRLRDHYASYQPALEQLQQKYQTAMKEKMLSKLERDRICGQMQGLQMTLQSLENSTLPITTDDDGKRLFFRDRSQVSNIHPCRKGGVLTVDKLNRGATQKKLADAREFKSKNDALNGEKENNDTPFPVDKGINEDLLKLRPPPGHLTRVGGFKLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNVTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVWS 1906
            E  Y+LE++ I    E +++Y+ +  D   + E       E  +K +   QE  +A +  I   +   P    VP  ++D++ +FL+++G+TRTLDCFQ EW+E   KG+     +  VPD+Y +   L+ + K +++D   YKQAA KA+E  +K++ ERD+H++ H+R+VQEKNKLI+++K L+ HYASY+P +  L +K+ T +KEKML+ LERD++ GQ+ GLQ TL+ L+             R       Q+   H   K      +    G TQK L +ARE       + G  ++++ P  +    N ++ K    P        +KL N  + HE  V+C+    +K +  +  +D  WK+  L    VL+TG GHT+W+S   F   G+KLAT+SGDTT+K+W+L   +C+ TFEGHS+++WS  WH+   F+A++S DKT K+WD+NS +CR  L GH+DSVNS++F   SN LLTSSADKT+ +WDAR   C QS+ GH +++N A  + +G  IASCDA G  K WD R+L   I +ID+G  P N+V +D+SG  +A +S + VI +++  S  +  L+GHE+   + +F HDGE L S  +D TVR WS
Sbjct:   39 EGAYYLEQVTITEASEDDYEYEEIPDDNFSIPE-----GEEDLAKAIQMAQE--QATDTEILERKTVLPSKHAVPEVIEDFLCNFLIKMGMTRTLDCFQSEWYELIQKGVTELRTVGNVPDVYTQIMLLENENKNLKKDLKHYKQAADKAREDLLKIQKERDFHRMHHKRIVQEKNKLINDLKGLKLHYASYEPTIRVLHEKHHTLLKEKMLTSLERDKVVGQISGLQETLKKLQ-------------RGHSYHGPQIKVDHSREK------ENAPEGPTQKGLREAREQNKCKTKMKGNTKDSEFPIDMQPNPNLNVSKESLSPAKFD----YKLKNIFRLHELPVSCVSMQPHKDILVSCGEDRLWKVLGLPKCNVLLTGFGHTDWLSDCCFHPSGDKLATSSGDTTVKLWDLCKGDCILTFEGHSRAVWSCTWHSCGNFVASSSLDKTSKIWDVNSERCRCTLYGHTDSVNSIEFFPFSNTLLTSSADKTLSIWDARTGICEQSLYGHMHSINDAIFDPRGHMIASCDACGVTKLWDFRKL-LPIVSIDIGPSPGNEVNFDSSGRVLAQASGNGVIHLLDLKSGEIHKLMGHENEAHTVVFSHDGEILFSGGSDGTVRTWS 631          
BLAST of WD_REPEATS_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8K450|SPG16_MOUSE (Sperm-associated antigen 16 protein OS=Mus musculus OX=10090 GN=Spag16 PE=1 SV=1)

HSP 1 Score: 437.187 bits (1123), Expect = 1.523e-144
Identity = 244/629 (38.79%), Postives = 366/629 (58.19%), Query Frame = 2
Query:   44 ENKYFLEKIEIPVYEESEFDYDFVKSDEILMLEDGTFDSFEHTSKILDELQEDERALEEAIFNNRPKLTTVPPSMDDYIRSFLLRLGLTRTLDCFQLEWFEKKHKGLLHEEDISEVPDIYVRNQQLDIQVKLMREDRNKYKQAALKAKEMHVKLRGERDYHKLQHRRMVQEKNKLIDEIKRLRDHYASYQPALEQLQQKYQTAMKEKMLSKLERDRICGQMQGLQMTLQSLE--NSTLPITTDDDGKRLFFRDRSQVSNIHPCRKGGVLTVDKLNRGATQKKLADAREFKSKNDALNGEKENNDTPFPVDKGINEDLLKLRPPPGHLTRVGG-------FKLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNVTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            E  Y+LE++ I    E E +Y+ +  D   + E    +  E    I+ E   D   LE+      P    +  +++D++ +FL+++G+TRTLDCFQ EW+E   K     + +  VPD+Y +   L+ + K ++++   +KQAA KAKE  ++ + ERD+H++ H+R+VQEKNKLI ++K L+ HYASY+P +  L +K+   +KEKML+ LERDR  G++ GLQ TL++++  +  +P+           R+    +  H C K      +  + G TQK L +ARE       L  EK+  D+ FPVD         ++P P   +           +KL N  + HE  V+CI  H  +    + S+D  WK+  L    VL+TG GHT+W+S   F   G KLAT+SGD+T+K+W+L+  EC  T EGH+ ++WS  WH+   F+A+AS D T K+WD+NS +CR  L GH+DSVNS++F   SNILLT+SADKT+ +WDAR   C QS+ GH ++VN A    +G  IASCDA G  K WD R+L   I +ID+G    N+V +D SG  +A +S++ +I +++  S  +  LVGHE  V S +F H GE L S  +D T+R+W
Sbjct:   33 EGAYYLEQVTITETSEDECEYEEIPDDNFSIPEGE--EDLEKAIHIIGEQARDIHILEQQTI--LPARNVMQEAIEDFLCNFLIKMGMTRTLDCFQAEWYELIQKKGSDFKGLGNVPDVYSQVMLLETENKNLKKELKHFKQAAEKAKEDLLRTQKERDFHRMHHKRIVQEKNKLIADLKGLKLHYASYEPTIRVLHEKHHALLKEKMLTSLERDRAVGKISGLQATLKNIDMGHIQVPVIKGSYESASITRESGDRAG-HSCEK------ENSSEGPTQKSLREAREEVGYKSKLKNEKK--DSEFPVD---------MQPDPNVTSCTENVSAAKFDYKLNNIFRLHELPVSCIVMHPCRDYLISCSEDRLWKMVGLPQGNVLLTGSGHTDWLSGCCFHPSGSKLATSSGDSTIKLWDLNKGECTLTLEGHNHAVWSCTWHSCGDFVASASLDMTSKIWDVNSERCRYTLYGHTDSVNSIEFFPFSNILLTASADKTLSVWDARTGKCEQSLYGHMHSVNDATFTPRGHIIASCDARGVTKLWDFRKL-IPIVSIDVGPSSGNEVNFDQSGRVLAQASANGIIHLLDLKSGQIHKLVGHESEVHSVVFSHLGENLYSGGSDGTIRLW 638          
BLAST of WD_REPEATS_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|P93107|PF20_CHLRE (Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii OX=3055 GN=PF20 PE=2 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 1.446e-61
Identity = 119/292 (40.75%), Postives = 171/292 (58.56%), Query Frame = 2
Query: 1034 FKLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNVTS-LVGHEDSVQSAMFDHDGEFLISASADCTVRVWS 1906
              L  T K H  +V  +  H  K +  T SDD +WK+W +    ++M G+GH +WV+   F   G  LA+  GD+ +KIW+     C+ TF  H Q+IWSV +H     +A+ S D T+++WDL + KCR  LRGH DSVN + +   S+ L T+S+DKTV +WDAR   C Q+  GHQ + N  + N  GT +AS DA G +K WD R  A  + TI+ G HPAN   +D SG  +A++  D  +K   T    + + L GHED+VQ+ +FD  G++L+S  +D T R+WS
Sbjct:  316 LSLNKTFKGHLLSVANLALHPTKPILVTASDDKTWKMWHMPGGDLIMCGEGHKDWVAGVDFHPAGTCLASGGGDSAVKIWDFEKQRCVTTFTDHKQAIWSVRFHHLGEVVASGSLDHTVRLWDLPAGKCRMALRGHVDSVNDLAWQPFSSSLATASSDKTVSVWDARAGLCTQTYYGHQNSCNGVSFNILGTQLASTDADGVVKLWDTRMTA-EVATINTGKHPANKSCFDRSGQVLAVACDDGKVKAYSTTDGVLQAELAGHEDAVQAVLFDPAGQYLVSCGSDNTFRLWS 606          

HSP 2 Score: 158.303 bits (399), Expect = 5.744e-40
Identity = 80/217 (36.87%), Postives = 134/217 (61.75%), Query Frame = 2
Query:  101 DYDFVKSDEILMLEDGTFDSFEHTSKILDELQEDERALEEAIFNNRP------KLTTVPPSMDDYIRSFLLRLGLTRTLDCFQLEWFEKKHKGLLHEEDISEVPDIYVRNQQLDIQVKLMREDRNKYKQAALKAKEMHVKLRGERDYHKLQHRRMVQEKNKLIDEIKRLRDHYASYQPALEQLQQKYQTAMKEKMLSKLERDRICGQMQGLQMTLQS 733
            D DF K +E+ ++ DG  D+ E     L +LQ+     E A    R       ++   P  +DD++R+F +++GL+RT +CF+ EW+E K  G L  ++ + VPD+Y+RN +L+  V  +R +  + K  A +A     K R ERD+H++ H+R+ QEKNKL+ +++RL++HYA Y+P + +L++KY+T MKEKM+  LERD++  ++  L+    S
Sbjct:   15 DDDF-KYEEVDVMSDGEDDASEDLDAALRKLQQFTSKQEAATGPARTTEVKPGQVVKKPEVIDDFLRNFFIKMGLSRTCECFEAEWYELKATGRL--DNSTTVPDVYLRNAELEDDVAGLRRELAEAKSIAGRASATWDKFRKERDFHRMHHKRVAQEKNKLLTDLRRLKEHYAKYEPTILELKKKYETLMKEKMMMSLERDKLAARVDALEQVASS 228          
BLAST of WD_REPEATS_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8YRI1|YY46_NOSS1 (Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=alr3466 PE=4 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 1.255e-40
Identity = 88/247 (35.63%), Postives = 141/247 (57.09%), Query Frame = 2
Query: 1169 LMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFN-VTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVWS 1906
            L T +GHTNWV+  AF  DG  LA+ SGD T+++W++S+++CLY  +GH+  + SV ++     LA+ S D+T+++W++NS KC    +GH+  VNSV F  + ++L + S+DKTV LWD   S C  +  GH   VNS   N  G+ +AS      ++ W+    +  ++T        + V +   G+ +A  S D  +++   +S   + + +GH + V S +F  DG  L S S D TVR+WS
Sbjct: 1151 LYTLQGHTNWVNAVAFSPDGATLASGSGDQTVRLWDISSSKCLYILQGHTSWVNSVVFNPDGSTLASGSSDQTVRLWEINSSKCLCTFQGHTSWVNSVVFNPDGSMLASGSSDKTVRLWDISSSKCLHTFQGHTNWVNSVAFNPDGSMLASGSGDQTVRLWEISS-SKCLHTFQGHTSWVSSVTFSPDGTMLASGSDDQTVRLWSISSGECLYTFLGHTNWVGSVIFSPDGAILASGSGDQTVRLWS 1396          

HSP 2 Score: 150.214 bits (378), Expect = 2.277e-36
Identity = 86/247 (34.82%), Postives = 137/247 (55.47%), Query Frame = 2
Query: 1169 LMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFN-VTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVWS 1906
            L T +G+T+WV    F  +G  LA  S D  +++W++S+ +CLYT +GH+  + +V +      LA+ S D+T+++WD++S KC  IL+GH+  VNSV F  + + L + S+D+TV LW+   S C  +  GH   VNS   N  G+ +AS  +   ++ WD    +  ++T     +  N V ++  GS +A  S D  +++ E +S   + +  GH   V S  F  DG  L S S D TVR+WS
Sbjct: 1109 LYTLQGYTSWVRFLVFSPNGVTLANGSSDQIVRLWDISSKKCLYTLQGHTNWVNAVAFSPDGATLASGSGDQTVRLWDISSSKCLYILQGHTSWVNSVVFNPDGSTLASGSSDQTVRLWEINSSKCLCTFQGHTSWVNSVVFNPDGSMLASGSSDKTVRLWDISS-SKCLHTFQGHTNWVNSVAFNPDGSMLASGSGDQTVRLWEISSSKCLHTFQGHTSWVSSVTFSPDGTMLASGSDDQTVRLWS 1354          

HSP 3 Score: 146.362 bits (368), Expect = 4.131e-35
Identity = 88/286 (30.77%), Postives = 149/286 (52.10%), Query Frame = 2
Query: 1049 TIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNVTSLV-GHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            T K H   V  +    N  +  + S D + +LW + S + L   +GHT WV   AF+ DG  LAT SGD T+++W++S+++C Y F+GH+  + SV + +    LA+ S D+T+++WD++S  C   L+GH+  V SV F  +  +L +   D+ V LWD     C  ++ G+   V     +  G  +A+  +   ++ WD       + T+    +  N V +   G+ +A  S D  +++ + +S     ++ GH   V S +F+ DG  L S S+D TVR+W
Sbjct:  943 TFKGHTSRVRSVVFSPNSLMLASGSSDQTVRLWDISSGECLYIFQGHTGWVYSVAFNLDGSMLATGSGDQTVRLWDISSSQCFYIFQGHTSCVRSVVFSSDGAMLASGSDDQTVRLWDISSGNCLYTLQGHTSCVRSVVFSPDGAMLASGGDDQIVRLWDISSGNCLYTLQGYTSWVRFLVFSPNGVTLANGSSDQIVRLWDISS-KKCLYTLQGHTNWVNAVAFSPDGATLASGSGDQTVRLWDISSSKCLYILQGHTSWVNSVVFNPDGSTLASGSSDQTVRLW 1227          

HSP 4 Score: 145.206 bits (365), Expect = 9.965e-35
Identity = 85/280 (30.36%), Postives = 149/280 (53.21%), Query Frame = 2
Query: 1067 GAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFN-VTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            G+V  +    + K+F T       + W   + + L+T KGH +WV+   F  DG+ LA+ S D T+++W++S+ +CL TF+GH+  + SV +  ++  LA+ S D+T+++WD++S +C  I +GH+  V SV F ++ ++L T S D+TV LWD   S C     GH   V S   +  G  +AS      ++ WD       + T+         V +   G+ +A    D ++++ + +S N + +L G+   V+  +F  +G  L + S+D  VR+W
Sbjct:  865 GSVLTVAFSPDGKLFATGDSGGIVRFWEAATGKELLTCKGHNSWVNSVGFSQDGKMLASGSDDQTVRLWDISSGQCLKTFKGHTSRVRSVVFSPNSLMLASGSSDQTVRLWDISSGECLYIFQGHTGWVYSVAFNLDGSMLATGSGDQTVRLWDISSSQCFYIFQGHTSCVRSVVFSSDGAMLASGSDDQTVRLWDISS-GNCLYTLQGHTSCVRSVVFSPDGAMLASGGDDQIVRLWDISSGNCLYTLQGYTSWVRFLVFSPNGVTLANGSSDQIVRLW 1143          

HSP 5 Score: 139.043 bits (349), Expect = 1.181e-32
Identity = 80/246 (32.52%), Postives = 131/246 (53.25%), Query Frame = 2
Query: 1169 LMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFN-VTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            L T +GHT+ V    F  DG  LA+   D  +++W++S+  CLYT +G++  +  + +  +   LA  S D+ +++WD++S KC   L+GH++ VN+V F  +   L + S D+TV LWD   S C   + GH   VNS   N  G+ +AS  +   ++ W+    +  + T        N V ++  GS +A  SSD  +++ + +S   + +  GH + V S  F+ DG  L S S D TVR+W
Sbjct: 1067 LYTLQGHTSCVRSVVFSPDGAMLASGGDDQIVRLWDISSGNCLYTLQGYTSWVRFLVFSPNGVTLANGSSDQIVRLWDISSKKCLYTLQGHTNWVNAVAFSPDGATLASGSGDQTVRLWDISSSKCLYILQGHTSWVNSVVFNPDGSTLASGSSDQTVRLWEINS-SKCLCTFQGHTSWVNSVVFNPDGSMLASGSSDKTVRLWDISSSKCLHTFQGHTNWVNSVAFNPDGSMLASGSGDQTVRLW 1311          

HSP 6 Score: 122.094 bits (305), Expect = 2.699e-27
Identity = 70/208 (33.65%), Postives = 116/208 (55.77%), Query Frame = 2
Query: 1037 KLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCR 1660
            K  +T + H   V  +  + +  +  + S D + +LW + S + L T +GHT+WVS   F  DG  LA+ S D T+++W++S+ ECLYTF GH+  + SV +      LA+ S D+T+++W ++S KC   L+GH++ V S+ F  +  +L + S D+TV LW+     C  ++ GH  +V S   +  G  +AS      +K WD +
Sbjct: 1275 KCLHTFQGHTNWVNSVAFNPDGSMLASGSGDQTVRLWEISSSKCLHTFQGHTSWVSSVTFSPDGTMLASGSDDQTVRLWSISSGECLYTFLGHTNWVGSVIFSPDGAILASGSGDQTVRLWSISSGKCLYTLQGHNNWVGSIVFSPDGTLLASGSDDQTVRLWNISSGECLYTLHGHINSVRSVAFSSDGLILASGSDDETIKLWDVK 1482          

