3' histone mRNA exonuclease 1

Overview
Name3' histone mRNA exonuclease 1
Smed IDSMED30005150
Length (bp)904
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 3' histone mRNA exonuclease 1 (SMED30005150) t-SNE clustered cells

Violin plots show distribution of expression levels for 3' histone mRNA exonuclease 1 (SMED30005150) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 3' histone mRNA exonuclease 1 (SMED30005150) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 3' histone mRNA exonuclease 1 (SMED30005150) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005150

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30005150SMESG000009332.1 SMESG000009320.1 Contig3864GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30005150SMESG000058668.1 Contig3864GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30005150SMESG000058668.1 dd_Smed_v4_1266_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30005150SMESG000058668.1 dd_Smed_v4_1266_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30005150SMESG000058668.1 dd_Smed_v4_1266_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005150SMESG000058668.1 dd_Smed_v4_1266_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30005150SMESG000058668.1 dd_Smed_v4_1266_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30005150SMESG000058668.1 dd_Smed_v4_1266_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005150SMESG000058668.1 Contig47153uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005150SMESG000058668.1 Contig47153newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30005150SMESG000058668.1 dd_Smed_v4_1266_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 3' histone mRNA exonuclease 1 vs. Ensembl Fly
Match: pck (gene:FBgn0013720 transcript:FBtr0070256)

HSP 1 Score: 69.3218 bits (168), Expect = 1.828e-13
Identity = 47/151 (31.13%), Postives = 78/151 (51.66%), Query Frame = 1
Query:  133 IAFVSPFWVATKPSDHRQFLRIGLWTVCFDGYMKP-YQYHKAYFGCYYIYYVEYDGVRDWLNPPWLYAVQ--VMMS---IGLITHAISTFIVICQSVMVFSHANVKTLATMLFTNFSTGLCILLALIAFGVESQDSRWIQFPEYNSLSWSY 567
            ++F SP+W+ +       F  +GLW  CF  ++ P Y + K + GC+ I+  EY  +R++L P WL AVQ  V MS   + L+   +S  I+      V  +  +    + + T  S+ L + LA+  FG  +    W+ +P++N L WSY
Sbjct:   45 MSFCSPYWIESYEETRASFKNMGLWQYCFKDFVYPKYAFLKQFTGCHNIFSHEYYVIREYLLPGWLMAVQGFVTMSFIIVFLVLALLSLTIIRLPLKAVLQYEWLLVRLSYMGTAISS-LFMFLAVCIFGGCAYRRDWMMYPKFNVLGWSY 194          
BLAST of 3' histone mRNA exonuclease 1 vs. Ensembl Fly
Match: pck (gene:FBgn0013720 transcript:FBtr0070255)

HSP 1 Score: 69.3218 bits (168), Expect = 1.828e-13
Identity = 47/151 (31.13%), Postives = 78/151 (51.66%), Query Frame = 1
Query:  133 IAFVSPFWVATKPSDHRQFLRIGLWTVCFDGYMKP-YQYHKAYFGCYYIYYVEYDGVRDWLNPPWLYAVQ--VMMS---IGLITHAISTFIVICQSVMVFSHANVKTLATMLFTNFSTGLCILLALIAFGVESQDSRWIQFPEYNSLSWSY 567
            ++F SP+W+ +       F  +GLW  CF  ++ P Y + K + GC+ I+  EY  +R++L P WL AVQ  V MS   + L+   +S  I+      V  +  +    + + T  S+ L + LA+  FG  +    W+ +P++N L WSY
Sbjct:   45 MSFCSPYWIESYEETRASFKNMGLWQYCFKDFVYPKYAFLKQFTGCHNIFSHEYYVIREYLLPGWLMAVQGFVTMSFIIVFLVLALLSLTIIRLPLKAVLQYEWLLVRLSYMGTAISS-LFMFLAVCIFGGCAYRRDWMMYPKFNVLGWSY 194          
BLAST of 3' histone mRNA exonuclease 1 vs. Ensembl Fly
Match: kune (gene:FBgn0033032 transcript:FBtr0086037)

