Protocadherin-9

Overview
NameProtocadherin-9
Smed IDSMED30005148
Length (bp)4139
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin-9 (SMED30005148) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin-9 (SMED30005148) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin-9 (SMED30005148) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin-9 (SMED30005148) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005148

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30005148SMESG000022791.1 SmedASXL_013811SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30005148SMESG000022791.1 dd_Smed_v4_7807_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30005148SMESG000022791.1 dd_Smed_v4_7807_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30005148SMESG000022791.1 dd_Smed_v4_7807_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30005148SMESG000022791.1 dd_Smed_v6_7807_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
body wall musculatureSMED30005148SMESG000022791.1 dd_Smed_v4_7807_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 238.424 bits (607), Expect = 1.301e-63
Identity = 246/851 (28.91%), Postives = 391/851 (45.95%), Query Frame = 1
Query:  439 FCILLSYFFNKEIHGQIEIHFKVVEESPTNSVIGNIH---NQALKQKGGVGSGDYY---YKSITDIEPFFLDSKTYE-FRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYK-ISYQSVNDGFKLKHSGRDHYEKL-SLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGK-HSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRI-GETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAI-----GYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTP 2943
            F +LL+        G  E ++ + EE P N +IG++    N +L     + +   +   YK+  D+    ++  T E F    R+DRE++C    ++  ++C   +  ++  I+ DE  +       ++ +   I DINDN+P + +  I +S+PE+S I ++ TLP A+DPD    N  Q Y+ I  Q++   F L        +K+  LIV K+ DRE++ T  +K+K  DG     S    + +S+TD ND  P FK+T I   I EN P+ + + QL A D D  +  K+ F F N V    R  F++N  TG I     +D E    + + V+ +DG     +A + + V +VNDN P I + Y+      T          L+EN      +A ++V+DKD +        N  + C  D H     LR   S   + F L T    D E T +Y  +L+  D+    L+ S    I + D NDN P+F      ++   + SI E  + G  + +V A D D G NA I Y L   +  +FS+D  +G L  +   D EK +K+  TI A +  +    S +      + V+I D ND  PVF  + Y F V E                    ++ +     +++P    D  D+   T S  D +  F I  +TG+I  N+   DREK  S++F ++A D      SS+A V I ++DVNDN P+++ P +     N SY+  +     G  +  + A D D G N +V Y IV                           N  ++F +D  TGNI + +K  ++D+G  ++ V+A+D G P
Sbjct:   10 FAVLLACVVFHS--GAQEKNYTIREEMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKT-GDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRD--EHC---FYEVEVAILPDEIFR-------LVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVG-INGVQNYELIKSQNI---FGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDT--------VVLSENIPLNTKIALITVTDKDADH-------NGRVTCFTD-HEIPFRLRPVFS---NQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVF------TQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNV-----TVFVSIIDQNDNSPVFTHNEYNFYVPEN-----------------LPRHGTVGLITVTDP----DYGDNSAVTLSILDENDDFTIDSQTGVIRPNIS-FDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPS-----NCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGG-------------------------NTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 759          

HSP 2 Score: 65.855 bits (159), Expect = 6.343e-10
Identity = 53/172 (30.81%), Postives = 85/172 (49.42%), Query Frame = 1
Query: 2482 LDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            LDRE+  ++  K++  D      SSTAI+Q+ + D NDN P  VF  T   EV++     +G  +  L A D D+G+N K+          FSF+      NL     S+I      +F L+ +TG I I + +   +  + K+ V ASD G  P + +  + +N+ +V+ N
Sbjct:  207 LDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHP--VFKETE-IEVSIPENAPVGTSVTQLHATDADIGENAKIH---------FSFS------NL----VSNIA---RRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAM--VLVNVTDVNDN 351          

HSP 3 Score: 54.6842 bits (130), Expect = 1.696e-6
Identity = 45/184 (24.46%), Postives = 79/184 (42.93%), Query Frame = 1
Query: 2482 LDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQE--AIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNGHGSSQGQFN 3027
            LD E    ++ K+ AAD  + PL+ +A++ I++ D NDN P++    T ++ V VS  E  + G  +  + A D D G N K+ Y + P + P                           F LD  TG + + +K+           + A D G PP      + ++I++ + N    +  ++N
Sbjct:  424 LDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVF----TQSF-VTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPP--------------------------EFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYN 576          
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 237.654 bits (605), Expect = 2.153e-63
Identity = 245/837 (29.27%), Postives = 388/837 (46.36%), Query Frame = 1
Query:  481 GQIEIHFKVVEESPTNSVIGNIH---NQALKQKGGVGSGDYY---YKSITDIEPFFLDSKTYE-FRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYK-ISYQSVNDGFKLKHSGRDHYEKL-SLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGK-HSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRI-GETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAI-----GYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTP 2943
            G  E ++ + EE P N +IGN+    N +L     + +   +   YK+  D+    ++  T E F    R+DRE++C    ++  ++C   +  ++  I+ DE  +       ++ +   I DINDN+P + +  I +S+PE+S I ++ TLP A+DPD    N  Q Y+ I  Q++   F L        +K+  LIV K+ DRE++ T  +K+K  DG     S    + +S+TD ND  P FK+T I   I EN P+ + + QL A D D  +  K+ F F N V    R  F++N  TG I     +D E    + + V+ +DG     +A + + V +VNDN P I + Y+      T          L+EN      +A ++V+DKD +        N  + C  D H     LR   S   + F L      D E T +Y  +L+  D+    L+ S    I + D NDN P+F      ++   + SI E  + G  +++V ATD D G NA I Y L   +  +FS+D  +G L  +   D EK +K+  TI A +  +    S +      + V+I D ND  PVF  + Y F V E                    ++ +     +++P    D  D+   T S  D +  F I  +TG+I  N+   DREK  S++F ++A D      SS+A V I ++DVNDN P+++ P  +NY    SY+  +     G  +  + A D D G N +V Y IV                           N  ++F +D  TGNI + +K  ++D+G  ++ V+A+D G P
Sbjct:   43 GAQEKNYTIREEIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKT-GDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRD--EHC---FYEVEVAILPDEIFR-------LVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVG-INGVQNYELIKSQNI---FGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDT--------VVLSENIPLNTKIALITVTDKDADH-------NGRVTCFTD-HEIPFRLRPVFS---NQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVF------TQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNV-----TVFVSIIDQNDNSPVFTHNEYKFYVPEN-----------------LPRHGTVGLITVTDP----DYGDNSAVTLSILDENDDFTIDSQTGVIRPNIS-FDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVP-PYNY----SYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGG-------------------------NTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 780          

HSP 2 Score: 65.4698 bits (158), Expect = 6.958e-10
Identity = 50/172 (29.07%), Postives = 82/172 (47.67%), Query Frame = 1
Query: 2482 LDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            LDRE+  ++  K++  D      SSTAI+Q+ + D NDN P  VF  T   EV++     +G  +  L A D D+G+N K+          FSF             S+ +      +F L+ +TG I I + +   +  + K+ V ASD G  P + +  + +N+ +V+ N
Sbjct:  228 LDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHP--VFKETE-IEVSIPENAPVGTSVTQLHATDADIGENAKIH---------FSF-------------SNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAM--VLVNVTDVNDN 372          
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 237.654 bits (605), Expect = 2.153e-63
Identity = 245/837 (29.27%), Postives = 388/837 (46.36%), Query Frame = 1
Query:  481 GQIEIHFKVVEESPTNSVIGNIH---NQALKQKGGVGSGDYY---YKSITDIEPFFLDSKTYE-FRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYK-ISYQSVNDGFKLKHSGRDHYEKL-SLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGK-HSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRI-GETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAI-----GYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTP 2943
            G  E ++ + EE P N +IGN+    N +L     + +   +   YK+  D+    ++  T E F    R+DRE++C    ++  ++C   +  ++  I+ DE  +       ++ +   I DINDN+P + +  I +S+PE+S I ++ TLP A+DPD    N  Q Y+ I  Q++   F L        +K+  LIV K+ DRE++ T  +K+K  DG     S    + +S+TD ND  P FK+T I   I EN P+ + + QL A D D  +  K+ F F N V    R  F++N  TG I     +D E    + + V+ +DG     +A + + V +VNDN P I + Y+      T          L+EN      +A ++V+DKD +        N  + C  D H     LR   S   + F L      D E T +Y  +L+  D+    L+ S    I + D NDN P+F      ++   + SI E  + G  +++V ATD D G NA I Y L   +  +FS+D  +G L  +   D EK +K+  TI A +  +    S +      + V+I D ND  PVF  + Y F V E                    ++ +     +++P    D  D+   T S  D +  F I  +TG+I  N+   DREK  S++F ++A D      SS+A V I ++DVNDN P+++ P  +NY    SY+  +     G  +  + A D D G N +V Y IV                           N  ++F +D  TGNI + +K  ++D+G  ++ V+A+D G P
Sbjct:   43 GAQEKNYTIREEIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKT-GDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRD--EHC---FYEVEVAILPDEIFR-------LVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVG-INGVQNYELIKSQNI---FGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDT--------VVLSENIPLNTKIALITVTDKDADH-------NGRVTCFTD-HEIPFRLRPVFS---NQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVF------TQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNV-----TVFVSIIDQNDNSPVFTHNEYKFYVPEN-----------------LPRHGTVGLITVTDP----DYGDNSAVTLSILDENDDFTIDSQTGVIRPNIS-FDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVP-PYNY----SYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGG-------------------------NTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 780          

HSP 2 Score: 65.4698 bits (158), Expect = 6.958e-10
Identity = 50/172 (29.07%), Postives = 82/172 (47.67%), Query Frame = 1
Query: 2482 LDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            LDRE+  ++  K++  D      SSTAI+Q+ + D NDN P  VF  T   EV++     +G  +  L A D D+G+N K+          FSF             S+ +      +F L+ +TG I I + +   +  + K+ V ASD G  P + +  + +N+ +V+ N
Sbjct:  228 LDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHP--VFKETE-IEVSIPENAPVGTSVTQLHATDADIGENAKIH---------FSF-------------SNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAM--VLVNVTDVNDN 372          
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 237.269 bits (604), Expect = 2.406e-63
Identity = 245/837 (29.27%), Postives = 388/837 (46.36%), Query Frame = 1
Query:  481 GQIEIHFKVVEESPTNSVIGNIH---NQALKQKGGVGSGDYY---YKSITDIEPFFLDSKTYE-FRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYK-ISYQSVNDGFKLKHSGRDHYEKL-SLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGK-HSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRI-GETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAI-----GYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTP 2943
            G  E ++ + EE P N +IGN+    N +L     + +   +   YK+  D+    ++  T E F    R+DRE++C    ++  ++C   +  ++  I+ DE  +       ++ +   I DINDN+P + +  I +S+PE+S I ++ TLP A+DPD    N  Q Y+ I  Q++   F L        +K+  LIV K+ DRE++ T  +K+K  DG     S    + +S+TD ND  P FK+T I   I EN P+ + + QL A D D  +  K+ F F N V    R  F++N  TG I     +D E    + + V+ +DG     +A + + V +VNDN P I + Y+      T          L+EN      +A ++V+DKD +        N  + C  D H     LR   S   + F L      D E T +Y  +L+  D+    L+ S    I + D NDN P+F      ++   + SI E  + G  +++V ATD D G NA I Y L   +  +FS+D  +G L  +   D EK +K+  TI A +  +    S +      + V+I D ND  PVF  + Y F V E                    ++ +     +++P    D  D+   T S  D +  F I  +TG+I  N+   DREK  S++F ++A D      SS+A V I ++DVNDN P+++ P  +NY    SY+  +     G  +  + A D D G N +V Y IV                           N  ++F +D  TGNI + +K  ++D+G  ++ V+A+D G P
Sbjct:   54 GAQEKNYTIREEIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKT-GDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRD--EHC---FYEVEVAILPDEIFR-------LVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVG-INGVQNYELIKSQNI---FGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDT--------VVLSENIPLNTKIALITVTDKDADH-------NGRVTCFTD-HEIPFRLRPVFS---NQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVF------TQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNV-----TVFVSIIDQNDNSPVFTHNEYKFYVPEN-----------------LPRHGTVGLITVTDP----DYGDNSAVTLSILDENDDFTIDSQTGVIRPNIS-FDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVP-PYNY----SYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGG-------------------------NTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 791          

HSP 2 Score: 65.4698 bits (158), Expect = 7.537e-10
Identity = 53/172 (30.81%), Postives = 85/172 (49.42%), Query Frame = 1
Query: 2482 LDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            LDRE+  ++  K++  D      SSTAI+Q+ + D NDN P  VF  T   EV++     +G  +  L A D D+G+N K+          FSF+      NL     S+I      +F L+ +TG I I + +   +  + K+ V ASD G  P + +  + +N+ +V+ N
Sbjct:  239 LDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHP--VFKETE-IEVSIPENAPVGTSVTQLHATDADIGENAKIH---------FSFS------NL----VSNIA---RRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAM--VLVNVTDVNDN 383          
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 237.269 bits (604), Expect = 2.520e-63
Identity = 245/837 (29.27%), Postives = 388/837 (46.36%), Query Frame = 1
Query:  481 GQIEIHFKVVEESPTNSVIGNIH---NQALKQKGGVGSGDYY---YKSITDIEPFFLDSKTYE-FRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYK-ISYQSVNDGFKLKHSGRDHYEKL-SLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGK-HSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRI-GETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAI-----GYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTP 2943
            G  E ++ + EE P N +IGN+    N +L     + +   +   YK+  D+    ++  T E F    R+DRE++C    ++  ++C   +  ++  I+ DE  +       ++ +   I DINDN+P + +  I +S+PE+S I ++ TLP A+DPD    N  Q Y+ I  Q++   F L        +K+  LIV K+ DRE++ T  +K+K  DG     S    + +S+TD ND  P FK+T I   I EN P+ + + QL A D D  +  K+ F F N V    R  F++N  TG I     +D E    + + V+ +DG     +A + + V +VNDN P I + Y+      T          L+EN      +A ++V+DKD +        N  + C  D H     LR   S   + F L      D E T +Y  +L+  D+    L+ S    I + D NDN P+F      ++   + SI E  + G  +++V ATD D G NA I Y L   +  +FS+D  +G L  +   D EK +K+  TI A +  +    S +      + V+I D ND  PVF  + Y F V E                    ++ +     +++P    D  D+   T S  D +  F I  +TG+I  N+   DREK  S++F ++A D      SS+A V I ++DVNDN P+++ P  +NY    SY+  +     G  +  + A D D G N +V Y IV                           N  ++F +D  TGNI + +K  ++D+G  ++ V+A+D G P
Sbjct:   54 GAQEKNYTIREEIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKT-GDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRD--EHC---FYEVEVAILPDEIFR-------LVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVG-INGVQNYELIKSQNI---FGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDT--------VVLSENIPLNTKIALITVTDKDADH-------NGRVTCFTD-HEIPFRLRPVFS---NQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVF------TQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNV-----TVFVSIIDQNDNSPVFTHNEYKFYVPEN-----------------LPRHGTVGLITVTDP----DYGDNSAVTLSILDENDDFTIDSQTGVIRPNIS-FDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVP-PYNY----SYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGG-------------------------NTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 791          

HSP 2 Score: 65.4698 bits (158), Expect = 7.175e-10
Identity = 53/172 (30.81%), Postives = 85/172 (49.42%), Query Frame = 1
Query: 2482 LDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            LDRE+  ++  K++  D      SSTAI+Q+ + D NDN P  VF  T   EV++     +G  +  L A D D+G+N K+          FSF+      NL     S+I      +F L+ +TG I I + +   +  + K+ V ASD G  P + +  + +N+ +V+ N
Sbjct:  239 LDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHP--VFKETE-IEVSIPENAPVGTSVTQLHATDADIGENAKIH---------FSFS------NL----VSNIA---RRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAM--VLVNVTDVNDN 383          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 137.502 bits (345), Expect = 4.666e-32
Identity = 153/654 (23.39%), Postives = 263/654 (40.21%), Query Frame = 1
Query: 1054 KDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDG---KHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDR--EETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTV-KEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            K  DRE      +K+ A++     +S    + + + D+ D  P F+K S    I E+ P+ + +L + A+D D  +  ++ +      +   +N   IN  +G I TA  +D E  S   + VI +D    K    A + I V +VNDN P  +              S  Y   + EN     V+A++  +D+D+ +    N   H           S+        L   +      + +R   + S   A +   D    +LS++V   I++ D+ND+ P         + I   +++E VAIG  + +V A D D G N II+YS++   S  F ID  SG ++   + D E   ++ L + A +       +  L T   I V ++D+ND  P F+K  Y  T+ +E P     +                   K + N     D   +     ++ +      IG+ G I   + V    K      +++ +   +  L    +V + I DVN  P    + N H + V +     IGY +  LKA D D GDN ++ Y I  S F                            F +D S+G+I ++  +   D  +  + V ASD  +PP     ++ + + +++ N
Sbjct:  226 KSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLG---EGNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFA--------------SDSYNVTILENITIPAVIATVKATDEDFGT----NGKVHY----------SMASSSGIGGLTIDYSTGEVTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTL---IAAQKMI---TLEENVAIGEEVGRVYAIDEDSGPNGIIKYSME--GSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARD-----MGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIIT-----------------LKAVDNDE---DQKITYRIEEADREVFSILDIGDQGAI---LSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVNSAP----YFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQF----------------------------FRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDN 780          

HSP 2 Score: 131.724 bits (330), Expect = 2.144e-30
Identity = 158/636 (24.84%), Postives = 262/636 (41.19%), Query Frame = 1
Query: 1072 KQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTD-GKHSDQATLTIEV--KNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKD------YESKRLGNQMNHLLDCRIDPHRESL--ELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTN--SNSDASQYFRIGET-GLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTE-------SSDIKFNRHEMFDLDGSTGNI--YIAQKMKLSDVGSKK 2910
            K + ++  ++A DG    LS  + + I++ DIND  P          + EN+ +   + ++ A DED      +++  + S D      F I+  +G I T   +D E  + Y++ V   D G  S   + TI V  K++NDN P                   +Y   ++E    G  + +L   D D      Y  +    ++  +LD        S+  EL+R   K+             R E S          +D   L       + I DVN  P   + PF       S  I E   IG  ++ +KA D D G+NA I YS+DS  S  F IDP SG++      D E    F + + AS+       S  L T  +I V ++D+ND  P F    Y  T+ E                       +++ ++ +   DI  +     + N  S+S + Q FR+  T G + V+   LDRE+ +     I A DR    LS+ + + + + DVNDN P +      +Y++ ++    +G  +  + A D D GDN  +++RI   +    F+  E+++   V           + K N+   F+L  S+G +   +  ++ +SDV   K
Sbjct:  441 KNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED------FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFD--------------KKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKV-------------RVEISA---------TDQGGLQGRCVVNVFIDDVNSAPYFNDHPF-------SVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDS--SQFFRIDPSSGDISVSSDLDREDRATFSVIVTASD-----HASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISE------------------DIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSK-LDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTF---EQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKF-FFELQASSGQLSSTVPVRIHVSDVNDNK 997          

HSP 3 Score: 131.339 bits (329), Expect = 3.299e-30
Identity = 176/640 (27.50%), Postives = 262/640 (40.94%), Query Frame = 1
Query:  841 SPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPL--TGEILTAGYIDYEIKSE---YTIPVIVTD-GKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDY-ESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQ----FSIDPISGELRNIDVFDYEKMEKFELTINASNPIIER-KNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDR------EKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDN-PPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPD 2703
            +P   +    ++L E+  IG E+    A+D D  P N   KY  S +   D    + SG     KL        DRE  A  S+K+ A D     L+    I + L DIND  P F K   +  I+E +P  S I+ L+A D DE  +   R E      E  R  F I  +   G IL+   +  E+K +     + +  TD G    +  + + + +VN      S  Y +   F            + E+   G+ V +L   D D  ++ R+   ++     RIDP    + +                   DRE+ + +   +   D  S  L+TS   E+ + D+NDN P F      +   ++ +I E + +GT+ +QV A D DIG N I+ Y L+  SS+     F +D  SG LR     D E+     L      PI  R + +  L    +IT+ + DVND  P FE+  Y   + E                   S   S    I++   D  D++D        +DA + F I E    +  V +L R       K + F F++QA   S   LSST  V+I + DVNDN P L  F    N   NV     IG+    + A DPD
Sbjct:  476 APTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGP-NGIIKY--SMEGSEDFIIDEDSGLIKTTKL-------LDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIE------EADREVFSILDIGDQGAILS---VSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVN------SAPYFNDHPFSVK---------IPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRIDPSSGDISVSSD---------------LDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQF------TSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVL------PIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAEN------------------SPVGSTVGTIVARDADEGDNADISFRIFGGADA-KLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQA---SSGQLSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGF----IPAFDPD 1028          

HSP 4 Score: 103.605 bits (257), Expect = 7.854e-22
Identity = 130/525 (24.76%), Postives = 222/525 (42.29%), Query Frame = 1
Query: 1183 HFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIV---TDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSST-QFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQ--LLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGE-TGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRI 2736
            HF++    K + E+ P+ + I  ++A     +    L +      D   +N F ++ ++GEI  A  +D E+  ++ + V      D   S   T+ + V +V DN+P                    Y   + E+   G  V  LSV  +D +S   G ++ + L    + + ++L    ++S +I      T    DRE  S     +I  D  +    ++   EI++ DVNDN P+F      +   ++ +I E + I   I  VKATD D G N  + YS+ S S     +ID  +GE     V   E+++     I A   +I  K+     L +   +T+N+ D+ND  P         T++E                      N    + +   + I + S        + + S+ F I E +GLI     +LDRE  + +S K+ A D     L+++  + + + D+NDN P +   +   Y V +S +   G  I  LKA D D  ++ K+TYRI
Sbjct:  164 HFQQEKYVKELPEDTPIETIIASVKAS---HASSQPLYYSMVAPQDSRSQNLFTLDTMSGEIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIF--------------EKDSYFGEIREDAPIGTTV--LSVFARDLDSGENG-EIEYSLG---EGNGKNLLAINAKSGVIQ-----TAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVF------ASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGE-----VTLRERIDAKNSPITA---VIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEE----------------------NVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDSGLIK-TTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTF---DKKEYNVTISEEMPRGSQIITLKAVDND--EDQKITYRI 618          

HSP 5 Score: 87.8113 bits (216), Expect = 5.358e-17
Identity = 82/295 (27.80%), Postives = 134/295 (45.42%), Query Frame = 1
Query: 1879 NPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSL----DSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRI-GETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSS 2748
            NP    V FQ  + +    + E   I T I  VKA+     ++  + YS+    DS S   F++D +SGE+R     D E ++K  L + A     ER +  +  +   + V++ DV D  P+FEKD Y   ++E                   +   +    + +   D  ++ + + Y+    +      I  ++G+I    P LDRE +S     + A+D+      STA+V+I ++DVNDN P++    + +Y V +     I   IA +KA D D G NGKV Y +  SS
Sbjct:  157 NPDANAVHFQQEKYVKE--LPEDTPIETIIASVKASH---ASSQPLYYSMVAPQDSRSQNLFTLDTMSGEIRLAKSMDREVLDKHILKVTA----YERVDPTISAS-TTVVVHVLDVQDNSPIFEKDSYFGEIRE------------------DAPIGTTVLSVFARDLDSGENGEIE-YSLGEGNGKNLLAINAKSGVIQTAAP-LDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFA---SDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSS 418          

HSP 6 Score: 54.299 bits (129), Expect = 7.871e-7
Identity = 39/173 (22.54%), Postives = 75/173 (43.35%), Query Frame = 1
Query: 2482 LDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNG 3000
            +DRE +     K+ A +R +  +S++  V + +LDV DN P++      +Y   +     IG  + ++ A D D G+NG++ Y +                            N   +  ++  +G I  A  +    +   ++ V ASD+GTP ++    + I +V+V+ N 
Sbjct:  228 MDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIF---EKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEG-------------------------NGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNA 372          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 131.724 bits (330), Expect = 2.401e-30
Identity = 158/636 (24.84%), Postives = 262/636 (41.19%), Query Frame = 1
Query: 1072 KQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTD-GKHSDQATLTIEV--KNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKD------YESKRLGNQMNHLLDCRIDPHRESL--ELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTN--SNSDASQYFRIGET-GLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTE-------SSDIKFNRHEMFDLDGSTGNI--YIAQKMKLSDVGSKK 2910
            K + ++  ++A DG    LS  + + I++ DIND  P          + EN+ +   + ++ A DED      +++  + S D      F I+  +G I T   +D E  + Y++ V   D G  S   + TI V  K++NDN P                   +Y   ++E    G  + +L   D D      Y  +    ++  +LD        S+  EL+R   K+             R E S          +D   L       + I DVN  P   + PF       S  I E   IG  ++ +KA D D G+NA I YS+DS  S  F IDP SG++      D E    F + + AS+       S  L T  +I V ++D+ND  P F    Y  T+ E                       +++ ++ +   DI  +     + N  S+S + Q FR+  T G + V+   LDRE+ +     I A DR    LS+ + + + + DVNDN P +      +Y++ ++    +G  +  + A D D GDN  +++RI   +    F+  E+++   V           + K N+   F+L  S+G +   +  ++ +SDV   K
Sbjct:   82 KNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED------FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFD--------------KKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKV-------------RVEISA---------TDQGGLQGRCVVNVFIDDVNSAPYFNDHPF-------SVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDS--SQFFRIDPSSGDISVSSDLDREDRATFSVIVTASD-----HASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISE------------------DIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSK-LDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTF---EQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKF-FFELQASSGQLSSTVPVRIHVSDVNDNK 638          

HSP 2 Score: 131.339 bits (329), Expect = 2.612e-30
Identity = 176/640 (27.50%), Postives = 262/640 (40.94%), Query Frame = 1
Query:  841 SPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPL--TGEILTAGYIDYEIKSE---YTIPVIVTD-GKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDY-ESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQ----FSIDPISGELRNIDVFDYEKMEKFELTINASNPIIER-KNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDR------EKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDN-PPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPD 2703
            +P   +    ++L E+  IG E+    A+D D  P N   KY  S +   D    + SG     KL        DRE  A  S+K+ A D     L+    I + L DIND  P F K   +  I+E +P  S I+ L+A D DE  +   R E      E  R  F I  +   G IL+   +  E+K +     + +  TD G    +  + + + +VN      S  Y +   F            + E+   G+ V +L   D D  ++ R+   ++     RIDP    + +                   DRE+ + +   +   D  S  L+TS   E+ + D+NDN P F      +   ++ +I E + +GT+ +QV A D DIG N I+ Y L+  SS+     F +D  SG LR     D E+     L      PI  R + +  L    +IT+ + DVND  P FE+  Y   + E                   S   S    I++   D  D++D        +DA + F I E    +  V +L R       K + F F++QA   S   LSST  V+I + DVNDN P L  F    N   NV     IG+    + A DPD
Sbjct:  117 APTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGP-NGIIKY--SMEGSEDFIIDEDSGLIKTTKL-------LDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIE------EADREVFSILDIGDQGAILS---VSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVN------SAPYFNDHPFSVK---------IPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRIDPSSGDISVSSD---------------LDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQF------TSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVL------PIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAEN------------------SPVGSTVGTIVARDADEGDNADISFRIFGGADA-KLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQA---SSGQLSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGF----IPAFDPD 669          

HSP 3 Score: 99.7525 bits (247), Expect = 1.169e-20
Identity = 95/395 (24.05%), Postives = 162/395 (41.01%), Query Frame = 1
Query: 1813 DSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            D    +LS++V   I++ D+ND+ P         + I   +++E VAIG  + +V A D D G N II+YS++   S  F ID  SG ++   + D E   ++ L + A +       +  L T   I V ++D+ND  P F+K  Y  T+ E   +   +                   K + N  D      +     ++ +      IG+ G I   + V    K      +++ +   +  L    +V + I DVN  P    + N H + V +     IGY +  LKA D D GDN ++ Y I  S F                            F +D S+G+I ++  +   D  +  + V ASD  +PP     ++ + + +++ N
Sbjct:   94 DGAQPALSSTVPLTINVIDINDHAPTL---IAAQKMI---TLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEG--SEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARD-----MGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIIT----------------LKAVDNDED---QKITYRIEEADREVFSILDIGDQGAI---LSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVNSAP----YFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQF----------------------------FRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDN 421          

HSP 4 Score: 82.0333 bits (201), Expect = 3.114e-15
Identity = 83/299 (27.76%), Postives = 133/299 (44.48%), Query Frame = 1
Query: 1852 EISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSST-QFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQ--LLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGE-TGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRI 2736
            EI++ DVNDN P+F      +   ++ +I E + I   I  VKATD D G N  + YS+ S S     +ID  +GE     V   E+++     I A   +I  K+     L +   +T+N+ D+ND  P         T++E                      N    + +   + I + S        + + S+ F I E +GLI     +LDRE  + +S K+ A D     L+++  + + + D+NDN P +   +   Y V +S +   G  I  LKA D D  ++ K+TYRI
Sbjct:    3 EITVVDVNDNAPVF------ASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGE-----VTLRERIDAKNSPITA---VIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEE----------------------NVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDSGLIK-TTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTF---DKKEYNVTISEEMPRGSQIITLKAVDND--EDQKITYRI 259          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 130.183 bits (326), Expect = 7.188e-30
Identity = 166/652 (25.46%), Postives = 262/652 (40.18%), Query Frame = 1
Query: 1039 SLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRS-SQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYS-LDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGE-TGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPP--LWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINI 2979
            ++ + K FD EKQ +    + A +   N  +    I+I L D+ND  P F     H  + E      P+L + A D D     ++ +     + E+  + F INP+TGE+     +    +  + + V   DG               N  N  I+V+     + KTP  S S+Y     E+  PG  + S+    K   S   G+Q ++     ID                D  ++  T+  D +        +        S  T V   I I D NDNPP F      S  +   SI+E + +      V+A+D+D   N  +RYS + S   +   ID  +G+L    + DYE    ++L + A++  I  ++S +      + +++ DVND  P FEK  YT  V E       VG                  K+++      DS ++       ++ S+YF I E  G ++    + DRE IS     I A D+   P SSTA  +I +LDVNDNPP  L + P      + V     +   I  + A DPD G NG V YR    S  F   +N                            G++Y+ +++  SD   +++ V  SDQG P +  +  + + I
Sbjct:  594 TVCIQKTFDFEKQKSYQTTVIATNA--NSETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHI---LSES--SSFSINPVTGEVFAQKPL---ARGRFHLVVSAKDGGGQSSE---------NSANIHITVI---DKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAMSKVKYSIYSGDQDHNF---SIDE---------------DTGKIYVTRYLDADVHDTVLLNIQATLPSGESNQTQVV--IFIEDHNDNPPQF------SSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNM-----TLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVG------------------KVVARDK---DSLENGQIVYRITNGSEYFGIDEKLGNVYTKRSI-DREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSITP------IVVPAGSPLSTAIGTIVAMDPDKGLNGSVLYRAQLQSSLFVVKSN----------------------------GDVYLRRQLNASDERHQRLSVIVSDQGVPRKSVVCHVPVRI 1136          

HSP 2 Score: 114.775 bits (286), Expect = 3.631e-25
Identity = 155/651 (23.81%), Postives = 279/651 (42.86%), Query Frame = 1
Query:  841 SPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKH-----SDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSD--KDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIH-SYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGE-TGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFN 2766
            +P ++   + L + E +++GT   LP   D D P  +   ++ I   +VN+ FKL     +   +  L+VN   DRE +    + ++A DG      GQL  +I + D ND  P F ++     ++ NI + S ++ ++A D D  +  ++ ++   +   +  N F I+  +G I T       +    T  VIV    H     S  A +TI V     ++P + +++L  SN           A+L EN   G +VA +S++   +D + + +G                S  L   Q+     + L+   + DRE  S++  + +  + D   +       ++I D+NDN P +      S  IH S +  +G +   T     A D D+G N  IRYS+  L +   SID  +G +   +  D     + +  + A     E   S  L T  ++  ++ D     P FEK L+   + E                   +   +   K+++N     +S   + Y+  N D  ++  +   +G + +     D EK  S+   + A + + +  +ST+++ I++ DVNDN P++ +PN   Y + V         +  + A+D D G  G+V+Y I+  S  FS N
Sbjct:  119 APSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDV-HRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSN-FAISQ-SGVITTTA----SLLPASTHDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESN----------SAHLMENSTLGSIVARVSIAQQYRDTKLRLIG----------------SSALCPQQTDQAHVYLLLLCGILDRETASEHHLKFL-LEKDGQIIIEHPQL-LTIGDINDNAPQWH-----SSQIHISLNRTQGGSRTLT-----AKDPDLGQNGWIRYSV--LDTELVSIDKETGRIFVPNTIDCNIGSEIKFRVRA-----EDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPE------------------DTPIGTCLVKVVANNSQCGNSKRIR-YSLQNQD--EHLTVDTMSGTVCIQ-KTFDFEKQKSYQTTVIATNANSE--TSTSLISIRLKDVNDNWPIF-YPN--EYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSSFSIN 690          

HSP 3 Score: 103.99 bits (258), Expect = 6.727e-22
Identity = 165/725 (22.76%), Postives = 275/725 (37.93%), Query Frame = 1
Query:  841 SPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKL--KHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATL-TIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLST--SVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQ-FSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            +P+W S  I++SL  +   G   TL  A DPD       Q   I Y  ++       K +GR       + V    D    + +  +++A DG    LS  L +   L D   K P F+K      I E+ P+ + ++++ A +    +  ++R+   N  DE       ++ ++G +      D+E +  Y   VI T+       +L +I +K+VNDN P   + Y            ++Y   + E   P   +  +S SD D  S   G    H+L               S S  I+    +T ++F ++  ++    L+    D    S+  S    I++ D +   P F      SR  +     E +  G  I  V A  +       ++YS+ S      FSID  +G++      D +  +   L I A+ P  E   +Q       + + IED ND  P F   L   +++E          V   D D        Y  I S+P              S+ +  Q+     TG       +LD E   ++  +++A D    P SS   + I +LDVNDN P +       Y + V         +  + A D D  +NG++ YRI                            N  E F +D   GN+Y  + +    +    I + A D+G PP+       I++++V+ N
Sbjct:  438 APQWHSSQIHISL--NRTQGGSRTL-TAKDPD-----LGQNGWIRYSVLDTELVSIDKETGR-------IFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQ-DE----HLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNANSETSTSLISIRLKDVNDNWP---IFY-----------PNEYHLTVREGPKPEEPLLVVSASDMD--SGTFGEVSYHILS-------------ESSSFSINP---VTGEVFAQKPLARGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQF------SRSKYEIRTTEDILPGIAIGSVGAMSK-------VKYSIYSGDQDHNFSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSGESNQTQ-------VVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHP-------------GSSIEIDQFTGQLSTG------SLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEF---EKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRIT---------------------------NGSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDN 1041          