HSP 7 Score: 112.464 bits (280), Expect = 3.589e-24
Identity = 63/181 (34.81%), Postives = 106/181 (58.56%), Query Frame = 2
Query: 1016 LTRVGGFKLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSI 1558
            L  +   K  +T + H   V+ +    +  +  + SDD + +LWS+ S + L T  GHTNWV    F  DG  LA+ SGD T+++W++S+ +CLYT +GH+  + S+ +      LA+ S D+T+++W+++S +C   L GH +SV SV F  +  IL + S D+T+ LWD +   C +++
Sbjct: 1310 LWEISSSKCLHTFQGHTSWVSSVTFSPDGTMLASGSDDQTVRLWSISSGECLYTFLGHTNWVGSVIFSPDGAILASGSGDQTVRLWSISSGKCLYTLQGHNNWVGSIVFSPDGTLLASGSDDQTVRLWNISSGECLYTLHGHINSVRSVAFSSDGLILASGSDDETIKLWDVKTGECIKTL 1490          
BLAST of WD_REPEATS_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q00808|HETE1_PODAS (Vegetative incompatibility protein HET-E-1 OS=Podospora anserina OX=2587412 GN=HET-E1 PE=4 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 5.137e-37
Identity = 101/288 (35.07%), Postives = 148/288 (51.39%), Query Frame = 2
Query: 1043 TNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNVT-SLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            T T++ H G V  +    + +   + SDD + K+W   S     T +GH + V   AF  DG+++A+ SGD T+KIW+ ++  C  T EGH  S+WSV +      +A+ S DKTIK+WD  S  C   L GH   V SV F  +   + + S D T+ +WDA   TC Q++ GH  +V S   +  G  +AS    G +K WD     T   T++      + V +   G  VA  S D  IK+ + AS   T +L GH   VQS  F  DG+ + S S+D T+++W
Sbjct:  918 TQTLEGHGGRVQSVAFSPDGQRVASGSDDHTIKIWDAASGTCTQTLEGHGSSVLSVAFSPDGQRVASGSGDKTIKIWDTASGTCTQTLEGHGGSVWSVAFSPDGQRVASGSDDKTIKIWDTASGTCTQTLEGHGGWVQSVVFSPDGQRVASGSDDHTIKIWDAVSGTCTQTLEGHGDSVWSVAFSPDGQRVASGSIDGTIKIWDAAS-GTCTQTLEGHGGWVHSVAFSPDGQRVASGSIDGTIKIWDAASGTCTQTLEGHGGWVQSVAFSPDGQRVASGSSDKTIKIW 1204          

HSP 2 Score: 146.362 bits (368), Expect = 3.678e-35
Identity = 90/244 (36.89%), Postives = 127/244 (52.05%), Query Frame = 2
Query: 1175 TGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNVT-SLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            T +GH   V   AF  DG+++A+ S D T+KIW+ ++  C  T EGH   + SV +      +A+ S D TIK+WD  S  C   L GH DSV SV F  +   + + S D T+ +WDA   TC Q++ GH   V+S   +  G  +AS    G +K WD     T   T++        V +   G  VA  SSD  IK+ +TAS   T +L GH   VQS  F  DG+ + S S+D T+++W
Sbjct: 1004 TLEGHGGSVWSVAFSPDGQRVASGSDDKTIKIWDTASGTCTQTLEGHGGWVQSVVFSPDGQRVASGSDDHTIKIWDAVSGTCTQTLEGHGDSVWSVAFSPDGQRVASGSIDGTIKIWDAASGTCTQTLEGHGGWVHSVAFSPDGQRVASGSIDGTIKIWDAAS-GTCTQTLEGHGGWVQSVAFSPDGQRVASGSSDKTIKIWDTASGTCTQTLEGHGGWVQSVAFSPDGQRVASGSSDNTIKIW 1246          

HSP 3 Score: 143.28 bits (360), Expect = 4.670e-34
Identity = 88/244 (36.07%), Postives = 126/244 (51.64%), Query Frame = 2
Query: 1175 TGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNVT-SLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            T +GH + V   AF  DG+++A+ S D T+KIW+ ++     T EGH  S+WSV +      +A+ S DKTIK+WD  S  C   L GH   V SV F  +   + + S D T+ +WDA   TC Q++ GH  +V S   +  G  +AS      +K WD     T   T++        V +   G  VA  S D  IK+ +TAS   T +L GH   VQS +F  DG+ + S S D T+++W
Sbjct:  836 TLEGHGSSVLSVAFSADGQRVASGSDDKTIKIWDTASGTGTQTLEGHGGSVWSVAFSPDRERVASGSDDKTIKIWDAASGTCTQTLEGHGGRVQSVAFSPDGQRVASGSDDHTIKIWDAASGTCTQTLEGHGSSVLSVAFSPDGQRVASGSGDKTIKIWDTAS-GTCTQTLEGHGGSVWSVAFSPDGQRVASGSDDKTIKIWDTASGTCTQTLEGHGGWVQSVVFSPDGQRVASGSDDHTIKIW 1078          

HSP 4 Score: 132.494 bits (332), Expect = 1.169e-30
Identity = 88/275 (32.00%), Postives = 133/275 (48.36%), Query Frame = 2
Query: 1043 TNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNVTSLVGHEDSVQSAMFDHDGEFL 1867
            T T++ H G+V  +    + +   + SDD + K+W   S     T +GH  WV    F  DG+++A+ S D T+KIW+  +  C  T EGH  S+WSV +      +A+ S D TIK+WD  S  C   L GH   V+SV F  +   + + S D T+ +WDA   TC Q++ GH   V S   +  G  +AS  +   +K WD     T   T++        V +   G  VA  SSD+ IK+ +TAS   T  +    +     FD+   ++
Sbjct: 1002 TQTLEGHGGSVWSVAFSPDGQRVASGSDDKTIKIWDTASGTCTQTLEGHGGWVQSVVFSPDGQRVASGSDDHTIKIWDAVSGTCTQTLEGHGDSVWSVAFSPDGQRVASGSIDGTIKIWDAASGTCTQTLEGHGGWVHSVAFSPDGQRVASGSIDGTIKIWDAASGTCTQTLEGHGGWVQSVAFSPDGQRVASGSSDKTIKIWDTAS-GTCTQTLEGHGGWVQSVAFSPDGQRVASGSSDNTIKIWDTASGTCTQTLNVGSTATCLSFDYTNAYI 1275          

HSP 5 Score: 112.079 bits (279), Expect = 3.924e-24
Identity = 76/212 (35.85%), Postives = 102/212 (48.11%), Query Frame = 2
Query: 1271 WNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNVT-SLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            WN     C  T EGH  S+ SV +      +A+ S DKTIK+WD  S      L GH  SV SV F  +   + + S DKT+ +WDA   TC Q++ GH   V S   +  G  +AS      +K WD     T   T++        V +   G  VA  S D  IK+ +TAS   T +L GH  SV S  F  DG+ + S S D T+++W
Sbjct:  830 WN----ACTQTLEGHGSSVLSVAFSADGQRVASGSDDKTIKIWDTASGTGTQTLEGHGGSVWSVAFSPDRERVASGSDDKTIKIWDAASGTCTQTLEGHGGRVQSVAFSPDGQRVASGSDDHTIKIWDAAS-GTCTQTLEGHGSSVLSVAFSPDGQRVASGSGDKTIKIWDTASGTCTQTLEGHGGSVWSVAFSPDGQRVASGSDDKTIKIW 1036          

HSP 6 Score: 76.2554 bits (186), Expect = 5.543e-13
Identity = 56/174 (32.18%), Postives = 79/174 (45.40%), Query Frame = 2
Query: 1385 TIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNVT-SLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            TI V +     C   L GH  SV SV F  +   + + S DKT+ +WD    T  Q++ GH  +V S   +     +AS      +K WD     T   T++        V +   G  VA  S D  IK+ + AS   T +L GH  SV S  F  DG+ + S S D T+++W
Sbjct:  822 TISVVEAEWNACTQTLEGHGSSVLSVAFSADGQRVASGSDDKTIKIWDTASGTGTQTLEGHGGSVWSVAFSPDRERVASGSDDKTIKIWDAAS-GTCTQTLEGHGGRVQSVAFSPDGQRVASGSDDHTIKIWDAASGTCTQTLEGHGSSVLSVAFSPDGQRVASGSGDKTIKIW 994          
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: V4BYT6 (WD_REPEATS_REGION domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_189601 PE=4 SV=1)

HSP 1 Score: 596.66 bits (1537), Expect = 0.000e+0
Identity = 304/623 (48.80%), Postives = 424/623 (68.06%), Query Frame = 2
Query:   50 KYFLEKIEIPVYEESEFDYDFVKSDEILMLEDGTFDSFEHTSKILDELQEDERALEEAIFNNRPKLTTVPPSMDDYIRSFLLRLGLTRTLDCFQLEWFEKKHKGLLHEEDISEVPDIYVRNQQLDIQVKLMREDRNKYKQAALKAKEMHVKLRGERDYHKLQHRRMVQEKNKLIDEIKRLRDHYASYQPALEQLQQKYQTAMKEKMLSKLERDRICGQMQGLQMTLQSLENSTLPITTDDDGKRLFFRDRSQVSNIHPCRKGGVLTVDKLNRGATQKKLADAREFKSKNDA----LNGEKENNDTPFPVDKGINEDLLKLRPPPGHLTRVGGFKLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNVTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVWS 1906
            K++LEK ++    + EF Y+ V  DE  + ++   ++ + T + + E QED  A        RP +T  P  +DD++R+FL+R+G+ RTLDCFQ EW+E + KGLLHEED+  VPDIY RNQ LD ++K ++++ +KY+ AA+KAKE +VKLR ERDYH++ H+R+VQEKNK ID+IKRL+ HY  Y+P L QL++KY+ AMKEKML+KLERDR  GQ+ GLQ TL+S+E+               F+  S  S +   RKG     DKL  G TQ+ LA  RE + + D      + ++  ND+ FP+D G+N  L + + PP HLTR GGF+L++TI+AH  +V+ +  H  K++  T+SDD+SWK+W++ S  ++MTG+GHT+WVS   F   G KLATTSGDTT+KIW+ S  EC++TF  H+ ++W+  WH+   FL T S D T K+WDLNSL+CR  LRGH+DSVNS+QF+  SN L+TSSADKT+ LWDAR   C Q+  GH ++VN A  N +   +ASCD++G  K WD R   + + ++D+G HPAN V +D SGS + +SS+DS IKM E AS  VT+L GHED+VQ A+FD  GEF++S  +DCTVR+WS
Sbjct:    9 KFYLEKEQLQADSDDEFQYEEVPVDEEFIPDE--IENLDVTVRTIRESQEDLEAGLRKESTARPSVTHEPEVVDDFVRNFLVRMGMNRTLDCFQTEWYELQQKGLLHEEDVDIVPDIYARNQDLDNEIKFLKKEVDKYRIAAIKAKETYVKLRKERDYHRMHHKRVVQEKNKFIDDIKRLKRHYQQYEPTLHQLKRKYEVAMKEKMLAKLERDRAVGQVNGLQSTLKSMES---------------FKGTSSTS-LQGSRKGD--NQDKL--GPTQRALAIEREKRMEEDVGLLPEDFKRYPNDSEFPIDTGVNPYLSQSKAPPSHLTRTGGFRLSHTIQAHSHSVSGVALHPRKQILVTSSDDNSWKMWAVPSGDIIMTGEGHTDWVSSCDFHPSGAKLATTSGDTTVKIWDFSKGECVHTFTDHTLAVWNCSWHSCGDFLGTCSMDNTSKIWDLNSLRCRFTLRGHTDSVNSIQFVPFSNTLITSSADKTLSLWDARTGLCTQTFYGHMHSVNHATFNLRCDTLASCDSYGIFKLWDVRN-GSEMVSVDIGPHPANHVAFDPSGSVLGISSNDSTIKMYEVASGQVTALYGHEDAVQCALFDKSGEFMVSGGSDCTVRIWS 608          
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: A0A1S3JB06 (sperm-associated antigen 16 protein OS=Lingula unguis OX=7574 GN=LOC106171687 PE=4 SV=1)

HSP 1 Score: 593.964 bits (1530), Expect = 0.000e+0
Identity = 309/628 (49.20%), Postives = 424/628 (67.52%), Query Frame = 2
Query:   32 MDLDENKYFLEKIEIPVYEESE-FDYDFVKSDEILMLEDGTFDSFEHTSKILDELQEDERALEEAIFNNRPKLTTVPPSMDDYIRSFLLRLGLTRTLDCFQLEWFEKKHKGLLHEEDISEVPDIYVRNQQLDIQVKLMREDRNKYKQAALKAKEMHVKLRGERDYHKLQHRRMVQEKNKLIDEIKRLRDHYASYQPALEQLQQKYQTAMKEKMLSKLERDRICGQMQGLQMTLQSLENSTLPITTDDDGKRLFFRDRSQVSNIHPCRKGGVLTVDKLNRGATQKKLADARE-FKSKNDALNGEKEN-NDTPFPVDKGINEDLLKLRPPPGHLTRVGGFKLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNVTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVWS 1906
            M  ++  ++LE  EI VYE  E + Y+ V  DE  +  D   D  +   + + E QED +A E+     R  ++T P  +DD++R+FL+++ L +TLD FQ EW+E + KG L+EEDI  VPDIY +NQQLD +VK +R++ +KYK+AALKAK+ +VKLR ERDYH++ H+R+VQEKNKLI +IKRL+ HY SY+P L QL+QKY+ AMKEKML+KLERDR  GQ+ GLQ TL+++E      T+ +    L  R      +   C KG VL VDK  RG TQ+ +A+ R   K+  ++L     + NDTPFP D G+N  L +++ P GHLTR GGF+L+ T +AH  AV+ +  H  K++  TTSDD +WKLW++ S  ++MTG+GHT+WVS   F   G KLAT SGDTT+KIW+ + AEC++TF  H+ ++W   WH+   FLAT S D T KVWDLNSL+CR  LRGH+DSVNS++FL  SN L T SADKT+ LWDAR   C Q+  GH +++N    N +G  IASCD++G +K WD R +A  + TID+G +PAN V +D SG  +A+ S+D+ IKM E A+  +T LVGHED VQ  +FD  G++L+S  +D TVR+WS
Sbjct:    1 MAAEDRAFYLEHQEI-VYESDEDYQYEEVPIDEDFVELD---DDLDAAVRTIRESQEDTQATEKKSAPPRASVSTKPEVVDDFVRNFLVKMNLYKTLDYFQTEWYELQQKGELNEEDIGVVPDIYTKNQQLDSEVKHLRKEVDKYKEAALKAKDTYVKLRKERDYHRMHHKRVVQEKNKLITDIKRLKKHYTSYEPTLRQLKQKYEVAMKEKMLTKLERDRAMGQVTGLQSTLRNME--AYRGTSAEKTSELSAR------STRLCEKGTVLYVDKEGRGPTQRAVAEERRRSKTMEESLPPTSSHPNDTPFPPDTGVNPYLTQVKAPSGHLTRTGGFRLSTTFQAHSNAVSSVAVHPRKQILATTSDDHTWKLWAIPSGDIIMTGEGHTDWVSDCDFHPSGAKLATASGDTTVKIWDFAKAECVHTFMDHTHAVWGCSWHSCGDFLATCSMDNTSKVWDLNSLRCRFTLRGHADSVNSIEFLPFSNTLATCSADKTLSLWDARTGLCAQTFYGHMHSINHCVFNLKGDTIASCDSYGIIKLWDVRTVA-PMTTIDVGPYPANRVAFDPSGMVLAIGSNDATIKMYEVATGQITPLVGHEDGVQGLVFDKKGDYLVSGGSDLTVRIWS 615          
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: A0A210PSZ8 (Sperm-associated antigen 16 protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT03962 PE=4 SV=1)