HSP 1 Score: 59.3066 bits (142), Expect = 5.507e-10
Identity = 53/237 (22.36%), Postives = 111/237 (46.84%), Query Frame = 1
Query:   73 TKTIFRVITYCTVIA-VCFNFIAFVSPFWVATKPS-DHRQFLRIGLWTVCFDGYMKPYQYHKAYF-GCYYIYYVEYDGVRDWLNPPWLYAVQVMMSIGLITHAISTFIVICQSVMVFSHANVKTLATMLFTNFSTGLCIL-------LALIAFGVESQDSRWIQFPEYNSLSWSYXXXXXXXXXXXXXXCM-LVHVFLQVARDLEMIEKRKLNETYDSIYPASEKMPTPYDPRSSSP 750
            +  I +V    +V + +CF  IAF +P+W+ T     + +F  +GLW VCF+ +   +++    F GC +++  EY  + D+L P +  +VQ+  ++  +   +   I +  + +  S  + + +  +L    + G C +       +A++ FG +     W+   + N + WS+A   +  ++ +    + LV    +  + L  I  R+++E  D  Y    + P+   P + SP
Sbjct:    4 SNRILQVALCASVFSLICF-VIAFSTPYWLVTDGRLQNPRFTNLGLWEVCFNNFQDIHRFFDNSFNGCLWVFEEEYYIIHDFLLPGFYISVQLFATLCFVMCLV--VIPLTVAFLRTSRDDDRYMVLLL----AIGSCQVVGSVFGFIAVVIFGAKGDSRDWMPGWQNNDMGWSFALGVVGAVLLLPSGVLYLVEARRERYKRLNEISNREISEYGDEYY--QNQGPSAVLPTAPSP 231          
BLAST of 3' histone mRNA exonuclease 1 vs. Ensembl Fly
Match: sinu (gene:FBgn0010894 transcript:FBtr0077136)