HSP 4 Score: 65.0846 bits (157), Expect = 4.123e-10
Identity = 121/554 (21.84%), Postives = 214/554 (38.63%), Query Frame = 1
Query: 1360 GEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQL-------ITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVP-FQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKM-----EKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDC-LPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINI 2979
            G I T   +D EI   Y++ VI T         + + V N+NDN P   +          P R       + EN   G  VA++   D D                 + P R  L +  S  +   HF +         T   D E   ++   +   D    S  T     I ++D+NDN P F  P +Q +    ++S       G    +++A D D      + YSL   SS+ F + P SG L       + K+     E++ +T+ A++  +   ++ +      ++V I +      P FEK  + F V E                      NS     I N     + S    Y   + +AS+ F I + G + V  P+ DRE+ ++  F+++  +             + +LD NDN P++    +  Y +++    A G  I  + A+D D G+NG+V+YRI+  +       N ++ ++++ E +D + +                          + +I VEA D G P +  + ++ +++
Sbjct: 1880 GVIRTNLELDREILERYSLKVIGTGSGQQIGTRVDVRVNNLNDNVPSFPM--------SKPRR-------VPENLRVGSYVATVGAKDVD----------------NLAPLRYFL-VSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATD---GSFDTFTNLTIFVSDINDNAPTFSKPLYQTTVSPATFSP------GQPFAKIEAHDLD--ARGALTYSLGQGSSSIFRVAPESGAL-------FMKVLPPAGERYLVTVTATDNGVPSFSTSV-----PVSVIIGEAEPTDKPGFEKAEFRFEVME----------------------NSKIGLQIGNLSG--EESREFHYRIQDPEASKIFSIDKFGRLFVAGPI-DREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVF---TSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTLNPDTGSIQLNEWNDAQLDEFPN---------------------ATWQILVEARDHGHPARAAVGKVQVSL 2329          

HSP 5 Score: 63.5438 bits (153), Expect = 1.386e-9
Identity = 63/244 (25.82%), Postives = 104/244 (42.62%), Query Frame = 1
Query: 1318 DETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEIS--VLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSS 2043
            DE       ++  +GEI T  ++DYE +S++ I V V   +  +   + +EV + NDN P  +  V+ L  S F   G S      + +   P F V    +         L   +N++           L  R+   +L     L+     DRE   +Y   +   D    +    +   I I D NDN P+F      SR  ++ S+   ++IG+ ++ V+ATD DIG N+ I Y +   S+
Sbjct:   62 DEQTSKFLKVDERSGEISTIAHLDYEKRSKFDI-VAVKVEESGETIDILVEVDDENDNAPSFADQVVKLEISEFAQLGTSFAL-PTVTDGDGPKFDVHRFVI---------LQGNVNNVF---------KLASRKVNEQL--QADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVF------SRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSA 277          

HSP 6 Score: 57.7658 bits (138), Expect = 8.579e-8
Identity = 119/561 (21.21%), Postives = 213/561 (37.97%), Query Frame = 1
Query: 1051 NKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENK-DPGFVVASLSVSDKDYESK---RLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDV--NDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSL-DSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNV---PVLDREKISSFSFKIQAADRSEKPLSSTAIVQI--QILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKAND 2697
            N + DRE     S+K+    G    +  ++D+ ++  ++ND  P F  +   ++  EN+ + S +  + AKD D  +   LR+   +         F I+  TG I     +D+E+  E+T+ +  TDG       LTI V ++NDN P           F  P     Y+  ++     PG   A +   D D        LG   + +   R+ P   +L            F  +     +R     Y   +   D+   S STSV   + I +    D P   +  F+       + + E   IG  I  +   +     +    Y + D  +S  FSID   G L      D E+    E  +   N ++  +  Q      K  V + D ND LPVF    Y  ++K+                     +     +I+++  D  ++        S +D +      +TG I +N      LD    +++   ++A D      ++   VQ+  ++   + + P +V P    YEV+V    ++G  +  ++A++
Sbjct: 1885 NLELDREILERYSLKVIG-TGSGQQIGTRVDVRVN--NLNDNVPSFPMSKPRRV-PENLRVGSYVATVGAKDVD--NLAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDGSFDTFTNLTIFVSDINDNAP----------TFSKP----LYQTTVSPATFSPGQPFAKIEAHDLDARGALTYSLGQGSSSIF--RVAPESGAL------------FMKVLPPAGER-----YLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFR-------FEVMENSKIGLQIGNLSGEE-----SREFHYRIQDPEASKIFSIDKF-GRLFVAGPIDREQRATHEFQVEIDNEMMTSQKVQC-----KCHVIVLDENDNLPVFTSVAYYLSLKDS------------------MAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLP---VYEVHVLEDTSVGTVLQKIRASN 2367          

HSP 7 Score: 57.3806 bits (137), Expect = 1.007e-7
Identity = 54/183 (29.51%), Postives = 87/183 (47.54%), Query Frame = 1
Query: 1732 IDHFQLITTKM-FDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSS----TQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTV 2265
            +D   +I T +  DRE   +Y  ++I   S    + T V  ++ + ++NDN P F  P    R      + E + +G+ +  V A  +D+ N A +RY L S SS    T F+ID  +G +      D+E + +  LTI A++   +        T   +T+ + D+ND  P F K LY  TV
Sbjct: 1876 VDSEGVIRTNLELDREILERYSLKVIGTGS-GQQIGTRV--DVRVNNLNDNVPSF--PMSKPR-----RVPENLRVGSYVATVGA--KDVDNLAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDGSFD--------TFTNLTIFVSDINDNAPTFSKPLYQTTV 2038          

HSP 8 Score: 56.225 bits (134), Expect = 2.025e-7
Identity = 77/340 (22.65%), Postives = 138/340 (40.59%), Query Frame = 1
Query: 1930 YSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKII-SNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPP 2946
            +++ E   IGT I  +     +           D  +S    +D  SGE+  I   DYEK  KF+        I+  K  +   T+  I V ++D ND  P F   +    + E  ++      +    D    K++ + F I+  N ++++  +  ++     +D            + VN   LDRE    +   I+A D  +          I+I+D NDN P++   +   Y  +VS   +IG  +  ++A D D+G+N +++Y I  +S P + N       +  T +S +  + H++  +    G+        LS      I V  S   +PP
Sbjct:   29 FTVPESAQIGTRIGWISGKREESAAPKYFVVFPDEQTSKFLKVDERSGEISTIAHLDYEKRSKFD--------IVAVKVEESGETID-ILVEVDDENDNAPSFADQVVKLEISEF-AQLGTSFALPTVTDGDGPKFDVHRFVILQGNVNNVFKLASRKVNEQLQAD------------LVVN-GQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVF---SRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAISQSGVITTTASLLPASTHDVIVVASDHGS------PSLSSSAVVTITVLGSTLSSPP 336          

HSP 9 Score: 51.2174 bits (121), Expect = 7.881e-6
Identity = 90/422 (21.33%), Postives = 163/422 (38.63%), Query Frame = 1
Query:  964 YKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEI----KSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSN--FKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKL---IDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITV 2202
            Y+I     +  F +   GR       L V    DRE++AT   +++  +        Q   ++ + D ND  P F   + +  + +++     I Q+ A D+D  +  ++ +   +  D    N   +NP TG I    + D ++     + + I V   D  H  +A        V      + +   SGS   F  P     Y  ++ E+   G V+  +  S+      RLG + + LL            L+  Q KL   +   +L      D E  S+    +    SD N  S  V  +I +  V++  P+F      ++  ++  I      G ++ Q++A D D G + +++YS+    ST                    K+E+    I    P++ R+N     T+++ITV
Sbjct: 2163 YRIQDPEASKIFSIDKFGR-------LFVAGPIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGND---LNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAA-------VGKVQVSLKMSSWSGSAPFFVLP----VYEVHVLEDTSVGTVLQKIRASN------RLGMRNDGLL----------YSLKEHQGKLGIDVKTGELTLKTHLDWE--SEPIISMYLSVSDGNGRSAVVPLKIVVEPVDEFAPVF------TKSSYTLQIPISTPAGESVGQMQAIDEDGGVHGVVKYSISDRQSTV-------------------KIEEHTGIIRLQKPLVSRRN----LTIEQITV 2516          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 108.612 bits (270), Expect = 2.826e-23
Identity = 177/771 (22.96%), Postives = 315/771 (40.86%), Query Frame = 1
Query:  841 SPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSL--IVNKDFDREKQAT----VSVKLKAF--------DGDPNPLSGQLDINISLTDINDKQPHFKKTSIHK---IINENIPLRSPILQLEAKDEDESDQHKLRFEF------DNSVDETVR--NRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTD--GKHSDQATLTIEVKNVNDNNPEISVLYLSGS--NFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHF--QLITTKMFDREETSQYFAQLICFDSDSNSLSTS-------VTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQ--FSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPH----DIYDSSDSQMYTNSNSDASQYFRIGE-TGLIHVNVPVLDRE---KISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKK---IWVEASDQGTPPQKKIERLHINIVNVDGNG 3000
            SP++  P    S+     +GT +    A D D          +I+Y    D      +G +H   L    +VN+   R  + T    + +K + F        +G P  L     + +++ D   K P ++ +   K    ++EN+ L   IL+  A    +S    + ++        N  +   R  N+F       E++    +DYE  + YT+ +  TD   + +   T  +EV++VND  P+ +V   +G+     TP    +        K  G  + ++   D D +  +  N++++    RI       E +  +   ID    ++   + FDRE+   Y   +   D   ++L  +       V  +I I DVNDN P FE      R      +KE    G  ++ +KA D D  +N  +RY L      +  F +   SG +   +  D+E  +++ L + AS+    R N+        + ++IEDVND  P FE+  Y  TV E                      + +  K++ N H    D  + S   +Y      A + FRIG+ +G I + V  LDR+    + S++F +QA D     L   A VQ+ + D+NDN P  +FP           +   GY    ++ N   +  +G     +    F    +   E+ N+E     +   N   +F +D +TG I+  + +   ++ S++   I V A+D+G P ++    + I + +++ N 
Sbjct:  976 SPQFERPSYETSVSRFEAVGTSVITVFAFDND-----AAHNAEITYSLEID----TTAGEEHQNDLDFFELVNR---RSGEITLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLE--------KTNGKPIVTVKAIDTDSDGPQ--NEVHY----RIVGEANGEETKHFR---IDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGR------VKESEGEGHDVITIKAHDLDKHSN--LRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASD---GRHNAT-----TNVYIHIEDVNDNAPQFEQQKYATTVIE---------------------EDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIEL-VKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSP--IFP-----------ERLFGY----IEENREPIHSDGVYFMDVQARDFD---DPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLD-REISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNA 1658          

HSP 2 Score: 91.6633 bits (226), Expect = 3.775e-18
Identity = 122/460 (26.52%), Postives = 191/460 (41.52%), Query Frame = 1
Query:  922 AMDPDQPPTNTTQKYKISYQSVNDGFKL-KHSGRDHYEKLSLIVNKDFDREKQATV---SVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPI-------LQLEAKDEDESDQHKLRFEFDNSVDETVRNR-------FYINPLTGEILTAGYIDYEIKSE--YTIPVIVTD-GKHSDQ--ATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLP 2232
            A D DQ   ++   Y++  Q  ++ F++ K+SG       ++ + K  DR+  A V   +  ++A D D N L G  D+ +++ DIND  P F +  +   I EN   R PI       + ++A+D D+        E+       VRN+       F I+  TG+I     +D EI SE  + I V   D G  S +  A +TI+V ++NDN P                  ++Y   + E    G  V S S  D D E+K   N   + L    D    + +    QS +     L   +  D E+ +Q     +                +++ D ND+ P          G   + ++E V  GT+I +  ATDRD G+ A  R +  S    QF+ID   G LR     D E +  + L       IIE  ++      Q + V ++DVND  P
Sbjct: 1461 ATDADQDEKSSRIVYRLEGQGADEVFRIGKYSG-------TIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPE-RLFGYIEEN---REPIHSDGVYFMDVQARDFDDPTTENANIEYG-----IVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFF--------------EKTRYEGSVEETAPIGAAVMSFSAFDADEEAK--DNVFTYQLSEESDYFYVTTDKDSKQSSV---GVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHI-------HGATEHRVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQFTIDQ-DGTLRVAHTLDREDIAVYNL-------IIEAYDNSNNIGRQMVAVYLQDVNDNGP 1870          

HSP 3 Score: 84.3445 bits (207), Expect = 6.024e-16
Identity = 146/571 (25.57%), Postives = 222/571 (38.88%), Query Frame = 1
Query: 1135 QLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSE----YTIPVIVTDGKH----SDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYE---------SKRLGNQMNHLLDCRIDPHRESLELRR--SQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGT------TIVQVKATDRDIGNNAIIRYSL---DSLSSTQFSIDPISGELRNID--VFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRS-EKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFP 2754
             +D+ I + D+ND  P F +      + E+IPL   IL++ A D+D  D  ++ +  DN       + F IN   GEI     +D +  +E    Y   V   D       S  A + I  +N ND     S ++L          +SQY A++AE+   G  V  +   D D +         + R   +MN      ID H   ++LR   S + L +    I   +  +++ S       C    S + ++  T  I I DVN+N P F            YS    +  GT      TIV+V+ATD D   N  I YSL    S S   F ID  +G L      VFD E   + ++T+ A++     +  + L    + +V + D+ND  P FE+  Y  +V    +    V  V   D+D +      Y   I         +D   +   N       R GE  LI   +P+    K   F F + A D    + L S+A V + +LD     P W         + V     +   I   +A       N  V Y++  S  P
Sbjct:  625 HVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDN-------HNFSINS-NGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDE----SAVFLP---------TSQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLF---SIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGS-------CCVYPSKTHTSYATLLIGIEDVNNNKPEFP-------DCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATD-----RGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNR------RSGEITLIK-PIPM----KTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGP 1141          

HSP 4 Score: 84.3445 bits (207), Expect = 6.075e-16
Identity = 164/732 (22.40%), Postives = 281/732 (38.39%), Query Frame = 1
Query:  898 GTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQ-------LDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESK------RLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETS-----QYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQG-----SRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSL--DSL--SSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYT---LQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKIS---SFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDG 2994
            G  I    A+D D         Y+I  ++  +G + KH   D      +  N+ FDREK     + ++A D   + L G        + + I + D+ND  P F++      + E+      ++ ++A D D+     LR+    +     R  F +   +G I     +D+E   +Y + +I +DG+H+    + I +++VNDN P+               +       + E+ D   V+ ++  +D D + K      RL  Q    +  RI  +  ++EL                K  DR+  +      +  Q I  D D N L      ++++ D+NDN PIF     G        IHS    +GV      VQ +  D     NA I Y +  + L    + F ID  +G++  +   D E   + E  I        R N + + +      +T+ + D+ND  P FEK  Y  +V+E       V      D D  +K N   ++ +S   D +       Y  ++ D+ Q       G++ V  P LD E ++    F   I+ +D       + A V + ++D ND+ P       H    +V      G  I    A D D GD  +  +RI   S P                       R    D DG+   + +A  +   D+    + +EA D      +++  +++  VN +G
Sbjct: 1235 GKPIVTVKAIDTDSDGPQNEVHYRIVGEA--NGEETKHFRIDELTG-EIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDK--HSNLRYHLIGAGGG--RIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGRHNATTNVYIHIEDVNDNAPQFE-------------QQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEV-FRIGKYSGTIEL---------------VKALDRDPPAGVPSWNFVVQAI--DDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHS----DGVYF--MDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEV------RANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQ-LSEESDYF-------YVTTDKDSKQ----SSVGVLRVKQP-LDYEDVTQRDGFHLGIRVSDGRH---DAEAAVHVALVDRNDHAPHIHGATEHRVREDVPR----GTSIGRYTATDRDAGDTAR--FRINRQSDP----------------------KRQFTIDQDGT---LRVAHTLDREDIAVYNLIIEAYDNSNNIGRQMVAVYLQDVNDNG 1869          

HSP 5 Score: 58.9214 bits (141), Expect = 3.873e-8
Identity = 71/316 (22.47%), Postives = 136/316 (43.04%), Query Frame = 1
Query: 1144 INISLTDINDKQPHFKKTSIH--KIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSV-SDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELR 2082
            I I + DI D+ P F  + +    ++  N  +   + Q  A+DE       + ++   ++D      F ++P +G + T G+  YE    Y I     D   SD  T  +          E+++L +            +Y   ++E+    + V  +   S + +E  R    + + L+    P  E+   R   S  I H     T++ D ++ +      +   +  ++  + V   I I DVNDN P F      +R +++  ++E + +  TI++V A D+D G+N+ I YS+D+ + +  S   IS ++R
Sbjct:  409 IRIHVADI-DEPPSFVNSPLPMLAVVPLNPTIGRIVYQFVARDEHGDGDSNVLYK---TIDVIPAGSFIVDPKSGVVRT-GWSKYERGDTYRISAQAMDLSPSDNTTSQLS---------EVAILEILADERPPQFAKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDT-PEDETKWFRIDPSTGIIHL----TRLLDFDDPALPKLHKLKVTAREDNRESHVDLTIRIDDVNDNVPTF------TRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHNFSINSNGEISAKVR 699          

HSP 6 Score: 53.1434 bits (126), Expect = 2.183e-6
Identity = 83/377 (22.02%), Postives = 160/377 (42.44%), Query Frame = 1
Query:  922 AMDPDQPPT-NTTQKYKISYQSVNDG---FKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYIN-------PLTGEILTAGYIDYEIKSE---YTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDN-PPIFEVP----FQGSRGIHSYSIKEGVAIGTTIVQVKATDRD 1995
            A D D P T N   +Y I    + +G   F++  +    +   SL  +++   E++  + V+  A D       G  ++ I +TD+ND  P F+KT     + E  P+ + ++   A D DE  +  + F +  S +    + FY+           G +     +DYE  ++   + + + V+DG+H  +A + + + + ND+ P I               ++++R  + E+   G  +   + +D+D      G+     ++ + DP R        Q  +     L      DRE+ + Y   +  +D+ +N     V   + + DVNDN P  + VP    F+ +  ++         +GT   +++ATDRD
Sbjct: 1573 ARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSL--DREISSEREFIIEVR--ANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNV-FTYQLSEES---DYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHIH-------------GATEHR--VREDVPRGTSIGRYTATDRD-----AGDTARFRINRQSDPKR--------QFTIDQDGTLRVAHTLDREDIAVYNLIIEAYDNSNNIGRQMVA--VYLQDVNDNGPEPYTVPRPCIFRENTPVNQ--------LGT--CEIRATDRD 1901          

HSP 7 Score: 51.9878 bits (123), Expect = 4.389e-6
Identity = 83/342 (24.27%), Postives = 144/342 (42.11%), Query Frame = 1
Query: 1765 FDREETSQYFAQLICFDSDSNSLSTSVTFEISITDV--NDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATD----RDIGNNAIIRYSLDSLS----STQFSIDPISGELRNIDVFDYE-----KMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISS----FSFKIQAADRSEK-PLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTY 2730
            ++R +T +  AQ +      N+  TS   E++I ++  ++ PP F      ++  +  ++ E   +  ++V VKA       D  +   I YSL+  +    +  F IDP +G +    + D++     K+ K ++T    N     + S +      +T+ I+DVND +P F + LYT  V+E                      N    K+ +   D  D+S    Y+  N +    F I   G I   V  LD ++++     + F + A D  E   LSS+A++ I+  + ND     VF  T  Y   V+     G  +  ++A D    D  +VTY
Sbjct:  488 YERGDTYRISAQAMDLSPSDNT--TSQLSEVAILEILADERPPQF------AKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDN-----RESHV-----DLTIRIDDVNDNVPTFTRPLYTAQVRE------------------DIPLNQTILKVTAVDKDTGDNS-RITYSVDNHN----FSINSNGEISAKVR-LDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESA--VFLPTSQYTAFVAEDAQGGTPVIQIQARD---ADRDEVTY 782          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 108.612 bits (270), Expect = 2.826e-23
Identity = 177/771 (22.96%), Postives = 315/771 (40.86%), Query Frame = 1
Query:  841 SPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSL--IVNKDFDREKQAT----VSVKLKAF--------DGDPNPLSGQLDINISLTDINDKQPHFKKTSIHK---IINENIPLRSPILQLEAKDEDESDQHKLRFEF------DNSVDETVR--NRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTD--GKHSDQATLTIEVKNVNDNNPEISVLYLSGS--NFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHF--QLITTKMFDREETSQYFAQLICFDSDSNSLSTS-------VTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQ--FSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPH----DIYDSSDSQMYTNSNSDASQYFRIGE-TGLIHVNVPVLDRE---KISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKK---IWVEASDQGTPPQKKIERLHINIVNVDGNG 3000
            SP++  P    S+     +GT +    A D D          +I+Y    D      +G +H   L    +VN+   R  + T    + +K + F        +G P  L     + +++ D   K P ++ +   K    ++EN+ L   IL+  A    +S    + ++        N  +   R  N+F       E++    +DYE  + YT+ +  TD   + +   T  +EV++VND  P+ +V   +G+     TP    +        K  G  + ++   D D +  +  N++++    RI       E +  +   ID    ++   + FDRE+   Y   +   D   ++L  +       V  +I I DVNDN P FE      R      +KE    G  ++ +KA D D  +N  +RY L      +  F +   SG +   +  D+E  +++ L + AS+    R N+        + ++IEDVND  P FE+  Y  TV E                      + +  K++ N H    D  + S   +Y      A + FRIG+ +G I + V  LDR+    + S++F +QA D     L   A VQ+ + D+NDN P  +FP           +   GY    ++ N   +  +G     +    F    +   E+ N+E     +   N   +F +D +TG I+  + +   ++ S++   I V A+D+G P ++    + I + +++ N 
Sbjct:  976 SPQFERPSYETSVSRFEAVGTSVITVFAFDND-----AAHNAEITYSLEID----TTAGEEHQNDLDFFELVNR---RSGEITLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLE--------KTNGKPIVTVKAIDTDSDGPQ--NEVHY----RIVGEANGEETKHFR---IDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGR------VKESEGEGHDVITIKAHDLDKHSN--LRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASD---GRHNAT-----TNVYIHIEDVNDNAPQFEQQKYATTVIE---------------------EDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIEL-VKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSP--IFP-----------ERLFGY----IEENREPIHSDGVYFMDVQARDFD---DPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLD-REISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNA 1658          

HSP 2 Score: 91.6633 bits (226), Expect = 3.775e-18
Identity = 122/460 (26.52%), Postives = 191/460 (41.52%), Query Frame = 1
Query:  922 AMDPDQPPTNTTQKYKISYQSVNDGFKL-KHSGRDHYEKLSLIVNKDFDREKQATV---SVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPI-------LQLEAKDEDESDQHKLRFEFDNSVDETVRNR-------FYINPLTGEILTAGYIDYEIKSE--YTIPVIVTD-GKHSDQ--ATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLP 2232
            A D DQ   ++   Y++  Q  ++ F++ K+SG       ++ + K  DR+  A V   +  ++A D D N L G  D+ +++ DIND  P F +  +   I EN   R PI       + ++A+D D+        E+       VRN+       F I+  TG+I     +D EI SE  + I V   D G  S +  A +TI+V ++NDN P                  ++Y   + E    G  V S S  D D E+K   N   + L    D    + +    QS +     L   +  D E+ +Q     +                +++ D ND+ P          G   + ++E V  GT+I +  ATDRD G+ A  R +  S    QF+ID   G LR     D E +  + L       IIE  ++      Q + V ++DVND  P
Sbjct: 1461 ATDADQDEKSSRIVYRLEGQGADEVFRIGKYSG-------TIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPE-RLFGYIEEN---REPIHSDGVYFMDVQARDFDDPTTENANIEYG-----IVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFF--------------EKTRYEGSVEETAPIGAAVMSFSAFDADEEAK--DNVFTYQLSEESDYFYVTTDKDSKQSSV---GVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHI-------HGATEHRVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQFTIDQ-DGTLRVAHTLDREDIAVYNL-------IIEAYDNSNNIGRQMVAVYLQDVNDNGP 1870          

HSP 3 Score: 84.3445 bits (207), Expect = 6.024e-16
Identity = 146/571 (25.57%), Postives = 222/571 (38.88%), Query Frame = 1
Query: 1135 QLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSE----YTIPVIVTDGKH----SDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYE---------SKRLGNQMNHLLDCRIDPHRESLELRR--SQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGT------TIVQVKATDRDIGNNAIIRYSL---DSLSSTQFSIDPISGELRNID--VFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRS-EKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFP 2754
             +D+ I + D+ND  P F +      + E+IPL   IL++ A D+D  D  ++ +  DN       + F IN   GEI     +D +  +E    Y   V   D       S  A + I  +N ND     S ++L          +SQY A++AE+   G  V  +   D D +         + R   +MN      ID H   ++LR   S + L +    I   +  +++ S       C    S + ++  T  I I DVN+N P F            YS    +  GT      TIV+V+ATD D   N  I YSL    S S   F ID  +G L      VFD E   + ++T+ A++     +  + L    + +V + D+ND  P FE+  Y  +V    +    V  V   D+D +      Y   I         +D   +   N       R GE  LI   +P+    K   F F + A D    + L S+A V + +LD     P W         + V     +   I   +A       N  V Y++  S  P
Sbjct:  625 HVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDN-------HNFSINS-NGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDE----SAVFLP---------TSQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLF---SIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGS-------CCVYPSKTHTSYATLLIGIEDVNNNKPEFP-------DCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATD-----RGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNR------RSGEITLIK-PIPM----KTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGP 1141          

HSP 4 Score: 84.3445 bits (207), Expect = 6.075e-16
Identity = 164/732 (22.40%), Postives = 281/732 (38.39%), Query Frame = 1
Query:  898 GTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQ-------LDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESK------RLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETS-----QYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQG-----SRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSL--DSL--SSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYT---LQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKIS---SFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDG 2994
            G  I    A+D D         Y+I  ++  +G + KH   D      +  N+ FDREK     + ++A D   + L G        + + I + D+ND  P F++      + E+      ++ ++A D D+     LR+    +     R  F +   +G I     +D+E   +Y + +I +DG+H+    + I +++VNDN P+               +       + E+ D   V+ ++  +D D + K      RL  Q    +  RI  +  ++EL                K  DR+  +      +  Q I  D D N L      ++++ D+NDN PIF     G        IHS    +GV      VQ +  D     NA I Y +  + L    + F ID  +G++  +   D E   + E  I        R N + + +      +T+ + D+ND  P FEK  Y  +V+E       V      D D  +K N   ++ +S   D +       Y  ++ D+ Q       G++ V  P LD E ++    F   I+ +D       + A V + ++D ND+ P       H    +V      G  I    A D D GD  +  +RI   S P                       R    D DG+   + +A  +   D+    + +EA D      +++  +++  VN +G
Sbjct: 1235 GKPIVTVKAIDTDSDGPQNEVHYRIVGEA--NGEETKHFRIDELTG-EIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDK--HSNLRYHLIGAGGG--RIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGRHNATTNVYIHIEDVNDNAPQFE-------------QQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEV-FRIGKYSGTIEL---------------VKALDRDPPAGVPSWNFVVQAI--DDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHS----DGVYF--MDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEV------RANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQ-LSEESDYF-------YVTTDKDSKQ----SSVGVLRVKQP-LDYEDVTQRDGFHLGIRVSDGRH---DAEAAVHVALVDRNDHAPHIHGATEHRVREDVPR----GTSIGRYTATDRDAGDTAR--FRINRQSDP----------------------KRQFTIDQDGT---LRVAHTLDREDIAVYNLIIEAYDNSNNIGRQMVAVYLQDVNDNG 1869          

HSP 5 Score: 58.9214 bits (141), Expect = 3.873e-8
Identity = 71/316 (22.47%), Postives = 136/316 (43.04%), Query Frame = 1
Query: 1144 INISLTDINDKQPHFKKTSIH--KIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSV-SDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELR 2082
            I I + DI D+ P F  + +    ++  N  +   + Q  A+DE       + ++   ++D      F ++P +G + T G+  YE    Y I     D   SD  T  +          E+++L +            +Y   ++E+    + V  +   S + +E  R    + + L+    P  E+   R   S  I H     T++ D ++ +      +   +  ++  + V   I I DVNDN P F      +R +++  ++E + +  TI++V A D+D G+N+ I YS+D+ + +  S   IS ++R
Sbjct:  409 IRIHVADI-DEPPSFVNSPLPMLAVVPLNPTIGRIVYQFVARDEHGDGDSNVLYK---TIDVIPAGSFIVDPKSGVVRT-GWSKYERGDTYRISAQAMDLSPSDNTTSQLS---------EVAILEILADERPPQFAKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDT-PEDETKWFRIDPSTGIIHL----TRLLDFDDPALPKLHKLKVTAREDNRESHVDLTIRIDDVNDNVPTF------TRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHNFSINSNGEISAKVR 699          

HSP 6 Score: 53.1434 bits (126), Expect = 2.183e-6
Identity = 83/377 (22.02%), Postives = 160/377 (42.44%), Query Frame = 1
Query:  922 AMDPDQPPT-NTTQKYKISYQSVNDG---FKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYIN-------PLTGEILTAGYIDYEIKSE---YTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDN-PPIFEVP----FQGSRGIHSYSIKEGVAIGTTIVQVKATDRD 1995
            A D D P T N   +Y I    + +G   F++  +    +   SL  +++   E++  + V+  A D       G  ++ I +TD+ND  P F+KT     + E  P+ + ++   A D DE  +  + F +  S +    + FY+           G +     +DYE  ++   + + + V+DG+H  +A + + + + ND+ P I               ++++R  + E+   G  +   + +D+D      G+     ++ + DP R        Q  +     L      DRE+ + Y   +  +D+ +N     V   + + DVNDN P  + VP    F+ +  ++         +GT   +++ATDRD
Sbjct: 1573 ARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSL--DREISSEREFIIEVR--ANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNV-FTYQLSEES---DYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHIH-------------GATEHR--VREDVPRGTSIGRYTATDRD-----AGDTARFRINRQSDPKR--------QFTIDQDGTLRVAHTLDREDIAVYNLIIEAYDNSNNIGRQMVA--VYLQDVNDNGPEPYTVPRPCIFRENTPVNQ--------LGT--CEIRATDRD 1901          

HSP 7 Score: 51.9878 bits (123), Expect = 4.389e-6
Identity = 83/342 (24.27%), Postives = 144/342 (42.11%), Query Frame = 1
Query: 1765 FDREETSQYFAQLICFDSDSNSLSTSVTFEISITDV--NDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATD----RDIGNNAIIRYSLDSLS----STQFSIDPISGELRNIDVFDYE-----KMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISS----FSFKIQAADRSEK-PLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTY 2730
            ++R +T +  AQ +      N+  TS   E++I ++  ++ PP F      ++  +  ++ E   +  ++V VKA       D  +   I YSL+  +    +  F IDP +G +    + D++     K+ K ++T    N     + S +      +T+ I+DVND +P F + LYT  V+E                      N    K+ +   D  D+S    Y+  N +    F I   G I   V  LD ++++     + F + A D  E   LSS+A++ I+  + ND     VF  T  Y   V+     G  +  ++A D    D  +VTY
Sbjct:  488 YERGDTYRISAQAMDLSPSDNT--TSQLSEVAILEILADERPPQF------AKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDN-----RESHV-----DLTIRIDDVNDNVPTFTRPLYTAQVRE------------------DIPLNQTILKVTAVDKDTGDNS-RITYSVDNHN----FSINSNGEISAKVR-LDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESA--VFLPTSQYTAFVAEDAQGGTPVIQIQARD---ADRDEVTY 782          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0078045)

HSP 1 Score: 210.69 bits (535), Expect = 2.191e-54
Identity = 224/801 (27.97%), Postives = 342/801 (42.70%), Query Frame = 1
Query:  571 GGVGSGD-YYYKSITDIEP-FFLDSKTYEFRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLK-HSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQ-----ATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQ---FSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVN-------------VPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQ---EAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLS 2892
            GG+ SG  Y   +   +E    +D  T E R   ++DRE    + +  I  + R     +    + DE                        +P +    +++  PE++    + TL  A D D  P NT Q+Y I   +VND F+L  H  RD    L L ++   DRE     S+ ++A DG   PL G + +NI++ D+ND QP F ++     + EN  + + +LQ+ A D D +D++ L     N         F I+P TG I     +D+E K  + + V+  D  H +Q     A ++I V +VNDN P I+V++L          S      ++E+  PG  VA +SV D D  SK     +N  L+   D H        S   +I H  L      DRE  S Y   ++  D  +  L  S +  + ITDVNDNPP FE      + ++  ++ E    GT+++QV A DRD G N+ + YSL     T    F IDP +G +      D E     +LT+ A +  +       L +   + V I DVND  P+F++  Y  +V E                      N    + I        +SD     N    A   + IGE G  H+                 LD E+ SS+ F + A DR    LS+TA++++Q+ DVNDN P++ +P  +   +  S +   +A    I  + A DPD G+ G+V+YRIV                           N   +F +D STG I++ +   LS
Sbjct:  103 GGIDSGPPYIIVAEAGVETDLAIDRATGEIRTKVKLDRETRASYSLVAIPLSGRNIRVLVT---VKDENDN---------------------APTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNT-QRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTD-ADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKD--HGEQPLETTAFVSIRVTDVNDNQPTINVIFL----------SDDASPKISESAQPGEFVARISVHDPD--SKTEYANVNVTLNGG-DGHFALTTRDNSIYLVIVHLPL------DREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFE------QDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPP-----LSSTATVLVTIHDVNDNEPIFDQSFYNVSVAE----------------------NEPVGRCILK----VSASDPDCGVN----AMVNYTIGE-GFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGG--LSTTAMIKMQLTDVNDNRPVF-YPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAG-------------------------NEAGIFRIDRSTGEIFVVRPDMLS 786          

HSP 2 Score: 166.392 bits (420), Expect = 9.163e-41
Identity = 192/759 (25.30%), Postives = 315/759 (41.50%), Query Frame = 1
Query:  841 SPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHY----EKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEF-DNSVDET--------VRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTD----GKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSL----DSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINAS---NPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTN----------SNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAAD--RSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIE-RLHINIVNVDGNGHG 3006
            +P++ +  + +S+PE +++G  +    A D D     +    +++Y  V      K SG+  +        LI+++  D E     ++ + A DG    LS  L I + + D+ND  P F+K      ++E+  + + I+Q+ A D D  +  ++ +   D  VD          V   F I P +G I     +D E +  Y + V+ TD      H+ +  + + V + NDN+P+               + S+Y   + EN   G VV  ++ SD D     LG   N  +   + P   S ++           ++ T +  DRE    Y   +   D  +   S  V   I ++DVNDN P    P +        S++E    GT +V+V+A DRD G NA I YS+    DS     FSIDP SG +R   V D+E+   + L + AS   NP  E        T++ + V + D+ND  P F      F V+E                D +  +       I  P D+  +S  + + +          +       F I       V   +LDRE  S F  +I+A D   S  P SS   V+I++ DVNDN P W        ++ VS    +G  I N  A D D G NG + YR++   FP    + E++ +L               F +D  TG + +   +    V    + V+A DQ +   ++++  + + +  +D N H 
Sbjct:  928 APEFEASMVRISVPESAELGAPLYAAHAHDKD-----SGSSGQVTYSLV------KESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHA-KTRVIVRVLDANDNDPKF--------------QKSKYEFRIEENLRRGSVVGVVTASDLD-----LGE--NAAIRYSLLPINSSFQVHPVTG------EISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQE-----DVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRE--------TVRMLRVEVLDLNDNRPTFTSSSLVFRVRE----------------DAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEW---PQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLI-RYFPQLNESQEQAMSL---------------FRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHA 1599          