HSP 1 Score: 587.03 bits (1512), Expect = 0.000e+0
Identity = 293/623 (47.03%), Postives = 418/623 (67.09%), Query Frame = 2
Query:   50 KYFLEKIEIPVYEESEFDYDFVKSDEILMLEDGTFDSFEHTSKILDELQEDERALEEAIFNNRPKLTTVPPSMDDYIRSFLLRLGLTRTLDCFQLEWFEKKHKGLLHEEDISEVPDIYVRNQQLDIQVKLMREDRNKYKQAALKAKEMHVKLRGERDYHKLQHRRMVQEKNKLIDEIKRLRDHYASYQPALEQLQQKYQTAMKEKMLSKLERDRICGQMQGLQMTLQSLENSTLPITTDDDGKRLFFRDRSQVSNIHPCRKGGVLTVDKLNRGATQKKLADAREFKSKNDALN----GEKENNDTPFPVDKGINEDLLKLRPPPGHLTRVGGFKLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNVTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVWS 1906
            KY+LEK +I V  + E+ Y+ V  DE  +  D   +  +   + + +++ED++A  +     R  +T     +DDY+R+FL+R+G+ RTLD FQ EW+E + +GLLHEED+  VPDIY+RNQ LD +VK ++++  KY++AA+KAKE +VKLR ERDYH++ H+R+VQEKNKLI ++KRL+ HYA Y+P L+QL++KY+ AMKEKMLSKLE+DR  GQ+ GLQ TL+S+E+         +GK      R    N H         VD   RG TQK LA      S  D  N     ++   D+ FP D G+N  L +++ P GHL+R GGF+L+NT +AH   ++ +  H  K++  T+SDD +WK+W++ S  ++MTG+GHT+WVS   F   G KLAT+SGD+T+KIW+ S AEC++TF  H+ ++W   WHT   FLA+ S D T KVWDLNSL+CR  +RGH+DSVNS++FL  SN LLT SADKT+ LWDAR   C Q+  GH ++VN A+ N +G  + SCD++G +K WD R +A  + + D G HPAN V +D SGS +A++S+DS +KM E ++  V+ L+GHED+VQ  +FD  GE+++S  +DCTVR+WS
Sbjct:    9 KYYLEKEKIAVDSDDEYTYEEVPVDEDFLAAD-LHEDLDLAVQTIQDVEEDKQAGIKKDSAPRASVTKREEVVDDYVRNFLVRMGMNRTLDSFQTEWYELQQRGLLHEEDVGVVPDIYLRNQDLDNEVKFLKQEVTKYREAAMKAKETYVKLRKERDYHRMHHKRVVQEKNKLISDVKRLKRHYAQYEPTLQQLKKKYEVAMKEKMLSKLEKDRAVGQVTGLQSTLKSMESFKGGSAKQSNGKMGSGERR----NWH---------VDAEGRGPTQKALAQEHSRTSLPDVQNLPEDFKRHPEDSEFPADTGVNPFLAQIKAPTGHLSRAGGFRLSNTFQAHSHPISDVALHPRKQILATSSDDHTWKMWAVPSGDIIMTGEGHTDWVSGCDFHPSGSKLATSSGDSTVKIWDFSKAECVHTFTDHTHAVWGCSWHTCGDFLASCSMDNTSKVWDLNSLRCRFTMRGHADSVNSIEFLPYSNTLLTCSADKTISLWDARTGLCAQTFYGHMHSVNYASFNLRGDTVGSCDSYGIVKLWDIRAVAPMV-SFDTGPHPANRVSFDPSGSVMAVASNDSTVKMYEISNGRVSPLIGHEDAVQCLIFDRSGEYMVSGGSDCTVRIWS 616          
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: W4XIN8 (WD_REPEATS_REGION domain-containing protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 568.155 bits (1463), Expect = 0.000e+0
Identity = 286/625 (45.76%), Postives = 409/625 (65.44%), Query Frame = 2
Query:   41 DENKYFLEKIEIPVYEESEFDYDFVKSDEILMLEDGTFDSFEHTSKILDELQEDERALEEAIFNNRPKLTTVPPSMDDYIRSFLLRLGLTRTLDCFQLEWFEKKHKGLLHEEDISEVPDIYVRNQQLDIQVKLMREDRNKYKQAALKAKEMHVKLRGERDYHKLQHRRMVQEKNKLIDEIKRLRDHYASYQPALEQLQQKYQTAMKEKMLSKLERDRICGQMQGLQMTLQSLENSTLPITTDD---DGKRLFFRDRSQVSNIHPCRKGGVLTVDKLNRGATQKKLADAREFKSKNDALNGEKENNDTPFPVDKGINEDLLKLRPPPGHLTRVGGFKLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNVTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVWS 1906
            +E  YFLE+  I    + EF Y+ +  D+ L+ E    +   +  + + E Q+D+ A +       P +T  P  +DD++R+FL+++G++RTLDCFQ EW+E + +GL++EED+  VPDIY RNQQLD QVK +R D ++++ AA+KAKE +VKLR ERD+H++ H+R+VQEKNKLID+IKRL+ HY SY+P L+QL+QKY+  MKE+ML+KLERDR   Q+  LQ TL+SLE+      T +   + +RL F      S + P ++     V +     T+    D          +   +   D+ FPVD G+N  L  ++ P  HLTR GGF+LT+T +AH  AV+ I  H  K++  T SDD +WK+WS+ S  ++MTG+GHT+W++   F   G +L T  GD T+KIW+ S AEC++TF  H  ++W   WH S  F+A+AS D T K+WDLNSL+CR  LRGH+DSVNSV FL  SN +LT+SADKTV LWDAR   CGQ+  GH ++VN A  + +G +IASCD++G ++ WD R  A S+ T D+G HP N   +D+SG+ +A+ S+D  +KM++  S  V+SL GHED+V + MFD  G+FL+S  AD TVR+WS
Sbjct:   10 EEGAYFLERATITEDSDDEFQYEEIPIDDDLVSE--IDEDLNNAVRTIQEAQDDKEAAKRKEGLIPPPVTQRPEVVDDFVRNFLVKMGMSRTLDCFQTEWYELQQRGLMNEEDVGTVPDIYCRNQQLDNQVKFLRTDVDRFRDAAMKAKETYVKLRKERDFHRMHHKRVVQEKNKLIDDIKRLKRHYGSYEPTLQQLKQKYEAVMKERMLAKLERDRAVNQVSALQATLRSLESGLREGATQEMTKEERRLMF-----ASGVGPTQQ----NVHRAREMTTEPFQPDPSSMDVTQQTI--PRHPKDSEFPVDNGVNPQLASVKGPSAHLTRTGGFRLTHTFQAHSLAVSGIALHPRKQILATVSDDQNWKMWSIPSGDIIMTGEGHTDWIADCDFHPSGSQLVTAGGDGTVKIWDFSKAECVHTFSEHQHAVWGCSWHASGDFVASASMDNTSKIWDLNSLRCRFTLRGHADSVNSVMFLPFSNNILTASADKTVSLWDARTGLCGQTFYGHVHSVNHATFSLRGDSIASCDSYGVVRVWDTRTCA-SMATYDVGPHPVNRAAFDSSGTVLAVGSNDGTVKMMDLTSGQVSSLAGHEDAVHAVMFDRAGDFLVSGGADNTVRIWS 620          
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: C3YKY8 (WD_REPEATS_REGION domain-containing protein (Fragment) OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_248284 PE=4 SV=1)

HSP 1 Score: 564.688 bits (1454), Expect = 0.000e+0
Identity = 291/626 (46.49%), Postives = 408/626 (65.18%), Query Frame = 2
Query:   71 EIPVYEESEFDYDF--VKSDEILMLEDGTFDSFEHTSKILDELQEDERALEEAIFNNRPKLTTVPPSMDDYIRSFLLRLGLTRTLDCFQLEWFEKKHKGLLHEEDISEVPDIYVRNQQLDIQVKLMREDRNKYKQAALKAKEMHVKLRGERDYHKLQHRRMVQEKNKLIDEIKRLRDHYASYQPALEQLQQKYQTAMKEKMLSKLERDRICGQMQGLQMTLQSLENSTLPITTDDDGKRLF---FRDRSQVS-NIHPCRKGGVLTVDKLNRGATQKKLADARE------FKSKNDALNGE--KENNDTPFPVDKGINEDLLKLRPPPGHLTRVGGFKLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNVTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVWS 1906
            E+ + E+ + DY +  V  DE  + E    +  +   ++++E  +D RA         P +   P  +DD++R++LL++G+ +TL+CFQ EW+E + KGLL EED+  VPD+Y RNQQLD  VKL+R++ +K+K AA KAK+M+VKLR ERD+H++ H+R+VQEKNKL+ +IKRL+ HYASY+P L QL+ KY+TAMKEKMLSKLERDR  GQ+ GLQ TL+++E           GK+ F   F+ + + S N     K G+        G TQ+ L +AR       +    D   GE  +   DT FP+D  +N  L   + P GHLTR GGF+LTNT+ AH+ A++ +  H  K++  TTSDD +WK+W++ +  ++MTG+GH +WVS A F   G KLATT+GD+T+K+W+ +  EC  TF  H+ + W   WH +  FLA+ S D T KVWDLNS +CR  LRGH+DSVNS+ FL  SN L T SADKT+ LWDAR   C Q+  GH ++VN+   N +G  IASCD++G LK WD R +AT I ++DLG HP N V +D SG  +A++S+D  +KM E  S  V+SL GHED+VQ+ +FD  GE+L+S  +D TVR+WS
Sbjct:    1 EVTITEDLDDDYQYEEVSVDEETIAEGD--EDLDAAVRVIEEAAQDIRASLRREGVPGPAVIERPEVVDDFVRNYLLKMGMRKTLECFQTEWYELQQKGLLKEEDVQTVPDVYSRNQQLDDHVKLLRKEVDKFKDAANKAKDMYVKLRKERDFHRMHHKRVVQEKNKLVTDIKRLKKHYASYEPTLRQLKHKYETAMKEKMLSKLERDRAVGQVSGLQATLKNIETGRGETVFLQGGKQDFYLNFQSKFKASKNSRELAKAGI--------GPTQQSLREARNIEGLPGYDPSKDPTRGEFKRHPKDTEFPLDNRVNPYLTSQKTPTGHLTRTGGFRLTNTLHAHQLAISNLALHPRKEILVTTSDDHTWKMWAIPNGDIIMTGEGHEDWVSAADFHPSGTKLATTAGDSTVKVWDFAKTECTVTFAEHTHAAWDCAWHWTGDFLASCSMDNTSKVWDLNSERCRYTLRGHADSVNSITFLYYSNTLCTGSADKTISLWDARTGLCAQTFYGHMHSVNNVTFNLRGDTIASCDSYGVLKLWDVRAIAT-ITSVDLGPHPTNRVAFDPSGQVLAVASNDGTVKMFEVGSGQVSSLTGHEDAVQAVVFDRKGEYLVSGGSDGTVRIWS 615          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000025776.2 (sperm associated antigen 16 [Source:NCBI gene;Acc:103027990])

HSP 1 Score: 481.485 bits (1238), Expect = 4.512e-163
Identity = 259/627 (41.31%), Postives = 385/627 (61.40%), Query Frame = 2
Query:   44 ENKYFLEKIEIPVYEESEFDYDFVKSDEILMLEDGTFDSFEHTSK--ILDELQEDERALEEAIFNNRPKLTTVPPSMDDYIRSFLLRLGLTRTLDCFQLEWFEKKHKGLLHEEDISEVPDIYVRNQQLDIQVKLMREDRNKYKQAALKAKEMHVKLRGERDYHKLQHRRMVQEKNKLIDEIKRLRDHYASYQPALEQLQQKYQTAMKEKMLSKLERDRICGQMQGL---QMTLQSLENSTLPITTDDDGKRLFFRDRSQVSNIHPCRKG-GVLTVDKLNRGATQKKLADAREFKSKNDALNGEKENNDTPFPVDKGINEDLLKLRPPPGHLTRVGGFKLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNVTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVWS 1906
            +  ++LEK+ IP  EESE  +++ +  E         ++ E   K  +    +E +R +E      +P L  +P  +DD++R+FL+++G++RTLDCFQ EWFE  HKG L  +++  +PD+Y  NQ LD ++K ++ +R+ YK AA +A E  +KL+ ERD+H+LQH+R+VQEKN+++++IKRL+ HYASY+PAL QL +KYQTA+++KML  +ERDR+  Q+Q +   Q    S   +   IT    G+     +++Q S     R G GV + D      +                    K   D+ FP +  IN  L +++       +V  F LT ++ AH  AV+C+  H  K V  + SDD  W+LW +   +++MTG+GHT+W+S  +F   G  LATTSGDTT+KIW+ +   C+ T EGH  + W   +HT   F+A+ S D T KVWDLNS +CR  LRGH DSVNS+ FL  SNILL+SSADKT+ LWDAR   C Q+  GHQ++ NSA  N  G  IASCD+ G +K WD R ++  + T+D G  P+N V +  +G  +A++S+D  +K+VE AS +++SL GH D+VQS +FDH GE+L+SA++D  + +WS
Sbjct:   13 DGPFYLEKVLIP--EESEDGFEYEEIIEEEESVTEGEETLEAAVKAAVKGRAEEFQRDIEPPNTAKQP-LNHIPEVVDDFLRNFLVKMGMSRTLDCFQTEWFEMLHKGKLKTDEVGFIPDVYTHNQLLDNELKNVQRERDSYKHAAFQAGETIIKLQKERDFHRLQHKRVVQEKNRMVEDIKRLKKHYASYEPALRQLNEKYQTALRQKMLVSIERDRVFSQVQNIDSNQRHTHSSPGTRSRITESQKGQ-----EKAQRSPERKSRPGDGVASEDPYKNTTS--------------------KHPKDSEFPSNTRINPFLPQIKALSAQSPKVSSFSLTKSLNAHTMAVSCLALHPRKLVIASASDDHLWRLWGMPEGEMIMTGEGHTDWLSSCSFHPSGGCLATTSGDTTVKIWDFAKGRCVLTLEGHMHATWGCCFHTCGDFVASCSMDNTAKVWDLNSERCRYTLRGHVDSVNSITFLSFSNILLSSSADKTLSLWDARTGLCAQTFYGHQHSCNSAAFNALGDTIASCDSCGVVKLWDVRNVSAMV-TLDTGPQPSNQVAFSPNGRMLAVASNDGSVKLVEVASLHLSSLSGHNDAVQSVIFDHKGEYLLSAASDGAICIWS 610          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Cavefish
Match: daw1 (dynein assembly factor with WD repeats 1 [Source:NCBI gene;Acc:103035445])

HSP 1 Score: 134.035 bits (336), Expect = 1.450e-33
Identity = 101/310 (32.58%), Postives = 154/310 (49.68%), Query Frame = 2
Query:  992 KLRPPPGHLTRVGGFKLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDND-GEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDC---RQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFN-VTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVWS 1906
            KL  P  H      F L  T++AH   +T +  +K+   F T S D + K+W   S   L T +GH N V   AF+N  G+K+AT S D T ++W++   +C YTF GH+  I  + ++  +  +AT S D T+K+WD+ S    + L GHS  + S+ F    + L+T S D TV +WD        ++ GH+  ++S N N   + I +       K WD    R LAT     D       DV ++  G  +A +S+D   ++ +  +F  V  L GHE  +    F+  G  +++ SAD T RVWS
Sbjct:   73 KLSQPDDH-----KFDLFKTLQAHILPLTNVAFNKSGSSFITGSYDRTCKIWDTASGTELHTLEGHKNVVYAVAFNNPYGDKIATGSFDKTCRLWSVETGQCFYTFRGHTAEIVCLAFNPQSTLVATGSMDTTVKLWDVESGVEVSTLSGHSAEIISLSFNTVGSRLVTGSFDHTVSVWDVPSGRLVHNLKGHRGEISSVNFNWDSSLIVTASMDKTCKVWDAEGGRCLATLTGHND----EVLDVCFNFKGQLIATASADGTSRVYDAQTFQFVCKLEGHEGEISKVCFNPQGTCVLTGSADKTARVWS 373          

HSP 2 Score: 126.331 bits (316), Expect = 6.193e-31
Identity = 79/248 (31.85%), Postives = 132/248 (53.23%), Query Frame = 2
Query: 1163 QVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFN-VTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            Q   T +GHT  + C AF+     +AT S DTT+K+W++ +   + T  GHS  I S+ ++T    L T S D T+ VWD+ S +    L+GH   ++SV F  +S++++T+S DKT  +WDA    C  +++GH   V     N +G  IA+  A G  + +D  Q    +  ++      + V ++  G+CV   S+D   ++   +S + +  L GH D + S  F++ G+ +I+ S D T R+W
Sbjct:  168 QCFYTFRGHTAEIVCLAFNPQSTLVATGSMDTTVKLWDVESGVEVSTLSGHSAEIISLSFNTVGSRLVTGSFDHTVSVWDVPSGRLVHNLKGHRGEISSVNFNWDSSLIVTASMDKTCKVWDAEGGRCLATLTGHNDEVLDVCFNFKGQLIATASADGTSRVYDA-QTFQFVCKLEGHEGEISKVCFNPQGTCVLTGSADKTARVWSVSSGSCLQVLEGHTDEIFSCAFNYYGDTIITGSKDNTCRIW 414          

HSP 3 Score: 71.633 bits (174), Expect = 6.981e-13
Identity = 46/163 (28.22%), Postives = 82/163 (50.31%), Query Frame = 2
Query: 1037 KLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLW 1525
            +L + +K H G ++ +  + +  +  T S D + K+W  +  + L T  GH + V    F+  G+ +AT S D T ++++    + +   EGH   I  V ++     + T S DKT +VW ++S  C  +L GH+D + S  F    + ++T S D T  +W
Sbjct:  252 RLVHNLKGHRGEISSVNFNWDSSLIVTASMDKTCKVWDAEGGRCLATLTGHNDEVLDVCFNFKGQLIATASADGTSRVYDAQTFQFVCKLEGHEGEISKVCFNPQGTCVLTGSADKTARVWSVSSGSCLQVLEGHTDEIFSCAFNYYGDTIITGSKDNTCRIW 414          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Cavefish
Match: POC1B (POC1 centriolar protein homolog B [Source:NCBI gene;Acc:103029957])

HSP 1 Score: 123.25 bits (308), Expect = 4.134e-30
Identity = 80/243 (32.92%), Postives = 124/243 (51.03%), Query Frame = 2
Query: 1181 KGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDC--RQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFN-VTSLVGHEDSVQSAMFDHDGEFLISASADCTVRV 1900
            KGH + V CA F    ++LAT S D T+ +WNL+     + FEGH   + +V +  S   LA+AS DKT+++W  N     T+   H+ +V SV F  +   L+T+S DK++ +W         S++ H   V  A  +  G  +ASC     ++ WD   RQ    INT      PA  V ++ SG+C+A S +D+ +K+ +  +   +     H  SV    F   G +LIS S+D TV++
Sbjct:   15 KGHRDAVPCADFSPSKKQLATGSSDKTVMVWNLNPKARAFRFEGHKDVVTAVHFSPSGDLLASASRDKTVRLWTPNIKGDSTVFTAHTATVRSVNFSSDGQRLITASDDKSLKIWSVHRQKFIYSLNQHTNWVRCARFSPDGRLVASCGDDRTVRLWDTSSRQC---INTFTDYGGPATFVDFNASGTCIASSGADNTLKIWDIRTNKLIQHYQVHSASVNCFSFHPSGNYLISGSSDSTVKI 254          

HSP 2 Score: 86.2705 bits (212), Expect = 8.999e-18
Identity = 48/148 (32.43%), Postives = 79/148 (53.38%), Query Frame = 2
Query: 1187 HTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDA 1630
            HTNWV CA F  DG  +A+   D T+++W+ S+ +C+ TF  +      VD++ S   +A++  D T+K+WD+ + K     + HS SVN   F  + N L++ S+D TV + D        ++ GH+  V +   + +G   AS  A
Sbjct:  143 HTNWVRCARFSPDGRLVASCGDDRTVRLWDTSSRQCINTFTDYGGPATFVDFNASGTCIASSGADNTLKIWDIRTNKLIQHYQVHSASVNCFSFHPSGNYLISGSSDSTVKILDLLEGRLIYTLYGHKGPVLAVVFSREGDLFASGGA 290          

HSP 3 Score: 85.8853 bits (211), Expect = 1.486e-17
Identity = 60/241 (24.90%), Postives = 104/241 (43.15%), Query Frame = 2
Query: 1184 GHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFN-VTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
             HT  V    F +DG++L T S D +LKIW++   + +Y+   H+  +    +      +A+   D+T+++WD +S +C      +      V F  +   + +S AD T+ +WD R +   Q      Y V+SA++N        C                        FHP        SG+ +   SSDS +K+++      + +L GH+  V + +F  +G+   S  AD  V +W
Sbjct:  100 AHTATVRSVNFSSDGQRLITASDDKSLKIWSVHRQKFIYSLNQHTNWVRCARFSPDGRLVASCGDDRTVRLWDTSSRQCINTFTDYGGPATFVDFNASGTCIASSGADNTLKIWDIRTNKLIQ-----HYQVHSASVN--------C----------------------FSFHP--------SGNYLISGSSDSTVKILDLLEGRLIYTLYGHKGPVLAVVFSREGDLFASGGADLQVLMW 297          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Cavefish
Match: POC1B (POC1 centriolar protein homolog B [Source:NCBI gene;Acc:103029957])

