SMED30005152

Overview
NameSMED30005152
Smed IDSMED30005152
Length (bp)892
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005152

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
prepharyngeal regionSMED30005152SMESG000042718.1 SmedASXL_014234SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
cephalic gangliaSMED30005152SMESG000042718.1 dd_Smed_v4_447_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30005152SMESG000042718.1 dd_Smed_v4_447_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30005152SMESG000042718.1 OX_Smed_1.0.01620ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
head regionSMED30005152SMESG000042718.1 OX_Smed_1.0.03267ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30005152 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.003692:16..976 +3561
Homology
BLAST of SMED30005152 vs. Planmine SMEST
Match: SMESG000042718.1 (SMESG000042718.1)

HSP 1 Score: 261.536 bits (667), Expect = 4.877e-79
Identity = 153/172 (88.95%), Postives = 153/172 (88.95%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 4378 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 4549          

HSP 2 Score: 254.603 bits (649), Expect = 1.261e-76
Identity = 148/172 (86.05%), Postives = 151/172 (87.79%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 1892 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 2063          

HSP 3 Score: 254.603 bits (649), Expect = 1.261e-76
Identity = 148/172 (86.05%), Postives = 151/172 (87.79%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 2449 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 2620          

HSP 4 Score: 254.603 bits (649), Expect = 1.261e-76
Identity = 148/172 (86.05%), Postives = 151/172 (87.79%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 2666 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 2837          

HSP 5 Score: 254.603 bits (649), Expect = 1.261e-76
Identity = 148/172 (86.05%), Postives = 151/172 (87.79%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 2883 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 3054          

HSP 6 Score: 254.603 bits (649), Expect = 1.261e-76
Identity = 148/172 (86.05%), Postives = 151/172 (87.79%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 3100 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 3271          

HSP 7 Score: 254.603 bits (649), Expect = 1.261e-76
Identity = 148/172 (86.05%), Postives = 151/172 (87.79%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 3648 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTKLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 3819          

HSP 8 Score: 253.447 bits (646), Expect = 3.676e-76
Identity = 148/172 (86.05%), Postives = 150/172 (87.21%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V + GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 3865 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLIGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 4036          

HSP 9 Score: 236.113 bits (601), Expect = 3.397e-70
Identity = 139/169 (82.25%), Postives = 144/169 (85.21%), Query Frame = 3
Query:  138 IKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            + D +T  NTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 1678 LLDKLTSPNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTKLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 1846          

HSP 10 Score: 236.113 bits (601), Expect = 3.397e-70
Identity = 139/169 (82.25%), Postives = 144/169 (85.21%), Query Frame = 3
Query:  138 IKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            + D +T  NTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 2235 LLDKLTSPNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 2403          

HSP 11 Score: 231.876 bits (590), Expect = 1.059e-68
Identity = 138/164 (84.15%), Postives = 141/164 (85.98%), Query Frame = 3
Query:  153 TDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            T S TISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 3439 TISKTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 3602          

HSP 12 Score: 190.274 bits (482), Expect = 3.552e-54
Identity = 116/136 (85.29%), Postives = 117/136 (86.03%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNV 479
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPN+
Sbjct: 4191 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPNL 4326          

HSP 13 Score: 189.889 bits (481), Expect = 4.024e-54
Identity = 118/142 (83.10%), Postives = 119/142 (83.80%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEI 497
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPN    S+I
Sbjct: 1552 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTKLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPNTISPSDI 1693          

HSP 14 Score: 182.956 bits (463), Expect = 1.020e-51
Identity = 113/142 (79.58%), Postives = 117/142 (82.39%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEI 497
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPN    S+I
Sbjct: 2109 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNTISPSDI 2250          

HSP 15 Score: 166.392 bits (420), Expect = 5.498e-46
Identity = 105/130 (80.77%), Postives = 107/130 (82.31%), Query Frame = 3
Query:  138 IKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTS 470
            + D +T  NTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTS
Sbjct: 4684 LLDKLTSPNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTS 4813          