HSP 1 Score: 47.7506 bits (112), Expect = 4.399e-6
Identity = 44/167 (26.35%), Postives = 72/167 (43.11%), Query Frame = 1
Query:  109 VIAVCFNFIAFVSPFWVATKPSDHR----QFLRIGLWTVCFDGY--MKPYQYHKAYFGCYYIY---YVEYDGVRDWLNPPWLYAVQ---VMMSIGLITHAISTFIVICQSVMVFSH--ANVKTLATMLFTNFSTGLCILLALIAFGVESQDSRWIQFPEYNSLSWSY 567
            V A  F  IAF +P W+    SD+R    +  R+GLW  CF     +      + + GC ++Y      YD +R +L P ++ A Q    +  IG++  AI   + I  +     H    +K+L  +L      G+   +A+I F      + W+     N   WS+
Sbjct:   44 VFAFAFIVIAFATPSWLV---SDYRITGAKLDRLGLWVHCFRSLPDVNDDSQRRFFVGCRWVYDPFTTGYDEIRGFLLPAFMIATQFFYTLAFIGMLVSAIGVLVFILCAGPDQKHFITLIKSLGYVL---LGAGVSAAIAVIVFAGFGNRNGWMPEHANNWFGWSF 204          
BLAST of 3' histone mRNA exonuclease 1 vs. TrEMBL
Match: A0A5J4NRG4 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0006300 PE=4 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 1.015e-51
Identity = 78/167 (46.71%), Postives = 113/167 (67.66%), Query Frame = 1
Query:   67 KPTKTIFRVITYCTVIAVCFNFIAFVSPFWVATKPSDHRQFLRIGLWTVCFDGYMKPYQYHKAYFGCYYIYYVEYDGVRDWLNPPWLYAVQVMMSIGLITHAISTFIVICQSVMVFSHANVKTLATMLFTNFSTGLCILLALIAFGVESQDSRWIQFPEYNSLSWSY 567
            +   ++F V  + T+ AV  NF++FVSPFW+ + P  H QF RIGLWT CF+GYM+P  ++KAYFGCYYIY+VEYD +R+W+NP WLYAVQ + S G++  ++  F+V+CQ+       +VK     L  +F T + +  +L+AF V   DS W+ +P++N LSWSY
Sbjct:    5 EKANSLFSVFLWLTLGAVVTNFVSFVSPFWIQSIPDSHSQFERIGLWTACFNGYMRPNDFNKAYFGCYYIYFVEYDNIREWINPIWLYAVQALSSSGMLMQSLVAFVVLCQTTRSIDRDDVKVTKFNLVGHFYTCITLAASLVAFAVARYDSTWMPYPQFNVLSWSY 171          
BLAST of 3' histone mRNA exonuclease 1 vs. TrEMBL
Match: A0A504YKL5 (Claudin protein septate junction protein OS=Fasciola gigantica OX=46835 GN=FGIG_04743 PE=4 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 1.166e-50
Identity = 92/237 (38.82%), Postives = 141/237 (59.49%), Query Frame = 1
Query:   49 LMSEKDKPTKTIFRVITYCTVIAVCFNFIAFVSPFWVATKPSDHRQFLRIGLWTVCFDGYMKPYQYHKAYFGCYYIYYVEYDGVRDWLNPPWLYAVQVMMSIGLITHAISTFIVICQSVMVFSHANVKTLATMLFTNFSTGLCILLALIAFGVESQDSRWIQFPEYNSLSWSYXXXXXXXXXXXXXXCM--LVHVFLQVARDLEMIEKRKLNETYDSIYPASEKMPTP--YDPRSSS 747
            +M+  +K T+  F      TV + C NFIAFVSP+W+ +    + QF  IGLWT CF+GYM+P+ Y KAYFGCYYIYY+EYD +R W+NP W YA+QV+ S G++ H++  F+V+CQ+       N++     L  +F   L +  +L+AF +   DS W+ FP++N LSWSY+ A ++F +T+  F +  + +++L    D   +   +     D   P  ++ P P  Y+PR  S
Sbjct:    1 MMNVANK-TRNFFIAFLSLTVFSACTNFIAFVSPYWIQSTAESNSQFKNIGLWTACFNGYMRPHMYDKAYFGCYYIYYIEYDRIRSWINPVWFYAIQVLSSCGMLVHSLVLFVVLCQTTNSIKRDNLQVAKFTLAGHFFVCLTLAASLVAFAIARYDSTWMPFPQFNVLSWSYSVAVLSFALTLISFLVGFVRYMYLDAVLDEYQMALLRQQADMDVSSPPMKERPAPLGYEPRQLS 236          
BLAST of 3' histone mRNA exonuclease 1 vs. TrEMBL
Match: A0A5K3FRX3 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 1.329e-49
Identity = 75/169 (44.38%), Postives = 110/169 (65.09%), Query Frame = 1
Query:   61 KDKPTKTIFRVITYCTVIAVCFNFIAFVSPFWVATKPSDHRQFLRIGLWTVCFDGYMKPYQYHKAYFGCYYIYYVEYDGVRDWLNPPWLYAVQVMMSIGLITHAISTFIVICQSVMVFSHANVKTLATMLFTNFSTGLCILLALIAFGVESQDSRWIQFPEYNSLSWSY 567
             D   + +F      +++A C NFIAFVSP+W+  +   +  F RIGLWT CFDGYM+P QY KAY+GC+YIYYVEYD +R+WLNP WLY VQV+ SIG++ H +  F ++CQ+    +  ++     ++  +F  G+ +L  L+ F   S DSRW+ +P +N LSW++
Sbjct:    9 SDAENRCLFITFLAFSLLAACLNFIAFVSPYWIEARSGAYALFNRIGLWTACFDGYMRPNQYDKAYYGCFYIYYVEYDSIREWLNPIWLYVVQVIASIGILCHGLVLFFLVCQATGRVAIESLHLTKWLMSGHFIAGISLLGTLLGFTYGSYDSRWVPYPRFNKLSWAF 177          
BLAST of 3' histone mRNA exonuclease 1 vs. TrEMBL
Match: A0A094ZHR1 (Uncharacterized protein OS=Schistosoma haematobium OX=6185 GN=MS3_00524 PE=4 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 2.850e-49
Identity = 105/244 (43.03%), Postives = 147/244 (60.25%), Query Frame = 1
Query:   73 TKTIFRVITYCTVIAVCFNFIAFVSPFWVATKPSDHRQFLRIGLWTVCFDGYMKPYQYHKAYFGCYYIYYVEYDGVRDWLNPPWLYAVQVMMSIGLITHAISTFIVICQSVMVFSHANVKTLATMLFTNFSTGLCILLALIAFGVESQDSRWIQFPEYNSLSWSYXXXXXXXXXXXXXXCMLVHVFLQVARDLEMIEKRKLNETYDSIYPASEKM----PTPYDPRSSSPPVYNEV*FIVIPLY 792
             K +F    + T    C NFI+FVSP+W+ + P  + QF RIGLWTVCFDGYM+P  Y+KAYFGCYYIYYV YD +RDWLNP WLY +QV  S G++ H + TFIV+CQ     S +++K+L  +   +F T L +  AL+AF V   DSRW+ +PE N+LSW+YA   ++FI T   F +    ++++    ++I ++  NE    +    EKM    P+P  P  S+   +NE      P Y
Sbjct:    4 NKRLFSCTVFFTTFGFCSNFISFVSPYWIQSIPEANSQFQRIGLWTVCFDGYMRPALYNKAYFGCYYIYYVIYDRIRDWLNPIWLYTIQVTSSCGVLVHFLVTFIVLCQVTGAISKSDLKSLKFIASGHFFTSLTLAAALVAFAVARYDSRWMPYPELNTLSWAYAVGVLSFICTFISFTISFITYIKLN---DLIHQQNTNE---HLLNDEEKMGISSPSPPAPHHST---FNEANVYTEPRY 238          
BLAST of 3' histone mRNA exonuclease 1 vs. TrEMBL
Match: G7YD61 (Claudin-like protein septate junction protein OS=Clonorchis sinensis OX=79923 GN=CLF_105194 PE=4 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 1.007e-48
Identity = 78/169 (46.15%), Postives = 113/169 (66.86%), Query Frame = 1
Query:   61 KDKPTKTIFRVITYCTVIAVCFNFIAFVSPFWVATKPSDHRQFLRIGLWTVCFDGYMKPYQYHKAYFGCYYIYYVEYDGVRDWLNPPWLYAVQVMMSIGLITHAISTFIVICQSVMVFSHANVKTLATMLFTNFSTGLCILLALIAFGVESQDSRWIQFPEYNSLSWSY 567
            K+K +  +F V  + T+ AV  NFI+FVSPFW+ + P  H QF RIGLWT CF+GYM+P  + KAYFGCYYIY+VEYD +R W+NP WLYA+QV+ S+G++  ++ TF V+CQ     +  ++  +   L  +F T + +  +L+AF +   DS W+ +P  N LSW+Y
Sbjct:    5 KEK-SHRLFLVFLWTTIAAVTTNFISFVSPFWIQSVPEAHSQFERIGLWTACFNGYMRPDDFSKAYFGCYYIYFVEYDRIRQWINPLWLYAIQVLSSLGILLQSLVTFTVLCQVTHSVNRDDLSVVKFNLLGHFFTCVTLAASLVAFAIARYDSTWMPYPSLNVLSWAY 172          
BLAST of 3' histone mRNA exonuclease 1 vs. Planmine SMEST
Match: SMESG000058668.1 (SMESG000058668.1)