HSP 1 Score: 125.176 bits (313), Expect = 5.216e-30
Identity = 80/243 (32.92%), Postives = 124/243 (51.03%), Query Frame = 2
Query: 1181 KGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDC--RQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFN-VTSLVGHEDSVQSAMFDHDGEFLISASADCTVRV 1900
            KGH + V CA F    ++LAT S D T+ +WNL+     + FEGH   + +V +  S   LA+AS DKT+++W  N     T+   H+ +V SV F  +   L+T+S DK++ +W         S++ H   V  A  +  G  +ASC     ++ WD   RQ    INT      PA  V ++ SG+C+A S +D+ +K+ +  +   +     H  SV    F   G +LIS S+D TV++
Sbjct:   28 KGHRDAVPCADFSPSKKQLATGSSDKTVMVWNLNPKARAFRFEGHKDVVTAVHFSPSGDLLASASRDKTVRLWTPNIKGDSTVFTAHTATVRSVNFSSDGQRLITASDDKSLKIWSVHRQKFIYSLNQHTNWVRCARFSPDGRLVASCGDDRTVRLWDTSSRQ---CINTFTDYGGPATFVDFNASGTCIASSGADNTLKIWDIRTNKLIQHYQVHSASVNCFSFHPSGNYLISGSSDSTVKI 267          

HSP 2 Score: 87.4261 bits (215), Expect = 8.710e-18
Identity = 48/148 (32.43%), Postives = 79/148 (53.38%), Query Frame = 2
Query: 1187 HTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDA 1630
            HTNWV CA F  DG  +A+   D T+++W+ S+ +C+ TF  +      VD++ S   +A++  D T+K+WD+ + K     + HS SVN   F  + N L++ S+D TV + D        ++ GH+  V +   + +G   AS  A
Sbjct:  156 HTNWVRCARFSPDGRLVASCGDDRTVRLWDTSSRQCINTFTDYGGPATFVDFNASGTCIASSGADNTLKIWDIRTNKLIQHYQVHSASVNCFSFHPSGNYLISGSSDSTVKILDLLEGRLIYTLYGHKGPVLAVVFSREGDLFASGGA 303          

HSP 3 Score: 87.4261 bits (215), Expect = 9.517e-18
Identity = 60/241 (24.90%), Postives = 104/241 (43.15%), Query Frame = 2
Query: 1184 GHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFN-VTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
             HT  V    F +DG++L T S D +LKIW++   + +Y+   H+  +    +      +A+   D+T+++WD +S +C      +      V F  +   + +S AD T+ +WD R +   Q      Y V+SA++N        C                        FHP        SG+ +   SSDS +K+++      + +L GH+  V + +F  +G+   S  AD  V +W
Sbjct:  113 AHTATVRSVNFSSDGQRLITASDDKSLKIWSVHRQKFIYSLNQHTNWVRCARFSPDGRLVASCGDDRTVRLWDTSSRQCINTFTDYGGPATFVDFNASGTCIASSGADNTLKIWDIRTNKLIQ-----HYQVHSASVN--------C----------------------FSFHP--------SGNYLISGSSDSTVKILDLLEGRLIYTLYGHKGPVLAVVFSREGDLFASGGADLQVLMW 310          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Cavefish
Match: POC1B (POC1 centriolar protein homolog B [Source:NCBI gene;Acc:103029957])

HSP 1 Score: 124.405 bits (311), Expect = 6.790e-30
Identity = 80/243 (32.92%), Postives = 124/243 (51.03%), Query Frame = 2
Query: 1181 KGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDC--RQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFN-VTSLVGHEDSVQSAMFDHDGEFLISASADCTVRV 1900
            KGH + V CA F    ++LAT S D T+ +WNL+     + FEGH   + +V +  S   LA+AS DKT+++W  N     T+   H+ +V SV F  +   L+T+S DK++ +W         S++ H   V  A  +  G  +ASC     ++ WD   RQ    INT      PA  V ++ SG+C+A S +D+ +K+ +  +   +     H  SV    F   G +LIS S+D TV++
Sbjct:   15 KGHRDAVPCADFSPSKKQLATGSSDKTVMVWNLNPKARAFRFEGHKDVVTAVHFSPSGDLLASASRDKTVRLWTPNIKGDSTVFTAHTATVRSVNFSSDGQRLITASDDKSLKIWSVHRQKFIYSLNQHTNWVRCARFSPDGRLVASCGDDRTVRLWDTSSRQ---CINTFTDYGGPATFVDFNASGTCIASSGADNTLKIWDIRTNKLIQHYQVHSASVNCFSFHPSGNYLISGSSDSTVKI 254          

HSP 2 Score: 87.4261 bits (215), Expect = 9.735e-18
Identity = 48/148 (32.43%), Postives = 79/148 (53.38%), Query Frame = 2
Query: 1187 HTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDA 1630
            HTNWV CA F  DG  +A+   D T+++W+ S+ +C+ TF  +      VD++ S   +A++  D T+K+WD+ + K     + HS SVN   F  + N L++ S+D TV + D        ++ GH+  V +   + +G   AS  A
Sbjct:  143 HTNWVRCARFSPDGRLVASCGDDRTVRLWDTSSRQCINTFTDYGGPATFVDFNASGTCIASSGADNTLKIWDIRTNKLIQHYQVHSASVNCFSFHPSGNYLISGSSDSTVKILDLLEGRLIYTLYGHKGPVLAVVFSREGDLFASGGA 290          

HSP 3 Score: 87.0409 bits (214), Expect = 1.305e-17
Identity = 60/241 (24.90%), Postives = 104/241 (43.15%), Query Frame = 2
Query: 1184 GHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFN-VTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
             HT  V    F +DG++L T S D +LKIW++   + +Y+   H+  +    +      +A+   D+T+++WD +S +C      +      V F  +   + +S AD T+ +WD R +   Q      Y V+SA++N        C                        FHP        SG+ +   SSDS +K+++      + +L GH+  V + +F  +G+   S  AD  V +W
Sbjct:  100 AHTATVRSVNFSSDGQRLITASDDKSLKIWSVHRQKFIYSLNQHTNWVRCARFSPDGRLVASCGDDRTVRLWDTSSRQCINTFTDYGGPATFVDFNASGTCIASSGADNTLKIWDIRTNKLIQ-----HYQVHSASVN--------C----------------------FSFHP--------SGNYLISGSSDSTVKILDLLEGRLIYTLYGHKGPVLAVVFSREGDLFASGGADLQVLMW 297          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004902.1 (pep scaffold:Pmarinus_7.0:GL478254:5937:33805:1 gene:ENSPMAG00000004437.1 transcript:ENSPMAT00000004902.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 463.381 bits (1191), Expect = 9.426e-157
Identity = 240/623 (38.52%), Postives = 390/623 (62.60%), Query Frame = 2
Query:   74 IPVYEESEFDYDFVKSDEILMLEDGTF----DSFEHTSKILDELQEDERA-LEEAIFNNRPKLTTVPPSMDDYIRSFLLRLGLTRTLDCFQLEWFEKKHKGLLHEEDISEVPDIYVRNQQLDIQVKLMREDRNKYKQAALKAKEMHVKLRGERDYHKLQHRRMVQEKNKLIDEIKRLRDHYASYQPALEQLQQKYQTAMKEKMLSKLERDRICGQMQGLQMTLQSLENSTLPITTDDDG----KRLFFRDRSQVSNIHPCRKGGVLTVDKLNRGATQKKLADARE----FKSKNDALNGEKENNDTPFPVDKGINEDLLKLRPPPGHLTRVGGFKLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNVTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            + + +++E  Y +   +E+ + ++G+     +  +   + L EL ED +A +       +P +T    ++DD++R+FL R+G++RTLDCFQ EW+E + K  L + +   V D+Y++NQ+L  ++  +  D  K++ A  + ++M V LR ERD+H++ H+R++QEKN+L++++KRL+ HYASY+PAL  L++KY+ A+KEKML+KLERDR  GQ+ GLQ TL SLE+     T    G    + +  ++ S+V+  H C+      V+    G +Q++L +AR+       +    +  +   D+ FPVD  +N  L +++  P    R G  +++ T+KAHE  V+ +  H  K++  T SDD  WK+WS+ +  ++MTG+GHT+W+    F+  G  LAT  GD+T+K+W+ S   C+ T EGH  ++W   WH+   F+A++S D + KVWD+NS +CR  LRGH+DSVNSV+FL  S+ LLTSSADKT+ LWDAR   C Q   GH ++ N    N +G  + SCD++G +K WD R+  T+  T++LG HPAN + +  SG  +A++S D+ +++V+  + +V +L GHED+VQ+ +F  DG+ L S  +D T+R+W
Sbjct:    1 VTIIDDAEDQYRY---EEVSIADEGSAQDADEDLDFAVRSLQELSEDVQATVRRQGVGEKPPVTRQLEAIDDFVRNFLFRMGMSRTLDCFQSEWYELQEKEQLGKAEQGTVSDVYIQNQELHDKLTSLHRDLAKFQDATRQTQDMLVTLRKERDHHRMHHQRVLQEKNRLLNDLKRLQKHYASYEPALRSLREKYEAALKEKMLTKLERDRAVGQIAGLQATLHSLESGLEEPTPIIAGTCKLQIITTKNTSEVA--HKCKDATETGVE----GPSQRRLREARQQGVAPADEPAKSSAARHPKDSEFPVDTRVNPLLGQVQKQPSDAMRSGSLRISQTLKAHEMPVSSMALHPRKEIIVTASDDQLWKMWSIPNGDIIMTGQGHTDWIGDCDFNPTGTNLATGGGDSTVKVWDFSQGACVLTLEGHGHAVWGCSWHSCGDFIASSSMDNSSKVWDVNSERCRQTLRGHTDSVNSVEFLPYSSTLLTSSADKTLSLWDARTGRCAQIFYGHLHSCNHGTFNLKGDTVVSCDSYGVIKVWDVRK-GTATMTLNLGPHPANRLSFHPSGHVMAVASDDACVRIVDLLTGHVETLSGHEDAVQAVVFSPDGDTLFSGGSDGTIRMW 613          

HSP 2 Score: 53.1434 bits (126), Expect = 1.293e-7
Identity = 40/160 (25.00%), Postives = 62/160 (38.75%), Query Frame = 2
Query: 1175 TGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQS-----------------------IWSV-------------------DWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWD 1528
            T +GHT+ V+   F      L T+S D TL +W+     C   F GH  S                       +W V                    +H S   +A AS D  +++ DL +    T L GH D+V +V F  + + L +  +D T+ +W+
Sbjct:  456 TLRGHTDSVNSVEFLPYSSTLLTSSADKTLSLWDARTGRCAQIFYGHLHSCNHGTFNLKGDTVVSCDSYGVIKVWDVRKGTATMTLNLGPHPANRLSFHPSGHVMAVASDDACVRIVDLLTGHVET-LSGHEDAVQAVVFSPDGDTLFSGGSDGTIRMWE 614          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010366.1 (pep scaffold:Pmarinus_7.0:GL484367:3335:13277:1 gene:ENSPMAG00000009387.1 transcript:ENSPMAT00000010366.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 182.185 bits (461), Expect = 1.844e-53
Identity = 92/229 (40.17%), Postives = 155/229 (67.69%), Query Frame = 2
Query:   71 EIPVYEESEFDYDFVKSDEILMLEDGTF----DSFEHTSKILDELQEDERA-LEEAIFNNRPKLTTVPPSMDDYIRSFLLRLGLTRTLDCFQLEWFEKKHKGLLHEEDISEVPDIYVRNQQLDIQVKLMREDRNKYKQAALKAKEMHVKLRGERDYHKLQHRRMVQEKNKLIDEIKRLRDHYASYQPALEQLQQKYQTAMKEKMLSKLERDRICGQMQGLQMTLQSLEN 742
            E+ + +++E  Y +   +E+ + ++G+     +  +   + L EL ED +A +       +P +T    ++DD++R+FL R+G++RTLDCFQ EW+E + K  L + +   V D+Y++NQ+L  ++  +  D  K++ A  + ++M V LR ERD+H++ H+R++QEKN+L++++KRL+ HYASY+PAL  L++KY+ A+KEKML+KLERDR  GQ+ GLQ TL SLE+
Sbjct:    3 EVTIIDDAEDQYRY---EEVSIADEGSAQDADEDLDFAVRSLQELSEDVQATVRRQGVGEKPPVTRQLEAIDDFVRNFLFRMGMSRTLDCFQSEWYELQEKEQLGKAEQGTVSDVYIQNQELHDKLTSLHRDLAKFQDATRQTQDMLVTLRKERDHHRMHHQRVLQEKNRLLNDLKRLQKHYASYEPALRSLREKYEAALKEKMLTKLERDRAVGQIAGLQATLHSLES 228          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: pafah1b1b (platelet-activating factor acetylhydrolase 1b, regulatory subunit 1b [Source:NCBI gene;Acc:394247])

HSP 1 Score: 119.783 bits (299), Expect = 6.545e-30
Identity = 72/260 (27.69%), Postives = 131/260 (50.38%), Query Frame = 2
Query: 1184 GHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFW---------DCRQLATSINTIDLGFHPANDVRYDTSGS----------CVAMSSSDSVIKMVETAS-FNVTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            GH + V+   F      + + S D T+K+W+    +   T +GH+ S+  + +  S   LA+ S D T+K+WD  S +C   + GH  +V+SV F+ N + L+++S DKT+ +W+ +   C ++ +GH+  V     N+ G+ IASC     ++ W         + R+    +  +      A+ V  + +G+           +   S D  IKM + ++   V +LVGH++ V+  +F   G+F++S + D T+RVW
Sbjct:   45 GHRSPVTRVIFHPVFSVIVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDLSGKMLASCSADMTVKLWDFQSFECLRTMHGHDHNVSSVAFMPNGDHLVSASRDKTMKMWEVQTGYCVKTFTGHREWVRMVRPNQDGSLIASCSNDQTVRVWVTATKECKAELREHEHVVECVSWAPDAASPVILEATGAEAKKGGKPGPYLLSGSRDKTIKMWDISTGICVITLVGHDNWVRGVLFHPGGKFILSCADDKTLRVW 304          

HSP 2 Score: 91.6633 bits (226), Expect = 2.594e-20
Identity = 59/229 (25.76%), Postives = 103/229 (44.98%), Query Frame = 2
Query: 1034 FKLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSA--------------------PFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCR 1660
            F+   T+  H+  V+ +    N     + S D + K+W + +   + T  GH  WV     + DG  +A+ S D T+++W  +  EC      H   +  V W   A                    P+L + S DKTIK+WD+++  C   L GH + V  V F      +L+ + DKT+ +WD +   C +S++ H++ V S + ++    + +      +K W+CR
Sbjct:  121 FECLRTMHGHDHNVSSVAFMPNGDHLVSASRDKTMKMWEVQTGYCVKTFTGHREWVRMVRPNQDGSLIASCSNDQTVRVWVTATKECKAELREHEHVVECVSWAPDAASPVILEATGAEAKKGGKPGPYLLSGSRDKTIKMWDISTGICVITLVGHDNWVRGVLFHPGGKFILSCADDKTLRVWDYKNKRCQKSLAAHEHFVTSLDFHKTAPYVITGSVDQSVKVWECR 349          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: POC1A (POC1 centriolar protein A [Source:HGNC Symbol;Acc:HGNC:24488])

HSP 1 Score: 102.064 bits (253), Expect = 2.544e-23
Identity = 66/241 (27.39%), Postives = 115/241 (47.72%), Query Frame = 2
Query: 1184 GHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNV-TSLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            GH + V    F   G  + + S D T+++W  S       F+ H+ ++ SV +      L TAS DK+IKVW ++  K    L  HS+ V S +F  +  ++++ S D+TV +WD+    C  +   H   VN  + +  GT IA+      +K WD R +   +    +     N + +  +G+ +  +S+DS +K+++     +  +L GH+    +  F   G+F  S  +D  V VW
Sbjct:   58 GHKDAVMSVQFSPSGHLVVSASRDKTVRLWVPSVKGESTVFKAHTATVRSVSFSADGQSLVTASDDKSIKVWTVHRQKFLYSLNQHSNWVRSAKFSPDGRLIVSGSDDRTVRVWDSNSRECVHTFYEHGGFVNQVDFHPSGTCIAAAGTDNTVKVWDIR-MNKLLQHYQVHGAAVNSLSFHPTGNYLITASNDSTLKVLDLVEGRLFYTLHGHQGPATAVAFSRAGDFFASGGSDEQVMVW 297          

HSP 2 Score: 100.523 bits (249), Expect = 8.343e-23
Identity = 68/244 (27.87%), Postives = 118/244 (48.36%), Query Frame = 2
Query: 1181 KGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNVTSLVGHED----SVQSAMFDHDGEFLISASADCTVRV 1900
            KGH + ++   F+ + ++LA+ S D  L +WN       Y F GH  ++ SV +  S   + +AS DKT+++W  +     T+ + H+ +V SV F  +   L+T+S DK++ +W         S++ H   V SA  +  G  I S      ++ WD           + G    N V +  SG+C+A + +D+ +K+ +     +  L+ H      +V S  F   G +LI+AS D T++V
Sbjct:   15 KGHRDTITSVDFNPNMKQLASGSMDACLMVWNFKPQTRAYRFVGHKDAVMSVQFSPSGHLVVSASRDKTVRLWVPSVKGESTVFKAHTATVRSVSFSADGQSLVTASDDKSIKVWTVHRQKFLYSLNQHSNWVRSAKFSPDGRLIVSGSDDRTVRVWDSNSRECVHTFYEHGGF-VNQVDFHPSGTCIAAAGTDNTVKVWD---IRMNKLLQHYQVHGAAVNSLSFHPTGNYLITASNDSTLKV 254          