HSP 16 Score: 155.221 bits (391), Expect = 4.363e-42
Identity = 100/123 (81.30%), Postives = 101/123 (82.11%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEI 497
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQG                  TLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPN    S+I
Sbjct: 4595 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQG------------------TLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPNTISPSDI 4699          

HSP 17 Score: 153.295 bits (386), Expect = 2.222e-41
Identity = 97/116 (83.62%), Postives = 97/116 (83.62%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTI 419
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTI
Sbjct: 3317 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTI 3432          

HSP 18 Score: 116.701 bits (291), Expect = 8.903e-29
Identity = 58/58 (100.00%), Postives = 58/58 (100.00%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ 302
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ
Sbjct: 4082 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ 4139          
BLAST of SMED30005152 vs. Planmine SMEST
Match: SMESG000042718.1 (SMESG000042718.1)

HSP 1 Score: 261.536 bits (667), Expect = 4.925e-79
Identity = 153/172 (88.95%), Postives = 153/172 (88.95%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 4378 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 4549          

HSP 2 Score: 254.603 bits (649), Expect = 1.273e-76
Identity = 148/172 (86.05%), Postives = 151/172 (87.79%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 1892 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 2063          

HSP 3 Score: 254.603 bits (649), Expect = 1.273e-76
Identity = 148/172 (86.05%), Postives = 151/172 (87.79%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 2449 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 2620          

HSP 4 Score: 254.603 bits (649), Expect = 1.273e-76
Identity = 148/172 (86.05%), Postives = 151/172 (87.79%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 2666 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 2837          

HSP 5 Score: 254.603 bits (649), Expect = 1.273e-76
Identity = 148/172 (86.05%), Postives = 151/172 (87.79%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 2883 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 3054          

HSP 6 Score: 254.603 bits (649), Expect = 1.273e-76
Identity = 148/172 (86.05%), Postives = 151/172 (87.79%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 3100 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 3271          

HSP 7 Score: 254.603 bits (649), Expect = 1.273e-76
Identity = 148/172 (86.05%), Postives = 151/172 (87.79%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 3648 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTKLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 3819          

HSP 8 Score: 253.447 bits (646), Expect = 3.713e-76
Identity = 148/172 (86.05%), Postives = 150/172 (87.21%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V + GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 3865 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLIGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 4036          

HSP 9 Score: 236.113 bits (601), Expect = 3.398e-70
Identity = 139/169 (82.25%), Postives = 144/169 (85.21%), Query Frame = 3
Query:  138 IKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            + D +T  NTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 1678 LLDKLTSPNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTKLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 1846          

HSP 10 Score: 236.113 bits (601), Expect = 3.398e-70
Identity = 139/169 (82.25%), Postives = 144/169 (85.21%), Query Frame = 3
Query:  138 IKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            + D +T  NTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 2235 LLDKLTSPNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 2403          

HSP 11 Score: 231.876 bits (590), Expect = 1.080e-68
Identity = 138/164 (84.15%), Postives = 141/164 (85.98%), Query Frame = 3
Query:  153 TDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            T S TISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 3439 TISKTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 3602          

HSP 12 Score: 190.274 bits (482), Expect = 3.587e-54
Identity = 116/136 (85.29%), Postives = 117/136 (86.03%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNV 479
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPN+
Sbjct: 4191 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPNL 4326          

HSP 13 Score: 189.889 bits (481), Expect = 4.064e-54
Identity = 118/142 (83.10%), Postives = 119/142 (83.80%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEI 497
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPN    S+I
Sbjct: 1552 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTKLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPNTISPSDI 1693          

HSP 14 Score: 182.956 bits (463), Expect = 1.030e-51
Identity = 113/142 (79.58%), Postives = 117/142 (82.39%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEI 497
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPN    S+I
Sbjct: 2109 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNTISPSDI 2250          

HSP 15 Score: 166.392 bits (420), Expect = 5.499e-46
Identity = 105/130 (80.77%), Postives = 107/130 (82.31%), Query Frame = 3
Query:  138 IKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTS 470
            + D +T  NTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTS
Sbjct: 4703 LLDKLTSPNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTS 4832          