HSP 3 Score: 145.206 bits (365), Expect = 2.477e-34
Identity = 158/653 (24.20%), Postives = 269/653 (41.19%), Query Frame = 1
Query: 1060 FDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTD-GKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGN--QMNHLLDCRIDPHRES--LELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLS-STQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQM-YTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
             D E +    + + A DG   PLS    + +++ D+ND +P F ++  +  + EN P+   IL++ A D D      + +             F +   +GEI  AG +D+E +S Y  PV+ TD G  S  A + +++ +VNDN P         S  ++P  SSQ       +  P   + ++  +D DY     GN  Q+++    RI    E+    + RS  ++     ++   M        +   +   D  +   +      +SI D    PPIFE      +  ++Y +KE +  GT +  V A   D+ + + +RYS+ S      FSI+  SG +R     D+E   +  L I A+           +Y   ++ + +EDVND  P FE  +   +V E       +                      ++ HD    S  Q+ Y+         F I       +    LD E     +  + A D     LS+   + + + DVNDNPP++       Y VNVS   +I   I  + A+D D G+N ++TYRIV +      N+           SSD+     + F +  ++G IY+   +        ++ V A+D GTP      R+ + +++ + N
Sbjct:  569 IDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHL--TEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQ------ASSTP---IVAVVATDPDY-----GNFGQVSY----RIVAGNEAGIFRIDRSTGEIF----VVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFE------KARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQAT------LGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYA--------------------AHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVF---EKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNS---------ISSSDVS----QHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDN 1149          

HSP 4 Score: 145.206 bits (365), Expect = 2.606e-34
Identity = 149/673 (22.14%), Postives = 293/673 (43.54%), Query Frame = 1
Query: 1048 VNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDG---KHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMN---HLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMF-------DREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVF---EKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGET-GLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFP---FSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTP--PQKKIERLHINIVNVDGNG 3000
            + K  D E ++ V + ++A  G+P P+ G   +NI + D+ND  P F+ + +   + E+  L +P+    A D+D     ++ +     V E+ +  F I+  +G ++ + ++DYE    +T+ V  TDG     S   T+ ++V++VNDN P                   +Y   ++E++     +  ++ SD D      GN       ++D  +D    S+    S S +  HF +     +       DRE   +Y   ++  D+ + +        + + D NDN P F+      +  + + I+E +  G+ +  V A+D D+G NA IRYSL  ++S+ F + P++GE+   +  D E  E ++L + A +     +++++      + +++ DVND  P     ++D+ +   ++ P  +V                     + +   H    S    +    +SD    F I  T G+I   V VLD E+ S +   + A+D    P  +  ++++++LD+NDN P +    + +    V    A+G+ + ++      +     V    V  SF     ++  N  +K+L   E++         FD+D  +GN+ +A+ +        ++ + A D      PQ     + I + +V+ N 
Sbjct:  886 IAKPLDHEAKSQVLLNIQATLGEP-PVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSL---VKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVF--------------EKDEYSVNVSESRSINAQIIQVNASDLD-----TGNNARITYRIVDAGVDNVTNSI----SSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQ------KSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSS-FQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARV-----PVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVR------------------VRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRV-VLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTF---TSSSLVFRVREDAALGHVVGSISP----IERPADVVRNSVEESFEDLRVTYTLNPLTKDL--IEAA---------FDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNA 1482          

HSP 5 Score: 118.242 bits (295), Expect = 4.015e-26
Identity = 167/665 (25.11%), Postives = 271/665 (40.75%), Query Frame = 1
Query: 1060 FDREKQATVSVKLKAFDGDPNPLSGQ-LDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINP-------LTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQ---ATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRL------GNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNN-AIIRYSLDSLSSTQFSIDPISGELRNIDV---FDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHD-IYDSSDSQMYTNSNSDASQYFRIG-ETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVN 2985
             DRE +A+ S  L A      PLSG+ + + +++ D ND  P F +TS+H    EN P       L A+D D    +  R+   N V   V + F ++        L  ++  +G++D E    Y++ +   DG         T+ I +++VNDN P  +               S+Y A + EN   G  V  +  SD D +   L        Q +     RIDP   ++ +                K  D E    +   ++  D     L T+    I +TDVNDN P   V F       S  I E    G  + ++   D D     A +  +L+      F++      +  + V    D E +  + L++ A++     K +  L+  + I + I DVND  P FE+DLY   V E                   +   ++  +++++  D   +S+ +     +    +Q+F+I  +TGLI     + D E        + A D    PLSSTA V + I DVNDN P++   +   Y V+V+  E +G CI  + A+DPD G N  V Y I            E  K+L  TE           F++  ++G I IA ++      S +  V A+D+G      + ++ +  VN
Sbjct:  138 LDRETRASYS--LVAI-----PLSGRNIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRY---NIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFN--------------QSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYI---------------NKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDA--SPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNG-GDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATD-----KGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVME------------------VADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHI-DCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIF---DQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTI-----------GEGFKHL--TE-----------FEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQLTDVN 709          

HSP 6 Score: 112.079 bits (279), Expect = 2.885e-24
Identity = 139/569 (24.43%), Postives = 230/569 (40.42%), Query Frame = 1
Query: 1327 VRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKD---YESKRLGNQMNHLLDC-RIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQ---FSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLP----VFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXY-NSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            V     I+  TGEI T   +D E ++ Y++  I   G++     + + VK+ NDN P                  +       EN         L   D D   Y ++R      ++ D  R+  HRE           + +  L  +   DRE T  Y   +   D  +  L   +T  I+I DVNDN PIF      ++  +  ++ E   +GT+++QV A+D D   N ++ Y+++   S +   F IDP +G +      D+E  E  EL + A +        Q L T   +++ + DVND  P    +F  D  +  + E      +V ++ V D D  ++Y N N      + H    + D+ +Y                 L+ V++P LDRE +S+++  + A D+   PL ++  + ++I DVNDNPP +       Y  NV      G  +  + A+D D G N  +TY +                  E  E+        + F +D  TG I     +        ++ V A D G PP      + + I +V+ N
Sbjct:  119 VETDLAIDRATGEIRTKVKLDRETRASYSLVAIPLSGRN---IRVLVTVKDENDNAPTFP--------------QTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRER--------DGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIF------NQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKD-----HGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIY-----------------LVIVHLP-LDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEF---EQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLA-----------------ETPET------HAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDN 607          

HSP 7 Score: 109.768 bits (273), Expect = 1.384e-23
Identity = 197/766 (25.72%), Postives = 313/766 (40.86%), Query Frame = 1
Query:  841 SPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKI---------SYQSVNDGFKLKH-SGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNP---LSGQLDINISLTDINDKQPHF--------KKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYL----SGSNFKTPGRSSQ--YRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTK-MFDREETSQYFAQLICFDSDSNS-LSTS----------------------VTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLS-STQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPL-SSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINI 2979
            +P+W    I L + E + +GT I    A D D   TN   +Y++         S +     F++   +G      LSL    DF+  ++  + V  +A D   N    L   + + + + D ND  PHF        K  S+   I++   +   +  + A DED  D  +L +E      E    RF IN  TG I         +KS   +P    D +   +  L I  K+     P+ S L L     GS+   P R  Q  YRA + EN   G  V  L V+ K        N +++ +   +      ++ +R          +ITT+  FDRE  + Y   +   D++  S LS+S                       T  I++ DVNDN P F     GS   +  S+ E    G  I  V A+D D G NA + YS+   +   +FSID  SGEL +    D E+  ++ L I AS    +R   +       IT+ +ED ND  P F+   YT +V+E                   +   ++  +I +   D+  ++   +Y+ +N    Q+   G++GLI   V  LDRE  +S++F + A D     + S+T  VQI +LD+NDN P++     + Y   V      G  +  ++A D DLG N ++ Y +           N E+  +               F ++ STG +  +Q +         + V A D+G PPQ  +  + + I
Sbjct: 1482 APEWPQDPIDLQVSEATPVGTIIHNFTATDADT-GTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTG-----ALSLQAPLDFEAVQEYLLIV--QALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASL--FISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGE---GRFRINSQTGIIEL-------VKS---LPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSH-NNPPRFLQAVYRATILENVPSGSFV--LQVTAKSLHGAENAN-LSYEIPAGVANDLFHVDWQRG---------IITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFR---PGS--CYGLSVPENSEPG-VIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGEL-SARPLDREQHSRYTLQIQAS----DRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQE------------------DAPLGTSVVQISAVDADLGVNA-RLVYSLANETQWQFAIDGQSGLI-TTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIF---ERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSL-----------NAENSAVSAK------------FRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLI 2154          

HSP 8 Score: 105.531 bits (262), Expect = 3.463e-22
Identity = 157/692 (22.69%), Postives = 273/692 (39.45%), Query Frame = 1
Query:  844 PKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPH----FKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVD-----ETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGK----HSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDS--LSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGE-TGLIHVNVP-VLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIV---PSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTG 2859
            P ++    + ++PE++ +GT +    A D D    N   +Y I+ +  +     +   R      ++ +NK  D E +    + + A D    PL     ++I +TD+ND QP     F        I+E+      + ++   D D   ++       N  D      T  N  Y+      ++    +D EI S YT+ V+ TD      H+ + ++ + + +VNDN PE                   Y A + E  DPG  V  +   D+D   + L + + + L    + H +  ++   Q+ LI      T    D E        ++  D     LS++ T  ++I DVNDN PIF+  F      ++ S+ E   +G  I++V A+D D G NA++ Y++       T+F +   SGE+      D+E+   +E  + A+    +R     L T   I + + DVND  PVF    Y  +++E P          +     +     N+ ++               Y     + +  FRI   TG I V  P +L           I A D      ++ A+V + I+D    PP++       Y   V      G  + ++ A   D+     V Y I    P  + FS  TN  S N+ + +  D +     + ++  + G
Sbjct:  284 PIFNQSRYFATVPENATVGTSVLQVYASDTDAD-ENGLVEYAINRRQSDKEQMFRIDPRTG----AIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYL------VIVHLPLDREIVSNYTLSVVATDKGTPPLHASK-SIFLRITDVNDNPPEF--------------EQDLYHANVMEVADPGTSVLQVLAHDRD---EGLNSALTYSLAETPETHAQWFQID-PQTGLI-----TTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSF------YNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLAT----DRGG---LSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQV--------------SYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIF---EKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGY-FSIETN--SGNIRIAKPLDHEAKSQVLLNIQATLG 907          

HSP 9 Score: 93.2041 bits (230), Expect = 1.661e-18
Identity = 165/727 (22.70%), Postives = 303/727 (41.68%), Query Frame = 1
Query:  841 SPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIV--NKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLA---------ENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPI--SGELRNIDVFDYEKMEKFELTINASNP-IIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDL-YTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAAD-RSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFS----FNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKK------IWVEASDQGTP 2943
            SPK+S      ++ E +  GT +    A D D   +N   +Y I   + ++ F ++ +        S IV  N   DRE +    +K+ A D     ++G   I + + D+ND QP F   ++   ++E   L + I  + A D D       R   +++VD    + F ++  +G+++    +DYE++ EY + VI +D  H  +  LT+ V + NDN P    ++L          + Q  AY A         E+    F + +++ +D D E    GN  N  +   I+P +E   +  S   +  +   +   +     +  YF ++I  D+   +L +S    +     NDN        Q     +   I E   +G+ ++Q       +G +A+ + SL  ++  + S   +  S  +  +   D E+ + ++L +  S+P      +S    +   + + I D ND  P+F++   Y   + E       + ++   D D  +  NS         +DI   +D  M+T              TG++ VN  +       S+   I+A D   ++PL S    ++++ D NDN P   FP T  Y   ++  E +G  +    A+D D G  G++ Y I P+    S    F  + ES    VT +    + + + +D++           +  SD+G KK      + +E+ D+ TP
Sbjct: 2319 SPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAG-SNARLRYHIVDGNHDNAFVIEPA-------FSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTVLTVRVNDENDNAP----VFL----------AQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSE----GN--NSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAV---SSSGDYFVRIIAKDAGKPALKSSTLLRVQ---ANDNGSGRSQFLQNQ---YRAQISEAAPLGSVVLQ-------LGQDALDQ-SLAIIAGNEESAFELLQSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVV------YDITSGNDEHMFTIDLV----------TGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPK--FPLTE-YVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESG--LVTSAFVFDYEQRQRYDME-----------LLASDMGGKKASVAVRVEIESRDEFTP 2967          

HSP 10 Score: 79.7221 bits (195), Expect = 2.312e-14
Identity = 120/478 (25.10%), Postives = 193/478 (40.38%), Query Frame = 1
Query:  949 NTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSV-------------------KLKAFDGDPNPLSGQ----LDINISLTDINDKQPHFKKTSIHKIINENIPLRSP---ILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTD----GKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSL-STSVTFEISITDVNDNPPIFE-VPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSL---DSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPV--FEKDLYTFTVKE 2271
            N    Y+I     ND F +       +++  +     FDRE QA+  +                   K ++ D   +  +GQ      I I++ D+ND  P F+  S + +   ++P  S    I  + A D DE     L +         + N+F I+  +GE L+A  +D E  S YT+ +  +D            +TI V++ NDN P   +              S+Y   + E+   G  V  +S  D D     LG  +N  L   +    +       QS LI      T    DRE  + Y   ++  D     + S +V  +I++ D+NDN PIFE  P+ G        +   +  G T+++V+A D D+G NA I YSL   +S  S +F I+P +G L        E  +   L + A +     K +    +L  I + I +     PV  F+ + Y   +KE
Sbjct: 1751 NANLSYEIPAGVANDLFHVD------WQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGL---SVPENSEPGVIHTVVASDLDEGPNADLIYSITGG---NLGNKFSIDSSSGE-LSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKL--------------SKYTGSVQEDAPLGTSVVQISAVDAD-----LG--VNARLVYSLANETQWQFAIDGQSGLI-----TTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQ-------VPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARD-----KGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKE 2177          

HSP 11 Score: 77.7962 bits (190), Expect = 9.276e-14
Identity = 150/684 (21.93%), Postives = 265/684 (38.74%), Query Frame = 1
Query:  871 LSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKD--FDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENI----------PLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTD-----GKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQL--ITTKM-----FDREETSQYFAQLICFDSDSN---SLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSS-TQFSIDPISGELRNIDVF-----DYEKMEKFELTINASN---PIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSST--------AIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNL 2790
            +S+ E    GTE+    A+D D       Q   I+Y S+  G      G    +  S ++      D E+++   + + A DG   P      + + + D+ND +P F  +S+   + E+           P+  P   +    E+  +  ++ +  +    + +   F I+  +G ++ A  +D E++SE+ + +   D        S   T+ IEV +VNDN PE                       ++E    G ++ + + +D D  +   G+    L+       R   +L  SQ + +  F++  +T  +      D E   +Y   +   D  SN    L TSVT  + I D ND+ P F  P        S  I +   IG  +  + A D D G+N  + Y +   +   +F I+  +G +  +        D EK  +F L I A +   P  E K S L      + + ++  ++  P F + +Y  T+ E      +V +V  K    +   N +Y       +D++     +    +     Q+ R  +   + + V V D  + S+ S       RS   +  T        A + I + DVNDN P   F     Y ++V      G  I  + A+D D G N  + Y I   +    F+ +  S  L
Sbjct: 1264 VSVREEQPPGTEVVRVRAVDRDH-----GQNASITY-SIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWP--------------QDPIDLQVSEATPVGTIIHNFTATDADTGTN--GDLQYRLI-------RYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQP--EPKKSSL-----NLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTR---GQFDRESQASYV-LPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSP--EFRPGSCYGLSVPENSEPG-VIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGEL 1904          

HSP 12 Score: 72.4034 bits (176), Expect = 3.129e-12
Identity = 135/576 (23.44%), Postives = 226/576 (39.24%), Query Frame = 1
Query: 1084 VSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINP-LTGEILTAGYIDYEIKSEYTIPVIVTD---GKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKD---YESKRLGNQMNHLLDCRIDPHRESL-ELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIF---EVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDI-GNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNP-----IIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKP------LSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGD--NGKVTYRI 2736
            + V L A   D   L+   ++ I L D ND  P F +      ++E     + + Q+ A D D     +LR+     VD    N F I P  +G + T   +D EI+  Y + +I TD    + +  AT+ +++ +VNDN P         +N  T          ++E  + G V+ S+S +D D     + RLG +        +D    S+  L R   K      L+  +  D E   +Y   +I  D+   + +      + + D NDN P+F   + P   +       I E +++   ++ V ATD D  GNN+ + Y ++  +   FS+ P +G +          M + +  +++S       I +      L +   + V   D       F ++ Y   + E                            ++    D  D S + +  N  S     F + ++  I V V  LDRE+   +  ++  +     P       SS   V I ILD NDN P  +F  +  YE  +S    + Y IA L+A D D  +  N +V Y I
Sbjct: 2288 IRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHI---VDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPT-----FPPNNLVT----------VSEATELGAVITSISANDVDTYPALTYRLGAE------STVDIENMSIFALDRYSGK------LVLKRRLDYELQQEYELDVIASDAAHEART---VLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEP-AQEGFSVHPSNGVVS-------VNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSV---------------------VLQLGQDALDQSLAIIAGNEES----AFELLQSKAI-VLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFP--IFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDI 2794          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0343249)

HSP 1 Score: 210.69 bits (535), Expect = 2.191e-54
Identity = 224/801 (27.97%), Postives = 342/801 (42.70%), Query Frame = 1
Query:  571 GGVGSGD-YYYKSITDIEP-FFLDSKTYEFRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLK-HSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQ-----ATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQ---FSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVN-------------VPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQ---EAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLS 2892
            GG+ SG  Y   +   +E    +D  T E R   ++DRE    + +  I  + R     +    + DE                        +P +    +++  PE++    + TL  A D D  P NT Q+Y I   +VND F+L  H  RD    L L ++   DRE     S+ ++A DG   PL G + +NI++ D+ND QP F ++     + EN  + + +LQ+ A D D +D++ L     N         F I+P TG I     +D+E K  + + V+  D  H +Q     A ++I V +VNDN P I+V++L          S      ++E+  PG  VA +SV D D  SK     +N  L+   D H        S   +I H  L      DRE  S Y   ++  D  +  L  S +  + ITDVNDNPP FE      + ++  ++ E    GT+++QV A DRD G N+ + YSL     T    F IDP +G +      D E     +LT+ A +  +       L +   + V I DVND  P+F++  Y  +V E                      N    + I        +SD     N    A   + IGE G  H+                 LD E+ SS+ F + A DR    LS+TA++++Q+ DVNDN P++ +P  +   +  S +   +A    I  + A DPD G+ G+V+YRIV                           N   +F +D STG I++ +   LS
Sbjct:  103 GGIDSGPPYIIVAEAGVETDLAIDRATGEIRTKVKLDRETRASYSLVAIPLSGRNIRVLVT---VKDENDN---------------------APTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNT-QRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTD-ADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKD--HGEQPLETTAFVSIRVTDVNDNQPTINVIFL----------SDDASPKISESAQPGEFVARISVHDPD--SKTEYANVNVTLNGG-DGHFALTTRDNSIYLVIVHLPL------DREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFE------QDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPP-----LSSTATVLVTIHDVNDNEPIFDQSFYNVSVAE----------------------NEPVGRCILK----VSASDPDCGVN----AMVNYTIGE-GFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGG--LSTTAMIKMQLTDVNDNRPVF-YPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAG-------------------------NEAGIFRIDRSTGEIFVVRPDMLS 786          

HSP 2 Score: 166.392 bits (420), Expect = 9.163e-41
Identity = 192/759 (25.30%), Postives = 315/759 (41.50%), Query Frame = 1
Query:  841 SPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHY----EKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEF-DNSVDET--------VRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTD----GKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSL----DSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINAS---NPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTN----------SNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAAD--RSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIE-RLHINIVNVDGNGHG 3006
            +P++ +  + +S+PE +++G  +    A D D     +    +++Y  V      K SG+  +        LI+++  D E     ++ + A DG    LS  L I + + D+ND  P F+K      ++E+  + + I+Q+ A D D  +  ++ +   D  VD          V   F I P +G I     +D E +  Y + V+ TD      H+ +  + + V + NDN+P+               + S+Y   + EN   G VV  ++ SD D     LG   N  +   + P   S ++           ++ T +  DRE    Y   +   D  +   S  V   I ++DVNDN P    P +        S++E    GT +V+V+A DRD G NA I YS+    DS     FSIDP SG +R   V D+E+   + L + AS   NP  E        T++ + V + D+ND  P F      F V+E                D +  +       I  P D+  +S  + + +          +       F I       V   +LDRE  S F  +I+A D   S  P SS   V+I++ DVNDN P W        ++ VS    +G  I N  A D D G NG + YR++   FP    + E++ +L               F +D  TG + +   +    V    + V+A DQ +   ++++  + + +  +D N H 
Sbjct:  928 APEFEASMVRISVPESAELGAPLYAAHAHDKD-----SGSSGQVTYSLV------KESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHA-KTRVIVRVLDANDNDPKF--------------QKSKYEFRIEENLRRGSVVGVVTASDLD-----LGE--NAAIRYSLLPINSSFQVHPVTG------EISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQE-----DVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRE--------TVRMLRVEVLDLNDNRPTFTSSSLVFRVRE----------------DAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEW---PQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLI-RYFPQLNESQEQAMSL---------------FRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHA 1599          

HSP 3 Score: 145.206 bits (365), Expect = 2.477e-34
Identity = 158/653 (24.20%), Postives = 269/653 (41.19%), Query Frame = 1
Query: 1060 FDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTD-GKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGN--QMNHLLDCRIDPHRES--LELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLS-STQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQM-YTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
             D E +    + + A DG   PLS    + +++ D+ND +P F ++  +  + EN P+   IL++ A D D      + +             F +   +GEI  AG +D+E +S Y  PV+ TD G  S  A + +++ +VNDN P         S  ++P  SSQ       +  P   + ++  +D DY     GN  Q+++    RI    E+    + RS  ++     ++   M        +   +   D  +   +      +SI D    PPIFE      +  ++Y +KE +  GT +  V A   D+ + + +RYS+ S      FSI+  SG +R     D+E   +  L I A+           +Y   ++ + +EDVND  P FE  +   +V E       +                      ++ HD    S  Q+ Y+         F I       +    LD E     +  + A D     LS+   + + + DVNDNPP++       Y VNVS   +I   I  + A+D D G+N ++TYRIV +      N+           SSD+     + F +  ++G IY+   +        ++ V A+D GTP      R+ + +++ + N
Sbjct:  569 IDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHL--TEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQ------ASSTP---IVAVVATDPDY-----GNFGQVSY----RIVAGNEAGIFRIDRSTGEIF----VVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFE------KARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQAT------LGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYA--------------------AHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVF---EKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNS---------ISSSDVS----QHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDN 1149          

HSP 4 Score: 145.206 bits (365), Expect = 2.606e-34
Identity = 149/673 (22.14%), Postives = 293/673 (43.54%), Query Frame = 1
Query: 1048 VNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDG---KHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMN---HLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMF-------DREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVF---EKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGET-GLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFP---FSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTP--PQKKIERLHINIVNVDGNG 3000
            + K  D E ++ V + ++A  G+P P+ G   +NI + D+ND  P F+ + +   + E+  L +P+    A D+D     ++ +     V E+ +  F I+  +G ++ + ++DYE    +T+ V  TDG     S   T+ ++V++VNDN P                   +Y   ++E++     +  ++ SD D      GN       ++D  +D    S+    S S +  HF +     +       DRE   +Y   ++  D+ + +        + + D NDN P F+      +  + + I+E +  G+ +  V A+D D+G NA IRYSL  ++S+ F + P++GE+   +  D E  E ++L + A +     +++++      + +++ DVND  P     ++D+ +   ++ P  +V                     + +   H    S    +    +SD    F I  T G+I   V VLD E+ S +   + A+D    P  +  ++++++LD+NDN P +    + +    V    A+G+ + ++      +     V    V  SF     ++  N  +K+L   E++         FD+D  +GN+ +A+ +        ++ + A D      PQ     + I + +V+ N 
Sbjct:  886 IAKPLDHEAKSQVLLNIQATLGEP-PVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSL---VKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVF--------------EKDEYSVNVSESRSINAQIIQVNASDLD-----TGNNARITYRIVDAGVDNVTNSI----SSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQ------KSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSS-FQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARV-----PVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVR------------------VRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRV-VLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTF---TSSSLVFRVREDAALGHVVGSISP----IERPADVVRNSVEESFEDLRVTYTLNPLTKDL--IEAA---------FDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNA 1482          

HSP 5 Score: 118.242 bits (295), Expect = 4.015e-26
Identity = 167/665 (25.11%), Postives = 271/665 (40.75%), Query Frame = 1
Query: 1060 FDREKQATVSVKLKAFDGDPNPLSGQ-LDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINP-------LTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQ---ATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRL------GNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNN-AIIRYSLDSLSSTQFSIDPISGELRNIDV---FDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHD-IYDSSDSQMYTNSNSDASQYFRIG-ETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVN 2985
             DRE +A+ S  L A      PLSG+ + + +++ D ND  P F +TS+H    EN P       L A+D D    +  R+   N V   V + F ++        L  ++  +G++D E    Y++ +   DG         T+ I +++VNDN P  +               S+Y A + EN   G  V  +  SD D +   L        Q +     RIDP   ++ +                K  D E    +   ++  D     L T+    I +TDVNDN P   V F       S  I E    G  + ++   D D     A +  +L+      F++      +  + V    D E +  + L++ A++     K +  L+  + I + I DVND  P FE+DLY   V E                   +   ++  +++++  D   +S+ +     +    +Q+F+I  +TGLI     + D E        + A D    PLSSTA V + I DVNDN P++   +   Y V+V+  E +G CI  + A+DPD G N  V Y I            E  K+L  TE           F++  ++G I IA ++      S +  V A+D+G      + ++ +  VN
Sbjct:  138 LDRETRASYS--LVAI-----PLSGRNIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRY---NIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFN--------------QSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYI---------------NKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDA--SPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNG-GDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATD-----KGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVME------------------VADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHI-DCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIF---DQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTI-----------GEGFKHL--TE-----------FEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQLTDVN 709          

HSP 6 Score: 112.079 bits (279), Expect = 2.885e-24
Identity = 139/569 (24.43%), Postives = 230/569 (40.42%), Query Frame = 1
Query: 1327 VRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKD---YESKRLGNQMNHLLDC-RIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQ---FSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLP----VFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXY-NSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            V     I+  TGEI T   +D E ++ Y++  I   G++     + + VK+ NDN P                  +       EN         L   D D   Y ++R      ++ D  R+  HRE           + +  L  +   DRE T  Y   +   D  +  L   +T  I+I DVNDN PIF      ++  +  ++ E   +GT+++QV A+D D   N ++ Y+++   S +   F IDP +G +      D+E  E  EL + A +        Q L T   +++ + DVND  P    +F  D  +  + E      +V ++ V D D  ++Y N N      + H    + D+ +Y                 L+ V++P LDRE +S+++  + A D+   PL ++  + ++I DVNDNPP +       Y  NV      G  +  + A+D D G N  +TY +                  E  E+        + F +D  TG I     +        ++ V A D G PP      + + I +V+ N
Sbjct:  119 VETDLAIDRATGEIRTKVKLDRETRASYSLVAIPLSGRN---IRVLVTVKDENDNAPTFP--------------QTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRER--------DGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIF------NQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKD-----HGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIY-----------------LVIVHLP-LDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEF---EQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLA-----------------ETPET------HAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDN 607          

HSP 7 Score: 109.768 bits (273), Expect = 1.384e-23
Identity = 197/766 (25.72%), Postives = 313/766 (40.86%), Query Frame = 1
Query:  841 SPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKI---------SYQSVNDGFKLKH-SGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNP---LSGQLDINISLTDINDKQPHF--------KKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYL----SGSNFKTPGRSSQ--YRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTK-MFDREETSQYFAQLICFDSDSNS-LSTS----------------------VTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLS-STQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPL-SSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINI 2979
            +P+W    I L + E + +GT I    A D D   TN   +Y++         S +     F++   +G      LSL    DF+  ++  + V  +A D   N    L   + + + + D ND  PHF        K  S+   I++   +   +  + A DED  D  +L +E      E    RF IN  TG I         +KS   +P    D +   +  L I  K+     P+ S L L     GS+   P R  Q  YRA + EN   G  V  L V+ K        N +++ +   +      ++ +R          +ITT+  FDRE  + Y   +   D++  S LS+S                       T  I++ DVNDN P F     GS   +  S+ E    G  I  V A+D D G NA + YS+   +   +FSID  SGEL +    D E+  ++ L I AS    +R   +       IT+ +ED ND  P F+   YT +V+E                   +   ++  +I +   D+  ++   +Y+ +N    Q+   G++GLI   V  LDRE  +S++F + A D     + S+T  VQI +LD+NDN P++     + Y   V      G  +  ++A D DLG N ++ Y +           N E+  +               F ++ STG +  +Q +         + V A D+G PPQ  +  + + I
Sbjct: 1482 APEWPQDPIDLQVSEATPVGTIIHNFTATDADT-GTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTG-----ALSLQAPLDFEAVQEYLLIV--QALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASL--FISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGE---GRFRINSQTGIIEL-------VKS---LPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSH-NNPPRFLQAVYRATILENVPSGSFV--LQVTAKSLHGAENAN-LSYEIPAGVANDLFHVDWQRG---------IITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFR---PGS--CYGLSVPENSEPG-VIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGEL-SARPLDREQHSRYTLQIQAS----DRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQE------------------DAPLGTSVVQISAVDADLGVNA-RLVYSLANETQWQFAIDGQSGLI-TTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIF---ERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSL-----------NAENSAVSAK------------FRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLI 2154          

HSP 8 Score: 105.531 bits (262), Expect = 3.463e-22
Identity = 157/692 (22.69%), Postives = 273/692 (39.45%), Query Frame = 1
Query:  844 PKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPH----FKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVD-----ETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGK----HSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDS--LSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGE-TGLIHVNVP-VLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIV---PSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTG 2859
            P ++    + ++PE++ +GT +    A D D    N   +Y I+ +  +     +   R      ++ +NK  D E +    + + A D    PL     ++I +TD+ND QP     F        I+E+      + ++   D D   ++       N  D      T  N  Y+      ++    +D EI S YT+ V+ TD      H+ + ++ + + +VNDN PE                   Y A + E  DPG  V  +   D+D   + L + + + L    + H +  ++   Q+ LI      T    D E        ++  D     LS++ T  ++I DVNDN PIF+  F      ++ S+ E   +G  I++V A+D D G NA++ Y++       T+F +   SGE+      D+E+   +E  + A+    +R     L T   I + + DVND  PVF    Y  +++E P          +     +     N+ ++               Y     + +  FRI   TG I V  P +L           I A D      ++ A+V + I+D    PP++       Y   V      G  + ++ A   D+     V Y I    P  + FS  TN  S N+ + +  D +     + ++  + G
Sbjct:  284 PIFNQSRYFATVPENATVGTSVLQVYASDTDAD-ENGLVEYAINRRQSDKEQMFRIDPRTG----AIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYL------VIVHLPLDREIVSNYTLSVVATDKGTPPLHASK-SIFLRITDVNDNPPEF--------------EQDLYHANVMEVADPGTSVLQVLAHDRD---EGLNSALTYSLAETPETHAQWFQID-PQTGLI-----TTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSF------YNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLAT----DRGG---LSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQV--------------SYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIF---EKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGY-FSIETN--SGNIRIAKPLDHEAKSQVLLNIQATLG 907          

HSP 9 Score: 93.2041 bits (230), Expect = 1.661e-18
Identity = 165/727 (22.70%), Postives = 303/727 (41.68%), Query Frame = 1
Query:  841 SPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIV--NKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLA---------ENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPI--SGELRNIDVFDYEKMEKFELTINASNP-IIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDL-YTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAAD-RSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFS----FNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKK------IWVEASDQGTP 2943
            SPK+S      ++ E +  GT +    A D D   +N   +Y I   + ++ F ++ +        S IV  N   DRE +    +K+ A D     ++G   I + + D+ND QP F   ++   ++E   L + I  + A D D       R   +++VD    + F ++  +G+++    +DYE++ EY + VI +D  H  +  LT+ V + NDN P    ++L          + Q  AY A         E+    F + +++ +D D E    GN  N  +   I+P +E   +  S   +  +   +   +     +  YF ++I  D+   +L +S    +     NDN        Q     +   I E   +G+ ++Q       +G +A+ + SL  ++  + S   +  S  +  +   D E+ + ++L +  S+P      +S    +   + + I D ND  P+F++   Y   + E       + ++   D D  +  NS         +DI   +D  M+T              TG++ VN  +       S+   I+A D   ++PL S    ++++ D NDN P   FP T  Y   ++  E +G  +    A+D D G  G++ Y I P+    S    F  + ES    VT +    + + + +D++           +  SD+G KK      + +E+ D+ TP
Sbjct: 2319 SPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAG-SNARLRYHIVDGNHDNAFVIEPA-------FSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTVLTVRVNDENDNAP----VFL----------AQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSE----GN--NSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAV---SSSGDYFVRIIAKDAGKPALKSSTLLRVQ---ANDNGSGRSQFLQNQ---YRAQISEAAPLGSVVLQ-------LGQDALDQ-SLAIIAGNEESAFELLQSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVV------YDITSGNDEHMFTIDLV----------TGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPK--FPLTE-YVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESG--LVTSAFVFDYEQRQRYDME-----------LLASDMGGKKASVAVRVEIESRDEFTP 2967          

HSP 10 Score: 79.7221 bits (195), Expect = 2.312e-14
Identity = 120/478 (25.10%), Postives = 193/478 (40.38%), Query Frame = 1
Query:  949 NTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSV-------------------KLKAFDGDPNPLSGQ----LDINISLTDINDKQPHFKKTSIHKIINENIPLRSP---ILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTD----GKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSL-STSVTFEISITDVNDNPPIFE-VPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSL---DSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPV--FEKDLYTFTVKE 2271
            N    Y+I     ND F +       +++  +     FDRE QA+  +                   K ++ D   +  +GQ      I I++ D+ND  P F+  S + +   ++P  S    I  + A D DE     L +         + N+F I+  +GE L+A  +D E  S YT+ +  +D            +TI V++ NDN P   +              S+Y   + E+   G  V  +S  D D     LG  +N  L   +    +       QS LI      T    DRE  + Y   ++  D     + S +V  +I++ D+NDN PIFE  P+ G        +   +  G T+++V+A D D+G NA I YSL   +S  S +F I+P +G L        E  +   L + A +     K +    +L  I + I +     PV  F+ + Y   +KE
Sbjct: 1751 NANLSYEIPAGVANDLFHVD------WQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGL---SVPENSEPGVIHTVVASDLDEGPNADLIYSITGG---NLGNKFSIDSSSGE-LSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKL--------------SKYTGSVQEDAPLGTSVVQISAVDAD-----LG--VNARLVYSLANETQWQFAIDGQSGLI-----TTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQ-------VPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARD-----KGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKE 2177          

HSP 11 Score: 77.7962 bits (190), Expect = 9.276e-14
Identity = 150/684 (21.93%), Postives = 265/684 (38.74%), Query Frame = 1
Query:  871 LSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKD--FDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENI----------PLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTD-----GKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQL--ITTKM-----FDREETSQYFAQLICFDSDSN---SLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSS-TQFSIDPISGELRNIDVF-----DYEKMEKFELTINASN---PIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSST--------AIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNL 2790
            +S+ E    GTE+    A+D D       Q   I+Y S+  G      G    +  S ++      D E+++   + + A DG   P      + + + D+ND +P F  +S+   + E+           P+  P   +    E+  +  ++ +  +    + +   F I+  +G ++ A  +D E++SE+ + +   D        S   T+ IEV +VNDN PE                       ++E    G ++ + + +D D  +   G+    L+       R   +L  SQ + +  F++  +T  +      D E   +Y   +   D  SN    L TSVT  + I D ND+ P F  P        S  I +   IG  +  + A D D G+N  + Y +   +   +F I+  +G +  +        D EK  +F L I A +   P  E K S L      + + ++  ++  P F + +Y  T+ E      +V +V  K    +   N +Y       +D++     +    +     Q+ R  +   + + V V D  + S+ S       RS   +  T        A + I + DVNDN P   F     Y ++V      G  I  + A+D D G N  + Y I   +    F+ +  S  L
Sbjct: 1264 VSVREEQPPGTEVVRVRAVDRDH-----GQNASITY-SIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWP--------------QDPIDLQVSEATPVGTIIHNFTATDADTGTN--GDLQYRLI-------RYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQP--EPKKSSL-----NLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTR---GQFDRESQASYV-LPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSP--EFRPGSCYGLSVPENSEPG-VIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGEL 1904          