HSP 3 Score: 90.8929 bits (224), Expect = 1.326e-19
Identity = 60/193 (31.09%), Postives = 96/193 (49.74%), Query Frame = 2
Query: 1043 TNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIAS 1621
            +   KAH   V  +    + +   T SDD S K+W++   + L +   H+NWV  A F  DG  + + S D T+++W+ ++ EC++TF  H   +  VD+H S   +A A  D T+KVWD+   K     + H  +VNS+ F    N L+T+S D T+ + D        ++ GHQ    +   +  G   AS
Sbjct:   95 STVFKAHTATVRSVSFSADGQSLVTASDDKSIKVWTVHRQKFLYSLNQHSNWVRSAKFSPDGRLIVSGSDDRTVRVWDSNSRECVHTFYEHGGFVNQVDFHPSGTCIAAAGTDNTVKVWDIRMNKLLQHYQVHGAAVNSLSFHPTGNYLITASNDSTLKVLDLVEGRLFYTLHGHQGPATAVAFSRAGDFFAS 287          

HSP 4 Score: 67.3958 bits (163), Expect = 4.119e-12
Identity = 49/201 (24.38%), Postives = 90/201 (44.78%), Query Frame = 2
Query: 1304 FEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFN-VTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            F+GH  +I SVD++ +   LA+ S D  + VW+           GH D+V SVQF  + ++++++S DKTV LW   +         H   V S + +  G ++ +      +K W   +    + +++   +     ++   G  +   S D  +++ ++ S   V +   H   V    F   G  + +A  D TV+VW
Sbjct:   14 FKGHRDTITSVDFNPNMKQLASGSMDACLMVWNFKPQTRAYRFVGHKDAVMSVQFSPSGHLVVSASRDKTVRLWVPSVKGESTVFKAHTATVRSVSFSADGQSLVTASDDKSIKVWTVHR-QKFLYSLNQHSNWVRSAKFSPDGRLIVSGSDDRTVRVWDSNSRECVHTFYEHGGFVNQVDFHPSGTCIAAAGTDNTVKVW 213          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008862.1 (pep scaffold:Pmarinus_7.0:GL476579:86637:114999:1 gene:ENSPMAG00000008000.1 transcript:ENSPMAT00000008862.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 91.6633 bits (226), Expect = 1.009e-19
Identity = 71/244 (29.10%), Postives = 124/244 (50.82%), Query Frame = 2
Query: 1181 KGHTNWV-SCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKM--VETASFNVTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            KGH + V +C  F   G ++ + S D TLK+W+    +CL T  GH+  +WS         + + S D+T+KVW+ ++ +C   L GH+ +V  +    + N +++ S D T+ +WD     C   ++GH  AV    +   G  + S      +K WD  +  T ++T+    +    +++D  G  +   S D+ I++   ET +  + +LVGH+ S+ S M   D   L+S +AD TV++W
Sbjct:  230 KGHDDHVITCLQFC--GNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSS--QMRGNIIVSGSTDRTLKVWNADTGQCVHTLYGHTSTVRCMHL--HGNRVVSGSRDATLRVWDIETGQCLHVLAGHVAAVRC--VQYDGRRVVSGAYDYTVKVWD-PESETCLHTLQGHTNRVYSLQFD--GVHIVSGSLDTSIRVWDAETGTC-LHTLVGHQ-SLTSGMELRD-NILVSGNADSTVKIW 459          

HSP 2 Score: 89.3521 bits (220), Expect = 5.157e-19
Identity = 61/209 (29.19%), Postives = 107/209 (51.20%), Query Frame = 2
Query: 1043 TNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISG---HQYAVNSANINEQGTNIASCDAFGFLKFWDCR 1660
             +T+  H   V C+  H N+ V  + S D + ++W +++ Q L    GH   V C  +D  G ++ + + D T+K+W+  +  CL+T +GH+  ++S+ +      + + S D +I+VWD  +  C   L GH    + ++     NIL++ +AD TV +WD +   C Q++ G   HQ AV     + +    +S D  G +K WD R
Sbjct:  307 VHTLYGHTSTVRCMHLHGNRVV--SGSRDATLRVWDIETGQCLHVLAGHVAAVRCVQYD--GRRVVSGAYDYTVKVWDPESETCLHTLQGHTNRVYSLQF--DGVHIVSGSLDTSIRVWDAETGTCLHTLVGHQSLTSGMEL--RDNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFSRKLVVTSSDD--GTVKLWDLR 505          

HSP 3 Score: 49.2914 bits (116), Expect = 2.296e-6
Identity = 46/173 (26.59%), Postives = 81/173 (46.82%), Query Frame = 2
Query: 1397 WDLNSLKCRTILRGHSDSV-NSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVR-YDTSGSCVAMSSSDSVIKM--VETASFNVTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            W    ++   +L+GH D V   +QF    N +++ S D T+ +W A    C +++ GH   V S+ +  +G  I S      LK W+    A +   +   +   + VR     G+ V   S D+ +++  +ET    +  L GH  +V+   +  DG  ++S + D TV+VW
Sbjct:  218 WRCGEIRAPKVLKGHDDHVITCLQFC--GNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQM--RGNIIVSGSTDRTLKVWN----ADTGQCVHTLYGHTSTVRCMHLHGNRVVSGSRDATLRVWDIETGQC-LHVLAGHVAAVRCVQY--DGRRVVSGAYDYTVKVW 379          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Yeast
Match: RSA4 (WD-repeat protein involved in ribosome biogenesis; may interact with ribosomes; required for maturation and efficient intra-nuclear transport or pre-60S ribosomal subunits, localizes to the nucleolus [Source:SGD;Acc:S000000668])

HSP 1 Score: 100.138 bits (248), Expect = 9.630e-23
Identity = 74/261 (28.35%), Postives = 131/261 (50.19%), Query Frame = 2
Query: 1169 LMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLY-TFEGHSQSIWSVDWHT-------SAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSIS---GHQYAVNSANIN-EQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDV--RYDTSGSCVAMSSSDSVIKMVET--ASFNVTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            + T KGH NWV C ++  DGE +AT S D T+++W+  + +CL     GHS+ I S+ W         S P LA++S D TIK+WD  S  C+  + GH++SV+ V++     +L + S D+TV +WD  I++ G+ I+    H + VN  +++ +    I + D  G       ++ +T              +  +   S   +  +S D  + +     ++  +  + GH+  V    F  DG +++SAS D ++++W
Sbjct:  179 MHTLKGHYNWVLCVSWSPDGEVIATGSMDNTIRLWDPKSGQCLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKW-GGQGLLYSGSHDRTVRVWD--INSQGRCINILKSHAHWVNHLSLSTDYALRIGAFDHTG-------KKPSTPEEAQKKALENYEKICKKNGNSEEMMVTASDDYTMFLWNPLKSTKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLW 429          

HSP 2 Score: 98.2117 bits (243), Expect = 4.862e-22
Identity = 90/338 (26.63%), Postives = 149/338 (44.08%), Query Frame = 2
Query: 1046 NTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTG-KGHTNWVSCAAFD-------NDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSL-KCRTILRGHSDSVNSVQFLVN---------------------------------------SNILLTSSADKTVCLWDARISTCGQS-ISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKM--VETASFNVTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVWS 1906
            +T+K H   V C+    + +V  T S D++ +LW   S Q L    +GH+ W++  +++           +LA++S D T+KIW+  +  C YT  GH+ S+  V W      L + SHD+T++VWD+NS  +C  IL+ H+  VN +    +                                         +++T+S D T+ LW+   ST   + ++GHQ  VN    +  G  I S      +K WD R     I+T          V + +    +   S D+ +K+  V T   +V  L GH+D V +  +  DG+ + S   D  VR+W+
Sbjct:  180 HTLKGHYNWVLCVSWSPDGEVIATGSMDNTIRLWDPKSGQCLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWGGQG-LLYSGSHDRTVRVWDINSQGRCINILKSHAHWVNHLSLSTDYALRIGAFDHTGKKPSTPEEAQKKALENYEKICKKNGNSEEMMVTASDDYTMFLWNPLKSTKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRD-GKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSV-DLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLWT 514          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Yeast
Match: TAF5 (Subunit (90 kDa) of TFIID and SAGA complexes; involved in RNA polymerase II transcription initiation and in chromatin modification [Source:SGD;Acc:S000000402])

HSP 1 Score: 93.5893 bits (231), Expect = 2.475e-20
Identity = 65/242 (26.86%), Postives = 105/242 (43.39%), Query Frame = 2
Query: 1184 GHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFN-VTSLVGH-EDSVQSAMFDHDGEFLISASADCTVRVW 1903
            GH+  V   +F  D + L + S D T+++W++     L +++GH+  +W V +     + ATASHD+T ++W  + +    I  GH + V+ V F  N   + T S+DKT  +WD       +   GH   V S         IA C         D R L+T                           S D +I + +  +   +  + GH ++++ S  +  +G  LIS  AD TVRVW
Sbjct:  523 GHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVIS---------IAVCP--------DGRWLST--------------------------GSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVW 721          

HSP 2 Score: 77.7962 bits (190), Expect = 2.526e-15
Identity = 62/230 (26.96%), Postives = 96/230 (41.74%), Query Frame = 2
Query: 1292 CLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNS------------------LKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDC------RQLATSINTID-LGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNVTSL-VGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            C+YTF+  ++ +  +D+       A    D  IK+W L+                     C+T++ GHS +V S  F  ++  LL+ S DKTV LW     T   S  GH + V   + +  G   A+       + W C      R  A  +N +D + FHP        +G  V   SSD   +M + ++ +   L +GH   V S     DG +L + S D  + VW
Sbjct:  458 CMYTFQNTNKDMSCLDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTCKTLV-GHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHP--------NGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVW 678          

HSP 3 Score: 75.0998 bits (183), Expect = 1.604e-14
Identity = 57/209 (27.27%), Postives = 101/209 (48.33%), Query Frame = 2
Query: 1049 TIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGH-QYAVNSANINEQGTNIASCDAFGFLKFWDCRQLAT 1672
            T+  H G V       + K   + S+D + +LWS+D+   L++ KGH + V   +F   G   AT S D T ++W+      L  F GH   +  V +H +  ++ T S DKT ++WD+++     +  GH+  V S+    +   L T S D  + +WD       + + GH + A+ S + +++G  + S  A   ++ WD ++  T
Sbjct:  520 TLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLKKATT 728          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Yeast
Match: MET30 (F-box protein containing five copies of the WD40 motif; controls cell cycle function, sulfur metabolism, and methionine biosynthesis as part of the ubiquitin ligase complex; interacts with and regulates Met4p, localizes within the nucleus; dissociation of Met30p from SCF complex in response to cadmium stress is regulated by Cdc48p [Source:SGD;Acc:S000001308])

HSP 1 Score: 91.6633 bits (226), Expect = 9.307e-20
Identity = 54/139 (38.85%), Postives = 77/139 (55.40%), Query Frame = 2
Query: 1169 LMTGK------GHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGH 1567
            L TGK      GH++ V    FD+   KL T S D T+++WN    EC+ T+ GHS S+ SVD  +    + + S DKT+KVW + S  C T LRGH++ VN V+    S    + S D T+ +WD R ++C +   GH
Sbjct:  329 LFTGKLIRRLSGHSDGVKTLYFDD--RKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVD--SYQKVIVSGSADKTVKVWHVESRTCYT-LRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGH 462          

HSP 2 Score: 78.1814 bits (191), Expect = 1.454e-15
Identity = 53/160 (33.12%), Postives = 82/160 (51.25%), Query Frame = 2
Query: 1181 KGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCR 1660
            KGH + V    F+     L T S D+T+ IW+L   + +    GHS  + ++ +      L T S DKTI+VW+  + +C +  RGHSDSV SV       ++++ SADKTV +W     TC  ++ GH   VN   ++ +  +  SC     ++ WD R
Sbjct:  299 KGHMDGVLTLQFNY--RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRK--LITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSY--QKVIVSGSADKTVKVWHVESRTC-YTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIR 451          

HSP 3 Score: 52.7582 bits (125), Expect = 1.283e-7
Identity = 37/116 (31.90%), Postives = 59/116 (50.86%), Query Frame = 2
Query: 1304 FEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFW 1651
            F+GH   + ++ ++     L T S+D TI +WDL + K    L GHSD V ++ F  +   L+T S DKT+ +W+     C  +  GH  +V S +  ++   I S  A   +K W
Sbjct:  298 FKGHMDGVLTLQFNYR--LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF--DDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKV--IVSGSADKTVKVW 407          

HSP 4 Score: 48.9062 bits (115), Expect = 2.100e-6
Identity = 23/63 (36.51%), Postives = 36/63 (57.14%), Query Frame = 2
Query: 1253 DTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPF-LATASHDKTIKVWDLNSLKCRTILRG 1438
            D T+K+W++   +C+ T  GH + +W +    +  F + + SHD +IKVWDL S KC     G
Sbjct:  531 DNTIKLWDVKTGKCIRTQFGHVEGVWDI---AADNFRIISGSHDGSIKVWDLQSGKCMHTFNG 590          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Yeast
Match: UTP13 (Nucleolar protein; component of the small subunit (SSU) processome containing the U3 snoRNA that is involved in processing of pre-18S rRNA [Source:SGD;Acc:S000004212])

HSP 1 Score: 91.2781 bits (225), Expect = 1.341e-19
Identity = 48/142 (33.80%), Postives = 71/142 (50.00%), Query Frame = 2
Query: 1235 LATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFW-DC 1657
             AT S D T KIWNL   E   T   H + +W V +      LAT+S DKT+K+W L++      L GH+++V    F+     L++  AD  + +WD     C +++ GH   + + +    G  I S DA G  +FW DC
Sbjct:  506 FATASYDKTCKIWNLENGELEATLANHKRGLWDVSFCQYDKLLATSSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQLISCGADGLIKIWDCSSGECLKTLDGHNNRLWALSTMNDGDMIVSADADGVFQFWKDC 647          

HSP 2 Score: 77.7962 bits (190), Expect = 2.084e-15
Identity = 64/255 (25.10%), Postives = 99/255 (38.82%), Query Frame = 2
Query: 1184 GHTNWVSCAAFDNDGEK-----LATTSGDTTLKIWNLSAAECL----------YTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNVTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            GH+  V+     N   K     L T S D T+K W +                YT   H + I ++    +    ATAS+DKT K+W+L + +    L  H   +  V F     +L TSS DKTV +W     +  +++ GH  AV   +   +   + SC A G +K WDC                       +SG C+                    +L GH + + +    +DG+ ++SA AD   + W
Sbjct:  432 GHSAAVTAVGLPNIVSKGYPEFLLTASNDLTIKKWIIPKPTASMDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATASYDKTCKIWNLENGELEATLANHKRGLWDVSFCQYDKLLATSSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQLISCGADGLIKIWDC-----------------------SSGECLK-------------------TLDGHNNRLWALSTMNDGDMIVSADADGVFQFW 644          

HSP 3 Score: 60.4622 bits (145), Expect = 5.964e-10
Identity = 65/254 (25.59%), Postives = 111/254 (43.70%), Query Frame = 2
Query: 1232 KLATTSGDTTLKIW---NLSAAEC-----LYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILR----GHSDSVNSVQF--LVN---SNILLTSSADKTVCLWDARISTCGQSIS----------GHQYAVNSANINEQGTNIASCDAFGFLKFWDCR--QLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNVT-SLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            KLA  +   +L+I    +LS  E      +  +EGH   + S+D      ++ATAS D T  VW  N   C+  +     GHS +V +V    +V+      LLT+S D T+  W     T    +            H+  +N+ +++   +  A+       K W+    +L  ++     G    +  +YD     +A SS D  +K+    +F+V  +L GH ++VQ   F +  + LIS  AD  +++W
Sbjct:  352 KLALATNSPSLRIIPVPDLSGPEASLPLDVEIYEGHEDLLNSLDATEDGLWIATASKDNTAIVWRYNENSCKFDIYAKYIGHSAAVTAVGLPNIVSKGYPEFLLTASNDLTIKKWIIPKPTASMDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATASYDKTCKIWNLENGELEATLANHKRGLWDVSFCQYD---KLLATSSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQLISCGADGLIKIW 602          

HSP 4 Score: 55.8398 bits (133), Expect = 1.453e-8
Identity = 25/78 (32.05%), Postives = 42/78 (53.85%), Query Frame = 2
Query: 1166 VLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVW 1399
            V+ T +GHTN V   +F N  ++L +   D  +KIW+ S+ ECL T +GH+  +W++        + +A  D   + W
Sbjct:  567 VMKTLEGHTNAVQRCSFINKQKQLISCGADGLIKIWDCSSGECLKTLDGHNNRLWALSTMNDGDMIVSADADGVFQFW 644          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Yeast
Match: PRP46 (Member of the NineTeen Complex (NTC); this complex contains Prp19p and stabilizes U6 snRNA in catalytic forms of the spliceosome containing U2, U5, and U6 snRNAs [Source:SGD;Acc:S000006072])

HSP 1 Score: 87.0409 bits (214), Expect = 1.160e-18
Identity = 47/159 (29.56%), Postives = 71/159 (44.65%), Query Frame = 2
Query: 1184 GHTNWVSCAAFDN-DGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDC 1657
            GH  WV C A D  D E   T S DTT+K+W+L+  +   T  GH  ++  V      P+L + S DKT+K WDL   +      GH   V +V      +++ T+  D  + LWD R      ++ GH+  +N          + S      ++ WD 
Sbjct:  137 GHLGWVRCVAIDPVDNEWFITGSNDTTMKVWDLATGKLKTTLAGHVMTVRDVAVSDRHPYLFSVSEDKTVKCWDLEKNQIIRDYYGHLSGVRTVSIHPTLDLIATAGRDSVIKLWDMRTRIPVITLVGHKGPINQVQCTPVDPQVVSSSTDATVRLWDV 295          