HSP 16 Score: 161.384 bits (407), Expect = 2.828e-44
Identity = 103/124 (83.06%), Postives = 108/124 (87.10%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSE-IVIDVNPTHQGTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEI 497
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQG+  +  E   +  N +  GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPN    S+I
Sbjct: 4595 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPNTISPSDI 4718          

HSP 17 Score: 153.295 bits (386), Expect = 2.243e-41
Identity = 97/116 (83.62%), Postives = 97/116 (83.62%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTI 419
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTI
Sbjct: 3317 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTI 3432          

HSP 18 Score: 116.701 bits (291), Expect = 8.989e-29
Identity = 58/58 (100.00%), Postives = 58/58 (100.00%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ 302
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ
Sbjct: 4082 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ 4139          
BLAST of SMED30005152 vs. Planmine SMEST
Match: SMESG000042718.1 (SMESG000042718.1)

HSP 1 Score: 261.536 bits (667), Expect = 4.926e-79
Identity = 153/172 (88.95%), Postives = 153/172 (88.95%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 4378 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 4549          

HSP 2 Score: 254.603 bits (649), Expect = 1.285e-76
Identity = 148/172 (86.05%), Postives = 151/172 (87.79%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 1892 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 2063          

HSP 3 Score: 254.603 bits (649), Expect = 1.285e-76
Identity = 148/172 (86.05%), Postives = 151/172 (87.79%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 2449 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 2620          

HSP 4 Score: 254.603 bits (649), Expect = 1.285e-76
Identity = 148/172 (86.05%), Postives = 151/172 (87.79%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 2666 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 2837          

HSP 5 Score: 254.603 bits (649), Expect = 1.285e-76
Identity = 148/172 (86.05%), Postives = 151/172 (87.79%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 2883 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 3054          

HSP 6 Score: 254.603 bits (649), Expect = 1.285e-76
Identity = 148/172 (86.05%), Postives = 151/172 (87.79%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 3100 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 3271          

HSP 7 Score: 254.603 bits (649), Expect = 1.285e-76
Identity = 148/172 (86.05%), Postives = 151/172 (87.79%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 3648 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTKLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 3819          

HSP 8 Score: 253.447 bits (646), Expect = 3.749e-76
Identity = 148/172 (86.05%), Postives = 150/172 (87.21%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V + GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 3865 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLIGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 4036          

HSP 9 Score: 236.113 bits (601), Expect = 3.497e-70
Identity = 139/167 (83.23%), Postives = 143/167 (85.63%), Query Frame = 3
Query:  144 DAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            D +T  NTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 1680 DKLTSPNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTKLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 1846          

HSP 10 Score: 236.113 bits (601), Expect = 3.497e-70
Identity = 139/167 (83.23%), Postives = 143/167 (85.63%), Query Frame = 3
Query:  144 DAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            D +T  NTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 2237 DKLTSPNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 2403          

HSP 11 Score: 231.876 bits (590), Expect = 1.091e-68
Identity = 138/164 (84.15%), Postives = 141/164 (85.98%), Query Frame = 3
Query:  153 TDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            T S TISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 3439 TISKTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 3602          

HSP 12 Score: 190.274 bits (482), Expect = 3.587e-54
Identity = 116/136 (85.29%), Postives = 117/136 (86.03%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNV 479
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPN+
Sbjct: 4191 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPNL 4326          

HSP 13 Score: 189.889 bits (481), Expect = 4.064e-54
Identity = 118/142 (83.10%), Postives = 119/142 (83.80%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEI 497
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPN    S+I
Sbjct: 1552 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTKLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPNTISPSDI 1693          

HSP 14 Score: 182.956 bits (463), Expect = 1.040e-51
Identity = 113/142 (79.58%), Postives = 117/142 (82.39%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEI 497
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPN    S+I
Sbjct: 2109 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNTISPSDI 2250          

HSP 15 Score: 166.392 bits (420), Expect = 5.606e-46
Identity = 105/128 (82.03%), Postives = 106/128 (82.81%), Query Frame = 3
Query:  144 DAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTS 470
            D +T  NTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTS
Sbjct: 4709 DKLTSPNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTS 4836          