HSP 12 Score: 72.4034 bits (176), Expect = 3.129e-12
Identity = 135/576 (23.44%), Postives = 226/576 (39.24%), Query Frame = 1
Query: 1084 VSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINP-LTGEILTAGYIDYEIKSEYTIPVIVTD---GKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKD---YESKRLGNQMNHLLDCRIDPHRESL-ELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIF---EVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDI-GNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNP-----IIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKP------LSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGD--NGKVTYRI 2736
            + V L A   D   L+   ++ I L D ND  P F +      ++E     + + Q+ A D D     +LR+     VD    N F I P  +G + T   +D EI+  Y + +I TD    + +  AT+ +++ +VNDN P         +N  T          ++E  + G V+ S+S +D D     + RLG +        +D    S+  L R   K      L+  +  D E   +Y   +I  D+   + +      + + D NDN P+F   + P   +       I E +++   ++ V ATD D  GNN+ + Y ++  +   FS+ P +G +          M + +  +++S       I +      L +   + V   D       F ++ Y   + E                            ++    D  D S + +  N  S     F + ++  I V V  LDRE+   +  ++  +     P       SS   V I ILD NDN P  +F  +  YE  +S    + Y IA L+A D D  +  N +V Y I
Sbjct: 2288 IRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHI---VDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPT-----FPPNNLVT----------VSEATELGAVITSISANDVDTYPALTYRLGAE------STVDIENMSIFALDRYSGK------LVLKRRLDYELQQEYELDVIASDAAHEART---VLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEP-AQEGFSVHPSNGVVS-------VNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSV---------------------VLQLGQDALDQSLAIIAGNEES----AFELLQSKAI-VLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFP--IFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDI 2794          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304900)

HSP 1 Score: 162.925 bits (411), Expect = 9.972e-40
Identity = 175/674 (25.96%), Postives = 287/674 (42.58%), Query Frame = 1
Query:  844 PKWSSPHIYLSLPEHSKIGTE---ITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGK---HSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSL------SSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGET-GLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPS--SFPFSFNTNEESKNLEVTESSDIKF 2820
            P++S     + +PE    GTE   +    A D DQ   N   +Y I   +    F +     D    +SL+  K  D E   +  + ++A DG     S    + +++ D ND  P F  +   + + EN+P+   I++++A D DE    ++ +      D        ++P TG + T   +D E +  +   V+  DG     S  +++ I V++VNDN+P  +  Y              Y A + E++ PG  V +++ +D D E  RL  ++           R    +     + +    +   +  D ++  ++   L    +DS   S + T  I+ITD N+  PIFE         +S S+ E   +GTT++ V ATD D+G NA I YSL+        S   FSI+P +G +      D E    + LT+ A +       +  L     + + + DVND  P F+  LY  ++ E       V +V   D D+     +   K + +  DI D S               F I  T G I  N   LDRE ++ F     A D+   PLSST  VQI++ DVND+PP +    +    + V     +G  +  + A+DPD G N  V Y I+    S  FS  T   S+  ++   +++ +
Sbjct:  579 PQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQG-NNAAIRYAIIGGNTQSQFSIDSMSGD----VSLV--KPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNF---PLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKY--------------YEANVGEDQPPGTPVTTVTATDPD-EDSRLHYEIT------TGNTRGRFAITSQNGRGL----ITIAQSLDYKQEKRFL--LTVAATDSGGRSDTATVHINITDANNFAPIFE------NAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKD-----GGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGL---NGRIKYLLSDRDIEDGS---------------FVIDPTSGTIRTN-KGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFA---SDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDY 1182          

HSP 2 Score: 158.688 bits (400), Expect = 1.813e-38
Identity = 180/647 (27.82%), Postives = 276/647 (42.66%), Query Frame = 1
Query:  841 SPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGE--ILTAGYIDYEIKSEYTIPVIVTD-GKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQ---LITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLD--SLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKI-SSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLW-----VFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIV 2739
            +P++ +     S+ E+  +G  I    A D D+   N    Y IS +  +D F L    R  + +      K  DRE+Q   + ++ A DG   P S    + I++ D+ND  P F        + E+ P  +P+  + A D DE    +L +E         R RF I    G   I  A  +DY+ +  + + V  TD G  SD AT+ I + + N              NF     ++ Y A + E+   G  V  +S +D D     +  Q+ + L+       ES+    S      + Q   ++T    DRE TS Y   +   D  + SLS +   EI +TDVNDN P F+ P      ++  SI E   +GT+++QV A+D D+G N  I+Y L    +    F IDP SG +R     D E +  F LT  A +     K S  L +  ++ + +EDVND  P F  D  T  V E       VG++   D D       +Y  I  +     DS+   + T   S+ +Q   + E          LD E     F   ++AA     PL + A ++I + DVNDN P+      +F   +N+  +    E     I  + A D D+ D  K+ YRI+
Sbjct:  686 APRFYTSQFQESVLENVPVGYNIIRVQAYDSDEG-ANAEITYSISER--DDNFPLAVDPRTGWVQ----TIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDS--RLHYEITTG---NTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDAN--------------NFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVG---VNAQITYSLN------EESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSP------LYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVD-----KGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGD-----DSNAFSLVTRPGSERAQLLTMTE----------LDYESTRKRFELVVRAA---SPPLRNDAHIEILVTDVNDNAPVLRDFQVIF---NNFRDHFPSGE-----IGRIPAFDADVSD--KLHYRIL 1258          

HSP 3 Score: 126.331 bits (316), Expect = 1.537e-28
Identity = 145/562 (25.80%), Postives = 244/562 (43.42%), Query Frame = 1
Query:  622 PFFLDSKTYEFRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKL-KHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVR-----NRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKH---SDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCR--------IDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYS-LDSLSSTQFSIDPISG----ELRNIDVFDYEKMEK-FELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVF 2238
            P  +D +T   +  K +DREE  RF  Q + ++  +  K   S ++   +   +D+ P               +PK+   ++    P     GT +T   A DPD+   ++   Y+I+  +    F +   +GR     +++  + D+ +EK+  ++V       D    S    ++I++TD N+  P F+       + E+ P+ + +L + A D D     ++ +  +   +E++      + F INP TG I+T   +D E  S Y + V   DG +   SD   + I V +VNDN P           FK+P     Y+A + E+   G  V  ++ SD D     L  ++ +LL  R        IDP   ++                T K  DRE  + +    I  D  S  LS++V  +I + DVND+PP F      S  I  Y + E   +G+ + ++ A D D G NA++ YS +    S  FS+    G    +L  +   DYE   K FEL + A++P + R ++        I + + DVND  PV 
Sbjct:  736 PLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQ-DVNDNDPAF-------------NPKYYEANVGEDQPP----GTPVTTVTATDPDE---DSRLHYEITTGNTRGRFAITSQNGRG---LITIAQSLDYKQEKRFLLTVAAT----DSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLN---EESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPA----------FKSP----LYQASILEDALVGTSVIQVAASDPDVG---LNGRIKYLLSDRDIEDGSFVIDPTSGTIR---------------TNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTF-----ASDKITLY-VPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAASPPL-RNDAH-------IEILVTDVNDNAPVL 1220          

HSP 4 Score: 124.79 bits (312), Expect = 3.920e-28
Identity = 153/669 (22.87%), Postives = 280/669 (41.85%), Query Frame = 1
Query:  943 PTNTTQKYKISYQSVNDG-FKLKHSGRDHYEKLSLIVNKDF---DREKQATVSVKLKAFDGDPNPLSGQLDINISLTDIND-------------KQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGK---HSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQ----LITTK-MFDREETSQYFAQLICFD---SDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGT---TIVQVKATDRDIGNNAIIRYS-LDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIG---ETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDL 2844
            P +  Q  K+S+  VND  F ++H  RD      L+ ++D    +   + +++  ++    D      +L I     + ND             + P+F++      + E  P  + +  + A+D ++S    + +   + +D   ++ F ++  TG + T+  +D E+   +   V+ TD      S   TL + V + ND++P                 + Q+ A + E    G  V +L  +D+D     +G   N  ++  I+   +   L + Q   I        +I+T+   DRE +  Y   +   D   + S   + + + ++ + D NDN P F      S   ++  + E    GT   T+  ++ATD D GNNA IRY+ +   + +QFSID +SG++  +   DYE +  + L I A +       S       ++ VN+ D ND  P F    +  +V E                         Y  I    +D  + +++++ T S S+    F +     TG +    P LDRE+   F+F++ A D    P S+++ V I + DVNDN P +   N   YE NV   +  G  +  + A DPD  ++ ++ Y I   +    F    ++    +T +  + + + + F L
Sbjct:  267 PRSVCQHCKVSFLDVNDERFAIEHQSRD------LVASRDVCIAESMWKVSITFNIRCDRRDIVDSDHRLKIVYHHQEFNDTDIARRVRRELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPEDS---PVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTF--------------EAEQFEASIREGATVGSTVITLRATDQD-----IGK--NAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQF------SERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQD-----GGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLEN--------------------VPVGYNIIRVQAYDSDEGANAEI-TYSISERDDNFPLAVDPRTGWVQTIKP-LDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAF---NPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLL 867          

HSP 5 Score: 114.775 bits (286), Expect = 5.129e-25
Identity = 156/735 (21.22%), Postives = 292/735 (39.73%), Query Frame = 1
Query:  841 SPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSG-----RDHYEKLSLIVNKDFDREKQATVSVKLKAFD---GDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRS---PILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDG---KHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSS-TQFSIDPISGE--LRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIG-ETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVD 2991
            SP + +     S+ E + +G+ +    A D D    N   +Y I  ++V DG  L         R       +      DRE   +  + + A D         +    + + + D ND  P F + +    + E+    +    +  + A D D+ +   +R+     +    +++F I+ ++G++     +DYE    Y + +   DG     S+   L + V + NDN P                 +SQ++  + EN   G+ +  +   D D   +    ++ + +  R D    +++ R    +        T K  DREE  ++  Q++  D      S S +  I++ DVNDN P F   +      +  ++ E    GT +  V ATD D   ++ + Y + + ++  +F+I   +G   +      DY++ ++F LT+ A++       S        + +NI D N+  P+FE   Y+ +V E                      ++    +  N    Y  ++  +    + D    F I  +TG I  N P LDRE  S +   + A D     LS T  V+I + DVNDN P +  P    Y+ ++     +G  +  + A+DPD+G NG++ Y +                + ++ + S         F +D ++G I   + +    V    +   A D+G+PP      + I + +V+
Sbjct:  461 SPTFEAEQFEASIREGATVGSTVITLRATDQDIG-KNAEIEYGI--EAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAI---IGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRF--------------YTSQFQESVLENVPVGYNIIRVQAYDSD---EGANAEITYSISERDDNFPLAVDPRTGWVQ--------TIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKY------YEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATD-------SGGRSDTATVHINITDANNFAPIFENAPYSASVFE-----------DAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDP---FSINPQTGAIVTNAP-LDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSP---LYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLL---------------SDRDIEDGS---------FVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVN 1107          

HSP 6 Score: 107.457 bits (267), Expect = 6.988e-23
Identity = 118/491 (24.03%), Postives = 202/491 (41.14%), Query Frame = 1
Query: 1558 YRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVP-FQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQ----------FSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            Y A + E +  G  V +  V  +D E   +   M  LLD R     +SL    S++ ++      T+   DRE    ++ +++  D      S + T ++++ D ND+ P FE   F+ S       I+EG  +G+T++ ++ATD+DIG NA I Y +++++             F ID  SG +      D E  + + L + A++  +    S+       + V + D ND  P F +  YT  V E          V       + + N+   +       I  ++ SQ   +S S        G+  L    V  LD E + S+   I+A D      S+T  + + ++D NDN P +    T  ++ +V     +GY I  ++A D D G N ++TY I           +E   N  +               +D  TG +   + +   + G     V A D G PP+     + I + +V+ N
Sbjct:  364 YVASVLEEQPAGAAVTT--VRARDPEDSPVVYSMVSLLDSR----SQSLFKVDSRTGVV-----TTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEAS-------IREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAAD--LASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAI----IGGNTQSQFSIDSMS--------GDVSL----VKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFY---TSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSI-----------SERDDNFPLA--------------VDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDN 790          

HSP 7 Score: 78.9518 bits (193), Expect = 3.803e-14
Identity = 90/407 (22.11%), Postives = 167/407 (41.03%), Query Frame = 1
Query: 1867 DVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYS----LDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQY--------FRIGETGLIHVNVPVLDREKISSFSFKIQAAD----RSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGY---CIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNGHGSSQGQFNK 3030
            ++ +  P FE      + ++  S+ E    G  +  V+A D +   ++ + YS    LDS S + F +D  +G +      D E M+     + A++     ++     TLQ   VN+ D ND  P FE + +  +++EG                  +   S    + +   DI  +++ +    + +D +          FRI     +      LDRE   S+   + AAD    +SE+  ++TA VQ+++LD NDN P +   +   Y V V   +  G     +A+++A D D G+N  + Y I                         I  N    F +D  +G++ + + +    V S ++ + A D G+P +    +L +N+++ + N       QF +
Sbjct:  351 ELRNQSPYFE------QALYVASVLEEQPAGAAVTTVRARDPE---DSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTT--TLQ---VNVLDCNDHSPTFEAEQFEASIREG------------------ATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSER-RTATASVQVKVLDDNDNYPQF---SERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAI-------------------------IGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQE 696          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304899)

HSP 1 Score: 162.54 bits (410), Expect = 1.181e-39
Identity = 175/674 (25.96%), Postives = 287/674 (42.58%), Query Frame = 1
Query:  844 PKWSSPHIYLSLPEHSKIGTE---ITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGK---HSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSL------SSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGET-GLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPS--SFPFSFNTNEESKNLEVTESSDIKF 2820
            P++S     + +PE    GTE   +    A D DQ   N   +Y I   +    F +     D    +SL+  K  D E   +  + ++A DG     S    + +++ D ND  P F  +   + + EN+P+   I++++A D DE    ++ +      D        ++P TG + T   +D E +  +   V+  DG     S  +++ I V++VNDN+P  +  Y              Y A + E++ PG  V +++ +D D E  RL  ++           R    +     + +    +   +  D ++  ++   L    +DS   S + T  I+ITD N+  PIFE         +S S+ E   +GTT++ V ATD D+G NA I YSL+        S   FSI+P +G +      D E    + LT+ A +       +  L     + + + DVND  P F+  LY  ++ E       V +V   D D+     +   K + +  DI D S               F I  T G I  N   LDRE ++ F     A D+   PLSST  VQI++ DVND+PP +    +    + V     +G  +  + A+DPD G N  V Y I+    S  FS  T   S+  ++   +++ +
Sbjct:  579 PQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQG-NNAAIRYAIIGGNTQSQFSIDSMSGD----VSLV--KPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNF---PLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKY--------------YEANVGEDQPPGTPVTTVTATDPD-EDSRLHYEIT------TGNTRGRFAITSQNGRGL----ITIAQSLDYKQEKRFL--LTVAATDSGGRSDTATVHINITDANNFAPIFE------NAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKD-----GGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGL---NGRIKYLLSDRDIEDGS---------------FVIDPTSGTIRTN-KGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFA---SDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDY 1182          

HSP 2 Score: 158.688 bits (400), Expect = 2.075e-38
Identity = 180/647 (27.82%), Postives = 276/647 (42.66%), Query Frame = 1
Query:  841 SPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGE--ILTAGYIDYEIKSEYTIPVIVTD-GKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQ---LITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLD--SLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKI-SSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLW-----VFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIV 2739
            +P++ +     S+ E+  +G  I    A D D+   N    Y IS +  +D F L    R  + +      K  DRE+Q   + ++ A DG   P S    + I++ D+ND  P F        + E+ P  +P+  + A D DE    +L +E         R RF I    G   I  A  +DY+ +  + + V  TD G  SD AT+ I + + N              NF     ++ Y A + E+   G  V  +S +D D     +  Q+ + L+       ES+    S      + Q   ++T    DRE TS Y   +   D  + SLS +   EI +TDVNDN P F+ P      ++  SI E   +GT+++QV A+D D+G N  I+Y L    +    F IDP SG +R     D E +  F LT  A +     K S  L +  ++ + +EDVND  P F  D  T  V E       VG++   D D       +Y  I  +     DS+   + T   S+ +Q   + E          LD E     F   ++AA     PL + A ++I + DVNDN P+      +F   +N+  +    E     I  + A D D+ D  K+ YRI+
Sbjct:  686 APRFYTSQFQESVLENVPVGYNIIRVQAYDSDEG-ANAEITYSISER--DDNFPLAVDPRTGWVQ----TIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDS--RLHYEITTG---NTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDAN--------------NFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVG---VNAQITYSLN------EESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSP------LYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVD-----KGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGD-----DSNAFSLVTRPGSERAQLLTMTE----------LDYESTRKRFELVVRAA---SPPLRNDAHIEILVTDVNDNAPVLRDFQVIF---NNFRDHFPSGE-----IGRIPAFDADVSD--KLHYRIL 1258          

HSP 3 Score: 125.946 bits (315), Expect = 1.865e-28
Identity = 145/562 (25.80%), Postives = 244/562 (43.42%), Query Frame = 1
Query:  622 PFFLDSKTYEFRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKL-KHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVR-----NRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKH---SDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCR--------IDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYS-LDSLSSTQFSIDPISG----ELRNIDVFDYEKMEK-FELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVF 2238
            P  +D +T   +  K +DREE  RF  Q + ++  +  K   S ++   +   +D+ P               +PK+   ++    P     GT +T   A DPD+   ++   Y+I+  +    F +   +GR     +++  + D+ +EK+  ++V       D    S    ++I++TD N+  P F+       + E+ P+ + +L + A D D     ++ +  +   +E++      + F INP TG I+T   +D E  S Y + V   DG +   SD   + I V +VNDN P           FK+P     Y+A + E+   G  V  ++ SD D     L  ++ +LL  R        IDP   ++                T K  DRE  + +    I  D  S  LS++V  +I + DVND+PP F      S  I  Y + E   +G+ + ++ A D D G NA++ YS +    S  FS+    G    +L  +   DYE   K FEL + A++P + R ++        I + + DVND  PV 
Sbjct:  736 PLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQ-DVNDNDPAF-------------NPKYYEANVGEDQPP----GTPVTTVTATDPDE---DSRLHYEITTGNTRGRFAITSQNGRG---LITIAQSLDYKQEKRFLLTVAAT----DSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLN---EESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPA----------FKSP----LYQASILEDALVGTSVIQVAASDPDVG---LNGRIKYLLSDRDIEDGSFVIDPTSGTIR---------------TNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTF-----ASDKITLY-VPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAASPPL-RNDAH-------IEILVTDVNDNAPVL 1220          

HSP 4 Score: 124.405 bits (311), Expect = 5.728e-28
Identity = 153/669 (22.87%), Postives = 280/669 (41.85%), Query Frame = 1
Query:  943 PTNTTQKYKISYQSVNDG-FKLKHSGRDHYEKLSLIVNKDF---DREKQATVSVKLKAFDGDPNPLSGQLDINISLTDIND-------------KQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGK---HSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQ----LITTK-MFDREETSQYFAQLICFD---SDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGT---TIVQVKATDRDIGNNAIIRYS-LDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIG---ETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDL 2844
            P +  Q  K+S+  VND  F ++H  RD      L+ ++D    +   + +++  ++    D      +L I     + ND             + P+F++      + E  P  + +  + A+D ++S    + +   + +D   ++ F ++  TG + T+  +D E+   +   V+ TD      S   TL + V + ND++P                 + Q+ A + E    G  V +L  +D+D     +G   N  ++  I+   +   L + Q   I        +I+T+   DRE +  Y   +   D   + S   + + + ++ + D NDN P F      S   ++  + E    GT   T+  ++ATD D GNNA IRY+ +   + +QFSID +SG++  +   DYE +  + L I A +       S       ++ VN+ D ND  P F    +  +V E                         Y  I    +D  + +++++ T S S+    F +     TG +    P LDRE+   F+F++ A D    P S+++ V I + DVNDN P +   N   YE NV   +  G  +  + A DPD  ++ ++ Y I   +    F    ++    +T +  + + + + F L
Sbjct:  267 PRSVCQHCKVSFLDVNDERFAIEHQSRD------LVASRDVCIAESMWKVSITFNIRCDRRDIVDSDHRLKIVYHHQEFNDTDIARRVRRELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPEDS---PVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTF--------------EAEQFEASIREGATVGSTVITLRATDQD-----IGK--NAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQF------SERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQD-----GGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLEN--------------------VPVGYNIIRVQAYDSDEGANAEI-TYSISERDDNFPLAVDPRTGWVQTIKP-LDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAF---NPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLL 867          

HSP 5 Score: 114.39 bits (285), Expect = 6.660e-25
Identity = 159/735 (21.63%), Postives = 293/735 (39.86%), Query Frame = 1
Query:  841 SPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSG-----RDHYEKLSLIVNKDFDREKQATVSVKLKAFD---GDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRS---PILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDG---KHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSS-TQFSIDPISGE--LRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIG-ETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVD 2991
            SP + +     S+ E + +G+ +    A D D    N   +Y I  ++V DG  L         R       +      DRE   +  + + A D         +    + + + D ND  P F + +    + E+    +    +  + A D D+ +   +R+     +    +++F I+ ++G++     +DYE    Y + +   DG     S+   L + V + NDN P                 +SQ++  + EN   G+ +  +   D D   +    ++ + +  R D    +++ R    +        T K  DREE  ++  Q++  D      S S +  I++ DVNDN P F   +      +  ++ E    GT +  V ATD D   ++ + Y + + ++  +F+I   +G   +      DY++ ++F LT+ A++       S        + +NI D N+  P+FE   Y+ +V E       V  V   D             +  N    Y  ++  +    + D    F I  +TG I  N P LDRE  S +   + A D     LS T  V+I + DVNDN P +  P    Y+ ++     +G  +  + A+DPD+G NG++ Y +                + ++ + S         F +D ++G I   + +    V    +   A D+G+PP      + I + +V+
Sbjct:  461 SPTFEAEQFEASIREGATVGSTVITLRATDQDIG-KNAEIEYGI--EAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAI---IGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRF--------------YTSQFQESVLENVPVGYNIIRVQAYDSD---EGANAEITYSISERDDNFPLAVDPRTGWVQ--------TIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKY------YEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATD-------SGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDS-----------DVGVNAQITYSLNEESINGLGSPDP---FSINPQTGAIVTNAP-LDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSP---LYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLL---------------SDRDIEDGS---------FVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVN 1107          

HSP 6 Score: 107.457 bits (267), Expect = 8.482e-23
Identity = 118/491 (24.03%), Postives = 202/491 (41.14%), Query Frame = 1
Query: 1558 YRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVP-FQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQ----------FSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            Y A + E +  G  V +  V  +D E   +   M  LLD R     +SL    S++ ++      T+   DRE    ++ +++  D      S + T ++++ D ND+ P FE   F+ S       I+EG  +G+T++ ++ATD+DIG NA I Y +++++             F ID  SG +      D E  + + L + A++  +    S+       + V + D ND  P F +  YT  V E          V       + + N+   +       I  ++ SQ   +S S        G+  L    V  LD E + S+   I+A D      S+T  + + ++D NDN P +    T  ++ +V     +GY I  ++A D D G N ++TY I           +E   N  +               +D  TG +   + +   + G     V A D G PP+     + I + +V+ N
Sbjct:  364 YVASVLEEQPAGAAVTT--VRARDPEDSPVVYSMVSLLDSR----SQSLFKVDSRTGVV-----TTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEAS-------IREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAAD--LASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAI----IGGNTQSQFSIDSMS--------GDVSL----VKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFY---TSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSI-----------SERDDNFPLA--------------VDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDN 790          

HSP 7 Score: 78.5666 bits (192), Expect = 4.350e-14
Identity = 90/407 (22.11%), Postives = 167/407 (41.03%), Query Frame = 1
Query: 1867 DVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYS----LDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQY--------FRIGETGLIHVNVPVLDREKISSFSFKIQAAD----RSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGY---CIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNGHGSSQGQFNK 3030
            ++ +  P FE      + ++  S+ E    G  +  V+A D +   ++ + YS    LDS S + F +D  +G +      D E M+     + A++     ++     TLQ   VN+ D ND  P FE + +  +++EG                  +   S    + +   DI  +++ +    + +D +          FRI     +      LDRE   S+   + AAD    +SE+  ++TA VQ+++LD NDN P +   +   Y V V   +  G     +A+++A D D G+N  + Y I                         I  N    F +D  +G++ + + +    V S ++ + A D G+P +    +L +N+++ + N       QF +
Sbjct:  351 ELRNQSPYFE------QALYVASVLEEQPAGAAVTTVRARDPE---DSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTT--TLQ---VNVLDCNDHSPTFEAEQFEASIREG------------------ATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSER-RTATASVQVKVLDDNDNYPQF---SERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAI-------------------------IGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQE 696          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0300578)

HSP 1 Score: 162.54 bits (410), Expect = 1.181e-39
Identity = 175/674 (25.96%), Postives = 287/674 (42.58%), Query Frame = 1
Query:  844 PKWSSPHIYLSLPEHSKIGTE---ITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGK---HSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSL------SSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGET-GLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPS--SFPFSFNTNEESKNLEVTESSDIKF 2820
            P++S     + +PE    GTE   +    A D DQ   N   +Y I   +    F +     D    +SL+  K  D E   +  + ++A DG     S    + +++ D ND  P F  +   + + EN+P+   I++++A D DE    ++ +      D        ++P TG + T   +D E +  +   V+  DG     S  +++ I V++VNDN+P  +  Y              Y A + E++ PG  V +++ +D D E  RL  ++           R    +     + +    +   +  D ++  ++   L    +DS   S + T  I+ITD N+  PIFE         +S S+ E   +GTT++ V ATD D+G NA I YSL+        S   FSI+P +G +      D E    + LT+ A +       +  L     + + + DVND  P F+  LY  ++ E       V +V   D D+     +   K + +  DI D S               F I  T G I  N   LDRE ++ F     A D+   PLSST  VQI++ DVND+PP +    +    + V     +G  +  + A+DPD G N  V Y I+    S  FS  T   S+  ++   +++ +
Sbjct:  579 PQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQG-NNAAIRYAIIGGNTQSQFSIDSMSGD----VSLV--KPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNF---PLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKY--------------YEANVGEDQPPGTPVTTVTATDPD-EDSRLHYEIT------TGNTRGRFAITSQNGRGL----ITIAQSLDYKQEKRFL--LTVAATDSGGRSDTATVHINITDANNFAPIFE------NAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKD-----GGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGL---NGRIKYLLSDRDIEDGS---------------FVIDPTSGTIRTN-KGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFA---SDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDY 1182          

HSP 2 Score: 158.688 bits (400), Expect = 2.075e-38
Identity = 180/647 (27.82%), Postives = 276/647 (42.66%), Query Frame = 1
Query:  841 SPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGE--ILTAGYIDYEIKSEYTIPVIVTD-GKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQ---LITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLD--SLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKI-SSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLW-----VFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIV 2739
            +P++ +     S+ E+  +G  I    A D D+   N    Y IS +  +D F L    R  + +      K  DRE+Q   + ++ A DG   P S    + I++ D+ND  P F        + E+ P  +P+  + A D DE    +L +E         R RF I    G   I  A  +DY+ +  + + V  TD G  SD AT+ I + + N              NF     ++ Y A + E+   G  V  +S +D D     +  Q+ + L+       ES+    S      + Q   ++T    DRE TS Y   +   D  + SLS +   EI +TDVNDN P F+ P      ++  SI E   +GT+++QV A+D D+G N  I+Y L    +    F IDP SG +R     D E +  F LT  A +     K S  L +  ++ + +EDVND  P F  D  T  V E       VG++   D D       +Y  I  +     DS+   + T   S+ +Q   + E          LD E     F   ++AA     PL + A ++I + DVNDN P+      +F   +N+  +    E     I  + A D D+ D  K+ YRI+
Sbjct:  686 APRFYTSQFQESVLENVPVGYNIIRVQAYDSDEG-ANAEITYSISER--DDNFPLAVDPRTGWVQ----TIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDS--RLHYEITTG---NTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDAN--------------NFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVG---VNAQITYSLN------EESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSP------LYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVD-----KGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGD-----DSNAFSLVTRPGSERAQLLTMTE----------LDYESTRKRFELVVRAA---SPPLRNDAHIEILVTDVNDNAPVLRDFQVIF---NNFRDHFPSGE-----IGRIPAFDADVSD--KLHYRIL 1258          

HSP 3 Score: 125.946 bits (315), Expect = 1.865e-28
Identity = 145/562 (25.80%), Postives = 244/562 (43.42%), Query Frame = 1
Query:  622 PFFLDSKTYEFRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKL-KHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVR-----NRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKH---SDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCR--------IDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYS-LDSLSSTQFSIDPISG----ELRNIDVFDYEKMEK-FELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVF 2238
            P  +D +T   +  K +DREE  RF  Q + ++  +  K   S ++   +   +D+ P               +PK+   ++    P     GT +T   A DPD+   ++   Y+I+  +    F +   +GR     +++  + D+ +EK+  ++V       D    S    ++I++TD N+  P F+       + E+ P+ + +L + A D D     ++ +  +   +E++      + F INP TG I+T   +D E  S Y + V   DG +   SD   + I V +VNDN P           FK+P     Y+A + E+   G  V  ++ SD D     L  ++ +LL  R        IDP   ++                T K  DRE  + +    I  D  S  LS++V  +I + DVND+PP F      S  I  Y + E   +G+ + ++ A D D G NA++ YS +    S  FS+    G    +L  +   DYE   K FEL + A++P + R ++        I + + DVND  PV 
Sbjct:  736 PLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQ-DVNDNDPAF-------------NPKYYEANVGEDQPP----GTPVTTVTATDPDE---DSRLHYEITTGNTRGRFAITSQNGRG---LITIAQSLDYKQEKRFLLTVAAT----DSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLN---EESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPA----------FKSP----LYQASILEDALVGTSVIQVAASDPDVG---LNGRIKYLLSDRDIEDGSFVIDPTSGTIR---------------TNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTF-----ASDKITLY-VPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAASPPL-RNDAH-------IEILVTDVNDNAPVL 1220          

HSP 4 Score: 124.405 bits (311), Expect = 5.728e-28
Identity = 153/669 (22.87%), Postives = 280/669 (41.85%), Query Frame = 1
Query:  943 PTNTTQKYKISYQSVNDG-FKLKHSGRDHYEKLSLIVNKDF---DREKQATVSVKLKAFDGDPNPLSGQLDINISLTDIND-------------KQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGK---HSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQ----LITTK-MFDREETSQYFAQLICFD---SDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGT---TIVQVKATDRDIGNNAIIRYS-LDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIG---ETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDL 2844
            P +  Q  K+S+  VND  F ++H  RD      L+ ++D    +   + +++  ++    D      +L I     + ND             + P+F++      + E  P  + +  + A+D ++S    + +   + +D   ++ F ++  TG + T+  +D E+   +   V+ TD      S   TL + V + ND++P                 + Q+ A + E    G  V +L  +D+D     +G   N  ++  I+   +   L + Q   I        +I+T+   DRE +  Y   +   D   + S   + + + ++ + D NDN P F      S   ++  + E    GT   T+  ++ATD D GNNA IRY+ +   + +QFSID +SG++  +   DYE +  + L I A +       S       ++ VN+ D ND  P F    +  +V E                         Y  I    +D  + +++++ T S S+    F +     TG +    P LDRE+   F+F++ A D    P S+++ V I + DVNDN P +   N   YE NV   +  G  +  + A DPD  ++ ++ Y I   +    F    ++    +T +  + + + + F L
Sbjct:  267 PRSVCQHCKVSFLDVNDERFAIEHQSRD------LVASRDVCIAESMWKVSITFNIRCDRRDIVDSDHRLKIVYHHQEFNDTDIARRVRRELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPEDS---PVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTF--------------EAEQFEASIREGATVGSTVITLRATDQD-----IGK--NAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQF------SERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQD-----GGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLEN--------------------VPVGYNIIRVQAYDSDEGANAEI-TYSISERDDNFPLAVDPRTGWVQTIKP-LDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAF---NPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLL 867          

HSP 5 Score: 114.39 bits (285), Expect = 6.660e-25
Identity = 159/735 (21.63%), Postives = 293/735 (39.86%), Query Frame = 1
Query:  841 SPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSG-----RDHYEKLSLIVNKDFDREKQATVSVKLKAFD---GDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRS---PILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDG---KHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSS-TQFSIDPISGE--LRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIG-ETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVD 2991
            SP + +     S+ E + +G+ +    A D D    N   +Y I  ++V DG  L         R       +      DRE   +  + + A D         +    + + + D ND  P F + +    + E+    +    +  + A D D+ +   +R+     +    +++F I+ ++G++     +DYE    Y + +   DG     S+   L + V + NDN P                 +SQ++  + EN   G+ +  +   D D   +    ++ + +  R D    +++ R    +        T K  DREE  ++  Q++  D      S S +  I++ DVNDN P F   +      +  ++ E    GT +  V ATD D   ++ + Y + + ++  +F+I   +G   +      DY++ ++F LT+ A++       S        + +NI D N+  P+FE   Y+ +V E       V  V   D             +  N    Y  ++  +    + D    F I  +TG I  N P LDRE  S +   + A D     LS T  V+I + DVNDN P +  P    Y+ ++     +G  +  + A+DPD+G NG++ Y +                + ++ + S         F +D ++G I   + +    V    +   A D+G+PP      + I + +V+
Sbjct:  461 SPTFEAEQFEASIREGATVGSTVITLRATDQDIG-KNAEIEYGI--EAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAI---IGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRF--------------YTSQFQESVLENVPVGYNIIRVQAYDSD---EGANAEITYSISERDDNFPLAVDPRTGWVQ--------TIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKY------YEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATD-------SGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDS-----------DVGVNAQITYSLNEESINGLGSPDP---FSINPQTGAIVTNAP-LDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSP---LYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLL---------------SDRDIEDGS---------FVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVN 1107          

HSP 6 Score: 107.457 bits (267), Expect = 8.482e-23
Identity = 118/491 (24.03%), Postives = 202/491 (41.14%), Query Frame = 1
Query: 1558 YRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVP-FQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQ----------FSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            Y A + E +  G  V +  V  +D E   +   M  LLD R     +SL    S++ ++      T+   DRE    ++ +++  D      S + T ++++ D ND+ P FE   F+ S       I+EG  +G+T++ ++ATD+DIG NA I Y +++++             F ID  SG +      D E  + + L + A++  +    S+       + V + D ND  P F +  YT  V E          V       + + N+   +       I  ++ SQ   +S S        G+  L    V  LD E + S+   I+A D      S+T  + + ++D NDN P +    T  ++ +V     +GY I  ++A D D G N ++TY I           +E   N  +               +D  TG +   + +   + G     V A D G PP+     + I + +V+ N
Sbjct:  364 YVASVLEEQPAGAAVTT--VRARDPEDSPVVYSMVSLLDSR----SQSLFKVDSRTGVV-----TTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEAS-------IREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAAD--LASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAI----IGGNTQSQFSIDSMS--------GDVSL----VKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFY---TSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSI-----------SERDDNFPLA--------------VDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDN 790          