HSP 1 Score: 468.774 bits (1205), Expect = 3.214e-169
Identity = 239/239 (100.00%), Postives = 239/239 (100.00%), Query Frame = 1
Query:   52 MSEKDKPTKTIFRVITYCTVIAVCFNFIAFVSPFWVATKPSDHRQFLRIGLWTVCFDGYMKPYQYHKAYFGCYYIYYVEYDGVRDWLNPPWLYAVQVMMSIGLITHAISTFIVICQSVMVFSHANVKTLATMLFTNFSTGLCILLALIAFGVESQDSRWIQFPEYNSLSWSYXXXXXXXXXXXXXXCMLVHVFLQVARDLEMIEKRKLNETYDSIYPASEKMPTPYDPRSSSPPVYNEV 768
            MSEKDKPTKTIFRVITYCTVIAVCFNFIAFVSPFWVATKPSDHRQFLRIGLWTVCFDGYMKPYQYHKAYFGCYYIYYVEYDGVRDWLNPPWLYAVQVMMSIGLITHAISTFIVICQSVMVFSHANVKTLATMLFTNFSTGLCILLALIAFGVESQDSRWIQFPEYNSLSWSYAFAAIAFIITVAVFCMLVHVFLQVARDLEMIEKRKLNETYDSIYPASEKMPTPYDPRSSSPPVYNEV
Sbjct:    1 MSEKDKPTKTIFRVITYCTVIAVCFNFIAFVSPFWVATKPSDHRQFLRIGLWTVCFDGYMKPYQYHKAYFGCYYIYYVEYDGVRDWLNPPWLYAVQVMMSIGLITHAISTFIVICQSVMVFSHANVKTLATMLFTNFSTGLCILLALIAFGVESQDSRWIQFPEYNSLSWSYAFAAIAFIITVAVFCMLVHVFLQVARDLEMIEKRKLNETYDSIYPASEKMPTPYDPRSSSPPVYNEV 239          
BLAST of 3' histone mRNA exonuclease 1 vs. Planmine SMEST
Match: SMESG000042798.1 (SMESG000042798.1)