HSP 2 Score: 80.1073 bits (196), Expect = 2.111e-16
Identity = 87/321 (27.10%), Postives = 145/321 (45.17%), Query Frame = 2
Query:  980 EDLLKLRPPPGHLTRVGGFKLTNTIKAHEGAVTCIRTHK-NKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQ--LATS--------INTIDLGFHPANDVRYDTSGSCVAMSSSD--SVIKMVETASFNVTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            E LL  RP   H      +KL+  I  H G V C+     + + F T S+D + K+W L + ++  T  GH   V   A  +    L + S D T+K W+L   + +  + GH   + +V  H +   +ATA  D  IK+WD+ +      L GH   +N VQ       +++SS D TV LWD       + ++ H+ +V +  ++ +  ++AS      ++ W   +  L T+        INT+ +     +DV +   G    +S  D  S  K    A+  +   +  E SV  + FD  G  LI+  AD ++++W
Sbjct:  116 EKLLSQRPE-WH----APWKLSRVINGHLGWVRCVAIDPVDNEWFITGSNDTTMKVWDLATGKLKTTLAGHVMTVRDVAVSDRHPYLFSVSEDKTVKCWDLEKNQIIRDYYGHLSGVRTVSIHPTLDLIATAGRDSVIKLWDMRTRIPVITLVGHKGPINQVQCTPVDPQVVSSSTDATVRLWDVVAGKTMKVLTHHKRSVRATALHPKEFSVASA-CTDDIRSWGLAEGSLLTNFESEKTGIINTLSIN---QDDVLF-AGGDNGVLSFYDYKSGHKYQSLATREMVGSLEGERSVLCSTFDKTGLRLITGEADKSIKIW 426          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO33837 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR29])

HSP 1 Score: 539.265 bits (1388), Expect = 0.000e+0
Identity = 282/625 (45.12%), Postives = 396/625 (63.36%), Query Frame = 2
Query:   32 MDLDENKYFLEKIEIPVYEESEFDYDFVKSDEILMLEDGTFDSFEHTSKILDELQEDERALEEAIFNNRPKLTTVPPSMDDYIRSFLLRLGLTRTLDCFQLEWFEKKHKGLLHEEDISEVPDIYVRNQQLDIQVKLMREDRNKYKQAALKAKEMHVKLRGERDYHKLQHRRMVQEKNKLIDEIKRLRDHYASYQPALEQLQQKYQTAMKEKMLSKLERDRICGQMQGLQMTLQSLENSTLPITTDDDGKRLFFRDRSQVSNIHPCRKGGVLTVDKLNRGATQKKLADAREFKSKNDALNGEKENNDTPFPVDKGINEDLLKLRPPPGHLTRVGGFKLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNVTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVWS 1906
            M  ++  Y+LE++ +    + EF Y+ V  ++   + +G  D  +   K + E  ED   ++         +TT P  ++D++R+FL+++G+ +TLDCFQ EW+E   KGLL+EE++  VPD++V+NQQLD  VKL+R+D  KYK AA KA++  V+LR ERD+H++ H+R+VQEKN+LI +IKRL+ HY+SY+P L  L+ KY+ AMKEKML+KLERDR  GQ+QGLQ TL  +  +   IT    G R       +V    P +             AT + L           AL  ++   D+ FPVD  +N  L   R P  HLTR GGF+LT++I AH   V+ +  H  K+VF T SDD+ WK+W++ S  ++MTG+GH NW+S   F   G +LAT+SGD T+KIW+ S AEC+ TF  H+ ++W   WH+   FLA+ S D T K+WDLNS +CR  LRGH+DSVNS+ FL  SN LLTSSADKT+ LWDAR   C Q+  GH  + N    N +G  +ASCDA+G +K WD R + + + T DLG HPAN V +D SG+ +A++S+D  ++M E AS  V  L GHED+VQS +FD  GEFL+S+ +D TVR+WS
Sbjct:    1 MAAEDETYYLEQLTVADDSDDEFPYEEVPIEDDYSVTEGDED-LDTAVKTIKEKSEDASLIKSGPL--VASVTTRPEVVEDFVRNFLVKMGMNKTLDCFQTEWYELMQKGLLNEEEVRIVPDLFVKNQQLDDTVKLLRQDVTKYKDAAEKARQTFVRLRKERDFHRMHHKRVVQEKNRLITDIKRLKKHYSSYEPTLVTLKHKYEVAMKEKMLTKLERDRAVGQVQGLQSTLHQVGGTKEVITEGTGGGRTI-----RVQQPAPAQ-------------ATNEDL-----------ALTTKRHPKDSEFPVDNRVNPMLAHHRGPSAHLTRSGGFRLTHSINAHSLPVSGLALHPRKQVFATVSDDNKWKMWAIPSGDIIMTGEGHKNWISDCDFHPGGARLATSSGDGTVKIWDFSKAECVLTFADHTHAVWGCTWHSKGDFLASCSMDNTSKIWDLNSERCRYTLRGHADSVNSIVFLPYSNTLLTSSADKTLSLWDARTGLCAQTFYGHMNSCNHCTFNLKGDTVASCDAYGVVKLWDVRTV-SCMATADLGPHPANRVAFDPSGTVLAIASNDGSVQMYEVASGKVNQLTGHEDAVQSVLFDRAGEFLLSSGSDGTVRIWS 592          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO34865 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN68])

HSP 1 Score: 123.635 bits (309), Expect = 1.957e-30
Identity = 92/292 (31.51%), Postives = 145/292 (49.66%), Query Frame = 2
Query: 1034 FKLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDND-GEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNVTS-LVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            F L   ++AH   +T +  +K+   F T S D + K+W   S +  +T +GH N V   AF+N  G+K+AT S D T K+WN    +C +T+ GHS  I  + ++  +  +AT S D T K+WD+ +    + L GHS  + S  F      LLT S D TV +WD R      ++ GH+  +++A  N   + I +       K WD       I T+        DV +D +G  +A +S+D   ++    + +  S L GHE  +    F+  G  L++AS+D T R+W
Sbjct:   82 FYLFKILRAHILPLTNVAFNKSGTSFITGSYDRTCKVWDTASGEETLTLEGHKNVVYAIAFNNPYGDKIATGSFDKTCKLWNAETGKCYHTYRGHSAEIVCLAFNPQSTVIATGSMDTTAKLWDVQTGAEISTLSGHSAEIISCAFNSTGTQLLTGSFDHTVSVWDTRSGRRVHTLIGHRGEISNAQFNFDCSFIVTGSMDKTCKIWDAGT-GKCIGTLRGHDDEVLDVAFDYTGQLIATASADGTGRVYNALTHHCLSKLEGHEGEISKITFNAQGTRLLTASSDKTARLW 372          

HSP 2 Score: 108.612 bits (270), Expect = 2.044e-25
Identity = 77/289 (26.64%), Postives = 127/289 (43.94%), Query Frame = 2
Query: 1037 KLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNVTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            K  +T + H   + C+  +    V  T S D + KLW + +   + T  GH+  +   AF++ G +L T S D T+ +W+  +   ++T  GH   I +  ++    F+ T S DKT K+WD  + KC   LRGH D V  V F     ++ T+SAD T  +++A    C   + GH+  ++    N QGT + +  +    + WD                         +G C+ +                   L GH D + S  F++DG+ +I+ S D T R+W
Sbjct:  168 KCYHTYRGHSAEIVCLAFNPQSTVIATGSMDTTAKLWDVQTGAEISTLSGHSAEIISCAFNSTGTQLLTGSFDHTVSVWDTRSGRRVHTLIGHRGEISNAQFNFDCSFIVTGSMDKTCKIWDAGTGKCIGTLRGHDDEVLDVAFDYTGQLIATASADGTGRVYNALTHHCLSKLEGHEGEISKITFNAQGTRLLTASSDKTARLWD-----------------------PNTGKCLQV-------------------LEGHTDEIFSCAFNYDGDIIITGSKDNTCRLW 414          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO41896 (Lissencephaly-1 homolog [Source:UniProtKB/Swiss-Prot;Acc:A7S338])

HSP 1 Score: 119.013 bits (297), Expect = 7.009e-29
Identity = 73/261 (27.97%), Postives = 129/261 (49.43%), Query Frame = 2
Query: 1184 GHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFW---------DCRQLATSINTIDLGFHPANDV-----------RYDTSGSCVAMSSSDSVIKMVE-TASFNVTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            GH + ++   F      + T+S D T+K+W+    +   T +GH+ ++  + +  +  FLA++S D TIK+WD    +C   L GH  +V+S+ FL + + L+++S DKT+ +W+     C ++  GH   V     N  G+ IASC     ++ W         D R     I  ++     A  V           +  + G  +  +S D  IK+ + +A   + +LVGH++ V++ MF   G+F++S S D T+R+W
Sbjct:  104 GHRSPITKVLFHPVYSVMVTSSEDATVKVWDYETGDFERTLKGHTDAVQDLAFDHTGKFLASSSADMTIKLWDFQGFECIRTLHGHDHNVSSISFLPSGDHLVSASRDKTIKMWEIATGYCVKTFQGHGEWVRRVRPNADGSLIASCSNDQTIRVWVVASRECKCDLRDHDHVIEDLNWAPESATPVINEAAGVEGGKKAMSPGPFLVSASRDKSIKIWDVSAGVCLVTLVGHDNWVRAVMFHPGGKFIVSCSDDKTLRIW 364          

HSP 2 Score: 97.8265 bits (242), Expect = 7.372e-22
Identity = 60/231 (25.97%), Postives = 110/231 (47.62%), Query Frame = 2
Query: 1031 GFKLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDW---------------------HTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCR 1660
            GF+   T+  H+  V+ I    +     + S D + K+W + +   + T +GH  WV     + DG  +A+ S D T+++W +++ EC      H   I  ++W                      +  PFL +AS DK+IK+WD+++  C   L GH + V +V F      +++ S DKT+ +WD +   C +++  H++ V + + ++    +A+      LK W+CR
Sbjct:  179 GFECIRTLHGHDHNVSSISFLPSGDHLVSASRDKTIKMWEIATGYCVKTFQGHGEWVRRVRPNADGSLIASCSNDQTIRVWVVASRECKCDLRDHDHVIEDLNWAPESATPVINEAAGVEGGKKAMSPGPFLVSASRDKSIKIWDVSAGVCLVTLVGHDNWVRAVMFHPGGKFIVSCSDDKTLRIWDYKNKRCAKTLVAHEHFVTTLDFHKSAPFVATGSVDLTLKVWECR 409          

HSP 3 Score: 83.9593 bits (206), Expect = 3.033e-17
Identity = 64/228 (28.07%), Postives = 102/228 (44.74%), Query Frame = 2
Query: 1298 YTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATS--INTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASF---------------------NVTSLVGHEDSVQS---AMFDHDGEFLISASADCTVRVW 1903
            YT  GH   I  V +H     + T+S D T+KVWD  +      L+GH+D+V  + F      L +SSAD T+ LWD +   C +++ GH + V+S +    G ++ S      +K W   ++AT   + T          VR +  GS +A  S+D  I++   AS                      + T ++     V+    AM    G FL+SAS D ++++W
Sbjct:  100 YTLTGHRSPITKVLFHPVYSVMVTSSEDATVKVWDYETGDFERTLKGHTDAVQDLAFDHTGKFLASSSADMTIKLWDFQGFECIRTLHGHDHNVSSISFLPSGDHLVSASRDKTIKMW---EIATGYCVKTFQGHGEWVRRVRPNADGSLIASCSNDQTIRVWVVASRECKCDLRDHDHVIEDLNWAPESATPVINEAAGVEGGKKAM--SPGPFLVSASRDKSIKIW 322          

HSP 4 Score: 75.485 bits (184), Expect = 1.503e-14
Identity = 50/162 (30.86%), Postives = 77/162 (47.53%), Query Frame = 2
Query: 1421 RTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETAS-FNVTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            R  L GH   +  V F    ++++TSS D TV +WD       +++ GH  AV     +  G  +AS  A   +K WD +     I T+    H  + + +  SG  +  +S D  IKM E A+ + V +  GH + V+    + DG  + S S D T+RVW
Sbjct:   99 RYTLTGHRSPITKVLFHPVYSVMVTSSEDATVKVWDYETGDFERTLKGHTDAVQDLAFDHTGKFLASSSADMTIKLWDFQGFE-CIRTLHGHDHNVSSISFLPSGDHLVSASRDKTIKMWEIATGYCVKTFQGHGEWVRRVRPNADGSLIASCSNDQTIRVW 259          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO33297 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSL6])

HSP 1 Score: 117.472 bits (293), Expect = 9.679e-29
Identity = 72/251 (28.69%), Postives = 122/251 (48.61%), Query Frame = 2
Query: 1163 QVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFN-VTSLVGHEDSVQSAMFDHD---GEFLISASADCTVRVW 1903
            Q+  T  GH   VS   F ++GE LA++S D  +KIW     +   T  GH   I  V W T +  L +AS DKT+K+WD  + KC   L+GHS+ V    F   SN++++ S D++V +WD +   C +++  H   V + + N  G  I S    G  + WD          ID    P + V++  +G  +  ++ D+ +K+ + +    + +  GH++       +     G++++S S D  V +W
Sbjct:   56 QLKYTLTGHNKAVSSVKFSHNGEWLASSSADKVIKIWGAYDGKFEKTITGHKLGISDVAWSTDSRHLVSASDDKTLKIWDFATGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVTAVHFNRDGALIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCVFANFSVTGGKWIVSGSEDHKVYIW 306          

HSP 2 Score: 55.0694 bits (131), Expect = 3.705e-8
Identity = 46/185 (24.86%), Postives = 87/185 (47.03%), Query Frame = 2
Query: 1037 KLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTF-EGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSV--QFLVNSN-ILLTSSADKTVCLWDARISTCGQSISGHQYAV 1579
            K   T+K H   V C   +    +  + S D+S ++W + + + L T   H++ V+   F+ DG  + ++S D   +IW+ ++ +CL T  +  +  +  V +  +  ++  A+ D T+K+WD +  KC     GH +    V   F V     +++ S D  V +W+ +     Q + GH   V
Sbjct:  140 KCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVTAVHFNRDGALIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCVFANFSVTGGKWIVSGSEDHKVYIWNLQSKEVVQKLDGHSDVV 324          

HSP 3 Score: 54.299 bits (129), Expect = 8.146e-8
Identity = 48/169 (28.40%), Postives = 80/169 (47.34%), Query Frame = 2
Query: 1037 KLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNW-VSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWH---TSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSA--DKTVCLW 1525
            K   T+ AH   VT +  +++  +  ++S D   ++W   S Q L T     N  VS   F  +G+ +   + D TLK+W+ S  +CL T+ GH    + V  +   T   ++ + S D  + +W+L S +    L GHSD V         NI+ + +   DKT+ +W
Sbjct:  182 KCLKTLPAHSDPVTAVHFNRDGALIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCVFANFSVTGGKWIVSGSEDHKVYIWNLQSKEVVQKLDGHSDVVLCCACHPTENIIASGALENDKTIKIW 350          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO45346 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTA6])

HSP 1 Score: 108.227 bits (269), Expect = 3.005e-25
Identity = 81/289 (28.03%), Postives = 130/289 (44.98%), Query Frame = 2
Query: 1040 LTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNV-TSLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            L    K H   VT +  + N K   T S D S  +W            GH + +    F   G  +A+ S D T+++W  S       F+ H+ ++ SVD+      L TAS DK++KVW ++  K    L  H + V   +F  +  ++++ S DKT+ LWD     C  +       VNS   +  GT IA+      +K WD R +   +          N V +  SG+ +  +SSD+ +K+++     +  +L GH+    S +F  +GE+  S S+D  V VW
Sbjct:   10 LERHFKGHRDTVTSVDFNPNMKQLVTGSMDSSLMIWHFKPHMRAYRFVGHKDAILSVKFSPSGHLIASASRDKTVRLWVPSVKGESTVFKAHTATVRSVDFSGDGQSLLTASDDKSLKVWTVHRQKFLYSLNAHMNWVRCAKFSPDGRLIVSGSDDKTIKLWDRTSKDCVHTFYDPGGFVNSVEFHPSGTCIAAGGTDSTVKVWDIR-MNKLLQHYQAHTGAVNSVSFHPSGNYLVSASSDTTLKILDLMEGRLFYTLHGHQGPATSVVFSRNGEYFASGSSDEQVMVW 297          

HSP 2 Score: 53.5286 bits (127), Expect = 1.413e-7
Identity = 31/95 (32.63%), Postives = 46/95 (48.42%), Query Frame = 2
Query: 1163 QVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKC--RTILRGH 1441
            ++L   + HT  V+  +F   G  L + S DTTLKI +L      YT  GH     SV +  +  + A+ S D+ + VW  N  K   + +LR H
Sbjct:  219 KLLQHYQAHTGAVNSVSFHPSGNYLVSASSDTTLKILDLMEGRLFYTLHGHQGPATSVVFSRNGEYFASGSSDEQVMVWKTNFDKVDYQEVLRTH 313          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Medaka
Match: wdr5 (WD repeat domain 5 [Source:NCBI gene;Acc:101166483])

HSP 1 Score: 120.939 bits (302), Expect = 9.594e-30
Identity = 74/249 (29.72%), Postives = 126/249 (50.60%), Query Frame = 2
Query: 1172 MTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFN-VTSLVGHEDSVQSAMFDH----DGEFLISASADCTVRVW 1903
             T  GHT  VS   F   GE LA++S D  +KIW     +   T  GH   I  V W + +  L +AS DKT+K+WD+NS KC   L+GHS+ V    F   SN++++ S D++V +WD +   C +++  H   V++ + N  G+ I S    G  + WD          ID    P + V++  +G  +  ++ D+ +K+ + +    + +  GH++  +  +F +     G++++S S D  V +W
Sbjct:   39 FTLAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVNSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNE-KYCIFANFSVTGGKWIVSGSEDNMVYIW 286          

HSP 2 Score: 90.1225 bits (222), Expect = 3.522e-19
Identity = 78/301 (25.91%), Postives = 143/301 (47.51%), Query Frame = 2
Query: 1034 FKLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQS-ISGHQYAVNSANINEQGTNIASCDAFGFLKFWD-----CRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKM--VETASFNVTSLVGHEDSVQSAMFDHDGEFLISASA---DCTVRVW 1903
            + L  T+  H  AV+ ++   + +   ++S D   K+W     +   T  GH   +S  A+ +D   L + S D TLKIW++++ +CL T +GHS  ++  +++  +  + + S D+++++WD+ + KC   L  HSD V++V F  + +++++SS D    +WD     C ++ I      V+    +  G  I +      LK WD     C +  T              V   T G  +   S D+++ +  ++T    V  L GH D V S    H  E +I+++A   D T+++W
Sbjct:   35 YSLKFTLAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVNSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSV---TGGKWIVSGSEDNMVYIWNLQTKEI-VQKLQGHTDVVISTAC-HPTENIIASAALENDKTIKLW 330          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Medaka
Match: daw1 (dynein assembly factor with WD repeats 1 [Source:NCBI gene;Acc:101168478])