HSP 7 Score: 78.5666 bits (192), Expect = 4.350e-14
Identity = 90/407 (22.11%), Postives = 167/407 (41.03%), Query Frame = 1
Query: 1867 DVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYS----LDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQY--------FRIGETGLIHVNVPVLDREKISSFSFKIQAAD----RSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGY---CIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNGHGSSQGQFNK 3030
            ++ +  P FE      + ++  S+ E    G  +  V+A D +   ++ + YS    LDS S + F +D  +G +      D E M+     + A++     ++     TLQ   VN+ D ND  P FE + +  +++EG                  +   S    + +   DI  +++ +    + +D +          FRI     +      LDRE   S+   + AAD    +SE+  ++TA VQ+++LD NDN P +   +   Y V V   +  G     +A+++A D D G+N  + Y I                         I  N    F +D  +G++ + + +    V S ++ + A D G+P +    +L +N+++ + N       QF +
Sbjct:  351 ELRNQSPYFE------QALYVASVLEEQPAGAAVTTVRARDPE---DSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTT--TLQ---VNVLDCNDHSPTFEAEQFEASIREG------------------ATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSER-RTATASVQVKVLDDNDNYPQF---SERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAI-------------------------IGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQE 696          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 235.728 bits (600), Expect = 3.713e-63
Identity = 232/869 (26.70%), Postives = 390/869 (44.88%), Query Frame = 1
Query:  400 IDSRNYSMLVLIRFCILLSYFFNKEIHGQIEIHFKVVEESPTNSVIGNIH---NQALKQKGGVGSGDYYYKSIT---DIEPFFLDSKTYE-FRVSKRVDREEIC----------RFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKI-SYQSVNDGFKLKHSGRDHYEKL-SLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHS-DQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDP-GFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTP 2943
            +D R++ +L  +  C  L     +E+       + + EE   N +IGNI    N +        + +  Y+ ++   D     + S T E F  S R+DRE++C           F+++ ++      ++ I+ +II  +   T+D++P                  + SP I +S+PE++ I +   +P A DPD  P N+  KY++ + QS    F L        EK   LIV ++ DRE++ T  +K+K  DG     S    + +++TD+ND +P FK++ I   I EN P+ + ++QL+A D D     ++++ F   V    R  F +N  TG I     +D E  + + + V+ +DG  S  +AT+TI V +VNDN P I + Y+      T          +   KDP    +A ++VSDKD +       +N  + C I+       L+       + + L T+ + D E T +Y  +++  DS   SL+ +    + + D NDNPPIF  P      +   ++ E       +  + ATD D G NA I Y L   +++ F +D  +G L    VFD E+ E+F  T+ A +       ++ L +   + V I D ND  P F  + + F V E                    KY++     ++   D     ++ +  +  +D   +    ++G+I  NV   DRE+ SS++F ++A D    P SS A V I ++DVNDN P+ ++P ++     V      G  +A + A D D G N ++ Y IV                           N   +F +D  TGNI + +K  ++D+G  ++ V  SD G P
Sbjct:    1 MDLRDFFLLATLVACFWLDPTIAQELI------YPIREELQENVLIGNIPKDLNISHMNSATGATSNLVYRLVSKAGDTPLLRVMSNTGEIFTTSNRIDREKLCPGPSFEDSECSFEIEVVILPNDY-FRLIKIKIIVKD---TNDNAPM-----------------FPSPVINISIPENTLINSRFAIPSATDPDTGP-NSVHKYELLNGQS---AFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARATITINVTDVNDNAPNIDLRYIISPTNGT---------VMLSEKDPINTKIALITVSDKDTD-------VNGKVICFIE-KDVPFHLKAVYD---NQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQP------VIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGP-NASFFDLDRKTGVLTASRVFDREEQERFLFTVTARD-----NGTRALQSQAAVIVTILDENDNSPKFTHNHFQFFVSEN-----------------LPKYSTVGVITVT---DADAGENAVVRLSILNDNENFILDPDSGVIKSNVS-FDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVSG-------------------------NVRSLFRIDPVTGNITLEEKPTIADIGLHRLVVNISDLGYP 760          

HSP 2 Score: 108.997 bits (271), Expect = 2.206e-23
Identity = 152/653 (23.28%), Postives = 247/653 (37.83%), Query Frame = 1
Query: 1117 PNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGE----ILTAGYIDYEIKSEYTIPVIVTDG---KHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAII--------RYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIG----------ETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHN-YEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            PN     + I I + D ND  P F    I+  I EN  + S      A D D       ++E  N   ++      +    GE    ++    +D E K  Y + V V DG   + S  A L + V +VNDN P                + SQ   ++ EN   G  V  L  +D D  +     ++ ++   ++ P    L    + + LI        +  DREET+ +  +L    SD +S     T  I++TDVNDN P  ++ +  S    +  + E   I T I  +  +D+D   N  +         + L ++   Q+ ++  +       + DYE  +++   I AS+      N   L     + V +ED ND  P+F + +    V E                              +N  D++ ++ S    +S  +A   +++G          +TG++  +  V DRE+   F F + A D   + L S A V + ILD NDN P +    THN ++  VS        +  +   D D G+N  V   I                            N +E F LD  +G I            S    V A D G+PP     ++ IN+++V+ N
Sbjct:  118 PNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLNG--QSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVF--------------KESQIEVHIPENSPVGTSVVQLQATDADVGANA---EIKYMFGAQVSPATRRLFALNTTTGLI-----TVQRPLDREETAIH--KLTVLASDGSSSPARATITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIEKDVPFHLKAVYDNQYLLETSA-------LLDYEGTKEYIFKIVASDSGKPSLNQTAL-----VRVRLEDENDNPPIFTQPVIELAVME------------------------------NNLRDMFLTTISATDEDSGRNAEIVYQLGPNASFFDLDRKTGVLTASR-VFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKF----THNHFQFFVSENLPKYSTVGVITVTDADAGENAVVRLSI---------------------------LNDNENFILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDVNDN 670          

HSP 3 Score: 64.3142 bits (155), Expect = 1.193e-9
Identity = 44/173 (25.43%), Postives = 77/173 (44.51%), Query Frame = 1
Query: 2482 LDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNG 3000
            LDRE+  ++  K++  D      SSTAI+Q+ + DVNDN P++        EV++     +G  +  L+A D D+G N ++ Y       P +                        +F L+ +TG I + + +   +    K+ V ASD  + P +    + IN+ +V+ N 
Sbjct:  209 LDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVF---KESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPAT----------------------RRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARA--TITINVTDVNDNA 354          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 235.728 bits (600), Expect = 5.334e-63
Identity = 232/869 (26.70%), Postives = 390/869 (44.88%), Query Frame = 1
Query:  400 IDSRNYSMLVLIRFCILLSYFFNKEIHGQIEIHFKVVEESPTNSVIGNIH---NQALKQKGGVGSGDYYYKSIT---DIEPFFLDSKTYE-FRVSKRVDREEIC----------RFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKI-SYQSVNDGFKLKHSGRDHYEKL-SLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHS-DQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDP-GFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTP 2943
            +D R++ +L  +  C  L     +E+       + + EE   N +IGNI    N +        + +  Y+ ++   D     + S T E F  S R+DRE++C           F+++ ++      ++ I+ +II  +   T+D++P                  + SP I +S+PE++ I +   +P A DPD  P N+  KY++ + QS    F L        EK   LIV ++ DRE++ T  +K+K  DG     S    + +++TD+ND +P FK++ I   I EN P+ + ++QL+A D D     ++++ F   V    R  F +N  TG I     +D E  + + + V+ +DG  S  +AT+TI V +VNDN P I + Y+      T          +   KDP    +A ++VSDKD +       +N  + C I+       L+       + + L T+ + D E T +Y  +++  DS   SL+ +    + + D NDNPPIF  P      +   ++ E       +  + ATD D G NA I Y L   +++ F +D  +G L    VFD E+ E+F  T+ A +       ++ L +   + V I D ND  P F  + + F V E                    KY++     ++   D     ++ +  +  +D   +    ++G+I  NV   DRE+ SS++F ++A D    P SS A V I ++DVNDN P+ ++P ++     V      G  +A + A D D G N ++ Y IV                           N   +F +D  TGNI + +K  ++D+G  ++ V  SD G P
Sbjct:    1 MDLRDFFLLATLVACFWLDPTIAQELI------YPIREELQENVLIGNIPKDLNISHMNSATGATSNLVYRLVSKAGDTPLLRVMSNTGEIFTTSNRIDREKLCPGPSFEDSECSFEIEVVILPNDY-FRLIKIKIIVKD---TNDNAPM-----------------FPSPVINISIPENTLINSRFAIPSATDPDTGP-NSVHKYELLNGQS---AFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARATITINVTDVNDNAPNIDLRYIISPTNGT---------VMLSEKDPINTKIALITVSDKDTD-------VNGKVICFIE-KDVPFHLKAVYD---NQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQP------VIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGP-NASFFDLDRKTGVLTASRVFDREEQERFLFTVTARD-----NGTRALQSQAAVIVTILDENDNSPKFTHNHFQFFVSEN-----------------LPKYSTVGVITVT---DADAGENAVVRLSILNDNENFILDPDSGVIKSNVS-FDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVSG-------------------------NVRSLFRIDPVTGNITLEEKPTIADIGLHRLVVNISDLGYP 760          

HSP 2 Score: 108.997 bits (271), Expect = 2.098e-23
Identity = 152/653 (23.28%), Postives = 247/653 (37.83%), Query Frame = 1
Query: 1117 PNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGE----ILTAGYIDYEIKSEYTIPVIVTDG---KHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAII--------RYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIG----------ETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHN-YEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            PN     + I I + D ND  P F    I+  I EN  + S      A D D       ++E  N   ++      +    GE    ++    +D E K  Y + V V DG   + S  A L + V +VNDN P                + SQ   ++ EN   G  V  L  +D D  +     ++ ++   ++ P    L    + + LI        +  DREET+ +  +L    SD +S     T  I++TDVNDN P  ++ +  S    +  + E   I T I  +  +D+D   N  +         + L ++   Q+ ++  +       + DYE  +++   I AS+      N   L     + V +ED ND  P+F + +    V E                              +N  D++ ++ S    +S  +A   +++G          +TG++  +  V DRE+   F F + A D   + L S A V + ILD NDN P +    THN ++  VS        +  +   D D G+N  V   I                            N +E F LD  +G I            S    V A D G+PP     ++ IN+++V+ N
Sbjct:  118 PNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLNG--QSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVF--------------KESQIEVHIPENSPVGTSVVQLQATDADVGANA---EIKYMFGAQVSPATRRLFALNTTTGLI-----TVQRPLDREETAIH--KLTVLASDGSSSPARATITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIEKDVPFHLKAVYDNQYLLETSA-------LLDYEGTKEYIFKIVASDSGKPSLNQTAL-----VRVRLEDENDNPPIFTQPVIELAVME------------------------------NNLRDMFLTTISATDEDSGRNAEIVYQLGPNASFFDLDRKTGVLTASR-VFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKF----THNHFQFFVSENLPKYSTVGVITVTDADAGENAVVRLSI---------------------------LNDNENFILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDVNDN 670          

HSP 3 Score: 64.3142 bits (155), Expect = 1.189e-9
Identity = 44/173 (25.43%), Postives = 77/173 (44.51%), Query Frame = 1
Query: 2482 LDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNG 3000
            LDRE+  ++  K++  D      SSTAI+Q+ + DVNDN P++        EV++     +G  +  L+A D D+G N ++ Y       P +                        +F L+ +TG I + + +   +    K+ V ASD  + P +    + IN+ +V+ N 
Sbjct:  209 LDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVF---KESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPAT----------------------RRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARAT--ITINVTDVNDNA 354          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 235.728 bits (600), Expect = 5.334e-63
Identity = 232/869 (26.70%), Postives = 390/869 (44.88%), Query Frame = 1
Query:  400 IDSRNYSMLVLIRFCILLSYFFNKEIHGQIEIHFKVVEESPTNSVIGNIH---NQALKQKGGVGSGDYYYKSIT---DIEPFFLDSKTYE-FRVSKRVDREEIC----------RFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKI-SYQSVNDGFKLKHSGRDHYEKL-SLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHS-DQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDP-GFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTP 2943
            +D R++ +L  +  C  L     +E+       + + EE   N +IGNI    N +        + +  Y+ ++   D     + S T E F  S R+DRE++C           F+++ ++      ++ I+ +II  +   T+D++P                  + SP I +S+PE++ I +   +P A DPD  P N+  KY++ + QS    F L        EK   LIV ++ DRE++ T  +K+K  DG     S    + +++TD+ND +P FK++ I   I EN P+ + ++QL+A D D     ++++ F   V    R  F +N  TG I     +D E  + + + V+ +DG  S  +AT+TI V +VNDN P I + Y+      T          +   KDP    +A ++VSDKD +       +N  + C I+       L+       + + L T+ + D E T +Y  +++  DS   SL+ +    + + D NDNPPIF  P      +   ++ E       +  + ATD D G NA I Y L   +++ F +D  +G L    VFD E+ E+F  T+ A +       ++ L +   + V I D ND  P F  + + F V E                    KY++     ++   D     ++ +  +  +D   +    ++G+I  NV   DRE+ SS++F ++A D    P SS A V I ++DVNDN P+ ++P ++     V      G  +A + A D D G N ++ Y IV                           N   +F +D  TGNI + +K  ++D+G  ++ V  SD G P
Sbjct:    1 MDLRDFFLLATLVACFWLDPTIAQELI------YPIREELQENVLIGNIPKDLNISHMNSATGATSNLVYRLVSKAGDTPLLRVMSNTGEIFTTSNRIDREKLCPGPSFEDSECSFEIEVVILPNDY-FRLIKIKIIVKD---TNDNAPM-----------------FPSPVINISIPENTLINSRFAIPSATDPDTGP-NSVHKYELLNGQS---AFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARATITINVTDVNDNAPNIDLRYIISPTNGT---------VMLSEKDPINTKIALITVSDKDTD-------VNGKVICFIE-KDVPFHLKAVYD---NQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQP------VIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGP-NASFFDLDRKTGVLTASRVFDREEQERFLFTVTARD-----NGTRALQSQAAVIVTILDENDNSPKFTHNHFQFFVSEN-----------------LPKYSTVGVITVT---DADAGENAVVRLSILNDNENFILDPDSGVIKSNVS-FDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVSG-------------------------NVRSLFRIDPVTGNITLEEKPTIADIGLHRLVVNISDLGYP 760          

HSP 2 Score: 108.997 bits (271), Expect = 2.098e-23
Identity = 152/653 (23.28%), Postives = 247/653 (37.83%), Query Frame = 1
Query: 1117 PNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGE----ILTAGYIDYEIKSEYTIPVIVTDG---KHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAII--------RYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIG----------ETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHN-YEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            PN     + I I + D ND  P F    I+  I EN  + S      A D D       ++E  N   ++      +    GE    ++    +D E K  Y + V V DG   + S  A L + V +VNDN P                + SQ   ++ EN   G  V  L  +D D  +     ++ ++   ++ P    L    + + LI        +  DREET+ +  +L    SD +S     T  I++TDVNDN P  ++ +  S    +  + E   I T I  +  +D+D   N  +         + L ++   Q+ ++  +       + DYE  +++   I AS+      N   L     + V +ED ND  P+F + +    V E                              +N  D++ ++ S    +S  +A   +++G          +TG++  +  V DRE+   F F + A D   + L S A V + ILD NDN P +    THN ++  VS        +  +   D D G+N  V   I                            N +E F LD  +G I            S    V A D G+PP     ++ IN+++V+ N
Sbjct:  118 PNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLNG--QSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVF--------------KESQIEVHIPENSPVGTSVVQLQATDADVGANA---EIKYMFGAQVSPATRRLFALNTTTGLI-----TVQRPLDREETAIH--KLTVLASDGSSSPARATITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIEKDVPFHLKAVYDNQYLLETSA-------LLDYEGTKEYIFKIVASDSGKPSLNQTAL-----VRVRLEDENDNPPIFTQPVIELAVME------------------------------NNLRDMFLTTISATDEDSGRNAEIVYQLGPNASFFDLDRKTGVLTASR-VFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKF----THNHFQFFVSENLPKYSTVGVITVTDADAGENAVVRLSI---------------------------LNDNENFILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDVNDN 670          

HSP 3 Score: 64.3142 bits (155), Expect = 1.189e-9
Identity = 44/173 (25.43%), Postives = 77/173 (44.51%), Query Frame = 1
Query: 2482 LDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNG 3000
            LDRE+  ++  K++  D      SSTAI+Q+ + DVNDN P++        EV++     +G  +  L+A D D+G N ++ Y       P +                        +F L+ +TG I + + +   +    K+ V ASD  + P +    + IN+ +V+ N 
Sbjct:  209 LDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVF---KESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPAT----------------------RRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARAT--ITINVTDVNDNA 354          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: CR847522.1 (pep chromosome:GRCz11:CHR_ALT_CTG6_1_1:4874141:4879379:1 gene:ENSDARG00000111493.1 transcript:ENSDART00000185190.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR847522.1)

HSP 1 Score: 235.728 bits (600), Expect = 7.646e-63
Identity = 232/869 (26.70%), Postives = 390/869 (44.88%), Query Frame = 1
Query:  400 IDSRNYSMLVLIRFCILLSYFFNKEIHGQIEIHFKVVEESPTNSVIGNIH---NQALKQKGGVGSGDYYYKSIT---DIEPFFLDSKTYE-FRVSKRVDREEIC----------RFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKI-SYQSVNDGFKLKHSGRDHYEKL-SLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHS-DQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDP-GFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTP 2943
            +D R++ +L  +  C  L     +E+       + + EE   N +IGNI    N +        + +  Y+ ++   D     + S T E F  S R+DRE++C           F+++ ++      ++ I+ +II  +   T+D++P                  + SP I +S+PE++ I +   +P A DPD  P N+  KY++ + QS    F L        EK   LIV ++ DRE++ T  +K+K  DG     S    + +++TD+ND +P FK++ I   I EN P+ + ++QL+A D D     ++++ F   V    R  F +N  TG I     +D E  + + + V+ +DG  S  +AT+TI V +VNDN P I + Y+      T          +   KDP    +A ++VSDKD +       +N  + C I+       L+       + + L T+ + D E T +Y  +++  DS   SL+ +    + + D NDNPPIF  P      +   ++ E       +  + ATD D G NA I Y L   +++ F +D  +G L    VFD E+ E+F  T+ A +       ++ L +   + V I D ND  P F  + + F V E                    KY++     ++   D     ++ +  +  +D   +    ++G+I  NV   DRE+ SS++F ++A D    P SS A V I ++DVNDN P+ ++P ++     V      G  +A + A D D G N ++ Y IV                           N   +F +D  TGNI + +K  ++D+G  ++ V  SD G P
Sbjct:    1 MDLRDFFLLATLVACFWLDPTIAQELI------YPIREELQENVLIGNIPKDLNISHMNSATGATSNLVYRLVSKAGDTPLLRVMSNTGEIFTTSNRIDREKLCPGPSFEDSECSFEIEVVILPNDY-FRLIKIKIIVKD---TNDNAPM-----------------FPSPVINISIPENTLINSRFAIPSATDPDTGP-NSVHKYELLNGQS---AFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARATITINVTDVNDNAPNIDLRYIISPTNGT---------VMLSEKDPINTKIALITVSDKDTD-------VNGKVICFIE-KDVPFHLKAVYD---NQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQP------VIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGP-NASFFDLDRKTGVLTASRVFDREEQERFLFTVTARD-----NGTRALQSQAAVIVTILDENDNSPKFTHNHFQFFVSEN-----------------LPKYSTVGVITVT---DADAGENAVVRLSILNDNENFILDPDSGVIKSNVS-FDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVSG-------------------------NVRSLFRIDPVTGNITLEEKPTIADIGLHRLVVNISDLGYP 760          

HSP 2 Score: 109.383 bits (272), Expect = 1.963e-23
Identity = 152/653 (23.28%), Postives = 247/653 (37.83%), Query Frame = 1
Query: 1117 PNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGE----ILTAGYIDYEIKSEYTIPVIVTDG---KHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAII--------RYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIG----------ETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHN-YEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            PN     + I I + D ND  P F    I+  I EN  + S      A D D       ++E  N   ++      +    GE    ++    +D E K  Y + V V DG   + S  A L + V +VNDN P                + SQ   ++ EN   G  V  L  +D D  +     ++ ++   ++ P    L    + + LI        +  DREET+ +  +L    SD +S     T  I++TDVNDN P  ++ +  S    +  + E   I T I  +  +D+D   N  +         + L ++   Q+ ++  +       + DYE  +++   I AS+      N   L     + V +ED ND  P+F + +    V E                              +N  D++ ++ S    +S  +A   +++G          +TG++  +  V DRE+   F F + A D   + L S A V + ILD NDN P +    THN ++  VS        +  +   D D G+N  V   I                            N +E F LD  +G I            S    V A D G+PP     ++ IN+++V+ N
Sbjct:  118 PNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLNG--QSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVF--------------KESQIEVHIPENSPVGTSVVQLQATDADVGANA---EIKYMFGAQVSPATRRLFALNTTTGLI-----TVQRPLDREETAIH--KLTVLASDGSSSPARATITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIEKDVPFHLKAVYDNQYLLETSA-------LLDYEGTKEYIFKIVASDSGKPSLNQTAL-----VRVRLEDENDNPPIFTQPVIELAVME------------------------------NNLRDMFLTTISATDEDSGRNAEIVYQLGPNASFFDLDRKTGVLTASR-VFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKF----THNHFQFFVSENLPKYSTVGVITVTDADAGENAVVRLSI---------------------------LNDNENFILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDVNDN 670          

HSP 3 Score: 63.929 bits (154), Expect = 1.431e-9
Identity = 44/173 (25.43%), Postives = 77/173 (44.51%), Query Frame = 1
Query: 2482 LDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNG 3000
            LDRE+  ++  K++  D      SSTAI+Q+ + DVNDN P++        EV++     +G  +  L+A D D+G N ++ Y       P +                        +F L+ +TG I + + +   +    K+ V ASD  + P +    + IN+ +V+ N 
Sbjct:  209 LDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVF---KESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPAT----------------------RRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARAT--ITINVTDVNDNA 354          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: pcdh7b (protocadherin 7b [Source:ZFIN;Acc:ZDB-GENE-081104-299])

HSP 1 Score: 229.565 bits (584), Expect = 4.869e-61
Identity = 241/902 (26.72%), Postives = 408/902 (45.23%), Query Frame = 1
Query:  409 RNYSMLVLIRFCILLSYFFNKEIHGQIEIHFKVVEESPTNSVIGNIHNQALKQKGGVGSG-DYYYKSITDIEPFFLDSKTYEFRVS-KRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKI----------SYQSVNDGFKLKHSGRDHYEKLS---------------------LIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKH---SDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDC--------RIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRI-GETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINI 2979
            R   ++  + +C L+    ++    Q+ + +++ EE P +  +GN+         G+ +G D  +   +  E F +D+ T +   + +R+DRE++ + QM      C + ++     +IG      + S  ++    V I+DINDN+P + SP + LS+ E+  IGT   LP A D D    N  ++Y++             +   G    HSG+  +++ +                     LI+    DRE++ +  + L+  DG   P S Q  + + +TD+ND  P F+K+     + EN    +PILQL+A D D     ++ + F  +  E+VR    ++  TG +     ID E  S+    V+  D      +D+AT+ I +K+ NDN P I +  + G  F   G      A +AE+      +A + VSD+D          N ++ C        ++ P  E +E   ++ K   H    T+   D E   +Y   ++  DS S SLS++ +  + + D+NDNPP+F      S+     S  E  A G  +V V A D D G NA I YSLDS  +  FSID  +G++R   + D E+ E++E  +     I + K   +L     + V + D ND  P F +D++TF ++E                  + + NS    I     D   ++D  +Y     +    F I   TG I  N+   DRE+ +++SF+++A D  + P S+TA V + ++DVNDNPP  +FP  ++Y + +     I   +  + A D D G N  ++YRIV  + PF                        ++FD+D  TG I +  K++    G  ++ V+ +D G P Q     +HI +
Sbjct:    2 RTTGIVDYLSYCFLILQLLSQPAAKQV-LRYRLAEEGPADVRVGNVAADL-----GITAGMDVTFTLESGSEYFKIDNMTGDLSTNERRIDREKLPQCQMIFDENECFIDFEV---SVIG-----PAQSWVDLFEGKVIILDINDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFG-RNGIERYELIQDNGESTVRRIGTSGSGSVDSHSGKRRFDEGASRSSVFELQVADTTDGEKQPQLIIKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVMITDVNDNTPRFEKSVYEADLPENSSPGAPILQLKAGDTDVGVNGQIEYVF-GAATESVRRLLRLDESTGWLSVLHRIDREDVSQLRFTVMARDRGQPPKTDKATVIINIKDENDNVPNIDIRKI-GRIFLKDG-----VANVAEDVIVDTPIALVQVSDRD-------KGPNGIVTCTVVGDVPFQLKPASE-VEGDMNKKKYFLH----TSAPLDYEAVQEYNVVIVAVDSGSPSLSSNNSLIVKVGDMNDNPPVF------SKSTVEVSFPENNAPGERVVTVVALDADSGKNAEISYSLDSSVNGIFSIDADTGDIRVNTILDREQTERYEFKV-----IAKDKGMPVLQGSATVVVLVADKNDNEPKFMQDVFTFYIQE------------------NLQPNSPVGMITVMDADKGQNADMSLYI---EEEENIFSIDNNTGTIFSNM-AFDREQRNNYSFRVKAVDGGDPPRSATATVSLSVMDVNDNPPTVLFPMNNSYTL-LPPSSNIRTVVRTVSATDTDTGVNANLSYRIVGGN-PF------------------------KLFDMDAWTGVISLVGKLEQKHFGLHRLVVQVNDSGVPSQSTTTLVHIYV 810          

HSP 2 Score: 102.064 bits (253), Expect = 2.769e-21
Identity = 156/675 (23.11%), Postives = 253/675 (37.48%), Query Frame = 1
Query: 1150 ISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDED-----------------------------ESDQHKLRFEFDNSVDETVRNRFYINPLT-GE----ILTAGYIDYEIKSEYTIPVIVTDGK---HSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVA-------IGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPIS---GELRNIDVF-------DYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSS-DSQMYTNSNSDASQYFRI-GETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLW---VFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            + + DIND  P F    +   + EN P+ +  L   A D D                               D H  +  FD     +      +   T GE    ++  G +D E +  Y + + V DG     S QA L + + +VNDN P                  S Y A L EN  PG  +  L   D D     +  Q+ ++     +  R  L L  S         L      DRE+ SQ    ++  D      +   T  I+I D NDN P  ++     R I    +K+GVA       + T I  V+ +DRD G N I+  ++  +    F + P S   G++     F       DYE ++++ + I A +       S  L +   + V + D+ND  PVF K     +  E                      N+   ++++      DS  ++++  + +S  +  F I  +TG I VN  +LDRE+   + FK+ A D+    L  +A V + + D NDN P +   VF  T   + N+     +G     +   D D G N  ++  I            EE +N+               F +D +TG I+           +    V+A D G PP+     + +++++V+ N
Sbjct:  125 VIILDINDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIERYELIQDNGESTVRRIGTSGSGSVDSHSGKRRFDEGASRSSVFELQVADTTDGEKQPQLIIKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVMITDVNDNTPRF--------------EKSVYEADLPENSSPGAPILQLKAGDTDVG---VNGQIEYVFGAATESVRRLLRLDESTG------WLSVLHRIDREDVSQLRFTVMARDRGQPPKTDKATVIINIKDENDNVPNIDI-----RKIGRIFLKDGVANVAEDVIVDTPIALVQVSDRDKGPNGIVTCTV--VGDVPFQLKPASEVEGDMNKKKYFLHTSAPLDYEAVQEYNVVIVAVD-----SGSPSLSSNNSLIVKVGDMNDNPPVFSKSTVEVSFPEN---------------------NAPGERVVTVVALDADSGKNAEISYSLDSSVNGIFSIDADTGDIRVNT-ILDREQTERYEFKVIAKDKGMPVLQGSATVVVLVADKNDNEPKFMQDVF--TFYIQENLQPNSPVGM----ITVMDADKGQNADMSLYI------------EEEENI---------------FSIDNNTGTIFSNMAFDREQRNNYSFRVKAVDGGDPPRSATATVSLSVMDVNDN 709          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: vapa (VAMP associated protein A [Source:Xenbase;Acc:XB-GENE-990155])

HSP 1 Score: 222.631 bits (566), Expect = 9.966e-59
Identity = 240/870 (27.59%), Postives = 388/870 (44.60%), Query Frame = 1
Query:  409 RNYSMLVLIRFCILLSYFFNKEIHGQIEIHFKVVEESPTNSVIGNI-------HNQALKQKGGVGSGDYYYKSITDIEPFF-LDSKTYE-FRVSKRVDREEICRFQMQNIMQNCRMT----------YKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKI-SYQSVNDGFKLKHSGRDHYEKL-SLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHS-DQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDP-GFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRE-SLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGE-TGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTP 2943
            R++ +L  +  C+ L     +E+       + + EE P N  IGNI       H  A    G   S  Y   S     P   + S T E F  S R+DRE++C     +    C             ++ I+ +II  +   T+D++P                  + S  I +S+PE++ I +   +P A+DPD    N  Q Y++ + QSV   F L        EK   LIV ++ DRE++ T  +K+K  DG     S    + ++++D+ND +P FK++ +   I EN P+ + ++QL A D D     ++++ F   V    +  F +N  TG I     +D E  + + + V+ TDG  +  +AT+TI V +VNDN P I + Y+      T         YL+E KDP    +A ++VSDKD +       +N  + C I+  RE    L+       + + L T+ + D E   ++  +++  D+   SL+ +    + + D NDNPPIF  P      +   S+ E    G  +  V A+D D G N+ I Y L   +++ F +D  +G L    VFD E+ E+F  T+ A +       +  L +   + V + D ND  P F  + + F V E                    KY++    +I+      D+ +++  T S  + ++ F +   +GLI  NV   DRE+ SS++F ++A D  + P SSTA V I I+D NDN P+ + P ++     V      G  +A + A D D G N ++ Y IV                           N   +F +D  TGNI + +K   +DVG  ++ V  SD G P
Sbjct:    4 RDFYLLAALIACLRLDSAIAQELI------YTIREELPENVPIGNIPKDLNISHINA--ATGSSTSLVYRLVSKAGDSPLVKVSSSTGEIFTTSTRIDREKLCAGSSNSDENECFFELEVVILPNDFFRLIKIKIIVKD---TNDNAPM-----------------FPSTVINISIPENTLINSRFPIPSAVDPDTG-FNGVQHYELLNGQSV---FGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNKPVFKESQVEVHIPENAPIGTSVVQLHATDADIGSNAEIKYIFGAQVTSATKRLFALNNTTGLITVQRPLDREETAVHKLTVLATDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGT--------VYLSE-KDPINTKIALITVSDKDTD-------VNSKVICFIE--REVPFHLKAVYD---NQYLLETSSLLDYEGIKEFSFKIVAADTGKPSLNQTALVRVELEDENDNPPIFSQP------VIELSVSENNRRGLYLTTVSASDEDSGKNSDIVYQLGP-NASFFDLDRKTGVLTASRVFDREEQERFIFTVTARD-----NGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSEN-----------------LPKYST--VGVITATDS--DAGENKAVTLSILNDNENFVLDPYSGLIKSNVS-FDREQQSSYTFDVKAVDGGQPPRSSTAKVTINIMDANDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDTDTGMNAELKYTIVSG-------------------------NNKGLFRIDPVTGNITLEEKPSAADVGLHRLVVNISDLGYP 761          

HSP 2 Score: 112.849 bits (281), Expect = 1.925e-24
Identity = 155/653 (23.74%), Postives = 253/653 (38.74%), Query Frame = 1
Query: 1117 PNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGE----ILTAGYIDYEIKSEYTIPVIVTDG---KHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAII--------RYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIG----------ETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHN-YEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            PN     + I I + D ND  P F  T I+  I EN  + S      A D D        +E  N   ++V     +    GE    ++    +D E K  Y + + V DG   + S  A L + V +VNDN P                + SQ   ++ EN   G  V  L  +D D  S     ++ ++   ++    + L    + + LI        +  DREET+ +  +L    +D +S     T  I++TDVNDNPP  ++ +  S    +  + E   I T I  +  +D+D   N+ +         + L ++   Q+ ++  S       + DYE +++F   I A++      N   L     + V +ED ND  P+F + +   +V E                              +N   +Y ++ S    +S  ++   +++G          +TG++  +  V DRE+   F F + A D    PL S A V + +LD NDN P +    THN ++  VS        +  + A D D G+N  VT  I                            N +E F LD  +G I            S    V+A D G PP+    ++ INI++ + N
Sbjct:  119 PNDFFRLIKIKIIVKDTNDNAPMFPSTVINISIPENTLINSRFPIPSAVDPDTGFNGVQHYELLNG--QSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNKPVF--------------KESQVEVHIPENAPIGTSVVQLHATDADIGSNA---EIKYIFGAQVTSATKRLFALNNTTGLI-----TVQRPLDREETAVH--KLTVLATDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPINTKIALITVSDKDTDVNSKVICFIEREVPFHLKAVYDNQYLLETSS-------LLDYEGIKEFSFKIVAADTGKPSLNQTAL-----VRVELEDENDNPPIFSQPVIELSVSE------------------------------NNRRGLYLTTVSASDEDSGKNSDIVYQLGPNASFFDLDRKTGVLTASR-VFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKF----THNHFQFFVSENLPKYSTVGVITATDSDAGENKAVTLSI---------------------------LNDNENFVLDPYSGLIKSNVSFDREQQSSYTFDVKAVDGGQPPRSSTAKVTINIMDANDN 671          