HSP 1 Score: 147.132 bits (370), Expect = 1.119e-41
Identity = 68/171 (39.77%), Postives = 100/171 (58.48%), Query Frame = 1
Query:   58 EKDKPTKTIFRVITYCTVIAVCFNFIAFVSPFWVATKPSDHRQFLRIGLWTVCFDGYMKPYQY-HKAYFGCYYIYYVEYDGVRDWLNPPWLYAVQVMMSIGLITHAISTFIVICQSVMVFSHANVKTLATMLFTNFSTGLCILLALIAFGVESQDSRWIQFPEYNSLSWSY 567
            EK+K     F+   Y    A  FN +AFVSP+W+  +P    QF+R+GLW  CFD Y+ P  Y  K Y GC+Y+Y+ EYD +RDWLNPPW Y VQ+M SI L+ +  +  +V+ + V   +  +  T    L   F    C ++ ++A GV S+D  W+  P++N +SWS+
Sbjct:    2 EKEKKISVNFKFALYLACAAFIFNLVAFVSPYWIVARPEYPSQFVRLGLWVACFDNYIHPEDYVSKMYKGCWYVYWPEYDYIRDWLNPPWFYGVQMMSSISLLCNGGAMILVLLKFVNAINIVDKNTNILALVLQFLAFCCYIIVIVAMGVMSKDREWMPRPDHNQVSWSF 172          
BLAST of 3' histone mRNA exonuclease 1 vs. Planmine SMEST
Match: SMESG000042798.1 (SMESG000042798.1)

HSP 1 Score: 147.517 bits (371), Expect = 1.141e-41
Identity = 68/171 (39.77%), Postives = 100/171 (58.48%), Query Frame = 1
Query:   58 EKDKPTKTIFRVITYCTVIAVCFNFIAFVSPFWVATKPSDHRQFLRIGLWTVCFDGYMKPYQY-HKAYFGCYYIYYVEYDGVRDWLNPPWLYAVQVMMSIGLITHAISTFIVICQSVMVFSHANVKTLATMLFTNFSTGLCILLALIAFGVESQDSRWIQFPEYNSLSWSY 567
            EK+K     F+   Y    A  FN +AFVSP+W+  +P    QF+R+GLW  CFD Y+ P  Y  K Y GC+Y+Y+ EYD +RDWLNPPW Y VQ+M SI L+ +  +  +V+ + V   +  +  T    L   F    C ++ ++A GV S+D  W+  P++N +SWS+
Sbjct:    2 EKEKKISVNFKFALYLACAAFIFNLVAFVSPYWIVARPEYPSQFVRLGLWVACFDNYIHPEDYVSKMYKGCWYVYWPEYDYIRDWLNPPWFYGVQMMSSISLLCNGGAMILVLLKFVNAINIVDKNTNILALVLQFLAFCCYIIVIVAMGVMSKDREWMPRPDHNQVSWSF 172          
BLAST of 3' histone mRNA exonuclease 1 vs. Planmine SMEST
Match: SMESG000028931.1 (SMESG000028931.1)