HSP 16 Score: 153.295 bits (386), Expect = 1.907e-41
Identity = 103/142 (72.54%), Postives = 105/142 (73.94%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEI 497
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQAN              +IVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPN    S+I
Sbjct: 4595 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQAN--------------KIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPNTISPSDI 4722          

HSP 17 Score: 153.295 bits (386), Expect = 2.244e-41
Identity = 97/116 (83.62%), Postives = 97/116 (83.62%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTI 419
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTI
Sbjct: 3317 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTI 3432          

HSP 18 Score: 116.701 bits (291), Expect = 8.989e-29
Identity = 58/58 (100.00%), Postives = 58/58 (100.00%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ 302
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ
Sbjct: 4082 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ 4139          
BLAST of SMED30005152 vs. Planmine SMEST
Match: SMESG000042718.1 (SMESG000042718.1)

HSP 1 Score: 261.536 bits (667), Expect = 5.471e-79
Identity = 153/172 (88.95%), Postives = 153/172 (88.95%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 4280 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 4451          

HSP 2 Score: 254.603 bits (649), Expect = 1.428e-76
Identity = 148/172 (86.05%), Postives = 151/172 (87.79%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 1903 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 2074          

HSP 3 Score: 254.603 bits (649), Expect = 1.428e-76
Identity = 148/172 (86.05%), Postives = 151/172 (87.79%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 2460 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 2631          

HSP 4 Score: 254.603 bits (649), Expect = 1.428e-76
Identity = 148/172 (86.05%), Postives = 151/172 (87.79%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 2677 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 2848          

HSP 5 Score: 254.603 bits (649), Expect = 1.428e-76
Identity = 148/172 (86.05%), Postives = 151/172 (87.79%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 2894 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 3065          

HSP 6 Score: 254.603 bits (649), Expect = 1.428e-76
Identity = 148/172 (86.05%), Postives = 151/172 (87.79%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 3111 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 3282          

HSP 7 Score: 254.603 bits (649), Expect = 1.428e-76
Identity = 148/172 (86.05%), Postives = 151/172 (87.79%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 3659 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTKLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 3830          

HSP 8 Score: 253.447 bits (646), Expect = 4.164e-76
Identity = 148/172 (86.05%), Postives = 150/172 (87.21%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V + GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 3876 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLIGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 4047          

HSP 9 Score: 236.113 bits (601), Expect = 3.810e-70
Identity = 139/167 (83.23%), Postives = 143/167 (85.63%), Query Frame = 3
Query:  144 DAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            D +T  NTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 2248 DKLTSPNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 2414          

HSP 10 Score: 231.876 bits (590), Expect = 1.177e-68
Identity = 138/164 (84.15%), Postives = 141/164 (85.98%), Query Frame = 3
Query:  153 TDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            T S TISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 3450 TISKTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 3613          

HSP 11 Score: 220.32 bits (560), Expect = 1.037e-64
Identity = 132/153 (86.27%), Postives = 133/153 (86.93%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQ 530
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRT +
Sbjct: 1552 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTKLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTFK 1704          

HSP 12 Score: 215.312 bits (547), Expect = 6.030e-63
Identity = 127/152 (83.55%), Postives = 131/152 (86.18%), Query Frame = 3
Query:  189 VLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            +LVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 1706 LLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTKLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 1857          

HSP 13 Score: 189.889 bits (481), Expect = 3.906e-54
Identity = 116/136 (85.29%), Postives = 117/136 (86.03%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNV 479
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPN+
Sbjct: 4093 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPNL 4228          

HSP 14 Score: 182.956 bits (463), Expect = 1.143e-51
Identity = 113/142 (79.58%), Postives = 117/142 (82.39%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEI 497
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPN    S+I
Sbjct: 2120 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNTISPSDI 2261          

HSP 15 Score: 169.859 bits (429), Expect = 3.435e-47
Identity = 107/123 (86.99%), Postives = 108/123 (87.80%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEI 497
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSE           TLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPN    S+I
Sbjct: 4497 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSE---------NRTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPNTISPSDI 4610          

HSP 16 Score: 166.392 bits (420), Expect = 6.046e-46
Identity = 105/128 (82.03%), Postives = 106/128 (82.81%), Query Frame = 3
Query:  144 DAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTS 470
            D +T  NTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTS
Sbjct: 4597 DKLTSPNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTS 4724          