HSP 3 Score: 62.003 bits (149), Expect = 7.929e-9
Identity = 113/476 (23.74%), Postives = 189/476 (39.71%), Query Frame = 1
Query:  865 IYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHY--EKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKH---SDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDY-ESKRLG-NQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAI-GTTIVQVKATDRDIGNNAIIRYSLDSLSSTQ-FSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTV 2265
            +YLS  E   I T+I L    D D   T+   K  I +      F LK    + Y  E  SL+     D E     S K+ A D     L+    + + L D ND  P F +  I   ++EN      +  + A DED      + ++   +      + F ++  TG +  +   D E +  +   V   D        QA + + V + NDN+P+ +               + ++ +++EN      V  ++ +D D  E+K +  + +N   +  +DP+          S LI      +   FDRE+ S Y   +   D      S++    I+I D NDN P+   P   +    S+ +    AI G+ + +V A D D G NA ++Y++ S ++   F IDP++G                       N  +E K S     L ++ VNI D+      + K L+T  +
Sbjct:  371 VYLS--EKDPINTKIALITVSDKD---TDVNSKV-ICFIEREVPFHLKAVYDNQYLLETSSLL-----DYEGIKEFSFKIVAADTGKPSLNQTALVRVELEDENDNPPIFSQPVIELSVSENNRRGLYLTTVSASDEDSGKNSDIVYQLGPNA-----SFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFT--------------HNHFQFFVSENLPKYSTVGVITATDSDAGENKAVTLSILNDNENFVLDPY----------SGLIK-----SNVSFDREQQSSYTFDVKAVDGGQPPRSSTAKVTINIMDANDNSPVVISPPSNT----SFKLVPLSAIPGSVVAEVFAVDTDTGMNAELKYTIVSGNNKGLFRIDPVTG-----------------------NITLEEKPSAADVGLHRLVVNISDLG-----YPKPLHTLVL 769          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: ENSXETT00000047804.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 216.468 bits (550), Expect = 1.163e-56
Identity = 240/882 (27.21%), Postives = 395/882 (44.78%), Query Frame = 1
Query:  385 MLKIQIDSRNYSMLVLIRFCILLSYFFNKEIHGQIEIHFKVVEESPTNSVIGNIHNQALKQKGGVGSGDYYYKSI---TDIEPFFLDSKTYE-FRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKI-SYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHS-DQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGE-TGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFP-NTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSK-KIWVEASDQGTP-PQKKIERLHINIVNVDGNG 3000
            +L++ + S  Y + VLI  CI+          G  E ++ V EE P N +IGN+            S    +K +    D+    ++  T E F  S R+DRE++C      I    +  Y+ ++  ++ DE  +       ++ +   I DINDNSP + S  I +S+PE++ + +  ++P A+DPD    N  Q Y++   Q+V     ++    D + +L  IV +  DRE++ T  +K+K  DG     S    + +++TD+ND +P FK+  I   I E+  + + + QL A D D     K+ F F N +    +  F I+  TG I     +D E    + + V+ +DG  +  +AT+TI + ++NDN P I   Y+      T          L+E       +A ++V+DKD +       +N  + C  D H     L+       + F L T    D E T +Y  +++  DS    L+ S    I I D NDN P+F +P  G       S  E    GT + ++ ATD D G NA + Y L   + T F++D  +G L  +   D EK +++  T+     I +   +  L T   +T+++ D ND  P F  + Y F V E                     Y +     +++     DS ++ + T S  +A   F I   TG+I  N+   DRE+  S++F+++A D+     SST  V I + DVNDN P++V P N ++Y++ V    + G  +A + A D D G N  + Y I                         I  N   +F +   +GNI + +K+   D G   K+ ++ +D G P P   I  +H+ +     NG
Sbjct:   18 ILEMDLLSGTYLLAVLIA-CIVFE-------SGAQEKNYIVREELPENVLIGNLLKDLNLTLDPDLSTPLQFKLVYKTGDVPLIRVEENTGEIFTTSNRIDREKLC----SGIFTENKCFYE-VEVAVLPDEVFR-------LVKIRFLIEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVG-VNGIQHYELLKGQNVFGLDVIETPEGDKWPQL--IVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASDGSSTPSRATVTINITDINDNIPSIDTRYIINPVNGT--------VQLSEKAPLNTKIALITVTDKDAD-------LNGKVTCFTD-HDVPFRLK---PVFDNQFLLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIG------LSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTV-----IAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPEN-----------------LPMYGTVGLITVTD----ADSGENAVVTLSLVNARDNFIIDPLTGVIRPNI-TFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYDL-VQTSTSPGSVVARVYAIDNDTGINADLRYSI-------------------------IGGNSRGLFAIGERSGNITLKEKLLAGDHGVLYKLVIKVNDSGKPEPFHTIAFVHLFVNETITNG 798          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: ENSXETT00000047801.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 216.083 bits (549), Expect = 1.357e-56
Identity = 240/882 (27.21%), Postives = 395/882 (44.78%), Query Frame = 1
Query:  385 MLKIQIDSRNYSMLVLIRFCILLSYFFNKEIHGQIEIHFKVVEESPTNSVIGNIHNQALKQKGGVGSGDYYYKSI---TDIEPFFLDSKTYE-FRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKI-SYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHS-DQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGE-TGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFP-NTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSK-KIWVEASDQGTP-PQKKIERLHINIVNVDGNG 3000
            +L++ + S  Y + VLI  CI+          G  E ++ V EE P N +IGN+            S    +K +    D+    ++  T E F  S R+DRE++C      I    +  Y+ ++  ++ DE  +       ++ +   I DINDNSP + S  I +S+PE++ + +  ++P A+DPD    N  Q Y++   Q+V     ++    D + +L  IV +  DRE++ T  +K+K  DG     S    + +++TD+ND +P FK+  I   I E+  + + + QL A D D     K+ F F N +    +  F I+  TG I     +D E    + + V+ +DG  +  +AT+TI + ++NDN P I   Y+      T          L+E       +A ++V+DKD +       +N  + C  D H     L+       + F L T    D E T +Y  +++  DS    L+ S    I I D NDN P+F +P  G       S  E    GT + ++ ATD D G NA + Y L   + T F++D  +G L  +   D EK +++  T+     I +   +  L T   +T+++ D ND  P F  + Y F V E                     Y +     +++     DS ++ + T S  +A   F I   TG+I  N+   DRE+  S++F+++A D+     SST  V I + DVNDN P++V P N ++Y++ V    + G  +A + A D D G N  + Y I                         I  N   +F +   +GNI + +K+   D G   K+ ++ +D G P P   I  +H+ +     NG
Sbjct:   18 ILEMDLLSGTYLLAVLIA-CIVFE-------SGAQEKNYIVREELPENVLIGNLLKDLNLTLDPDLSTPLQFKLVYKTGDVPLIRVEENTGEIFTTSNRIDREKLC----SGIFTENKCFYE-VEVAVLPDEVFR-------LVKIRFLIEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVG-VNGIQHYELLKGQNVFGLDVIETPEGDKWPQL--IVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASDGSSTPSRATVTINITDINDNIPSIDTRYIINPVNGT--------VQLSEKAPLNTKIALITVTDKDAD-------LNGKVTCFTD-HDVPFRLK---PVFDNQFLLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIG------LSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTV-----IAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPEN-----------------LPMYGTVGLITVTD----ADSGENAVVTLSLVNARDNFIIDPLTGVIRPNI-TFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYDL-VQTSTSPGSVVARVYAIDNDTGINADLRYSI-------------------------IGGNSRGLFAIGERSGNITLKEKLLAGDHGVLYKLVIKVNDSGKPEPFHTIAFVHLFVNETITNG 798          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: ENSXETT00000047798.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 214.157 bits (544), Expect = 5.667e-56
Identity = 239/875 (27.31%), Postives = 390/875 (44.57%), Query Frame = 1
Query:  406 SRNYSMLVLIRFCILLSYFFNKEIHGQIEIHFKVVEESPTNSVIGNIHNQALKQKGGVGSGDYYYKSI---TDIEPFFLDSKTYE-FRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKI-SYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHS-DQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGE-TGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFP-NTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSK-KIWVEASDQGTP-PQKKIERLHINIVNVDGNG 3000
            S  Y + VLI  CI+          G  E ++ V EE P N +IGN+            S    +K +    D+    ++  T E F  S R+DRE++C      I    +  Y+ ++  ++ DE  +       ++ +   I DINDNSP + S  I +S+PE++ + +  ++P A+DPD    N  Q Y++   Q+V     ++    D + +L  IV +  DRE++ T  +K+K  DG     S    + +++TD+ND +P FK+  I   I E+  + + + QL A D D     K+ F F N +    +  F I+  TG I     +D E    + + V+ +DG  +  +AT+TI + ++NDN P I   Y+      T          L+E       +A ++V+DKD +       +N  + C  D H     L+       + F L T    D E T +Y  +++  DS    L+ S    I I D NDN P+F +P  G       S  E    GT + ++ ATD D G NA + Y L   + T F++D  +G L  +   D EK +++  T+     I +   +  L T   +T+++ D ND  P F  + Y F V E                     Y +     +++     DS ++ + T S  +A   F I   TG+I  N+   DRE+  S++F+++A D+     SST  V I + DVNDN P++V P N ++Y++ V    + G  +A + A D D G N  + Y I                         I  N   +F +   +GNI + +K+   D G   K+ ++ +D G P P   I  +H+ +     NG
Sbjct:    5 SGTYLLAVLIA-CIVFE-------SGAQEKNYIVREELPENVLIGNLLKDLNLTLDPDLSTPLQFKLVYKTGDVPLIRVEENTGEIFTTSNRIDREKLC----SGIFTENKCFYE-VEVAVLPDEVFR-------LVKIRFLIEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVG-VNGIQHYELLKGQNVFGLDVIETPEGDKWPQL--IVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASDGSSTPSRATVTINITDINDNIPSIDTRYIINPVNGT--------VQLSEKAPLNTKIALITVTDKDAD-------LNGKVTCFTD-HDVPFRLK---PVFDNQFLLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIG------LSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTV-----IAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPEN-----------------LPMYGTVGLITVTD----ADSGENAVVTLSLVNARDNFIIDPLTGVIRPNI-TFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYDL-VQTSTSPGSVVARVYAIDNDTGINADLRYSI-------------------------IGGNSRGLFAIGERSGNITLKEKLLAGDHGVLYKLVIKVNDSGKPEPFHTIAFVHLFVNETITNG 778          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: ENSXETT00000027070.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:19099783:19110965:-1 gene:ENSXETG00000013163.1 transcript:ENSXETT00000027070.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 212.231 bits (539), Expect = 1.063e-55
Identity = 231/856 (26.99%), Postives = 372/856 (43.46%), Query Frame = 1
Query:  433 IRFCILLSYFFNKEIHGQIEIHFKVVEESPTNSVIGNIHNQALKQKGGVGSGDYYYKSITDIEPFFLDSKTYEFRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGF----KLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKH-SDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSL------DSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDS--QMYTNSNSDA--SQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNV----SYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTP 2943
            IR+ ++  +F         ++ + + EE     VIGNI N        + S  ++  S +  +   +  +  +  V+ R+DRE +C  Q     QNC +  + +             +S      +NVEI D+NDNSP +S     +S+ E + +GT   L  A DPD    N+ Q YK+S    ND F    K+   GR + E   L++ K  DREK+ +  + L AFDG     +G   I I +TDIND  P F K +    ++EN+P+   ++ L A D DE    ++ + F N + E  +  F INP  G +   G +DYE+ + Y + V   DG        L I+V +VNDN P+I +              + +   + E+   G V+A +++ D D  S   G  +  +         ESL      S   ++++L+T+   DRE+TS+Y   +   D  S  L+ S T  + +TDVNDN P+F+      +  +   I+E    G +  +V ATD DI  N  + Y +      D   S+  SI+ +SG L     FDYEK+ +F +         E K S  L   + I + + DVND  PVFEK  Y   ++E                       S++F++ +   DI ++      + T+   D   S Y  I     +       D E +  F  ++ A D      S+ A V+I I D NDN P  ++P+  +   +V     +    GY +  + A D D G N  ++Y +                 L+V + S +   ++        TG I I + ++ +D   ++I V   D G P
Sbjct:   14 IRWQVIFCFFSFLCESVICQLQYSIYEEQRLGYVIGNIANDLGVSAEELSSRKFHIVSRSKKQYLNVHLENGDLYVADRIDREALCGMQ-----QNCFLNIEAVM------------ESPLHFYTINVEIQDVNDNSPSFSKSIFEISISELAVVGTHFALGSAKDPDLG-NNSIQSYKLS---ANDYFGMLEKVNTDGRKYPE---LVLEKTLDREKKNSSVLILSAFDGGTPSKTGTSLIRIVVTDINDNYPLFNKDTYRVTVSENVPIGFLVIDLHATDADEGSNAEITYLF-NDIPENAQEVFAINPENGSVQITGKLDYEVATNYEMTVEAKDGGGLVSYCKLLIQVSDVNDNAPDILI--------------TSFSDIIPEDSRVGTVIALVNLDDLD--SGENGEVVGQI--------SESLPFHLISSSG-NYYKLVTSMDLDREKTSEYNITIKAEDKGSPQLTNSKTIRLILTDVNDNAPVFD------KMDYVAYIQENNPSGNSFYRVHATDPDINENGKVVYMILTDIIEDIPISSYVSINTVSGVLYAQRSFDYEKLREFYIQ-------AEDKGSPQLTNNKTIRLILTDVNDNAPVFEKMDYVAYIQENNPS------------------GSSFFRVHATDSDINENGKVVYMILTDIIEDMPLSSYISINTVSGVLYAQRSFDYESLREFYIQVMAKDSGSPSRSANATVKICITDQNDNAPKILYPSQDSEAASVFEFIPHFSTKGYLVTKVVAVDADSGHNAWLSYHL-----------------LQVPDPSFLIIGQN--------TGEIRITRDLQETDALRQRIVVMVKDNGYP 763          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 231.876 bits (590), Expect = 9.438e-62
Identity = 240/851 (28.20%), Postives = 390/851 (45.83%), Query Frame = 1
Query:  439 FCILLSYFFNKEIHGQIEIHFKVVEESPTNSVIGNIH---NQALKQKGGVGSGDYY---YKSITDIEPFFLDSKTYE-FRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYK-ISYQSVNDGFKLKHSGRDHYEKL-SLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHS-DQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIG-ETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAI-----GYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTP 2943
            F +LL+    +   G  E ++ V EE P N +IG++    N +L     + +   +   YK+  D+    ++  T E F    R+DRE++C      I+ + R  Y+ ++  ++ DE  +       ++ +   I DINDN+P + +  I +S+PE+S I +  +LP A+DPD    N  Q Y+ I  Q++   F L        +K+  LIV K+ DRE++ T  +K+K  DG     S    + +S+ D ND  P F +  I   I EN P+ S + QL A D D  +  ++ F F N V    +  F++N  TG I     +D E    + + V+ TDG  +  +AT+ + V ++NDN P I + Y+      T          L+EN      +A ++V DKD E        N  + C  D H     LR   S   + F L T    D E T +Y  +L+  D+    L+ S    I + D NDN P+F      ++   S S+ E  + G  + ++ ATD D G NA I Y L   +  +F++D  +G L  +   D EK EK+  T+ A +  I       L +   + V + D ND  P+F  + Y F V E                    K+ +     +++P    D  ++   T S  D +  F I  ++G+I  N+   DRE+  S++F ++A D      SSTA V I ++DVNDN P+++ P +     N S++  +     G  +  + A D D+G N +V Y IV                           N   +F ++ ++GNI + +K  +SD+G  ++ V+A+D G P
Sbjct:   10 FAVLLACVVFQS--GAQEKNYTVREEMPENVLIGDLLKDLNLSLIPDKSLTTPMQFKLVYKT-GDVPLIRIEEGTGEIFTTGARIDREKLC----AGIVLDARCFYE-VEVAVLPDEIFR-------LVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIG-INGVQNYQLIKSQNI---FGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVLATDGGSTPARATVLVNVTDINDNVPSIDIRYIVNPTNGT--------VLLSENAPLNTKIALITVMDKDSEH-------NGRVTCFTD-HEVPFRLRPVFS---NQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVF------TQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPP-----LMSNATVFVTVLDQNDNSPIFTHNEYNFYVPES-----------------LPKHGTVGLITVTDP----DYGENSAVTLSILDVNDQFTIDPQSGVIRPNIS-FDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPS-----NYSFEWVLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGG-------------------------NTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQP 759          

HSP 2 Score: 63.5438 bits (153), Expect = 1.993e-9
Identity = 46/172 (26.74%), Postives = 82/172 (47.67%), Query Frame = 1
Query: 2482 LDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            LDRE+  ++  K++  D      SSTAI+Q+ + D NDN P+++       EV++     IG  +  L A D D+G+N ++        F FS   +  +K L               F L+ +TG I + + +   +  S K+ V A+D G+ P +    + +N+ +++ N
Sbjct:  207 LDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFI---EKEIEVSIPENAPIGSSVTQLHATDADIGENARI-------HFYFSNLVSNIAKRL---------------FHLNTTTGLITVKEPLDREESPSHKLLVLATDGGSTPARA--TVLVNVTDINDN 351          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 233.032 bits (593), Expect = 1.476e-61
Identity = 240/851 (28.20%), Postives = 390/851 (45.83%), Query Frame = 1
Query:  439 FCILLSYFFNKEIHGQIEIHFKVVEESPTNSVIGNIH---NQALKQKGGVGSGDYY---YKSITDIEPFFLDSKTYE-FRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYK-ISYQSVNDGFKLKHSGRDHYEKL-SLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSD-QATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIG-ETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAI-----GYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTP 2943
            F +LL+    +   G  E ++ V EE P N +IG++    N +L     + +   +   YK+  D+    ++  T E F    R+DRE++C      I+ + R  Y+ ++  ++ DE  +       ++ +   I DINDN+P + +  I +S+PE+S I +  +LP A+DPD    N  Q Y+ I  Q++   F L        +K+  LIV K+ DRE++ T  +K+K  DG     S    + +S+ D ND  P F +  I   I EN P+ S + QL A D D  +  ++ F F N V    +  F++N  TG I     +D E    + + V+ TDG  +  +AT+ + V ++NDN P I + Y+      T          L+EN      +A ++V DKD E        N  + C  D H     LR   S   + F L T    D E T +Y  +L+  D+    L+ S    I + D NDN P+F      ++   S S+ E  + G  + ++ ATD D G NA I Y L   +  +F++D  +G L  +   D EK EK+  T+ A +  I       L +   + V + D ND  P+F  + Y F V E                    K+ +     +++P    D  ++   T S  D +  F I  ++G+I  N+   DRE+  S++F ++A D      SSTA V I ++DVNDN P+++ P +     N S++  +     G  +  + A D D+G N +V Y IV                           N   +F ++ ++GNI + +K  +SD+G  ++ V+A+D G P
Sbjct:   10 FAVLLACVVFQS--GAQEKNYTVREEMPENVLIGDLLKDLNLSLIPDKSLTTPMQFKLVYKT-GDVPLIRIEEGTGEIFTTGARIDREKLC----AGIVLDARCFYE-VEVAVLPDEIFR-------LVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIG-INGVQNYQLIKSQNI---FGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVLATDGGSTPARATVLVNVTDINDNVPSIDIRYIVNPTNGT--------VLLSENAPLNTKIALITVMDKDSEH-------NGRVTCFTD-HEVPFRLRPVFS---NQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVF------TQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPP-----LMSNATVFVTVLDQNDNSPIFTHNEYNFYVPES-----------------LPKHGTVGLITVTDP----DYGENSAVTLSILDVNDQFTIDPQSGVIRPNI-SFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPS-----NYSFEWVLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGG-------------------------NTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQP 759          

HSP 2 Score: 63.5438 bits (153), Expect = 1.974e-9
Identity = 46/172 (26.74%), Postives = 82/172 (47.67%), Query Frame = 1
Query: 2482 LDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            LDRE+  ++  K++  D      SSTAI+Q+ + D NDN P+++       EV++     IG  +  L A D D+G+N ++        F FS   +  +K L               F L+ +TG I + + +   +  S K+ V A+D G+ P +    + +N+ +++ N
Sbjct:  207 LDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFI---EKEIEVSIPENAPIGSSVTQLHATDADIGENARI-------HFYFSNLVSNIAKRL---------------FHLNTTTGLITVKEPLDREESPSHKLLVLATDGGSTPARA--TVLVNVTDINDN 351          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 231.876 bits (590), Expect = 1.774e-61
Identity = 240/851 (28.20%), Postives = 390/851 (45.83%), Query Frame = 1
Query:  439 FCILLSYFFNKEIHGQIEIHFKVVEESPTNSVIGNIH---NQALKQKGGVGSGDYY---YKSITDIEPFFLDSKTYE-FRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYK-ISYQSVNDGFKLKHSGRDHYEKL-SLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSD-QATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIG-ETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAI-----GYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTP 2943
            F +LL+    +   G  E ++ V EE P N +IG++    N +L     + +   +   YK+  D+    ++  T E F    R+DRE++C      I+ + R  Y+ ++  ++ DE  +       ++ +   I DINDN+P + +  I +S+PE+S I +  +LP A+DPD    N  Q Y+ I  Q++   F L        +K+  LIV K+ DRE++ T  +K+K  DG     S    + +S+ D ND  P F +  I   I EN P+ S + QL A D D  +  ++ F F N V    +  F++N  TG I     +D E    + + V+ TDG  +  +AT+ + V ++NDN P I + Y+      T          L+EN      +A ++V DKD E        N  + C  D H     LR   S   + F L T    D E T +Y  +L+  D+    L+ S    I + D NDN P+F      ++   S S+ E  + G  + ++ ATD D G NA I Y L   +  +F++D  +G L  +   D EK EK+  T+ A +  I       L +   + V + D ND  P+F  + Y F V E                    K+ +     +++P    D  ++   T S  D +  F I  ++G+I  N+   DRE+  S++F ++A D      SSTA V I ++DVNDN P+++ P +     N S++  +     G  +  + A D D+G N +V Y IV                           N   +F ++ ++GNI + +K  +SD+G  ++ V+A+D G P
Sbjct:   10 FAVLLACVVFQS--GAQEKNYTVREEMPENVLIGDLLKDLNLSLIPDKSLTTPMQFKLVYKT-GDVPLIRIEEGTGEIFTTGARIDREKLC----AGIVLDARCFYE-VEVAVLPDEIFR-------LVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIG-INGVQNYQLIKSQNI---FGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVLATDGGSTPARATVLVNVTDINDNVPSIDIRYIVNPTNGT--------VLLSENAPLNTKIALITVMDKDSEH-------NGRVTCFTD-HEVPFRLRPVFS---NQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVF------TQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPP-----LMSNATVFVTVLDQNDNSPIFTHNEYNFYVPES-----------------LPKHGTVGLITVTDP----DYGENSAVTLSILDVNDQFTIDPQSGVIRPNIS-FDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPS-----NYSFEWVLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGG-------------------------NTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQP 759          

HSP 2 Score: 63.929 bits (154), Expect = 1.793e-9
Identity = 46/172 (26.74%), Postives = 82/172 (47.67%), Query Frame = 1
Query: 2482 LDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            LDRE+  ++  K++  D      SSTAI+Q+ + D NDN P+++       EV++     IG  +  L A D D+G+N ++        F FS   +  +K L               F L+ +TG I + + +   +  S K+ V A+D G+ P +    + +N+ +++ N
Sbjct:  207 LDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFI---EKEIEVSIPENAPIGSSVTQLHATDADIGENARI-------HFYFSNLVSNIAKRL---------------FHLNTTTGLITVKEPLDREESPSHKLLVLATDGGSTPARA--TVLVNVTDINDN 351          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 228.409 bits (581), Expect = 2.653e-61
Identity = 242/874 (27.69%), Postives = 395/874 (45.19%), Query Frame = 1
Query:  400 IDSRNYSMLVLIRFCILLSYFFNKEIHGQIEIHFKVVEESPTNSVIGNI-------HNQALKQKGGVGSGDYYYKSITDIEPFF-LDSKTYE-FRVSKRVDREEICR-----------FQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKI-SYQSVNDGFKLKHSGRDHYEKL-SLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHS-DQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDP-GFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRE-SLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGE-TGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTP 2943
            +D R++ +L  +  C+ L     +E+       + + EE P N  IGNI       H  A    G   S  Y   S     P   + S T E F  S R+DRE++C            F+++ ++      ++ I+ +II  +   T+D++P                  + SP I +S+PE++ I +   +P A DPD    N  Q Y++ + QSV   F L        EK   LIV ++ DRE++ T  +K+K  DG     S    + ++++D+ND +P FK+  +   I EN P+ + ++QL A D D     ++R+ F   V    +  F +N  TG I     +D E  + + + V+ +DG  +  +AT+TI V +VNDN P I + Y+      T         YL+E KDP    +A ++VSDKD +       +N  + C I+  RE    L+       + + L T+ + D E T ++  +++  DS   SL+ +    + + D NDNPPIF  P      +   S+ E    G  +  + ATD D G NA I Y L   +++ F +D  +G L    VF+ E+ E+F  T+ A +       +  L +   + V + D ND  P F  + + F V E                    KY++     +++     D+ +++  T S  + ++ F +   +G+I  NV   DRE+ SS++F ++A D  + P SSTA V I ++DVNDN P+ + P ++     V      G  +A + A D D G N ++ Y IV                           N   +F +D  TGNI + +K   +DVG  ++ V  SD G P
Sbjct:    1 MDLRDFYLLAALIACLRLDSAIAQELI------YTIREELPENVPIGNIPKDLNISHINA--ATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDF-FRLIKIKIIVKD---TNDNAPM-----------------FPSPVINISIPENTLINSRFPIPSATDPDTG-FNGVQHYELLNGQSV---FGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGT--------VYLSE-KDPVNTKIALITVSDKDTD-------VNGKVICFIE--REVPFHLKAVYD---NQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQP------VIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGP-NASFFDLDRKTGVLTASRVFNREEQERFIFTVTARD-----NGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSEN-----------------LPKYSTVGVITVTDE----DAGENKAVTLSILNDNENFVLDPYSGVIKSNVS-FDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVSG-------------------------NNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYP 761          

HSP 2 Score: 112.079 bits (279), Expect = 2.555e-24
Identity = 155/653 (23.74%), Postives = 251/653 (38.44%), Query Frame = 1
Query: 1117 PNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGE----ILTAGYIDYEIKSEYTIPVIVTDG---KHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGS--RGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAI------IRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIG----------ETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHN-YEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            PN     + I I + D ND  P F    I+  I EN  + S      A D D        +E  N   ++V     +    GE    ++    +D E K  Y + + V DG   + S  A L + V +VNDN P                +  Q   ++ EN   G  V  L  +D D  S     ++ ++   ++ P  + L    + + LI        +  DREET+ +  ++    SD +S     T  I++TDVNDNPP  ++ +  S   G    S K+ V     ++ V   D D+    I      + + L ++   Q+ ++  S       + DYE  ++F   I AS+      N   L     + V +ED ND  P+F + +   +V E                              +N   +Y ++ S    +S  +A   +++G          +TG++  +  V +RE+   F F + A D    PL S A V + +LD NDN P +    THN ++  VS        +  +   D D G+N  VT  I                            N +E F LD  +G I            S    V+A+D G PP+    ++ IN+++V+ N
Sbjct:  119 PNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNG--QSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVF--------------KEGQVEVHIPENAPVGTSVIQLHATDADIGSNA---EIRYIFGAQVAPATKRLFALNNTTGLI-----TVQRSLDREETAIH--KVTVLASDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQYLLETSS-------LLDYEGTKEFSFKIVASDSGKPSLNQTAL-----VRVKLEDENDNPPIFNQPVIELSVSE------------------------------NNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTAS-RVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKF----THNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSI---------------------------LNDNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDN 671          

HSP 3 Score: 63.1586 bits (152), Expect = 2.279e-9
Identity = 47/182 (25.82%), Postives = 79/182 (43.41%), Query Frame = 1
Query: 2479 VLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNGHGSSQGQF 3024
            +LD E    FSFKI A+D  +  L+ TA+V++++ D NDNPP++   N    E++VS     G  +  + A D D G N  + Y++ P++                             FDLD  TG +  ++     +       V A D GTPP +    + + +++ + N    +   F
Sbjct:  426 LLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIF---NQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNA---------------------------SFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHF 577          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 232.261 bits (591), Expect = 3.061e-61
Identity = 240/851 (28.20%), Postives = 390/851 (45.83%), Query Frame = 1
Query:  439 FCILLSYFFNKEIHGQIEIHFKVVEESPTNSVIGNIH---NQALKQKGGVGSGDYY---YKSITDIEPFFLDSKTYE-FRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYK-ISYQSVNDGFKLKHSGRDHYEKL-SLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSD-QATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIG-ETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAI-----GYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTP 2943
            F +LL+    +   G  E ++ V EE P N +IG++    N +L     + +   +   YK+  D+    ++  T E F    R+DRE++C      I+ + R  Y+ ++  ++ DE  +       ++ +   I DINDN+P + +  I +S+PE+S I +  +LP A+DPD    N  Q Y+ I  Q++   F L        +K+  LIV K+ DRE++ T  +K+K  DG     S    + +S+ D ND  P F +  I   I EN P+ S + QL A D D  +  ++ F F N V    +  F++N  TG I     +D E    + + V+ TDG  +  +AT+ + V ++NDN P I + Y+      T          L+EN      +A ++V DKD E        N  + C  D H     LR   S   + F L T    D E T +Y  +L+  D+    L+ S    I + D NDN P+F      ++   S S+ E  + G  + ++ ATD D G NA I Y L   +  +F++D  +G L  +   D EK EK+  T+ A +  I       L +   + V + D ND  P+F  + Y F V E                    K+ +     +++P    D  ++   T S  D +  F I  ++G+I  N+   DRE+  S++F ++A D      SSTA V I ++DVNDN P+++ P +     N S++  +     G  +  + A D D+G N +V Y IV                           N   +F ++ ++GNI + +K  +SD+G  ++ V+A+D G P
Sbjct:   10 FAVLLACVVFQS--GAQEKNYTVREEMPENVLIGDLLKDLNLSLIPDKSLTTPMQFKLVYKT-GDVPLIRIEEGTGEIFTTGARIDREKLC----AGIVLDARCFYE-VEVAVLPDEIFR-------LVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIG-INGVQNYQLIKSQNI---FGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVLATDGGSTPARATVLVNVTDINDNVPSIDIRYIVNPTNGT--------VLLSENAPLNTKIALITVMDKDSEH-------NGRVTCFTD-HEVPFRLRPVFS---NQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVF------TQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPP-----LMSNATVFVTVLDQNDNSPIFTHNEYNFYVPES-----------------LPKHGTVGLITVTDP----DYGENSAVTLSILDVNDQFTIDPQSGVIRPNI-SFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPS-----NYSFEWVLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGG-------------------------NTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQP 759          

HSP 2 Score: 63.5438 bits (153), Expect = 1.926e-9
Identity = 46/172 (26.74%), Postives = 82/172 (47.67%), Query Frame = 1
Query: 2482 LDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            LDRE+  ++  K++  D      SSTAI+Q+ + D NDN P+++       EV++     IG  +  L A D D+G+N ++        F FS   +  +K L               F L+ +TG I + + +   +  S K+ V A+D G+ P +    + +N+ +++ N
Sbjct:  207 LDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFI---EKEIEVSIPENAPIGSSVTQLHATDADIGENARI-------HFYFSNLVSNIAKRL---------------FHLNTTTGLITVKEPLDREESPSHKLLVLATDGGSTPARA--TVLVNVTDINDN 351          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q71M42|PC11X_PANTR (Protocadherin-11 X-linked OS=Pan troglodytes OX=9598 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 242.276 bits (617), Expect = 1.335e-63
Identity = 247/847 (29.16%), Postives = 394/847 (46.52%), Query Frame = 1
Query:  439 FCILLSYFFNKEIHGQIEIHFKVVEESPTNSVIGNIH---NQALKQKGGVGSGDYY---YKSITDIEPFFLDSKTYE-FRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYK-ISYQSVNDGFKLKHSGRDHYEKL-SLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGK-HSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRI-GETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVF-PNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTP 2943
            F +LL+        G  E ++ + EE P N +IG++    N +L     + +   +   YK+  D+    ++  T E F    R+DRE++C    ++  ++C   +  ++  I+ DE  +       ++ +   I DINDN+P + +  I +S+PE+S I ++ TLP A+DPD   TN  Q Y+ I  Q++   F L        +K+  LIV K+ DRE++ T  +K+K  DG     S    + +S+TD ND  P FK+T I   I EN P+ + + QL A D D  +  K+ F F N V    R  F++N  TG I     +D E    + + V+ +DG     +A + + V +VNDN P I + Y+      T          L+EN      +A ++V+DKD +        N  + C  D H     LR   S   + F L T    D E T +Y  +L+  D+    L+ S    I + D NDN P+F      ++   + SI E  + G  + +V ATD D G NA I Y L   +  +FS+D  +G L  +   D EK +K+  TI A +  +    S +      + V+I D ND  PVF  + Y F V E                    ++ +     +++P    D  D+   T S  D +  F I  +TG+I  N+   DREK  S++F ++A D      SS+A V I ++DVNDN P+++  P+ ++YE+ +      G  +  + A D D G N +V Y IV                           N  ++F +D  TGNI + +K  ++D+G  ++ V+A+D G P
Sbjct:   10 FAVLLACVVFHS--GAQEKNYTIREEMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKT-GDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRD--EHC---FYEVEVAILPDEIFR-------LVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVG-TNGVQNYELIKSQNI---FGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDT--------VVLSENIPLNTKIALITVTDKDADH-------NGRVTCFTD-HEIPFRLRPVFS---NQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVF------TQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNV-----TVFVSIIDQNDNSPVFTHNEYNFYVPEN-----------------LPRHGTVGLITVTDP----DYGDNSAVTLSILDENDDFTIDSQTGVIRPNI-SFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTNP-GTVVFQVMAVDNDTGMNAEVRYSIVGG-------------------------NTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 759          

HSP 2 Score: 65.855 bits (159), Expect = 3.290e-9
Identity = 53/172 (30.81%), Postives = 85/172 (49.42%), Query Frame = 1
Query: 2482 LDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            LDRE+  ++  K++  D      SSTAI+Q+ + D NDN P  VF  T   EV++     +G  +  L A D D+G+N K+          FSF+      NL     S+I      +F L+ +TG I I + +   +  + K+ V ASD G  P + +  + +N+ +V+ N
Sbjct:  207 LDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHP--VFKETE-IEVSIPENAPVGTSVTQLHATDADIGENAKIH---------FSFS------NL----VSNIA---RRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAM--VLVNVTDVNDN 351          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q6WYY1|PC11X_PANPA (Protocadherin-11 X-linked OS=Pan paniscus OX=9597 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 242.276 bits (617), Expect = 1.346e-63
Identity = 247/847 (29.16%), Postives = 394/847 (46.52%), Query Frame = 1
Query:  439 FCILLSYFFNKEIHGQIEIHFKVVEESPTNSVIGNIH---NQALKQKGGVGSGDYY---YKSITDIEPFFLDSKTYE-FRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYK-ISYQSVNDGFKLKHSGRDHYEKL-SLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGK-HSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRI-GETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVF-PNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTP 2943
            F +LL+        G  E ++ + EE P N +IG++    N +L     + +   +   YK+  D+    ++  T E F    R+DRE++C    ++  ++C   +  ++  I+ DE  +       ++ +   I DINDN+P + +  I +S+PE+S I ++ TLP A+DPD   TN  Q Y+ I  Q++   F L        +K+  LIV K+ DRE++ T  +K+K  DG     S    + +S+TD ND  P FK+T I   I EN P+ + + QL A D D  +  K+ F F N V    R  F++N  TG I     +D E    + + V+ +DG     +A + + V +VNDN P I + Y+      T          L+EN      +A ++V+DKD +        N  + C  D H     LR   S   + F L T    D E T +Y  +L+  D+    L+ S    I + D NDN P+F      ++   + SI E  + G  + +V ATD D G NA I Y L   +  +FS+D  +G L  +   D EK +K+  TI A +  +    S +      + V+I D ND  PVF  + Y F V E                    ++ +     +++P    D  D+   T S  D +  F I  +TG+I  N+   DREK  S++F ++A D      SS+A V I ++DVNDN P+++  P+ ++YE+ +      G  +  + A D D G N +V Y IV                           N  ++F +D  TGNI + +K  ++D+G  ++ V+A+D G P
Sbjct:   10 FAVLLACVVFHS--GAQEKNYTIREEMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKT-GDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRD--EHC---FYEVEVAILPDEIFR-------LVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVG-TNGVQNYELIKSQNI---FGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDT--------VVLSENIPLNTKIALITVTDKDADH-------NGRVTCFTD-HEIPFRLRPVFS---NQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVF------TQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNV-----TVFVSIIDQNDNSPVFTHNEYNFYVPEN-----------------LPRHGTVGLITVTDP----DYGDNSAVTLSILDENDDFTIDSQTGVIRPNI-SFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTNP-GTVVFQVMAVDNDTGMNAEVRYSIVGG-------------------------NTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 759          