HSP 1 Score: 118.242 bits (295), Expect = 3.623e-28
Identity = 86/292 (29.45%), Postives = 144/292 (49.32%), Query Frame = 2
Query: 1034 FKLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDND-GEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNVTS-LVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            F L   +  H   +T +  +K+   F T S D   ++W   S Q L++ +GHTN V+  AF+   G+K+AT S D T K+W      CL+T  GH   I  + ++  +  +AT S D + K+WD+   K    L+GHS  + S+ F    + L+T S+D+T+ +WD         ++GH   +++A  N   + I S       K W+       + T+        DV +D++G  VA++S+D    +   A++   + L GHE  +    F   G  +++AS+D T R+W
Sbjct:   80 FFLQQEVHVHLLPLTNVAFNKSGSRFITGSYDRRCRVWDTTSGQQLLSLEGHTNIVAAVAFNIPYGDKIATGSFDRTCKLWCAQTGSCLHTLRGHLAEIRCLAFNPQSTLVATGSTDASAKLWDVKRGKEVATLKGHSAEILSLCFNSVGSQLVTGSSDQTLAVWDVATERLVHMLAGHAGEISNAQFNWDCSLIVSGSLDNTCKLWEAVS-GRCVATLAAHTEEVLDVCFDSTGQLVAIASADGTASVFNAATYECMARLEGHEGEISKICFSPQGNTILTASSDKTARLW 370          

HSP 2 Score: 96.2857 bits (238), Expect = 7.948e-21
Identity = 67/249 (26.91%), Postives = 125/249 (50.20%), Query Frame = 2
Query: 1169 LMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPA--NDVRYDTSGSCVAMSSSDSVIKM--VETASFNVTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            L T +GH   + C AF+     +AT S D + K+W++   + + T +GHS  I S+ +++    L T S D+T+ VWD+ + +   +L GH+  +++ QF  + +++++ S D T  LW+A    C  +++ H   V     +  G  +A   A G    ++    AT      L  H    + + +   G+ +  +SSD   ++  V+T    +  L GH   + S  F+++G+ +I+ SAD T ++W
Sbjct:  168 LHTLRGHLAEIRCLAFNPQSTLVATGSTDASAKLWDVKRGKEVATLKGHSAEILSLCFNSVGSQLVTGSSDQTLAVWDVATERLVHMLAGHAGEISNAQFNWDCSLIVSGSLDNTCKLWEAVSGRCVATLAAHTEEVLDVCFDSTGQLVAIASADGTASVFNA---ATYECMARLEGHEGEISKICFSPQGNTILTASSDKTARLWDVQTGGC-LQILTGHTLEIFSCAFNYEGDTIITGSADNTCQIW 412          

HSP 3 Score: 89.7373 bits (221), Expect = 9.298e-19
Identity = 47/159 (29.56%), Postives = 79/159 (49.69%), Query Frame = 2
Query: 1184 GHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCR 1660
            GH   +S A F+ D   + + S D T K+W   +  C+ T   H++ +  V + ++   +A AS D T  V++  + +C   L GH   ++ + F    N +LT+S+DKT  LWD +   C Q ++GH   + S   N +G  I +  A    + W C+
Sbjct:  257 GHAGEISNAQFNWDCSLIVSGSLDNTCKLWEAVSGRCVATLAAHTEEVLDVCFDSTGQLVAIASADGTASVFNAATYECMARLEGHEGEISKICFSPQGNTILTASSDKTARLWDVQTGGCLQILTGHTLEIFSCAFNYEGDTIITGSADNTCQIWRCK 415          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Medaka
Match: PAFAH1B1 (platelet activating factor acetylhydrolase 1b regulatory subunit 1 [Source:NCBI gene;Acc:101169717])

HSP 1 Score: 117.472 bits (293), Expect = 6.196e-28
Identity = 70/260 (26.92%), Postives = 127/260 (48.85%), Query Frame = 2
Query: 1184 GHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFW---------DCRQLATSINTIDLGFHPANDVRYDTSGSCVAMS----------SSDSVIKMVETAS-FNVTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            GH + V+   F      + + S D T+K+W+    +   T +GH+ S+  + +  +   LA+ S D TIK+WD    +C   + GH  +V+SV  + N + ++++S DKT+ +W+     C ++ +GH+  V     N+ GT IASC     ++ W         + R+    +  I      A+    + +GS    S          S D  IKM + ++   + +LVGH++ V+  +F   G+F++S + D T+R+W
Sbjct:  106 GHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDQTGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVATGYCVKTFAGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVASKECKAELREHEHVVECISWAPESASPTILEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGILFHPGGKFIVSCADDKTLRIW 365          

HSP 2 Score: 93.9745 bits (232), Expect = 4.246e-20
Identity = 56/230 (24.35%), Postives = 105/230 (45.65%), Query Frame = 2
Query: 1031 GFKLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSA--------------------PFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCR 1660
            GF+   T+  H+  V+ +    N     + S D + K+W + +   + T  GH  WV     + DG  +A+ S D T+++W +++ EC      H   +  + W   +                    PFL + S DKTIK+WD+++  C   L GH + V  + F      +++ + DKT+ +WD +   C +++  H++ V S + ++    + +      +K W+CR
Sbjct:  181 GFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVATGYCVKTFAGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVASKECKAELREHEHVVECISWAPESASPTILEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGILFHPGGKFIVSCADDKTLRIWDYKNKRCMKTLCAHEHFVTSLDFHKAAPFVVTGSVDQTVKVWECR 410          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Medaka
Match: PAFAH1B1 (platelet activating factor acetylhydrolase 1b regulatory subunit 1 [Source:NCBI gene;Acc:101169717])

HSP 1 Score: 117.472 bits (293), Expect = 6.196e-28
Identity = 70/260 (26.92%), Postives = 127/260 (48.85%), Query Frame = 2
Query: 1184 GHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFW---------DCRQLATSINTIDLGFHPANDVRYDTSGSCVAMS----------SSDSVIKMVETAS-FNVTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            GH + V+   F      + + S D T+K+W+    +   T +GH+ S+  + +  +   LA+ S D TIK+WD    +C   + GH  +V+SV  + N + ++++S DKT+ +W+     C ++ +GH+  V     N+ GT IASC     ++ W         + R+    +  I      A+    + +GS    S          S D  IKM + ++   + +LVGH++ V+  +F   G+F++S + D T+R+W
Sbjct:  106 GHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDQTGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVATGYCVKTFAGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVASKECKAELREHEHVVECISWAPESASPTILEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGILFHPGGKFIVSCADDKTLRIW 365          

HSP 2 Score: 93.9745 bits (232), Expect = 4.246e-20
Identity = 56/230 (24.35%), Postives = 105/230 (45.65%), Query Frame = 2
Query: 1031 GFKLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSA--------------------PFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCR 1660
            GF+   T+  H+  V+ +    N     + S D + K+W + +   + T  GH  WV     + DG  +A+ S D T+++W +++ EC      H   +  + W   +                    PFL + S DKTIK+WD+++  C   L GH + V  + F      +++ + DKT+ +WD +   C +++  H++ V S + ++    + +      +K W+CR
Sbjct:  181 GFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVATGYCVKTFAGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVASKECKAELREHEHVVECISWAPESASPTILEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGILFHPGGKFIVSCADDKTLRIWDYKNKRCMKTLCAHEHFVTSLDFHKAAPFVVTGSVDQTVKVWECR 410          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Medaka
Match: wdr5 (WD repeat domain 5 [Source:NCBI gene;Acc:101166483])

HSP 1 Score: 115.546 bits (288), Expect = 7.750e-28
Identity = 74/251 (29.48%), Postives = 122/251 (48.61%), Query Frame = 2
Query: 1172 MTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDS---VIKMVETASFNVTSLVGHEDSVQSAMFDH----DGEFLISASADCTVRVW 1903
             T  GHT  VS   F   GE LA++S D  +KIW     +   T  GH   I  V W + +  L +AS DKT+K+WD+NS KC   L+GHS+ V    F   SN++++ S D++V +WD +   C +++  H   V++ + N  G+ I S    G  + WD          ID    P + V++  +G  +  ++ D+           S  + +  GH++  +  +F +     G++++S S D  V +W
Sbjct:   38 FTLAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVNSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNSSLTFVFFYVNSQCLKTYTGHKNE-KYCIFANFSVTGGKWIVSGSEDNMVYIW 287          

HSP 2 Score: 65.0846 bits (157), Expect = 6.293e-11
Identity = 46/181 (25.41%), Postives = 96/181 (53.04%), Query Frame = 2
Query: 1037 KLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKC-RTILRGHSDSVNSVQFLVNSNILLTSSADKT--VCLWDARISTCGQSISGHQ 1570
            K   TI  H+  ++ +    +  +  + SDD + K+W ++S + L T KGH+N+V C  F+     + + S D +++IW++   +CL T   HS  + +V ++     + ++S+D   ++WD  S +C +T++   +  V+ V+F  N   +L ++ D +    ++    S C ++ +GH+
Sbjct:   77 KFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVNSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNSSLTFVFFYVNSQCLKTYTGHK 257          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000071691.1 (SMESG000071691.1)

HSP 1 Score: 1201.04 bits (3106), Expect = 0.000e+0
Identity = 591/591 (100.00%), Postives = 591/591 (100.00%), Query Frame = 2
Query:  134 MLEDGTFDSFEHTSKILDELQEDERALEEAIFNNRPKLTTVPPSMDDYIRSFLLRLGLTRTLDCFQLEWFEKKHKGLLHEEDISEVPDIYVRNQQLDIQVKLMREDRNKYKQAALKAKEMHVKLRGERDYHKLQHRRMVQEKNKLIDEIKRLRDHYASYQPALEQLQQKYQTAMKEKMLSKLERDRICGQMQGLQMTLQSLENSTLPITTDDDGKRLFFRDRSQVSNIHPCRKGGVLTVDKLNRGATQKKLADAREFKSKNDALNGEKENNDTPFPVDKGINEDLLKLRPPPGHLTRVGGFKLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNVTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVWS 1906
            MLEDGTFDSFEHTSKILDELQEDERALEEAIFNNRPKLTTVPPSMDDYIRSFLLRLGLTRTLDCFQLEWFEKKHKGLLHEEDISEVPDIYVRNQQLDIQVKLMREDRNKYKQAALKAKEMHVKLRGERDYHKLQHRRMVQEKNKLIDEIKRLRDHYASYQPALEQLQQKYQTAMKEKMLSKLERDRICGQMQGLQMTLQSLENSTLPITTDDDGKRLFFRDRSQVSNIHPCRKGGVLTVDKLNRGATQKKLADAREFKSKNDALNGEKENNDTPFPVDKGINEDLLKLRPPPGHLTRVGGFKLTNTIKAHEGAVTCIRTHKNKKVFCTTSDDDSWKLWSLDSLQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNVTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVWS
Sbjct:    1 MLEDGTFDSFEHTSKILDELQEDERALEEAIFNNRPKLTTVPPSMDDYIRSFLLRLGLTRTLDCFQLEWFEKKHKGLLHEEDISEVPDIYVRNQQLDIQVKLMREDRNKYKQAALKAKEMHVKLRGERDYHKLQHRRMVQEKNKLIDEIKRLRDHYASYQPALEQLQQKYQTAMKEKMLSKLERDRICGQMQGLQMTLQSLENSTLPITTDDDGKRLFFRDRSQVSNIHPCRKGGVLTVDKLNRGATQKKLADAREFKSKNDALNGEKENNDTPFPVDKGINEDLLKLRPPPGHLTRVGGFKLTNTIKAHEGAVTCIRTHKNKKVFCTTSDDDSWKLWSLDSLQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNVTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVWS 591          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000008519.1 (SMESG000008519.1)

HSP 1 Score: 121.709 bits (304), Expect = 2.144e-30
Identity = 80/251 (31.87%), Postives = 126/251 (50.20%), Query Frame = 2
Query: 1169 LMTGKGHTNWVSCAAFDND-GEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQF--LVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNVTSLV--GHEDSVQSAMFDHDGEFLISASADCTVRVWS 1906
            L T +GH N V   A++    +K+ T S D T K+W+ +     +TF+GH+  +  V ++ S+  + T   D    +WD+ S KC + L+GH+  V S+QF    N   L+T S D TV LWD         + GH   +++A  N  GT +A+      +K WD R  A  + T+        DV +D  G  VA + +D+ +++ +   F+  S +  GHE  V    F+  G  L+SASAD + R W+
Sbjct:    5 LFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWN 255          

HSP 2 Score: 81.2629 bits (199), Expect = 1.230e-16
Identity = 48/146 (32.88%), Postives = 74/146 (50.68%), Query Frame = 2
Query: 1184 GHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLS-AAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSL-KCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNI 1615
            GH   +S A F+ DG  +AT S D ++KIW+L   A  L+T  GH+  +  V +      +A+A  D T+++WD+    K   I +GH   V+ V F     +LL++SADK+   W+       Q + GH   + S   N  G+ I
Sbjct:  139 GHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKI 284          

HSP 3 Score: 67.781 bits (164), Expect = 4.648e-12
Identity = 36/120 (30.00%), Postives = 66/120 (55.00%), Query Frame = 2
Query: 1169 LMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLS-AAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLW 1525
            L T  GHT+ V    FDN G+++A+   D T+++W++   ++  + F+GH   +  V ++     L +AS DK+ + W+  + K   +L GH+D + S  F  + + ++T S D T  +W
Sbjct:  177 LFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKVIQVLEGHTDEIFSCAFNYDGSKIITGSKDNTCRIW 296          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000008529.1 (SMESG000008529.1)

HSP 1 Score: 111.694 bits (278), Expect = 1.830e-26
Identity = 82/271 (30.26%), Postives = 132/271 (48.71%), Query Frame = 2
Query: 1034 FKLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDND-GEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQF--LVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNVTSLV--GHEDSV 1831
            + L   ++AH   +T +  +KN   F T S D + K+W       L T +GH N V   A++    +K+ T S D T K+W+ +     +TF+GH+  +  V ++ S+  + T   D    +WD+ S KC + L+GH+  V S+QF    N   L+T S D TV LWD         + GH   +++A  N  GT +A+      +K WD R  A  + T+        DV +D  G  VA + +D+ +++ +   F+  S +  GHE  V
Sbjct:   82 YGLFKVLRAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAYNLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKPSFIFKGHEAEV 352          

HSP 2 Score: 102.834 bits (255), Expect = 1.719e-23
Identity = 73/253 (28.85%), Postives = 120/253 (47.43%), Query Frame = 2
Query: 1181 KGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPF---LATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINE--QGTNIASCDAFGFLKFWDC---RQLATSINTIDLGFHPA--NDVRYDTSGSCVAMSSSDSVIKM--VETASFNVTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            + H   ++   F+ +G++  T S D T K+W+ S    L+T EGH   ++S+ +  + PF   + T S DKT K+W  N        +GH+  V  VQF  +S ++ T   D    LWD     C  ++ GH   V S    +   G ++ +      +  WD    R+++  I       H A  +   ++  G+ VA +S D  IK+  +   + ++ +L GH D V    FD+ G+ + SA AD TVR+W
Sbjct:   89 RAHILPLTNVTFNKNGDRFLTGSYDRTCKVWDTSMGTTLFTLEGHKNVVYSIAY--NLPFSDKIVTGSFDKTAKMWSANDGSLYHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIG------HDAEISAAVFNFDGTYVATASMDKSIKIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLW 333          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000024482.1 (SMESG000024482.1)

HSP 1 Score: 105.916 bits (263), Expect = 6.550e-24
Identity = 85/295 (28.81%), Postives = 126/295 (42.71%), Query Frame = 2
Query: 1037 KLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCR-----QLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNVTSLV-GHEDSVQSAMFDHDGEFLISASADCTVRVW 1903
            KL    K H+  VTC+  + N     +   D    +W+           GH + +    F   G+ +A+ S D T+++W  S       F  H+ ++ SVD       + T S DKTIKVW ++  K    L  H + V  V+F  +  ++ +SS DKT+ LWD     C  +   H   V S   +  G+ IAS      +  WD R     Q  TS  +      P N V +  SG+ +  SS DS +K+ +     +   V GHE  +    F H GE   S  AD  V +W
Sbjct:    5 KLQVHFKGHKDKVTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDISCDNLEMVTGSDDKTIKVWKMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTS------PVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLW 293          

HSP 2 Score: 94.3597 bits (233), Expect = 4.105e-20
Identity = 46/161 (28.57%), Postives = 83/161 (51.55%), Query Frame = 2
Query: 1187 HTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLA 1669
            H NWV C  F +DG+ +A++S D T+K+W+    EC++TF+ H   + S+ +H +  ++A+   D  + +WD+   K       H+  VN+V F  + N L++SS D ++ ++D        ++ GH+  +     +  G   AS  A   +  W   QL+
Sbjct:  139 HKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQAGQLS 299          

HSP 3 Score: 67.781 bits (164), Expect = 1.231e-11
Identity = 42/165 (25.45%), Postives = 83/165 (50.30%), Query Frame = 2
Query: 1037 KLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDA 1531
            K + ++  H+  V C+R   + ++  ++SDD + KLW   + + + T + H  +V   AF  +G  +A+   D+ + IW++   + L  +  H+  + +V +H S  FL ++S D ++K++DL   +    ++GH   +    F     +  +  AD  V LW A
Sbjct:  131 KFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDIRMNKLLQHYTSHTSPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLWQA 295          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000054739.1 (SMESG000054739.1)