HSP 17 Score: 153.295 bits (386), Expect = 2.351e-41
Identity = 97/116 (83.62%), Postives = 97/116 (83.62%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTI 419
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTI
Sbjct: 3328 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTI 3443          
BLAST of SMED30005152 vs. Planmine SMEST
Match: SMESG000042718.1 (SMESG000042718.1)

HSP 1 Score: 261.536 bits (667), Expect = 5.578e-79
Identity = 153/172 (88.95%), Postives = 153/172 (88.95%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 4280 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 4451          

HSP 2 Score: 254.603 bits (649), Expect = 1.442e-76
Identity = 148/172 (86.05%), Postives = 151/172 (87.79%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 1903 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 2074          

HSP 3 Score: 254.603 bits (649), Expect = 1.442e-76
Identity = 148/172 (86.05%), Postives = 151/172 (87.79%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 2460 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 2631          

HSP 4 Score: 254.603 bits (649), Expect = 1.442e-76
Identity = 148/172 (86.05%), Postives = 151/172 (87.79%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 2677 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 2848          

HSP 5 Score: 254.603 bits (649), Expect = 1.442e-76
Identity = 148/172 (86.05%), Postives = 151/172 (87.79%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 2894 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 3065          

HSP 6 Score: 254.603 bits (649), Expect = 1.442e-76
Identity = 148/172 (86.05%), Postives = 151/172 (87.79%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 3111 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 3282          

HSP 7 Score: 254.603 bits (649), Expect = 1.442e-76
Identity = 148/172 (86.05%), Postives = 151/172 (87.79%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 3659 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTKLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 3830          

HSP 8 Score: 253.447 bits (646), Expect = 4.204e-76
Identity = 148/172 (86.05%), Postives = 150/172 (87.21%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V + GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 3876 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLIGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 4047          

HSP 9 Score: 236.113 bits (601), Expect = 3.847e-70
Identity = 139/167 (83.23%), Postives = 143/167 (85.63%), Query Frame = 3
Query:  144 DAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            D +T  NTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 2248 DKLTSPNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 2414          

HSP 10 Score: 231.876 bits (590), Expect = 1.200e-68
Identity = 138/164 (84.15%), Postives = 141/164 (85.98%), Query Frame = 3
Query:  153 TDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            T S TISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 3450 TISKTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 3613          

HSP 11 Score: 220.32 bits (560), Expect = 1.047e-64
Identity = 132/153 (86.27%), Postives = 133/153 (86.93%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQ 530
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRT +
Sbjct: 1552 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTKLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTFK 1704          

HSP 12 Score: 215.312 bits (547), Expect = 6.089e-63
Identity = 127/152 (83.55%), Postives = 131/152 (86.18%), Query Frame = 3
Query:  189 VLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG-------------------TLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 587
            +LVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQG                   TLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF
Sbjct: 1706 LLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTKLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCF 1857          

HSP 13 Score: 189.889 bits (481), Expect = 3.944e-54
Identity = 116/136 (85.29%), Postives = 117/136 (86.03%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNV 479
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPN+
Sbjct: 4093 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPNL 4228          

HSP 14 Score: 182.956 bits (463), Expect = 1.143e-51
Identity = 113/142 (79.58%), Postives = 117/142 (82.39%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEI 497
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGD+S V ++GIDLAQSPKLLDKLTSPN    S+I
Sbjct: 2120 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDKSMVVLTGIDLAQSPKLLDKLTSPNTISPSDI 2261          

HSP 15 Score: 166.392 bits (420), Expect = 6.105e-46
Identity = 105/128 (82.03%), Postives = 106/128 (82.81%), Query Frame = 3
Query:  144 DAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTS 470
            D +T  NTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTS
Sbjct: 4607 DKLTSPNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTS 4734          

HSP 16 Score: 161.384 bits (407), Expect = 3.022e-44
Identity = 103/124 (83.06%), Postives = 108/124 (87.10%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSE-IVIDVNPTHQGTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTISGIDLAQSPKLLDKLTSPNVNPGSEI 497
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQG+  +  E   +  N +  GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPN    S+I
Sbjct: 4497 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKLLDKLTSPNTISPSDI 4620          

HSP 17 Score: 153.295 bits (386), Expect = 2.374e-41
Identity = 97/116 (83.62%), Postives = 97/116 (83.62%), Query Frame = 3
Query:  129 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ-------------------GTLKSAVNEINLVIKEPEXXXXXXXXXXXDNGDQSTVTI 419
            QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ                   GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTI
Sbjct: 3328 QCLIKDAMTDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQGIFKSHFENTRLFNNNSSLGTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTI 3443          
The following BLAST results are available for this feature:
BLAST of SMED30005152 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005152 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005152 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005152 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005152 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005152 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005152 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005152 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005152 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005152 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005152 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005152 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005152 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005152 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000042718.14.877e-7988.95SMESG000042718.1[more]
SMESG000042718.14.925e-7988.95SMESG000042718.1[more]
SMESG000042718.14.926e-7988.95SMESG000042718.1[more]
SMESG000042718.15.471e-7988.95SMESG000042718.1[more]
SMESG000042718.15.578e-7988.95SMESG000042718.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005152 ID=SMED30005152|Name=SMED30005152|organism=Schmidtea mediterranea sexual|type=transcript|length=892bp
CTGAAGCATCTACAACTTCAGAAACAAGTTCGACATCCATAACTACGACG
TCCGGAACTACAACATCTACCACAACGCCAACAGTAACTTTTACAACGTC
AACACCGAAAACAACAACAATTCCAACACAGTGTTTAATTAAAGACGCAA
TGACAGACAGCAATACTATATCACCATCTGACATCACAGTTCTTGTCGAT
GACACACCATTGCCTAAACAAGCAAATGTAAATCTTGGAAGTACACAAGG
TTTAACAATAACTGGTTCAGAAATCGTAATTGACGTCAATCCAACACATC
AAGGAACGCTGAAGTCAGCAGTCAATGAAATCAACCTTGTCATTAAAGAA
CCTGAACTAGTCCTAGTTGCAGTACTGACAGTAACATTGGACAATGGTGA
TCAATCAACTGTAACAATATCCGGAATAGATCTAGCACAATCTCCAAAGT
TGTTGGACAAATTGACTTCGCCAAATGTAAATCCAGGATCTGAAATCGAG
AAAATAGAAATTTCCATTAGAACCATTCAAAATTCTGATGGAACTAATCC
AACAATAACTATCAAGTTAGAAGTCAATGGTTGCTTCACTCCAACTGAAG
CTTCTACTACATCAACGGCTTCTCAAACTTCAATATCCGGAACTATGATG
TCTATGACCACAAAATCAACGACAACTACGTCGCAGACATATTGTGAAAA
TGATGAAACATATTGTGAAGGCATAAATGGAAAAATGATTTGTGCAAAAA
ATTGTGATAATATAGCAGAATGTAAAAATCCTAATCTAGATGAACCACAA
AGCTGTAAAGGAACTGAAACAACGATTGGATCAAGCTTTATAACAGAAAT
ACCTCAGTCGAATATAACATTAATGCAATCGACATCGGAAAG
back to top

protein sequence of SMED30005152-orf-1

>SMED30005152-orf-1 ID=SMED30005152-orf-1|Name=SMED30005152-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=296bp
EASTTSETSSTSITTTSGTTTSTTTPTVTFTTSTPKTTTIPTQCLIKDAM
TDSNTISPSDITVLVDDTPLPKQANVNLGSTQGLTITGSEIVIDVNPTHQ
GTLKSAVNEINLVIKEPELVLVAVLTVTLDNGDQSTVTISGIDLAQSPKL
LDKLTSPNVNPGSEIEKIEISIRTIQNSDGTNPTITIKLEVNGCFTPTEA
STTSTASQTSISGTMMSMTTKSTTTTSQTYCENDETYCEGINGKMICAKN
CDNIAECKNPNLDEPQSCKGTETTIGSSFITEIPQSNITLMQSTSE
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0000419prepharyngeal region
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..34