HSP 2 Score: 65.855 bits (159), Expect = 3.262e-9
Identity = 53/172 (30.81%), Postives = 85/172 (49.42%), Query Frame = 1
Query: 2482 LDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            LDRE+  ++  K++  D      SSTAI+Q+ + D NDN P  VF  T   EV++     +G  +  L A D D+G+N K+          FSF+      NL     S+I      +F L+ +TG I I + +   +  + K+ V ASD G  P + +  + +N+ +V+ N
Sbjct:  207 LDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHP--VFKETE-IEVSIPENAPVGTSVTQLHATDADIGENAKIH---------FSFS------NL----VSNIA---RRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAM--VLVNVTDVNDN 351          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q6X862|PC11X_GORGO (Protocadherin-11 X-linked OS=Gorilla gorilla gorilla OX=9595 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 4.138e-63
Identity = 247/846 (29.20%), Postives = 393/846 (46.45%), Query Frame = 1
Query:  439 FCILLSYFFNKEIHGQIEIHFKVVEESPTNSVIGNIH---NQALKQKGGVGSGDYY---YKSITDIEPFFLDSKTYE-FRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKL-SLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGK-HSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRI-GETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVF-PNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTP 2943
            F +LL+        G  E ++ + EE P N +IG++    N +L     + +   +   YK+  D+    ++  T E F    R+DRE++C    ++  ++C   +  ++  I+ DE  +       ++ +   I DINDN+P + +  I +S+PE+S I ++ TLP A+DPD    N  Q Y++  +S N  F L        +K+  LIV K+ DREK+ T  +K+K  DG     S    + +S+TD ND  P FK+T I   I EN P+ + + QL A D D  +  K+ F F N V    R  F++N  TG I     +D E    + + V+ +DG     +A + + V +VNDN P I + Y+      T          L+EN      +A ++V+DKD +        N  + C  D H     LR   S   + F L T    D E T +Y  +L+  D+    L+ S    I + D NDN P+F      ++   + SI E  + G  + +V ATD D G NA I Y L   +  +FS+D  +G L  +   D EK +K+  TI A +  +    S +      + V+I D ND  PVF  + Y F V E                    ++ +     +++P    D  D+   T S  D +  F I  +TG+I  N+   DREK  S++F ++A D      SS+A V I ++DVNDN P+++  P+ ++YE+ +      G  +  + A D D G N +V Y IV                           N  ++F +D  TGNI + +K  ++D+G  ++ V+A+D G P
Sbjct:   10 FAVLLACVVFHS--GAQEKNYTIREEMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKT-GDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRD--EHC---FYEVEVAILPDEIFR-------LVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVG-INGVQNYEL-IKSQN-MFGLDVIETPEGDKMPQLIVQKELDREKKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDT--------VVLSENIPLNTKIALITVTDKDADH-------NGRVTCFTD-HEIPFRLRPVFS---NQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVF------TQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNV-----TVFVSIIDQNDNSPVFTHNEYNFYVPEN-----------------LPRHGTVGLITVTDP----DYGDNSAVTLSILDENDDFTIDSQTGVIRPNI-SFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTNP-GTVVFQVIAVDNDTGMNAEVRYSIVGG-------------------------NTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 759          

HSP 2 Score: 67.3958 bits (163), Expect = 1.078e-9
Identity = 54/172 (31.40%), Postives = 85/172 (49.42%), Query Frame = 1
Query: 2482 LDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            LDREK  ++  K++  D      SSTAI+Q+ + D NDN P  VF  T   EV++     +G  +  L A D D+G+N K+          FSF+      NL     S+I      +F L+ +TG I I + +   +  + K+ V ASD G  P + +  + +N+ +V+ N
Sbjct:  207 LDREKKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHP--VFKETE-IEVSIPENAPVGTSVTQLHATDADIGENAKIH---------FSFS------NL----VSNIA---RRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAM--VLVNVTDVNDN 351          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q6WXV7|PC11X_PONPY (Protocadherin-11 X-linked OS=Pongo pygmaeus OX=9600 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 239.195 bits (609), Expect = 1.460e-62
Identity = 246/847 (29.04%), Postives = 393/847 (46.40%), Query Frame = 1
Query:  439 FCILLSYFFNKEIHGQIEIHFKVVEESPTNSVIGNIH---NQALKQKGGVGSGDYY---YKSITDIEPFFLDSKTYE-FRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYK-ISYQSVNDGFKLKHSGRDHYEKL-SLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGK-HSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRI-GETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVF-PNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTP 2943
            F +LL+        G  E ++ + EE P N +IG++    N +L     + +   +   YK+  D+    ++  T E F    R+DRE++C    ++  ++C   +  ++  I+ DE  +       ++ +   I DINDN+P + +  I +S+PE+S I ++ TLP A+DPD    N  Q Y+ I  Q++   F L        +K+  LIV K+ DRE++ T  +K+K  DG     S    + +S+TD ND  P FK+T I   I EN P+ + + QL A D D  +  K+ F F N V    R  F++N  TG I     +D E    + + V+ +DG     +A + + V +VNDN P I + Y+      T          L+EN      +A ++V+DKD +        N  + C  D H     LR   S   + F L T    D E T +Y  +L+  D+    L+ S    I + D NDN P+F      ++   + SI E  + G  + +V ATD D G NA I Y L   +  +FS+D  +G L  +   D EK +K+  TI A +  +    S +      + V+I D ND  PVF  + Y F V E                    ++ +     +++P    D  D+   T S  D +  F I  +TG+I  N+   DREK  S++F ++A D      SS+A V I ++DVNDN P+++  P+ ++YE+ +      G  +  + A D D G N +V Y IV                           N  ++F +D  TGNI + +K  ++D+G  ++ V+A+D G P
Sbjct:   10 FAVLLACVVFHS--GAQEKNYTIREEMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKT-GDVPLTRIEEDTGEIFTTGARIDREKLCAGIPRD--EHC---FYEVEVAILPDEIFR-------LVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVG-INGVQNYELIKSQNI---FGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPINDT--------VVLSENIPLNTKIALITVTDKDADH-------NGRVTCFTD-HEIPFRLRPVFS---NQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVF------TQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNV-----TVFVSIIDQNDNSPVFTHNEYNFYVPEN-----------------LPRHGTVGLITVTDP----DYGDNSAVTLSILDENDDFTIDSQTGVIRPNI-SFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTNP-GTVVFQVIAVDNDTGMNAEVRYSIVGG-------------------------NTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 759          

HSP 2 Score: 65.855 bits (159), Expect = 2.802e-9
Identity = 53/172 (30.81%), Postives = 85/172 (49.42%), Query Frame = 1
Query: 2482 LDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            LDRE+  ++  K++  D      SSTAI+Q+ + D NDN P  VF  T   EV++     +G  +  L A D D+G+N K+          FSF+      NL     S+I      +F L+ +TG I I + +   +  + K+ V ASD G  P + +  + +N+ +V+ N
Sbjct:  207 LDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHP--VFKETE-IEVSIPENAPVGTSVTQLHATDADIGENAKIH---------FSFS------NL----VSNIA---RRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAM--VLVNVTDVNDN 351          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q9BZA7|PC11X_HUMAN (Protocadherin-11 X-linked OS=Homo sapiens OX=9606 GN=PCDH11X PE=2 SV=1)

HSP 1 Score: 238.81 bits (608), Expect = 1.799e-62
Identity = 246/851 (28.91%), Postives = 391/851 (45.95%), Query Frame = 1
Query:  439 FCILLSYFFNKEIHGQIEIHFKVVEESPTNSVIGNIH---NQALKQKGGVGSGDYY---YKSITDIEPFFLDSKTYE-FRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYK-ISYQSVNDGFKLKHSGRDHYEKL-SLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGK-HSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRI-GETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAI-----GYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTP 2943
            F +LL+        G  E ++ + EE P N +IG++    N +L     + +   +   YK+  D+    ++  T E F    R+DRE++C    ++  ++C   +  ++  I+ DE  +       ++ +   I DINDN+P + +  I +S+PE+S I ++ TLP A+DPD    N  Q Y+ I  Q++   F L        +K+  LIV K+ DRE++ T  +K+K  DG     S    + +S+TD ND  P FK+T I   I EN P+ + + QL A D D  +  K+ F F N V    R  F++N  TG I     +D E    + + V+ +DG     +A + + V +VNDN P I + Y+      T          L+EN      +A ++V+DKD +        N  + C  D H     LR   S   + F L T    D E T +Y  +L+  D+    L+ S    I + D NDN P+F      ++   + SI E  + G  + +V A D D G NA I Y L   +  +FS+D  +G L  +   D EK +K+  TI A +  +    S +      + V+I D ND  PVF  + Y F V E                    ++ +     +++P    D  D+   T S  D +  F I  +TG+I  N+   DREK  S++F ++A D      SS+A V I ++DVNDN P+++ P +     N SY+  +     G  +  + A D D G N +V Y IV                           N  ++F +D  TGNI + +K  ++D+G  ++ V+A+D G P
Sbjct:   10 FAVLLACVVFHS--GAQEKNYTIREEMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKT-GDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRD--EHC---FYEVEVAILPDEIFR-------LVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVG-INGVQNYELIKSQNI---FGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDT--------VVLSENIPLNTKIALITVTDKDADH-------NGRVTCFTD-HEIPFRLRPVFS---NQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVF------TQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNV-----TVFVSIIDQNDNSPVFTHNEYNFYVPEN-----------------LPRHGTVGLITVTDP----DYGDNSAVTLSILDENDDFTIDSQTGVIRPNI-SFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPS-----NCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGG-------------------------NTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 759          

HSP 2 Score: 99.3673 bits (246), Expect = 1.911e-19
Identity = 105/437 (24.03%), Postives = 175/437 (40.05%), Query Frame = 1
Query: 1744 QLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSST----QFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGET---GLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQE--AIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNGHGSSQGQFN 3027
            QLI  K  DREE   Y  ++   D      S++   ++S+TD NDN P+F+            SI E   +GT++ Q+ ATD DIG NA I +S  +L S      F ++  +G +   +  D E+    +L + AS+         L+     + VN+ DVND +P  +       V +                  +   N+    I     D    +D        +D    FR+        +      LD E    ++ K+ AAD  + PL+ +A++ I++ D NDN P++    T ++ V VS  E  + G  +  + A D D G N K+ Y + P + P                           F LD  TG + + +K+           + A D G PP      + ++I++ + N    +  ++N
Sbjct:  200 QLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFK------ETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASD-------GGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVND------------TVVLSENIPLNTKIALITVTDKD----ADHNGRVTCFTDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVF----TQSF-VTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPP--------------------------EFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYN 576          
BLAST of Protocadherin-9 vs. TrEMBL
Match: H2KRD8 (Protocadherin-9 OS=Clonorchis sinensis OX=79923 GN=CLF_106059 PE=4 SV=1)

HSP 1 Score: 370.163 bits (949), Expect = 1.468e-102
Identity = 302/1028 (29.38%), Postives = 471/1028 (45.82%), Query Frame = 1
Query:  460 FFNKEIHGQIEIHFKVVEESPTNSVIGNIH------NQALKQKGGVGSGDYYYKSITDIEPFFLDSKTYEFRVSKRVDREEIC---------------RFQMQN--------IMQNCRMTYKFIQSRIIGDEKGQTSDS---SPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGF-----KLKHSGRDHYE-------------------------------KLSLIVNKDFDREKQATVS------------------VKLKAFDGD-PNPLSGQLDINISLTDINDKQPHFKKTSIHKI-------------INENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSG-------SNFKTPGRSSQYRA------YLAENKDPGFVVASLSVSDKDYESKRLGNQMNHL------------------------------LDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKI--------------------TVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMY---TNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKF--NRHE-------------------MFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIV 2982
            F    +H Q+ + F VVEES + + IGN++      N  +  +  VG     ++ +T    F+L+S T E      +DRE IC               R ++Q+        ++     +   IQ +++     Q + +   S  ++++ + ++DINDN P W    I+L++PEHS +GT   LP A DPD  P NTT  Y ++  + +DG      ++ H G   ++                               +L L V +DFD E  +T S                  ++L A DG  P  L+G   INIS+ DIND  P FK  +  K+             + EN P+   I   +A D DESD+ +L+F    SV  +VR+ F +N  TGE+      DYE +  +T+P+IVTD KH+    L + +KN ND+ P I V  +          N+K    S  Y        ++ E+  PG  +A++ VSD D          N L                              + C+I+     L L       ++ F+L+T   FDRE+ +++FA L+C+D     LS+ +   + I D+ND+ PIF+     +  + +Y +KE    GT +   +ATD D+G NA + +SL S +  +FSIDP+SG +R++  FD E+  +F +T+   + ++  KN     T + I                     V+I+DVNDC PVF   LY  +V E                   +K NS   +I +N  D  ++++   Y   + + +D +Q FR+   G I+V    LDRE++ S++F + A D     LSST  V + + DVNDN P WVFP  +N  VNV+  E +GYC+  L A DPD G+NG+V+YR++ +S   +    E    L    +S + F  NRH                    +F+LD ++G+IY+ + M   D+GS K+ VEASD+G P +     L INIV
Sbjct:   23 FLLVRMHAQLTMEFTVVEESSSQTFIGNLNTASSLLNNVVDSQSLVGG---TFQLLTQTNLFYLNSSTGELFTRSVIDRERICPEANNVRFVQSDSSSRTKLQSERTHDLPVVLDKLGDSICVIQLQVLHFMHPQQAPADVQSHRVLILKLTVLDINDNPPSWQENVIHLAVPEHSPVGTRFPLPTAFDPDCGPINTTVSYALT-DATSDGRSSGIKQVTHYGHGAFQLDTELVQESGFSELSSLMWSQQTMHCTRRMFRLWLRVTRDFDYEDVSTSSRLGEREFSTTSLPLKQLHLQLSASDGGLPVALTGTTLINISVVDINDHSPTFKIQNPEKLSAASGTILEDIVEVEENTPVGRVIYVAQASDLDESDKGRLQFSMGTSVSRSVRSAFEVNTNTGEVALLQSPDYEKQKSFTVPLIVTDHKHTATMNLLVRIKNQNDHPPVIVVQSVGNPASTNVDPNYKNTQASIPYSPTRSVNLHITEHDSPGRFIATVFVSDLDEPDGTEAAYDNSLHITPYQTAAAPPASVLSSKFFEASSAAENGIRCQIN--HLGLALSPLFDGAVNQFKLVTRTSFDREQQAEHFATLVCYDRGHPQLSSQLGIHLLIDDINDHAPIFK-----NHNMVAY-LKENEPAGTVVYTAEATDLDLGINAQLHFSLSSDNLNEFSIDPMSGIIRSLRAFDREQENQFNVTVIVQDRVLFDKNKSDAPTNRGIIQIRGIFPSSMERHSVKANLIVHIQDVNDCPPVFGNSLYQLSVSE------------------DAKINSLVGQIKANDSDATETNNQVQYLIKSQTENDGAQEFRVSAKGHIYVARGNLDRERVPSYNFYLVAVDSGVPALSSTTQVHVYVTDVNDNAPTWVFPAHNNQAVNVTVTEPVGYCVTQLNAIDPDEGENGEVSYRLIQTSRVATLENLERGSPL----TSKMAFIPNRHSNADAKYVGRLGADRPTAGNLFELDSNSGSIYVGRSMSTDDIGSIKLVVEASDKGQPVKVNHRVLQINIV 1016          
BLAST of Protocadherin-9 vs. TrEMBL
Match: A0A4S2M0G9 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004667 PE=4 SV=1)

HSP 1 Score: 365.54 bits (937), Expect = 6.357e-102
Identity = 302/1030 (29.32%), Postives = 475/1030 (46.12%), Query Frame = 1
Query:  460 FFNKEIHGQIEIHFKVVEESPTNSVIGNIH------NQALKQKGGVGSGDYYYKSITDIEPFFLDSKTYEFRVSKRVDREEIC---------------RFQMQN--------IMQNCRMTYKFIQSRIIGDEKGQTSDS---SPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGF-----KLKHSGRDHYE-------------------------------KLSLIVNKDFDREKQAT------------------VSVKLKAFDGD-PNPLSGQLDINISLTDINDKQPHFKKTSIHKI-------------INENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGS-------NFK--------TPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHL------------------------------LDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKN-------------------SQLLYTLQK-ITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMY---TNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKF--NRHE-------------------MFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIV 2982
            F    +H Q+ + F VVEESP+ + IGN++      N     +  VG     ++ +T    F L+S T E      +DRE IC               R ++Q+        ++     +   IQ +++     Q   +   S  ++++ + ++DINDN P W    I+LS+PEHS +GT   LP A DPD  PTNTT  Y ++ ++ +DG      ++ H G   ++                               +L L V +D D +  +T                  + ++L A DG  P  L+G   INIS+ DIND  P FK  +  K+             I EN P+   I   +A D DESD+ +L+F    SV   VR+ F +N  TGE+      DYE +  +T+P+IVTD KH+    L + +KN ND+ P I V  +          N+K        +P RS     ++ E+  PG  +A++ VSD D   +      N L                              + C+I+     L L       ++ F+L+T   FDRE+ +++FA L+C+D     LS+ +   + I D+ND+ PIF+     ++ + +Y +KE    GT +   +ATD D+G NA + +SL   +  +FSIDPI+G +R++  FD E+  +F +T+   + ++  KN                   S   ++++  + V+I+DVNDC PVF   LY  +V E                   +K NS   +I +N  D  ++++   Y   + + +D +Q FR+   G I+V    LDRE++ S++F + A D     LSST  V + + DVNDN P WVFP  +N  VNV+  E +GYC+  L A DPD G+NG+V+YR++ +S   +    E    L    +S + F  NRH                    +F+LD ++G+IY+ + M   D+GS K+ VEASD+G P +     L INIV
Sbjct:   23 FLLVRMHAQLTMEFTVVEESPSQTFIGNLNTAPSLLNNMADSQSLVGG---TFQLLTQTNLFQLNSSTGELFTRSVIDRERICPEASNVRFVQSDSTARTKLQSERTHDLPVVLDKLGDSICVIQLQVLHFLHPQQVPADVQSHRVLILKLTVLDINDNPPSWQENVIHLSVPEHSPVGTRFPLPTAFDPDCGPTNTTVSYALT-EATSDGRSSGIKQVTHYGNGAFQLDTELIQESGFSELNNLMWSQQTMHCTRRMFRLWLRVTRDLDYDDVSTSNRLGEREFSTTSLPLKQLHLQLSASDGGLPVALTGTTLINISVVDINDHSPIFKIQNPGKLSTGSSTILEDTVEIEENTPVGRVIYVAQASDLDESDKGRLQFSLGTSVSRLVRSAFEVNSNTGEVALLQSPDYEKQKSFTVPLIVTDHKHTANMNLLVRIKNQNDHPPVIVVQSVGNPASTNVDPNYKNTKAIIPYSPTRS--VTLHITEHDSPGRFIATVFVSDLDEPDRTEAAYDNSLHITPYQTAAAPPASVLSSTFFEGSSAAENGIRCQIN--HLGLALSPLFDGAVNQFKLVTRTAFDREQQAEHFATLVCYDRGQPQLSSQLGIHLLIDDINDHAPIFK-----NQNMVAY-LKENEPAGTVVYTAEATDLDLGINAQLHFSLSPENLNEFSIDPITGIIRSLRAFDREQENQFNVTVIVQDRVLFDKNKSDEPINHGIIQVRGIFPSSMERHSVKANLIVHIQDVNDCPPVFGNSLYQLSVAE------------------DAKINSLVGQIKANDSDATETNNQVQYLIKSQTENDGAQEFRVSAKGHIYVARGNLDRERVPSYNFYLVAVDSGVPALSSTTQVHVYVTDVNDNAPTWVFPAHNNQAVNVTVTEPVGYCVTQLNAIDPDEGENGEVSYRLIQTSRVATLENLERGGPL----TSKMAFIPNRHSNADAKYVGRLGADRPTAGNLFELDSNSGSIYVGRSMGTDDIGSIKLVVEASDKGQPIKVNHRVLQINIV 1016          
BLAST of Protocadherin-9 vs. TrEMBL
Match: A0A4S2M1F5 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004667 PE=4 SV=1)

HSP 1 Score: 366.311 bits (939), Expect = 3.013e-101
Identity = 302/1030 (29.32%), Postives = 475/1030 (46.12%), Query Frame = 1
Query:  460 FFNKEIHGQIEIHFKVVEESPTNSVIGNIH------NQALKQKGGVGSGDYYYKSITDIEPFFLDSKTYEFRVSKRVDREEIC---------------RFQMQN--------IMQNCRMTYKFIQSRIIGDEKGQTSDS---SPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGF-----KLKHSGRDHYE-------------------------------KLSLIVNKDFDREKQAT------------------VSVKLKAFDGD-PNPLSGQLDINISLTDINDKQPHFKKTSIHKI-------------INENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGS-------NFK--------TPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHL------------------------------LDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKN-------------------SQLLYTLQK-ITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMY---TNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKF--NRHE-------------------MFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIV 2982
            F    +H Q+ + F VVEESP+ + IGN++      N     +  VG     ++ +T    F L+S T E      +DRE IC               R ++Q+        ++     +   IQ +++     Q   +   S  ++++ + ++DINDN P W    I+LS+PEHS +GT   LP A DPD  PTNTT  Y ++ ++ +DG      ++ H G   ++                               +L L V +D D +  +T                  + ++L A DG  P  L+G   INIS+ DIND  P FK  +  K+             I EN P+   I   +A D DESD+ +L+F    SV   VR+ F +N  TGE+      DYE +  +T+P+IVTD KH+    L + +KN ND+ P I V  +          N+K        +P RS     ++ E+  PG  +A++ VSD D   +      N L                              + C+I+     L L       ++ F+L+T   FDRE+ +++FA L+C+D     LS+ +   + I D+ND+ PIF+     ++ + +Y +KE    GT +   +ATD D+G NA + +SL   +  +FSIDPI+G +R++  FD E+  +F +T+   + ++  KN                   S   ++++  + V+I+DVNDC PVF   LY  +V E                   +K NS   +I +N  D  ++++   Y   + + +D +Q FR+   G I+V    LDRE++ S++F + A D     LSST  V + + DVNDN P WVFP  +N  VNV+  E +GYC+  L A DPD G+NG+V+YR++ +S   +    E    L    +S + F  NRH                    +F+LD ++G+IY+ + M   D+GS K+ VEASD+G P +     L INIV
Sbjct:   23 FLLVRMHAQLTMEFTVVEESPSQTFIGNLNTAPSLLNNMADSQSLVGG---TFQLLTQTNLFQLNSSTGELFTRSVIDRERICPEASNVRFVQSDSTARTKLQSERTHDLPVVLDKLGDSICVIQLQVLHFLHPQQVPADVQSHRVLILKLTVLDINDNPPSWQENVIHLSVPEHSPVGTRFPLPTAFDPDCGPTNTTVSYALT-EATSDGRSSGIKQVTHYGNGAFQLDTELIQESGFSELNNLMWSQQTMHCTRRMFRLWLRVTRDLDYDDVSTSNRLGEREFSTTSLPLKQLHLQLSASDGGLPVALTGTTLINISVVDINDHSPIFKIQNPGKLSTGSSTILEDTVEIEENTPVGRVIYVAQASDLDESDKGRLQFSLGTSVSRLVRSAFEVNSNTGEVALLQSPDYEKQKSFTVPLIVTDHKHTANMNLLVRIKNQNDHPPVIVVQSVGNPASTNVDPNYKNTKAIIPYSPTRS--VTLHITEHDSPGRFIATVFVSDLDEPDRTEAAYDNSLHITPYQTAAAPPASVLSSTFFEGSSAAENGIRCQIN--HLGLALSPLFDGAVNQFKLVTRTAFDREQQAEHFATLVCYDRGQPQLSSQLGIHLLIDDINDHAPIFK-----NQNMVAY-LKENEPAGTVVYTAEATDLDLGINAQLHFSLSPENLNEFSIDPITGIIRSLRAFDREQENQFNVTVIVQDRVLFDKNKSDEPINHGIIQVRGIFPSSMERHSVKANLIVHIQDVNDCPPVFGNSLYQLSVAE------------------DAKINSLVGQIKANDSDATETNNQVQYLIKSQTENDGAQEFRVSAKGHIYVARGNLDRERVPSYNFYLVAVDSGVPALSSTTQVHVYVTDVNDNAPTWVFPAHNNQAVNVTVTEPVGYCVTQLNAIDPDEGENGEVSYRLIQTSRVATLENLERGGPL----TSKMAFIPNRHSNADAKYVGRLGADRPTAGNLFELDSNSGSIYVGRSMGTDDIGSIKLVVEASDKGQPIKVNHRVLQINIV 1016          
BLAST of Protocadherin-9 vs. TrEMBL
Match: A0A074ZZF0 (Uncharacterized protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=T265_12724 PE=4 SV=1)

HSP 1 Score: 362.073 bits (928), Expect = 8.133e-101
Identity = 308/1040 (29.62%), Postives = 476/1040 (45.77%), Query Frame = 1
Query:  460 FFNKEIHGQIEIHFKVVEESPTNSVIGNIH------NQALKQKGGVGSGDYYYKSITDIEPFFLDSKTYEFRVSKRVDREEIC------RFQMQNIMQNCRM-----------------TYKFIQSRIIGDEKGQTSDS---SPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGF-----KLKHSGRDHYE-------------------------------KLSLIVNKDFDREKQAT------------------VSVKLKAFDGD-PNPLSGQLDINISLTDINDKQPHFKKTSIHKI-------------INENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGS-------NFK--------TPGRSSQYRAYLAENKDPGFVVASLSVSDKD---------------------------------YESKRLGN-----QMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTI----------NASNPIIERKNSQLLYTL----------QKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMY---TNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLE--VTESSDIKF--NRHE-------------------MFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIV 2982
            F    +H Q  + F VVEESP  + IGN++      N  +  +  VG     ++ +T    F+L+S T E      VDRE IC      RF   +     ++                 +   IQ +++     Q + +   S  ++++ + ++DINDN P W    I L++PEHS +GT   LP A DPD  PTNTT  Y ++  + +DG      ++ H G   ++                               +L L V +D D +  +T                  + ++L A DG  P  L+G   INIS+ DIND  P FK  +  KI             I EN  +   I   +A D DESD+ +L+F    SV  +VR+ F +N  TGE++     DYE +  +T+P++VTD KH+    L + +KN ND+ P I V  +  S       N+K        +P RS     ++ E+  PG ++A++ VSD D                                 +E+   G+     Q+NHL           L L       ++ F+LIT   FDRE+ +++FA L+C+D     LS+ +   + I D+ND+ PIF+     ++ + +Y +KE    GT +   +ATD D+G NA + +SL   +  +FSID ISG +R++  FD E+  +F +T+          N S+  I R   Q+                + V+I+DVNDC PVF   LY  +V E                   +K NS   +I +N  D  ++++   Y   + + ++ +Q FR+   G I+V    LDRE++ S++F + A D     LSST  V + + DVNDN P WVFP  +N  VNV+  E +GYC+  L A DPD G+NG+V+YR++ +S   +       +NLE  V  +S + F  NRH                    +F+LD ++G+IY+ + M   D+GS K+ VEASD+G P +     L INIV
Sbjct:   23 FLLVRMHAQQTMEFTVVEESPPQTFIGNLNTASSLLNNVVDSQSIVGG---TFQLLTQTNLFYLNSSTGELFTRSVVDRERICPEASNVRFLQSDTSARTKLHSERTHDVPVVLDKLGDSTCVIQLQVLHFMHSQQTPADVQSHRVLILKLTVLDINDNPPSWQENVIQLAVPEHSPVGTRFPLPTAFDPDCGPTNTTVSYALT-DANSDGRSSGIKQVAHYGHSAFQLDTELVQESGFSELNNLMWSQQTMHCTRRMFRLWLRVTRDLDYDDVSTSNRLGEREFSTTSLPLKQLHLQLSASDGGLPVALTGTTLINISVVDINDHSPIFKIQNPGKISDASGTMPEDTVEIEENTLVGRVIYVAQASDLDESDKGRLQFSLGTSVSRSVRSAFEVNINTGEVVLLQSPDYEKQKSFTVPLLVTDHKHTANMNLLVRIKNQNDHPPVIVVQSVGNSAPTNVDSNYKNTQSNIPYSPTRS--VTLHITEHDSPGRLIATVFVSDLDEPDGTEVAYDNSLHIAPYQTAPAPSASVLPSKYFEASSAGDNGIRCQINHL----------GLALSPLFDGAVNQFKLITRTSFDREQQAEHFATLVCYDRGQPQLSSQLGIHLLIDDINDHAPIFK-----NQNMVAY-LKENEPAGTVVYTAEATDLDLGVNAQLHFSLSPENLNEFSIDSISGIVRSLRAFDREQENQFNVTVIVQDRVLFDKNKSDASINRGIIQVRGIFPSSMERHSVKANLIVHIQDVNDCPPVFGNSLYQLSVAE------------------DAKINSLVGQIKANDSDATETNNQVQYLIKSQTENEGAQEFRVSAKGHIYVARGNLDRERVPSYNFYLVAVDSGVPALSSTTQVHVYVTDVNDNAPTWVFPAHNNQAVNVTVTEPVGYCVTQLNAIDPDEGENGEVSYRLIQTSRVATL------ENLERGVPLTSKVAFIPNRHSNADVKYVGRLGADKPTAGNLFELDPNSGSIYVGRSMGTDDIGSIKLVVEASDKGQPIKVNHRVLQINIV 1016          
BLAST of Protocadherin-9 vs. TrEMBL
Match: A0A1S8WGR8 (Cadherin domain protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_10586 PE=4 SV=1)

HSP 1 Score: 357.836 bits (917), Expect = 1.132e-98
Identity = 308/1044 (29.50%), Postives = 473/1044 (45.31%), Query Frame = 1
Query:  451 LSYFFNKEIHGQIEIHFKVVEESPTNSVIGNIH------NQALKQKGGVGSGDYYYKSITDIEPFFLDSKTYEFRVSKRVDREEIC------RFQMQNIMQNCRM-TYKFIQSRIIGDEKGQT-------------SDSSPXXXXXXXXXXXXXXX------SPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGF-----KLKHSGRDHYE-------------------------------KLSLIVNKDFDREKQAT------------------VSVKLKAFDGD-PNPLSGQLDINISLTDINDKQPHFKKTSIHKI-------------INENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGS-------NFK--------TPGRSSQYRAYLAENKDPGFVVASLSVSDKD---------------------------------YESKRLGN-----QMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTI----------NASNPIIERKNSQLLYTL----------QKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYN--SNYFKIIS--NPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLE--VTESSDIKF--NRHE-------------------MFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIV 2982
            L  F    +H Q  + F VVEESP  + IGN++      N  +  +  VG     ++ +T    F+L+S T E      VDRE IC      RF   +     ++ + +     ++ D+ G +             S  +P  +  +  +I            P W    I L++PEHS +GT   LP A DPD  PTNTT  Y ++  + +DG      ++ H G   ++                               +L L V +D D +  +T                  + ++L A DG  P  L+G   INIS+ DIND  P FK  +  KI             I EN  +   I   +A D DESD+ +L+F    SV  +VR+ F +N  TGE++     DYE +  +T+P++VTD KH+    L + +KN ND+ P I V  +  S       N+K        +P RS     ++ E+  PG ++A++ VSD D                                 +E+   G+     Q+NHL           L L       ++ F+LIT   FDRE+ +++FA L+C+D     LS+ +   + I D+ND+ PIF+     ++ + +Y +KE    GT +   +ATD D+G NA + +SL   +  +FSID ISG +R++  FD E+  +F +T+          N S+  I R   Q+                + V+I+DVNDC PVF   LY  +V E    +  VG++   D D +   N  S   +++S   P  +     SQ    + ++ +Q FR+   G I+V    LDRE++ S++F + A D     LSST  V + + DVNDN P WVFP  +N  VNV+  E +GYC+  L A DPD G+NG+V+YR++ +S   +       +NLE  V  +S + F  NRH                    +F+LD ++G+IY+ + M   D+GS K+ VEASD+G P +     L INIV
Sbjct:   30 LCRFLLVRMHAQQTMEFTVVEESPPQTFIGNLNTASSLLNNVVDSQSIVGG---TFQLLTQTNLFYLNSSTGELFTRSVVDRERICPEASNVRFLQSDTSARTKLHSERTHDVPVVLDKLGDSTCVIQLQVLHFMHSQQTPADVQSHRVLILKLTVLDINDNPPSWQENVIQLAVPEHSPVGTRFPLPTAFDPDCGPTNTTVSYALT-DANSDGRSSGIKQVAHYGHSAFQLDTELVQESGFSELNNLMWSQQTMHCTRRMFRLWLRVTRDLDYDDVSTSNRLGEREFSTTSLPLKQLHLQLSASDGGLPVALTGTTLINISVVDINDHSPIFKIQNPGKISDASGTMPEDTVEIEENTLVGRVIYVAQASDLDESDKGRLQFSLGTSVSRSVRSAFEVNINTGEVVLLQSPDYEKQKSFTVPLLVTDHKHTANMNLLVRIKNQNDHPPVIVVQSVGNSAPTNVDSNYKNTQSNIPYSPTRS--VTLHITEHDSPGRLIATVFVSDLDEPDGTEVAYDNSLHIAPYQTAPAPSASVLPSKYFEASSAGDNGIRCQINHL----------GLALSPLFDGAVNQFKLITRTSFDREQQAEHFATLVCYDRGQPQLSSQLGIHLLIDDINDHAPIFK-----NQNMVAY-LKENEPAGTVVYTAEATDLDLGVNAQLHFSLSPENLNEFSIDSISGIVRSLRAFDREQENQFNVTVIVQDRVLFDKNKSDASINRGIIQVRGIFPSSMERHSVKANLIVHIQDVNDCPPVFGNSLYQLSVAEDAKINSLVGQIKANDSDATETNNQSSKELRVLSFTGPEMVQYLIKSQ----TENEGAQEFRVSAKGHIYVARGNLDRERVPSYNFYLVAVDSGVPALSSTTQVHVYVTDVNDNAPTWVFPAHNNQAVNVTVTEPVGYCVTQLNAIDPDEGENGEVSYRLIQTSRVATL------ENLERGVPLTSKVAFIPNRHSNADVKYVGRLGADKPTAGNLFELDPNSGSIYVGRSMGTDDIGSIKLVVEASDKGQPIKVNHRVLQINIV 1041          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: dchs1b (dachsous cadherin-related 1b [Source:ZFIN;Acc:ZDB-GENE-050208-41])