HSP 1 Score: 83.9593 bits (206), Expect = 8.550e-19
Identity = 48/177 (27.12%), Postives = 83/177 (46.89%), Query Frame = 1
Query:   46 ILMSEKDKPTKTIFRVITYCTVIAVCFNFIAFVSPFWVATKPSDHRQFLRIGLWTVCFDGYMKPYQYH-KAYFGCYYIYYVEYDGVRDWLNPPWLYAVQVMMSIGLITHAISTFIVICQSVMVFSHANVKTLAT--MLFTNFSTGLCILLALIAFGVESQDSRWIQFPEYNSLSWSY 567
            IL+S+K +       V T   VI      IAF + +W+ + P  H +F R+GLW  C +GY        +++FGC++++   Y  ++D L P W   VQ   ++  +       ++I     +  H   + L +  + F+   + +   +A++ FG    D  W+  PE N  SWSY
Sbjct:   11 ILLSKKRRQFYVFMSVFTLICVI------IAFCTSYWLQSWPRIHSEFKRLGLWEFCLNGYTARRDIKMQSFFGCWWLFAPYYYPIQDLLTPAWFQTVQAFFTLAFLLQLAINILLIFYGFKIIKHPERRALTSRILFFSQIVSIILTFIAIVIFGCRCFDLYWMPRPELNWPSWSY 181          
BLAST of 3' histone mRNA exonuclease 1 vs. Planmine SMEST
Match: SMESG000028931.1 (SMESG000028931.1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.407e-17
Identity = 40/148 (27.03%), Postives = 72/148 (48.65%), Query Frame = 1
Query:  133 IAFVSPFWVATKPSDHRQFLRIGLWTVCFDGYMKPYQYH-KAYFGCYYIYYVEYDGVRDWLNPPWLYAVQVMMSIGLITHAISTFIVICQSVMVFSHANVKTLAT--MLFTNFSTGLCILLALIAFGVESQDSRWIQFPEYNSLSWSY 567
            IAF + +W+ + P  H +F R+GLW  C +GY        +++FGC++++   Y  ++D L P W   VQ   ++  +       ++I     +  H   + L +  + F+   + +   +A++ FG    D  W+  PE N  SWSY
Sbjct:   11 IAFCTSYWLQSWPRIHSEFKRLGLWEFCLNGYTARRDIKMQSFFGCWWLFAPYYYPIQDLLTPAWFQTVQAFFTLAFLLQLAINILLIFYGFKIIKHPERRALTSRILFFSQIVSIILTFIAIVIFGCRCFDLYWMPRPELNWPSWSY 158          
The following BLAST results are available for this feature:
BLAST of 3' histone mRNA exonuclease 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 3' histone mRNA exonuclease 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 3' histone mRNA exonuclease 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
pck1.828e-1331.13gene:FBgn0013720 transcript:FBtr0070256[more]
pck1.828e-1331.13gene:FBgn0013720 transcript:FBtr0070255[more]
kune5.507e-1022.36gene:FBgn0033032 transcript:FBtr0086037[more]
sinu4.399e-626.35gene:FBgn0010894 transcript:FBtr0077136[more]
back to top
BLAST of 3' histone mRNA exonuclease 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 3' histone mRNA exonuclease 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 3' histone mRNA exonuclease 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 3' histone mRNA exonuclease 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 3' histone mRNA exonuclease 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4NRG41.015e-5146.71Uncharacterized protein OS=Paragonimus westermani ... [more]
A0A504YKL51.166e-5038.82Claudin protein septate junction protein OS=Fascio... [more]
A0A5K3FRX31.329e-4944.38Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A094ZHR12.850e-4943.03Uncharacterized protein OS=Schistosoma haematobium... [more]
G7YD611.007e-4846.15Claudin-like protein septate junction protein OS=C... [more]
back to top
BLAST of 3' histone mRNA exonuclease 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 3' histone mRNA exonuclease 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 3' histone mRNA exonuclease 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 3' histone mRNA exonuclease 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 3' histone mRNA exonuclease 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 3' histone mRNA exonuclease 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000058668.13.214e-169100.00SMESG000058668.1[more]
SMESG000042798.11.119e-4139.77SMESG000042798.1[more]
SMESG000042798.11.141e-4139.77SMESG000042798.1[more]
SMESG000028931.18.550e-1927.12SMESG000028931.1[more]
SMESG000028931.11.407e-1727.03SMESG000028931.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005150 ID=SMED30005150|Name=3' histone mRNA exonuclease 1|organism=Schmidtea mediterranea sexual|type=transcript|length=904bp
AAATATCTATTTTTCAAATATTTTTCCTTTTAAATAGTTAATGTCATATT
AATGAGTGAAAAGGATAAACCAACAAAAACAATTTTCAGAGTTATTACTT
ATTGCACAGTAATAGCAGTATGTTTCAATTTTATAGCTTTTGTTAGTCCG
TTTTGGGTTGCAACAAAACCTAGTGACCATCGTCAATTTTTAAGAATTGG
TTTATGGACAGTGTGTTTTGACGGATACATGAAACCATATCAGTATCATA
AAGCATATTTTGGTTGTTATTACATTTATTACGTCGAATATGATGGTGTA
AGAGATTGGTTAAATCCACCTTGGCTTTATGCTGTTCAAGTCATGATGTC
TATTGGGTTAATTACTCATGCGATTTCAACATTTATTGTGATTTGTCAGA
GTGTTATGGTGTTTTCCCATGCAAATGTTAAAACTTTGGCTACAATGCTT
TTTACTAACTTCTCAACAGGACTTTGTATATTGCTTGCGTTGATTGCTTT
CGGGGTGGAGAGCCAAGATTCCCGATGGATACAATTCCCAGAATACAACT
CGCTCTCCTGGTCCTATGCCTTTGCAGCGATTGCCTTTATTATCACCGTT
GCCGTGTTCTGCATGCTTGTACACGTGTTTTTACAGGTGGCGCGAGATTT
AGAAATGATTGAAAAACGAAAACTCAACGAAACATACGATAGTATTTATC
CTGCAAGTGAGAAAATGCCCACTCCATATGATCCGAGGTCGTCATCGCCT
CCAGTTTATAATGAAGTTTGATTTATAGTTATTCCTTTATATCATTGAGG
CTGTGCTGTCAATATTTCATATCGGACTCCATATCATTACCTGTTTTTGT
TCGTTACAATTTTGTATTAATTACTAAATAAATATTATTGTTCTTAAAAA
AAAA
back to top