HSP 1 Score: 95.5153 bits (236), Expect = 5.422e-21
Identity = 75/253 (29.64%), Postives = 118/253 (46.64%), Query Frame = 2
Query:  848 VDKLNRGATQKKLADAREFKSKNDALNGE-----KENNDT----PFPVDKGINEDLLKLRPPPGHLTRVGGFKLTNTIKAHEGAVTCIRTHKNKKVFCTTXXXXXXXXXXXXXXQVLMTGKGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAV 1579
            +DK   G  +KK       + K + L  +     KE +D      F   K  + D L  R P  H+           +K H  ++TC+R H    VF + S+D + K+W  +S     T +GHTN V   AFD  G+ LA+ S D  +K+W+     C+ T  GH  ++  V +  S   L +AS DKTIK+W++++  C     GHSD V  V+   + +++ + S D +V +W      C      H++ V
Sbjct:    6 IDKKFSGLLEKKWTSVIRLQKKVNDLESQLQETKKETHDVISNATFKGRKSSSVDWLP-RIPARHV-----------LKGHRASITCVRFHPLYNVFVSGSEDATIKIWDYESGDYERTLRGHTNHVQDLAFDPSGKLLASCSADMQIKLWDFVEFTCVKTLSGHDHNVSGVSFMPSGDHLLSASRDKTIKLWEVSTGYCVQTFEGHSDWVRVVKPNFDGSLIASCSNDNSVRVWSMANKECKFDFREHEHVV 246          

HSP 2 Score: 91.2781 bits (225), Expect = 1.240e-19
Identity = 50/157 (31.85%), Postives = 76/157 (48.41%), Query Frame = 2
Query: 1181 KGHTNWVSCAAFDNDGEKLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFW 1651
            KGH   ++C  F        + S D T+KIW+  + +   T  GH+  +  + +  S   LA+ S D  IK+WD     C   L GH  +V+ V F+ + + LL++S DKT+ LW+     C Q+  GH   V     N  G+ IASC     ++ W
Sbjct:   72 KGHRASITCVRFHPLYNVFVSGSEDATIKIWDYESGDYERTLRGHTNHVQDLAFDPSGKLLASCSADMQIKLWDFVEFTCVKTLSGHDHNVSGVSFMPSGDHLLSASRDKTIKLWEVSTGYCVQTFEGHSDWVRVVKPNFDGSLIASCSNDNSVRVW 228          

HSP 3 Score: 79.337 bits (194), Expect = 1.125e-15
Identity = 59/203 (29.06%), Postives = 91/203 (44.83%), Query Frame = 2
Query: 1301 TFEGHSQSIWSVDWHTSAPFLATASHDKTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDARISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSINTIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETAS-FNVTSLVGHEDSVQSAMFDHDGEFLISASADCTVRVWS 1906
            TF+G   S  SVDW    P                     R +L+GH  S+  V+F    N+ ++ S D T+ +WD       +++ GH   V     +  G  +ASC A   +K WD  +  T + T+    H  + V +  SG  +  +S D  IK+ E ++ + V +  GH D V+    + DG  + S S D +VRVWS
Sbjct:   50 TFKGRKSS--SVDWLPRIP--------------------ARHVLKGHRASITCVRFHPLYNVFVSGSEDATIKIWDYESGDYERTLRGHTNHVQDLAFDPSGKLLASCSADMQIKLWDFVEF-TCVKTLSGHDHNVSGVSFMPSGDHLLSASRDKTIKLWEVSTGYCVQTFEGHSDWVRVVKPNFDGSLIASCSNDNSVRVWS 229          
The following BLAST results are available for this feature:
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SPAG162.376e-15239.26sperm associated antigen 16 [Source:HGNC Symbol;Ac... [more]
SPAG162.762e-4939.57sperm associated antigen 16 [Source:HGNC Symbol;Ac... [more]
SPAG161.106e-4839.57sperm associated antigen 16 [Source:HGNC Symbol;Ac... [more]
SPAG161.035e-4646.71sperm associated antigen 16 [Source:HGNC Symbol;Ac... [more]
SPAG161.949e-4638.98sperm associated antigen 16 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr-5.11.577e-2827.78WD repeat-containing protein wdr-5.1 [Source:UniP... [more]
wdr-5.11.577e-2827.78WD repeat-containing protein wdr-5.1 [Source:UniP... [more]
wdr-5.34.710e-2326.69WD repeat-containing protein wdr-5.3 [Source:UniP... [more]
wdr-5.23.720e-2227.35WD repeat-containing protein wdr-5.2 [Source:UniP... [more]
prp-44.373e-2027.38Yeast PRP (Splicing factor) related [Source:UniPr... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wds9.098e-2828.92gene:FBgn0040066 transcript:FBtr0308566[more]
wds9.098e-2828.92gene:FBgn0040066 transcript:FBtr0070438[more]
CG109317.662e-2527.46gene:FBgn0034274 transcript:FBtr0089545[more]
CG75683.356e-2229.13gene:FBgn0039673 transcript:FBtr0330294[more]
Lis-13.965e-2227.57gene:FBgn0015754 transcript:FBtr0087241[more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr56.753e-2929.32WD repeat domain 5 [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
daw19.235e-2931.53dynein assembly factor with WDR repeat domains 1 [... [more]
daw11.585e-2831.53dynein assembly factor with WDR repeat domains 1 [... [more]
pafah1b1b8.156e-2826.54platelet-activating factor acetylhydrolase 1b, reg... [more]
pafah1b1b8.156e-2826.54platelet-activating factor acetylhydrolase 1b, reg... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SPAG162.714e-8544.16sperm associated antigen 16 [Source:NCBI gene;Acc:... [more]
daw11.810e-2930.48dynein assembly factor with WDR repeat domains 1 [... [more]
daw12.409e-2930.48dynein assembly factor with WDR repeat domains 1 [... [more]
daw12.628e-2930.48dynein assembly factor with WDR repeat domains 1 [... [more]
daw13.610e-2930.48dynein assembly factor with WDR repeat domains 1 [... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Spag162.177e-14538.79sperm associated antigen 16 [Source:MGI Symbol;Acc... [more]
Spag163.439e-4732.30sperm associated antigen 16 [Source:MGI Symbol;Acc... [more]
Wdr5b1.459e-2930.24WD repeat domain 5B [Source:MGI Symbol;Acc:MGI:191... [more]
Wdr53.878e-2929.32WD repeat domain 5 [Source:MGI Symbol;Acc:MGI:2155... [more]
Pafah1b11.794e-2727.31platelet-activating factor acetylhydrolase, isofor... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8N0X2|SPG16_HUMAN1.141e-15139.26Sperm-associated antigen 16 protein OS=Homo sapien... [more]
sp|Q8K450|SPG16_MOUSE1.523e-14438.79Sperm-associated antigen 16 protein OS=Mus musculu... [more]
sp|P93107|PF20_CHLRE1.446e-6140.75Flagellar WD repeat-containing protein Pf20 OS=Chl... [more]
sp|Q8YRI1|YY46_NOSS11.255e-4035.63Uncharacterized WD repeat-containing protein alr34... [more]
sp|Q00808|HETE1_PODAS5.137e-3735.07Vegetative incompatibility protein HET-E-1 OS=Podo... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4BYT60.000e+048.80WD_REPEATS_REGION domain-containing protein OS=Lot... [more]
A0A1S3JB060.000e+049.20sperm-associated antigen 16 protein OS=Lingula ung... [more]
A0A210PSZ80.000e+047.03Sperm-associated antigen 16 protein OS=Mizuhopecte... [more]
W4XIN80.000e+045.76WD_REPEATS_REGION domain-containing protein OS=Str... [more]
C3YKY80.000e+046.49WD_REPEATS_REGION domain-containing protein (Fragm... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000025776.24.512e-16341.31sperm associated antigen 16 [Source:NCBI gene;Acc:... [more]
daw11.450e-3332.58dynein assembly factor with WD repeats 1 [Source:N... [more]
POC1B4.134e-3032.92POC1 centriolar protein homolog B [Source:NCBI gen... [more]
POC1B5.216e-3032.92POC1 centriolar protein homolog B [Source:NCBI gen... [more]
POC1B6.790e-3032.92POC1 centriolar protein homolog B [Source:NCBI gen... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004902.19.426e-15738.52pep scaffold:Pmarinus_7.0:GL478254:5937:33805:1 ge... [more]
ENSPMAT00000010366.11.844e-5340.17pep scaffold:Pmarinus_7.0:GL484367:3335:13277:1 ge... [more]
pafah1b1b6.545e-3027.69platelet-activating factor acetylhydrolase 1b, reg... [more]
POC1A2.544e-2327.39POC1 centriolar protein A [Source:HGNC Symbol;Acc:... [more]
ENSPMAT00000008862.11.009e-1929.10pep scaffold:Pmarinus_7.0:GL476579:86637:114999:1 ... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
RSA49.630e-2328.35WD-repeat protein involved in ribosome biogenesis;... [more]
TAF52.475e-2026.86Subunit (90 kDa) of TFIID and SAGA complexes; invo... [more]
MET309.307e-2038.85F-box protein containing five copies of the WD40 m... [more]
UTP131.341e-1933.80Nucleolar protein; component of the small subunit ... [more]
PRP461.160e-1829.56Member of the NineTeen Complex (NTC); this complex... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO338370.000e+045.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348651.957e-3031.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418967.009e-2927.97Lissencephaly-1 homolog [Source:UniProtKB/Swiss-P... [more]
EDO332979.679e-2928.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453463.005e-2528.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr59.594e-3029.72WD repeat domain 5 [Source:NCBI gene;Acc:101166483... [more]
daw13.623e-2829.45dynein assembly factor with WD repeats 1 [Source:N... [more]
PAFAH1B16.196e-2826.92platelet activating factor acetylhydrolase 1b regu... [more]
PAFAH1B16.196e-2826.92platelet activating factor acetylhydrolase 1b regu... [more]
wdr57.750e-2829.48WD repeat domain 5 [Source:NCBI gene;Acc:101166483... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000071691.10.000e+0100.00SMESG000071691.1[more]
SMESG000008519.12.144e-3031.87SMESG000008519.1[more]
SMESG000008529.11.830e-2630.26SMESG000008529.1[more]
SMESG000024482.16.550e-2428.81SMESG000024482.1[more]
SMESG000054739.15.422e-2129.64SMESG000054739.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005158 ID=SMED30005158|Name=WD_REPEATS_REGION domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1919bp
CTGTGTGATAACTTCTTTTTTTTAATTTTAAATGGATTTGGATGAAAATA
AATATTTTTTAGAAAAAATTGAAATACCTGTTTATGAAGAATCTGAATTC
GATTATGATTTTGTGAAATCTGATGAAATTTTGATGCTTGAGGATGGAAC
TTTTGATTCGTTTGAACACACATCGAAAATTTTGGATGAGCTTCAAGAAG
ATGAAAGAGCTCTTGAAGAAGCGATTTTCAATAATAGACCAAAATTAACA
ACAGTTCCTCCATCGATGGACGATTACATTAGATCGTTTCTACTTCGATT
AGGGTTGACTCGAACTCTTGATTGTTTCCAATTAGAATGGTTCGAAAAGA
AACATAAGGGTTTGCTTCATGAGGAAGATATCAGTGAAGTTCCGGATATT
TATGTTAGAAATCAACAGTTAGATATACAAGTAAAATTGATGCGAGAAGA
TAGGAATAAATATAAGCAAGCGGCATTAAAAGCTAAGGAAATGCATGTAA
AACTTAGAGGTGAACGAGATTATCATAAACTTCAGCATCGGAGAATGGTT
CAGGAAAAAAACAAACTAATTGATGAAATAAAACGACTTCGAGATCATTA
TGCGTCGTATCAGCCGGCTTTAGAACAATTACAACAGAAATATCAGACAG
CCATGAAAGAGAAAATGCTTAGCAAACTTGAAAGAGATCGAATTTGCGGT
CAGATGCAAGGGCTTCAAATGACACTTCAGAGTCTAGAAAATTCCACTCT
TCCTATCACCACAGATGACGATGGAAAACGATTATTTTTTCGAGATAGAA
GCCAGGTTTCAAATATTCATCCTTGTCGCAAAGGTGGCGTTCTTACAGTT
GATAAATTAAATCGAGGGGCCACTCAAAAAAAATTGGCTGATGCTAGAGA
ATTTAAATCAAAAAATGACGCTTTAAATGGTGAAAAAGAAAATAATGATA
CTCCATTCCCAGTTGATAAAGGAATAAATGAAGATCTGCTAAAACTTCGA
CCTCCTCCCGGACATTTAACTCGAGTTGGAGGTTTCAAATTGACAAATAC
AATAAAAGCGCATGAAGGTGCTGTAACCTGTATCAGAACACATAAAAACA
AAAAGGTTTTCTGTACGACAAGTGATGATGATTCATGGAAACTTTGGTCT
CTCGATTCCTTGCAGGTCCTTATGACCGGTAAAGGACACACAAATTGGGT
TTCATGTGCAGCATTTGATAATGATGGTGAGAAATTGGCTACAACAAGTG
GTGATACCACTTTGAAGATTTGGAACTTATCTGCCGCAGAATGCCTCTAC
ACCTTCGAAGGACATTCCCAATCGATTTGGTCTGTTGATTGGCATACCTC
AGCTCCGTTTTTAGCTACAGCAAGTCATGATAAAACAATAAAAGTTTGGG
ATTTGAACTCTTTGAAATGCCGCACCATTCTAAGAGGACACTCGGATTCT
GTAAATAGCGTCCAATTTCTCGTGAATAGTAACATCCTTCTGACATCATC
GGCCGATAAAACCGTTTGCCTTTGGGATGCTAGAATCAGCACATGTGGGC
AATCGATTTCTGGCCATCAATACGCCGTTAATTCCGCAAATATCAATGAA
CAGGGTACAAATATCGCTTCCTGTGATGCGTTTGGATTTCTGAAATTCTG
GGACTGCCGGCAATTGGCAACATCGATTAACACAATTGATCTGGGATTTC
ACCCTGCCAACGATGTCCGGTATGACACGAGTGGATCCTGTGTGGCAATG
TCGAGTAGTGACTCGGTGATCAAAATGGTTGAAACGGCCAGTTTCAATGT
GACGTCACTTGTTGGCCACGAAGATTCCGTTCAATCTGCGATGTTTGATC
ATGATGGGGAATTTCTGATTTCTGCCTCCGCAGATTGCACTGTCCGAGTT
TGGTCGTAAATTTGTTACG
back to top

protein sequence of SMED30005158-orf-1

>SMED30005158-orf-1 ID=SMED30005158-orf-1|Name=SMED30005158-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=626bp
MDLDENKYFLEKIEIPVYEESEFDYDFVKSDEILMLEDGTFDSFEHTSKI
LDELQEDERALEEAIFNNRPKLTTVPPSMDDYIRSFLLRLGLTRTLDCFQ
LEWFEKKHKGLLHEEDISEVPDIYVRNQQLDIQVKLMREDRNKYKQAALK
AKEMHVKLRGERDYHKLQHRRMVQEKNKLIDEIKRLRDHYASYQPALEQL
QQKYQTAMKEKMLSKLERDRICGQMQGLQMTLQSLENSTLPITTDDDGKR
LFFRDRSQVSNIHPCRKGGVLTVDKLNRGATQKKLADAREFKSKNDALNG
EKENNDTPFPVDKGINEDLLKLRPPPGHLTRVGGFKLTNTIKAHEGAVTC
IRTHKNKKVFCTTSDDDSWKLWSLDSLQVLMTGKGHTNWVSCAAFDNDGE
KLATTSGDTTLKIWNLSAAECLYTFEGHSQSIWSVDWHTSAPFLATASHD
KTIKVWDLNSLKCRTILRGHSDSVNSVQFLVNSNILLTSSADKTVCLWDA
RISTCGQSISGHQYAVNSANINEQGTNIASCDAFGFLKFWDCRQLATSIN
TIDLGFHPANDVRYDTSGSCVAMSSSDSVIKMVETASFNVTSLVGHEDSV
QSAMFDHDGEFLISASADCTVRVWS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005929cilium
GO:0005930axoneme
GO:0031514motile cilium
GO:0042995cell projection
GO:1990716axonemal central apparatus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR020472G-protein_beta_WD-40_rep
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0007288sperm axoneme assembly
GO:0030030cell projection organization
GO:0035082axoneme assembly
GO:0051012microtubule sliding
GO:0060271cilium morphogenesis
GO:0060294cilium movement involved in cell motility
GO:0097231cell motility in response to calcium ion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 44..64
NoneNo IPR availableCOILSCoilCoilcoord: 127..147
NoneNo IPR availableCOILSCoilCoilcoord: 197..217
NoneNo IPR availableCOILSCoilCoilcoord: 169..189
NoneNo IPR availablePANTHERPTHR14604WD40 REPEAT PF20coord: 4..625
NoneNo IPR availablePANTHERPTHR14604:SF3SPERM-ASSOCIATED ANTIGEN 16 PROTEINcoord: 4..625
NoneNo IPR availableCDDcd00200WD40coord: 337..625
e-value: 2.02215E-79
score: 251.1
IPR020472G-protein beta WD-40 repeatPRINTSPR00320GPROTEINBRPTcoord: 486..500
score: 41.05
coord: 612..625
score: 34.03
coord: 444..458
score: 42.34
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 376..415
e-value: 3.0E-9
score: 46.7
coord: 334..373
e-value: 1.2E-5
score: 34.7
coord: 502..541
e-value: 0.35
score: 19.9
coord: 586..625
e-value: 2.0E-7
score: 40.6
coord: 418..457
e-value: 6.5E-12
score: 55.6
coord: 460..499
e-value: 1.9E-9
score: 47.4
coord: 545..584
e-value: 47.0
score: 6.5
IPR001680WD40 repeatPFAMPF00400WD40coord: 590..625
e-value: 6.2E-6
score: 26.8
coord: 337..373
e-value: 0.0045
score: 17.8
coord: 462..499
e-value: 5.1E-7
score: 30.3
coord: 378..415
e-value: 2.4E-6
score: 28.2
coord: 420..457
e-value: 6.0E-10
score: 39.6
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 341..382
score: 11.244
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 593..625
score: 15.688
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 467..499
score: 14.218
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 383..424
score: 14.385
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 425..466
score: 15.822
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 507..625
e-value: 6.2E-23
score: 83.1
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 329..421
e-value: 3.3E-23
score: 83.8
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 422..506
e-value: 5.4E-25
score: 90.5
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 444..458
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 402..416
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 486..500
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 341..625
score: 54.839
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 334..624