protein sequence of SMED30005150-orf-1

>SMED30005150-orf-1 ID=SMED30005150-orf-1|Name=SMED30005150-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=240bp
MSEKDKPTKTIFRVITYCTVIAVCFNFIAFVSPFWVATKPSDHRQFLRIG
LWTVCFDGYMKPYQYHKAYFGCYYIYYVEYDGVRDWLNPPWLYAVQVMMS
IGLITHAISTFIVICQSVMVFSHANVKTLATMLFTNFSTGLCILLALIAF
GVESQDSRWIQFPEYNSLSWSYAFAAIAFIITVAVFCMLVHVFLQVARDL
EMIEKRKLNETYDSIYPASEKMPTPYDPRSSSPPVYNEV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004527exonuclease activity
Vocabulary: biological process
TermDefinition
GO:0090305nucleic acid phosphodiester bond hydrolysis
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR004031PMP22/EMP/MP20/Claudin
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.140.150coord: 6..204
e-value: 2.5E-18
score: 68.2
NoneNo IPR availablePANTHERPTHR21284FAMILY NOT NAMEDcoord: 12..205
NoneNo IPR availableTMHMMTMhelixcoord: 13..35
NoneNo IPR availableTMHMMTMhelixcoord: 172..194
NoneNo IPR availableTMHMMTMhelixcoord: 133..152
NoneNo IPR availableTMHMMTMhelixcoord: 91..113
IPR004031PMP-22/EMP/MP20/Claudin superfamilyPFAMPF13903Claudin_2coord: 20..183
e-value: 9.8E-12
score: 45.0