HSP 1 Score: 249.21 bits (635), Expect = 3.566e-66
Identity = 228/797 (28.61%), Postives = 378/797 (47.43%), Query Frame = 1
Query:  493 IHFKVVEESPTNSVIGNIHNQALKQKGGVGSGD---YYYKSITDIEP------FFLDSKTYEFRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLK-HSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQAT---LTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSL---DSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHD--IYDSSDSQMYTNSNSDASQYFRIG-ETGLIHVNVPVLDR-EKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFN 2823
            +  ++ EE P  +++G+I         G+  G+    Y+  I+D E         +D  T     ++R+DREE             R  Y FI   + G             + V++ + DIND++P +      L +PE + +GT+ +L  A D D+    TTQ Y I   +V   F+L+     +    L L+VN   DREK+A+ S+ L+AFDG     +GQ+ +++++ DIND  P F ++    II+E++P  S ILQ+ A D DE D   + +E +    +  R  F I+P +G I     +DYE++  + + V   D     + T   +TI V++ NDN P +++++LS                ++E   PG  VA +SVSD DY     G   N  +       + +L  + S   LI        ++ DREE   Y  +++  DS +  L    +F I +TDVNDNPP+F+      +  +  +I E V  G+ ++QV A D+D G N  + YS+       S  F+IDP++G +      DYE      + + A++          L +   + ++++D+ND  PVF   +Y  ++KE                  ++   + + ++ ++  D   + +    + + + S     F I  ETG I  +   LDR E   SF F + AAD     LSS+A+V++ + D+NDN P + +P   NY V++S Q A G  +  + A+DPD G+NGKVTYR VP      F  N+++  + ++ S   K N
Sbjct:   49 LELQLDEEQPAGTIVGDI-------SAGLPPGETASLYF--ISDHEGTGVGSDLNIDETTGIIETARRLDREE-------------RDHYSFIAVTMTG-----------LTVEVSITVNDINDHAPVFPKKKASLKIPEQTAVGTKFSLEPATDADKDQL-TTQGYLIKEGNVGQVFRLETKRATNKVLYLDLVVNGVLDREKRASYSLLLEAFDGGSPKKTGQMTLDVTVQDINDHAPIFNQSRYRAIISESLPQGSNILQVFASDADEGDNGLVLYEINRRQSDPDR-YFVIDPRSGIITLNKPLDYEVRKVHELVVQARDNASHPEITNAFVTIHVRDFNDNQPTMTIIFLSEDG----------SPRISEGAQPGQYVARISVSDPDY-----GEYSNVNVSLEGGDGKFALTTKDSIIYLI-----YVDQVLDREERDSYELRVMATDSGTPPLRAESSFTIQVTDVNDNPPLFD------QQAYKQTIPEVVYPGSFVLQVTARDKDHGPNGDVLYSILPDRGTHSDWFTIDPVTGIITTATQLDYETYPNPSVKVVATD-----GGKPPLSSTALVEISLQDINDNEPVFGSSVYNVSIKE------------------NTAAGTCFLEVTASDADGGSFGAVAYSLGSGAGSSPPTRFSINKETGQICTSA-ALDRDEGADSFEFTVTAADGGG--LSSSAVVKVSLQDINDNRPTF-YP--VNYAVSLSSQSAPGTSVIRVTAHDPDGGENGKVTYRTVPGGGSNFFTLNKDTGVISLSRSLHGKAN 755          

HSP 2 Score: 150.599 bits (379), Expect = 5.956e-36
Identity = 177/738 (23.98%), Postives = 299/738 (40.51%), Query Frame = 1
Query:  841 SPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSL-------IVNKDFDREKQATVSVKLKAFDG--DPNPLS-GQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDG---KHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRI-DPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLD-SLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIG-ETGLIHVNVPVLDREKISSFSFKIQAADRS-EKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQE-AIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNG 3000
            +P++    + + +PE+ + G+ I    A D D    N+  +Y I           +H   D  + L+L        + +  D E+ +++ + ++  D   DPN    G +   I +TD ND  P F   +   ++ E+ P+   +L + A+D D+ +  ++ +            RF +NP TG +     +D E +  Y + +I  D    +HS    L+++V +VND  P                  S+Y   + EN+  G  V ++S +D+D  +       +  +D  I  P    + L               TK+ DRE+   Y   +   D          T  I++ D NDN P+F       R  +S  + E +     +  +KATD+D G++  + Y +        F +D  SG L      D E+ + + L + A +     + +  L +   + + + DVND  P F    YT  V E                   +   S+   + +   D  +  + Q+    +S+A   F +  +TG I    P LDREK +S+SF++ A D S   P ++TA V + ILDVNDN P ++        +NVS +  A  + +A +KA D D G NG V YR       FS N+                            TG I   + +       + + VEA DQG+P Q  +  + I +   D  G
Sbjct: 1428 APEFPEDPVTIVVPENMQPGSSIYTFQAADKDGSGPNSEVRYSI-----------QHRYPDRSDLLTLDPISGVLTLGQALDHEETSSLFLVVRGTDSAVDPNQRRWGSVTARIFVTDENDNAPIFSSPTAVSVM-EDQPVGFVLLYVMARDADQGENGRVSYRIQTG---NAGGRFSLNPNTGSLSILKAMDREEQDSYNLTIIAEDHGTPQHSTTQVLSVQVIDVNDEAPWF--------------EKSEYEVQVRENQPAGTTVLTVSATDRDQGTNGRVTYGDVTVDGFIIAPETGVISL---------------TKVLDREQQDHYTVTVYAKDGGMPPNFAKATVHITVLDENDNAPVF------GRLQYSLELPENLE-PVELFIIKATDQDSGDSGHLEYRITVGDPDGDFQLDSSSGALSTSRPLDRERRDSYSLEVVAQD-----RGTPSLSSTATVEITVLDVNDNSPTFTSSSYTVDVSE------------------DAAVGSSLLDVTAKDAD--EGQNGQILYFLSSEARGDFTVDPDTGRIVTAAP-LDREKRASYSFQVCAVDLSPATPRNTTAQVTVTILDVNDNAPFFI---QDPLIINVSSRSVATNHVVATMKAEDKDFGANGSVFYRFAMPVRGFSINS---------------------------LTGEIQTTELLSSLTQSQRTLIVEAMDQGSPAQSSLGVVIIYVKEQDYQG 2058          

HSP 3 Score: 143.665 bits (361), Expect = 9.084e-34
Identity = 191/773 (24.71%), Postives = 327/773 (42.30%), Query Frame = 1
Query:  460 FFNKEIHGQIEIHFKVVEESPTNSVIGNIHNQALKQKGGVGSGDYYYKSITDIEPFFLDSKTYEFRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDG-FKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFD-GDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQH-KLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDG------KHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDY-ESKRLGNQM---NHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIE--DVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRI-GETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTY 2730
             F+  + G+ E+  +V E  P  S++G +  QA     G  S  +Y  S +  E F L+  T E R S  + R E   + +                 +   ++G    SS    V+ ++I+  +  +PK ++  + L+  E +K G+ I    + D      +    Y +   +  DG F +     D Y      + ++ D EK A  ++ ++  D     P +  + ++I++ D ND  P F +  +  ++ EN+   S I   +A D+D S  + ++R+   +   +   +   ++P++G +     +D+E  S   + V  TD       +     T  I V + NDN P           F +P   S     + E++  GFV+  +   D D  E+ R+  ++   N      ++P+  SL +                K  DREE   Y   +I  D  +   ST+    + + DVND  P FE      +  +   ++E    GTT++ V ATDRD G N  + Y    ++   F I P +G +    V D E+ + + +T+ A       K+  +     K TV+I   D ND  PVF +  Y+  + E                          F I +   D  DS   + Y  +  D    F++   +G +  + P LDRE+  S+S ++ A DR    LSSTA V+I +LDVNDN P +    + +Y V+VS   A+G  + ++ A D D G NG++ Y
Sbjct: 1214 IFSHMMPGK-ELLIQVQEGLPAGSLLGTL--QAKDPDEGENSTIFYSLSGSRAERFSLNPNTGELRSSSPLRRAEKSEYSIT----------------VSASDRGAPPQSS--SCVLRIQILGSSRAAPKPNTLSMTLNSVEGAKPGSVIGSVRSHDHRDVVLDGQVTYLVVGGTDKDGTFMVDRLTGDVY------LARELDYEKGALYTLNIEVEDFSKAYPSTYMIQLDITVQDSNDHAPEFPEDPVTIVVPENMQPGSSIYTFQAADKDGSGPNSEVRYSIQHRYPDR-SDLLTLDPISGVLTLGQALDHEETSSLFLVVRGTDSAVDPNQRRWGSVTARIFVTDENDNAP----------IFSSPTAVS-----VMEDQPVGFVLLYVMARDADQGENGRVSYRIQTGNAGGRFSLNPNTGSLSI---------------LKAMDREEQDSYNLTIIAEDHGTPQHSTTQVLSVQVIDVNDEAPWFE------KSEYEVQVRENQPAGTTVLTVSATDRDQGTNGRVTYG--DVTVDGFIIAPETGVISLTKVLDREQQDHYTVTVYA-------KDGGMPPNFAKATVHITVLDENDNAPVFGRLQYSLELPENLEPV-------------------ELFIIKATDQDSGDSGHLE-YRITVGDPDGDFQLDSSSGALSTSRP-LDRERRDSYSLEVVAQDRGTPSLSSTATVEITVLDVNDNSPTF---TSSSYTVDVSEDAAVGSSLLDVTAKDADEGQNGQILY 1889          

HSP 4 Score: 139.428 bits (350), Expect = 1.552e-32
Identity = 153/615 (24.88%), Postives = 260/615 (42.28%), Query Frame = 1
Query: 1042 LIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEF--DNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKH---SDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYES-----KRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRY-SLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCL--PVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRI-GETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDL 2844
            + V++  DRE++ +  +++ A D    PL  +    I +TD+ND  P F + +  + I E +   S +LQ+ A+D+D      + +    D     T  + F I+P+TG I TA  +DYE     ++ V+ TDG     S  A + I ++++NDN P                 SS Y   + EN   G     ++ SD D  S       LG+        R   ++E+              Q+ T+   DR+E +  F +     +D   LS+S   ++S+ D+NDN P F  P       ++ S+    A GT++++V A D D G N  + Y ++    S  F+++  +G +        +      + I A       ++   L       VNI  V   +  PVFE+  Y FTV E                       +    + +N   +     S  YT S+ D   YF +  ETG +  ++P LD E   S   ++QA+  S      T  V I I DVNDN P   F  +++  + +     IG  +  ++A D D G NG++++ ++ S    +F+    S  + +  S  + ++    +DL
Sbjct:  425 IYVDQVLDREERDSYELRVMATDSGTPPLRAESSFTIQVTDVNDNPPLFDQQAYKQTIPEVVYPGSFVLQVTARDKDHGPNGDVLYSILPDRG---THSDWFTIDPVTGIITTATQLDYETYPNPSVKVVATDGGKPPLSSTALVEISLQDINDNEPVFG--------------SSVYNVSIKENTAAGTCFLEVTASDADGGSFGAVAYSLGSGAGSSPPTRFSINKET-------------GQICTSAALDRDEGADSF-EFTVTAADGGGLSSSAVVKVSLQDINDNRPTF-YPVN-----YAVSLSSQSAPGTSVIRVTAHDPDGGENGKVTYRTVPGGGSNFFTLNKDTGVISLSRSLHGKANSVIAMVITA-------QDGGGLTAPVNARVNISVVAGSVAPPVFEQAQYFFTVSE------------------DVLRGTEVGVVRANSRSLATKDIS--YTISSGDPDGYFTVDSETGALRTSLP-LDHEARPSLELEVQASSGSPPAFGQTR-VTITIGDVNDNTP--AFLPSYSESLLLPEVTKIGSVVYRVQAEDRDSGQNGRISFHLLASGGQRAFSVERGSGEIRLISS--LSYDSVPRYDL 969          

HSP 5 Score: 137.887 bits (346), Expect = 4.690e-32
Identity = 164/655 (25.04%), Postives = 285/655 (43.51%), Query Frame = 1
Query:  877 LPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDG-FKL-KHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKH----SDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHR--ESLELRRSQSKLIDH-FQ----LITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQ-FSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMY-------TNSNSDASQYFRIGE-TGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNE 2775
            +PE+S IGTEIT+    D D  P      Y +   + + G F + ++SGR       + +    D E+++  ++ ++A D   +    + ++ + + D+ND  P F +      + E+ P  S ++ + A D D  +  ++ +     V  + R  FYI+P  G +     ++++ +      VI    +     S  AT+ I++ +VNDN P                  S+YRA ++E++ PG  + +L   D D       +Q N   D  I       + ++  S   +  H FQ    LI  +  D E  S+Y   ++  D      S+SV   I++ DVNDNPP+F      S   +  ++ EG A GT I+++ ATD+D   +A I+YS+ S    + FS+D  +G LR     D E      + I AS       +    + L  I V ++D+ND  P F     T +++E                      N      ++  H I    D+ MY        + +S   ++F + + TG +  +    D EK++SF F   A D      S+T  VQ+ I   ++  P +   +  ++EV    ++  G  I  ++A D D G +G V Y   P++ P+ F+ N+
Sbjct: 2277 VPENSLIGTEITMVTGNDVDSGP---VLSYSLRLDTPSQGKFGIHRYSGR-------VFLTAPLDFEERSWYTLTVQASD---SKHQSEANVTVLVGDMNDNVPTFTQDLYQVTLPEHSPPGSAVVTVTATDRDSGENGRVTYR----VLSSSREGFYIDPNNGTLFIGQKVEFDPERPSVSVVIEASDRGKPPLSSIATVQIQLTDVNDNAPMF--------------HQSEYRATVSEDQLPGATILTLEAVDVDL------SQENSGFDFAIASGNVGNAFQIESSVRFIEGHGFQTVGTLILAEQLDFELMSRYNLTIVVSDRGVPQRSSSVPAVITVIDVNDNPPVF------SHAEYVVALSEGAAAGTEILRLSATDQDSAPHAEIQYSISSGDEMELFSVDQWTGALRLQRPLDRETQPSHVVIIQAS-------DGHGHFALAPINVEVKDINDNRPYFPIQTMTASIRE----------------------NQPANSAVTVLHAI--DQDTGMYGILKYFMVDRSSQGKEFFAVDQNTGEVR-SRQAFDFEKVNSFHFMALAVDAGNN--SATVTVQVYITGEDEYDPAFT-SSAFSFEVPEGAKK--GQSIGQVQAVDEDGGVDGIVLYSF-PNTSPY-FDVNK 2849          

HSP 6 Score: 118.627 bits (296), Expect = 3.207e-26
Identity = 144/563 (25.58%), Postives = 239/563 (42.45%), Query Frame = 1
Query: 1345 INPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVK-NVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQ---FSIDPISGELRNIDVFDYEKMEKFELTI----NASNPIIERKNSQLLYTLQKITVNIEDVNDCLP----VFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            I+  TG I TA  +D E +  Y+   +   G       LT+EV   VND N    V     ++ K P +++             F +   + +DKD    +L  Q   + +  +      LE +R+ +K++ +  L+   + DRE+ + Y   L  FD  S   +  +T ++++ D+ND+ PIF      ++  +   I E +  G+ I+QV A+D D G+N ++ Y ++   S     F IDP SG +      DYE  +  EL +    NAS+P I         T   +T+++ D ND  P    +F  +  +  + EG     YV ++ V D D     N N      +      + DS +Y                 LI+V+  VLDRE+  S+  ++ A D    PL + +   IQ+ DVNDNPPL+   +   Y+  +      G  +  + A D D G NG V Y I+P                        +    + F +D  TG I  A ++      +  + V A+D G PP      + I++ +++ N
Sbjct:   95 IDETTGIIETARRLDREERDHYSFIAVTMTG-------LTVEVSITVNDINDHAPVFPKKKASLKIPEQTAVGTK---------FSLEPATDADKD----QLTTQGYLIKEGNVG-QVFRLETKRATNKVL-YLDLVVNGVLDREKRASYSLLLEAFDGGSPKKTGQMTLDVTVQDINDHAPIF------NQSRYRAIISESLPQGSNILQVFASDADEGDNGLVLYEINRRQSDPDRYFVIDPRSGIITLNKPLDYEVRKVHELVVQARDNASHPEI---------TNAFVTIHVRDFNDNQPTMTIIFLSEDGSPRISEGAQPGQYVARISVSDPDYGEYSNVNVSLEGGDGKFALTTKDSIIY-----------------LIYVD-QVLDREERDSYELRVMATDSGTPPLRAESSFTIQVTDVNDNPPLF---DQQAYKQTIPEVVYPGSFVLQVTARDKDHGPNGDVLYSILPD-----------------------RGTHSDWFTIDPVTGIITTATQLDYETYPNPSVKVVATDGGKPPLSSTALVEISLQDINDN 576          

HSP 7 Score: 110.538 bits (275), Expect = 9.430e-24
Identity = 133/502 (26.49%), Postives = 209/502 (41.63%), Query Frame = 1
Query:  844 PKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNK-DFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINP-----------LTGEILTAGYIDYEIKSEYTIPVIVTD---GKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYE-------SKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQ---FSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEG 2274
            P ++     ++LPEHS  G+ +    A D D    N    Y++   S  +GF +     D       I  K +FD E+  +VSV ++A D    PLS    + I LTD+ND  P F ++     ++E+    + IL LEA D D S Q    F+F       V N F I               G ++ A  +D+E+ S Y + ++V+D    + S      I V +VNDN P  S               ++Y   L+E    G  +  LS +D+D         S   G++M       +D    +L L+R                 DRE    +   +I   SD +         + + D+NDN P F  P Q      + SI+E     + +  + A D+D G   I++Y +   SS     F++D  +GE+R+   FD+EK+  F     A    ++  N+    T+Q + +  ED  D  P F    ++F V EG
Sbjct: 2367 PTFTQDLYQVTLPEHSPPGSAVVTVTATDRDS-GENGRVTYRV-LSSSREGFYI-----DPNNGTLFIGQKVEFDPER-PSVSVVIEASDRGKPPLSSIATVQIQLTDVNDNAPMFHQSEYRATVSEDQLPGATILTLEAVDVDLS-QENSGFDF-AIASGNVGNAFQIESSVRFIEGHGFQTVGTLILAEQLDFELMSRYNLTIVVSDRGVPQRSSSVPAVITVIDVNDNPPVFS--------------HAEYVVALSEGAAAGTEILRLSATDQDSAPHAEIQYSISSGDEMELF---SVDQWTGALRLQRP---------------LDRETQPSHV--VIIQASDGHGHFALAPINVEVKDINDNRPYF--PIQ----TMTASIRENQPANSAVTVLHAIDQDTGMYGILKYFMVDRSSQGKEFFAVDQNTGEVRSRQAFDFEKVNSFHFMALA----VDAGNNSATVTVQ-VYITGEDEYD--PAFTSSAFSFEVPEG 2811          

HSP 8 Score: 108.227 bits (269), Expect = 5.091e-23
Identity = 130/525 (24.76%), Postives = 225/525 (42.86%), Query Frame = 1
Query:  625 FFLDSKTYEFRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRI---IGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESD---------QHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDG----KHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLA--ENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASN 2145
            F +DS+T   R S  +D E     +++ +  +      F Q+R+   IGD     +D++P  +             P +S     L LPE +KIG+ +    A D D     + Q  +IS+  +  G +   S      ++ LI +  +D   +    +++ A DG     S    + + +   +D+ P F   +    + EN PL +  LQ+ A   D+            ++LR + D +        F I P +G +     +D E K  Y + V+ T G    K +  AT+ + V + NDN+P                R SQ R +LA  EN   G     +S +D+D         +N  L  R+     + ++  SQ+      ++ T    DRE  S Y   ++  D  +   S + T  I++ D NDN PIF     G   +    ++EG+  G+ +  ++A D D G N+ I YSL    + +FS++P +GELR+       +  ++ +T++AS+
Sbjct:  839 FTVDSETGALRTSLPLDHEARPSLELE-VQASSGSPPAFGQTRVTITIGD----VNDNTPAFL-------------PSYSE---SLLLPEVTKIGSVVYRVQAEDRD-----SGQNGRISFHLLASGGQRAFSVERGSGEIRLISSLSYDSVPR--YDLQVLARDGGVPQRSATFTLVVHVQAEDDQGPAFDTLTYRVELKENTPLNTRFLQVRALSRDQLKNGSSPAALLSYRLRPDGDAA-------GFGIVPDSGWLFVKSALDREAKDIYLLTVLATSGSGRMKKTGSATVRVSVTDENDNSP----------------RLSQERVFLAVRENLPTGTGFGRVSATDRDA-------GLNSRLTYRLLHTDRNFQIN-SQTG-----EVSTRAALDREHQSSYQLVVVVQDGGTPPRSATGTAHITVLDENDNAPIFSHMMPGKELL--IQVQEGLPAGSLLGTLQAKDPDEGENSTIFYSLSGSRAERFSLNPNTGELRSSSPLRRAEKSEYSITVSASD 1297          

HSP 9 Score: 107.457 bits (267), Expect = 8.956e-23
Identity = 155/677 (22.90%), Postives = 258/677 (38.11%), Query Frame = 1
Query:  997 FKLKHSGRDHYEKL-----SLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESD--QHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCR-----IDPHRESLELRRSQSKLIDHFQLITTKM-FDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRD----------------IGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGE-TGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQG 2937
            + ++ SGR    K+     S+      DRE      + + A D     L+G   + + + D+ND  P        ++  EN  + + I  +   D D      + LR       D   + +F I+  +G +     +D+E +S YT+ V  +D KH  +A +T+ V ++NDN P  +                 Y+  L E+  PG  V +++ +D+D  S   G     +L        IDP+  +L               I  K+ FD E  S     +   D     LS+  T +I +TDVNDN P+F       +  +  ++ E    G TI+ ++A D D                +GN   I  S+  +    F      G L   +  D+E M ++ LTI  S+  + +++S +        + + DVND  PVF    Y   + EG +                    +   ++ +   D    ++ Q Y+ S+ D  + F + + TG + +  P LDRE   S    IQA+D       + A + +++ D+NDN P   FP       ++   +     +  L A D D G  G + Y +V                       D      E F +D +TG +   Q      V S      A D G
Sbjct: 2201 YSIQSSGRSGLFKIDPLSGSITTAAIMDREIWMQTKLVITATDRGSPKLAGSATLTVIIVDLNDNSPTIPLPREVRV-PENSLIGTEITMVTGNDVDSGPVLSYSLRL------DTPSQGKFGIHRYSGRVFLTAPLDFEERSWYTLTVQASDSKHQSEANVTVLVGDMNDNVPTFT--------------QDLYQVTLPEHSPPGSAVVTVTATDRD--SGENGRVTYRVLSSSREGFYIDPNNGTL--------------FIGQKVEFDPERPSVSVV-IEASDRGKPPLSSIATVQIQLTDVNDNAPMFH------QSEYRATVSEDQLPGATILTLEAVDVDLSQENSGFDFAIASGNVGNAFQIESSVRFIEGHGFQ---TVGTLILAEQLDFELMSRYNLTIVVSDRGVPQRSSSV-----PAVITVIDVNDNPPVFSHAEYVVALSEGAAA------------------GTEILRLSATDQDSAPHAEIQ-YSISSGDEMELFSVDQWTGALRLQRP-LDRETQPSHVVIIQASDGHGH--FALAPINVEVKDINDNRPY--FP-IQTMTASIRENQPANSAVTVLHAIDQDTGMYGILKYFMV-----------------------DRSSQGKEFFAVDQNTGEVRSRQAFDFEKVNSFHFMALAVDAG 2777          

HSP 10 Score: 90.5077 bits (223), Expect = 1.374e-17
Identity = 157/726 (21.63%), Postives = 281/726 (38.71%), Query Frame = 1
Query:  871 LSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDG----FKL-KHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHS--DQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNN-----AIIRYSL-DSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSD---SQMYTNSNSDASQYFRI-GETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLW--VFPNTHNYEVNVSYQEAI--GYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVN 2985
            +SL   S  GT +    A DPD       +  K++Y++V  G    F L K +G        + +++    +  + +++ + A DG          +NIS+   +   P F++      ++E++ LR   + +   +        + +   +   +     F ++  TG + T+  +D+E +    + V  + G      Q  +TI + +VNDN P     Y                  L E    G VV  +   D+D  S + G    HLL       + +  + R   ++    +LI++  +D     +Y  Q++  D      S + T  + +   +D  P F+         +   +KE   + T  +QV+A  RD   N     A++ Y L     +  F I P SG L      D E  + + LT+ A++     K +        + V++ D ND  P   ++     V+E                  +    + + ++ +   D   +S      ++T+ N      F+I  +TG +      LDRE  SS+   +   D    P S+T    I +LD NDN P++  + P     E+ +  QE +  G  +  L+A DPD G+N  + Y +  S                          R E F L+ +TG +  +  ++ ++     I V ASD+G PPQ     L I I+ 
Sbjct:  694 VSLSSQSAPGTSVIRVTAHDPDG-----GENGKVTYRTVPGGGSNFFTLNKDTG-------VISLSRSLHGKANSVIAMVITAQDGGGLTAPVNARVNISVVAGSVAPPVFEQAQYFFTVSEDV-LRGTEVGVVRANSRSLATKDISYTISSGDPD---GYFTVDSETGALRTSLPLDHEARPSLELEVQASSGSPPAFGQTRVTITIGDVNDNTPAFLPSY-------------SESLLLPEVTKIGSVVYRVQAEDRD--SGQNGRISFHLLASG---GQRAFSVERGSGEI----RLISSLSYD--SVPRYDLQVLARDGGVPQRSATFTLVVHVQAEDDQGPAFDTL------TYRVELKENTPLNTRFLQVRALSRDQLKNGSSPAALLSYRLRPDGDAAGFGIVPDSGWLFVKSALDREAKDIYLLTVLATSGSGRMKKTGS----ATVRVSVTDENDNSPRLSQERVFLAVRE------------------NLPTGTGFGRVSATDRDAGLNSRLTYRLLHTDRN------FQINSQTGEVSTRA-ALDREHQSSYQLVVVVQDGGTPPRSATGTAHITVLDENDNAPIFSHMMPGK---ELLIQVQEGLPAGSLLGTLQAKDPDEGENSTIFYSLSGS--------------------------RAERFSLNPNTGELRSSSPLRRAEKSEYSITVSASDRGAPPQSSSCVLRIQILG 1315          

HSP 11 Score: 84.3445 bits (207), Expect = 1.008e-15
Identity = 135/558 (24.19%), Postives = 237/558 (42.47%), Query Frame = 1
Query:  583 SGDYYYKSITDIEP---FFLDSKTYEFRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDP-NPLSGQLDINISLTDINDKQPHF-KKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLS-STQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVF 2238
            SG   Y+ IT  +P   F LDS +     S+ +DRE    + ++                ++  ++G  S SS     V + ++D+NDNSP ++S    + + E + +G+ +    A D D+   N    Y +S ++  D      +GR       ++     DREK+A+ S ++ A D  P  P +    + +++ D+ND  P F +   I  + + ++     +  ++A+D+D      + + F   V       F IN LTGEI T   +    +S+ T+ V   D     Q++L + +  V + +         G  F    R       + EN   G  VA       D    R G   +     R    ++S  +  S  ++  H    ++   D E+T +     +   +++ S S+ +   + + DVNDN P F++     +   +Y ++E     + I+QV A D D G N  + YS+ S   S  F IDP+SG +    + D E   + +L I A++     + S  L     +TV I D+ND  P  
Sbjct: 1779 SGHLEYR-ITVGDPDGDFQLDSSSGALSTSRPLDRERRDSYSLE----------------VVAQDRGTPSLSS--TATVEITVLDVNDNSPTFTSSSYTVDVSEDAAVGSSLLDVTAKDADEG-QNGQILYFLSSEARGDFTVDPDTGR-------IVTAAPLDREKRASYSFQVCAVDLSPATPRNTTAQVTVTILDVNDNAPFFIQDPLIINVSSRSVATNHVVATMKAEDKDFGANGSVFYRFAMPV-----RGFSINSLTGEIQTTELLSSLTQSQRTLIVEAMDQGSPAQSSLGVVIIYVKEQD-------YQGIRFSRTTRD----VSIQENAAKGTAVAQAQAQYPD--GTRGGIAYSIFSGNR----QQSFRISSSTGEIWVH----SSTGLDFEDTPRL---RLVVKAETASSSSFMAVNLILQDVNDNLPRFQL-----QNYVAY-MREARGYDSPIIQVVAEDVDQGPNGQVTYSIQSSGRSGLFKIDPLSGSITTAAIMDREIWMQTKLVITATD-----RGSPKLAGSATLTVIIVDLNDNSPTI 2269          

HSP 12 Score: 68.9366 bits (167), Expect = 4.404e-11
Identity = 51/184 (27.72%), Postives = 86/184 (46.74%), Query Frame = 1
Query: 2452 TGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLS-DVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNG 3000
            +G + +  P LD E+ S ++  +QA+D   +   S A V + + D+NDN P +       Y+V +      G  +  + A D D G+NG+VTYR++ SS                           E F +D + G ++I QK++   +  S  + +EASD+G PP   I  + I + +V+ N 
Sbjct: 2321 SGRVFLTAP-LDFEERSWYTLTVQASDSKHQ---SEANVTVLVGDMNDNVPTF---TQDLYQVTLPEHSPPGSAVVTVTATDRDSGENGRVTYRVLSSS--------------------------REGFYIDPNNGTLFIGQKVEFDPERPSVSVVIEASDRGKPPLSSIATVQIQLTDVNDNA 2471          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 235.728 bits (600), Expect = 5.449e-63
Identity = 234/870 (26.90%), Postives = 393/870 (45.17%), Query Frame = 1
Query:  400 IDSRNYSMLVLIRFCILLSYFFNKEIHGQIEIHFKVVEESPTNSVIGNIH---NQALKQKGGVGSGDYYYKSITDI--EPFF-LDSKTYE-FRVSKRVDREEIC----------RFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYK-ISYQSVNDGFKLKHSGRDHYEKL-SLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSD-QATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDP-GFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGE-TGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTP 2943
            +D +++ +L  +  C+ L     +E+       + + EE   N +IGNI    N +        S +  Y+ ++     P   + S T E F  S R+DRE++C           F+++ ++      ++ I+ +I+  +   T+D++P                  + SP I +S+PE++ I +   +P A DPD  P N+  KY+ ++ QS    F L        EK   LIV ++ DRE++ T  +K+K  DG     S    + +++TD+ND +P FK++ I   I E+ P+ + ++QL+A D D     ++++ F   V    R  F +N  TG I     +D E  + + + V+ +DG  S  +AT+TI V +VNDN P I + Y+      T          L   KDP    +A ++VSDKD +       +N  + C I+       L+       + + L T+ + D E T +Y  +++  DS   SL+ +    + + D NDNPPIF  P      +   ++ E       +  + ATD D G NA I Y L   +++ F +D  +G L    VFD E  E+F  T+ A +       ++ L +   + V I D ND  P F  + + F V E                    KY++     +++     D+ ++ + + S  + ++ F +   TG+I  NV   DRE+ SS++F ++A D    P SS A V I ++DVNDNPP+ ++P ++     V      G  +A + A D D G N ++ Y IV                           N   +F +D  TGNI + +K   +D G  ++ V  SD G P
Sbjct:    1 MDLKDFYLLATLVACLWLDPAIAQELI------YPIREELQENVLIGNIPKDLNISHMNTATGASNNLVYRLVSKAGDNPLLRVMSNTGEIFTTSNRIDREKLCPGPSYEDSECSFEIEVVILPNDY-FRLIKIKIVVKD---TNDNAPM-----------------FPSPVINISIPENTLINSRFAIPSATDPDMGP-NSVYKYELVNGQS---AFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPESSPVGTSVVQLQATDADVGANAEIKYMFGTQVSPATRRLFALNSTTGLITVQRPLDREETANHKLSVLASDGSSSSARATVTINVTDVNDNAPNIDLRYIISPTNGT---------VLLSEKDPVNTKIALITVSDKDTD-------VNGKVICFIE-KDVPFHLKAVYD---NQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQP------VIELTVSENNKRDLYLTTITATDEDSGRNAEIVYQLGP-NASFFDLDRKTGVLTASRVFDREDQERFLFTVTARD-----NGTRALQSQAAVIVTILDQNDNSPKFTHNHFQFFVSEN-----------------LPKYSTVGVITVTD----ADAGENAVVSLSILNDNENFILDPYTGVIKSNVS-FDREQQSSYTFDVRAVDSGHPPCSSAAKVTINVIDVNDNPPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIV-------------------------NGNNKGLFRIDPVTGNITLEEKPTEADSGLHRLVVNISDLGYP 760          

HSP 2 Score: 113.235 bits (282), Expect = 1.071e-24
Identity = 154/653 (23.58%), Postives = 248/653 (37.98%), Query Frame = 1
Query: 1117 PNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGE----ILTAGYIDYEIKSEYTIPVIVTDG---KHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPF--QGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAI------IRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIG----------ETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHN-YEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            PN     + I I + D ND  P F    I+  I EN  + S      A D D       ++E  N   ++      +    GE    ++    +D E K  Y + + V DG   + S  A L + V +VNDN P                + SQ   ++ E+   G  V  L  +D D  +     ++ ++   ++ P    L    S + LI        +  DREET+ +  +L    SD +S S   T  I++TDVNDN P  ++ +    + G    S K+ V     ++ V   D D+    I      + + L ++   Q+ ++  +       + DYE  +++   I AS+      N   L     + V +ED ND  P+F + +   TV E                              +N  D+Y ++ +    +S  +A   +++G          +TG++  +  V DRE    F F + A D   + L S A V + ILD NDN P +    THN ++  VS        +  +   D D G+N  V+  I                            N +E F LD  TG I            S    V A D G PP     ++ IN+++V+ N
Sbjct:  118 PNDYFRLIKIKIVVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDMGPNSVYKYELVNG--QSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVF--------------KESQIEVHIPESSPVGTSVVQLQATDADVGANA---EIKYMFGTQVSPATRRLFALNSTTGLI-----TVQRPLDREETANH--KLSVLASDGSSSSARATVTINVTDVNDNAPNIDLRYIISPTNGTVLLSEKDPVNTKIALITVSDKDTDVNGKVICFIEKDVPFHLKAVYDNQYLLETSA-------LLDYEGTKEYIFKIVASDSGKPSLNQTAL-----VRVRLEDENDNPPIFTQPVIELTVSE------------------------------NNKRDLYLTTITATDEDSGRNAEIVYQLGPNASFFDLDRKTGVLTASR-VFDREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKF----THNHFQFFVSENLPKYSTVGVITVTDADAGENAVVSLSI---------------------------LNDNENFILDPYTGVIKSNVSFDREQQSSYTFDVRAVDSGHPPCSSAAKVTINVIDVNDN 670          

HSP 3 Score: 67.781 bits (164), Expect = 8.099e-11
Identity = 133/607 (21.91%), Postives = 238/607 (39.21%), Query Frame = 1
Query:  484 QIEIHFKVVEESPTNSVIGNIHNQALKQKGGVGS-GDYYYKSITDIEP-----FFLDSKTYEFRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTD-GKHS--DQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLI--TTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAI-GTTIVQVKATDRDIGNNAIIRYSL-DSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTV 2265
            QIE+H       P +S +G    Q       VG+  +  Y   T + P     F L+S T    V + +DREE    ++  +  +   +       I        +D++P I +  +        SP   +    + L E   + T+I L    D D   T+   K  I +   +  F LK    + Y    L  +   D E       K+ A D     L+    + + L D ND  P F +  I   ++EN      +  + A DED     ++ ++   +      + F ++  TG +  +   D E +  +   V   D G  +   QA + + + + NDN+P+ +               + ++ +++EN      V  ++V+D D          N ++   I        L  +++ ++D +  +  +   FDRE+ S Y   +   DS     S++    I++ DVNDNPPI   P   +    S+ +    AI G+ + +V A D D G NA ++Y++ +  +   F IDP++G                       N  +E K ++    L ++ VNI D+      + K L+T  +
Sbjct:  255 QIEVHI------PESSPVGTSVVQLQATDADVGANAEIKYMFGTQVSPATRRLFALNSTTGLITVQRPLDREETANHKLSVLASDGSSSSARATVTI---NVTDVNDNAPNIDLRYII-------SPTNGT----VLLSEKDPVNTKIALITVSDKD---TDVNGKV-ICFIEKDVPFHLKAVYDNQY---LLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLTTITATDEDSGRNAEIVYQLGPNA-----SFFDLDRKTGVLTASRVFDREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKFT--------------HNHFQFFVSENLPKYSTVGVITVTDADAGE-------NAVVSLSI--------LNDNENFILDPYTGVIKSNVSFDREQQSSYTFDVRAVDSGHPPCSSAAKVTINVIDVNDNPPIVIYPPSNT----SFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVNGNNKGLFRIDPVTG-----------------------NITLEEKPTEADSGLHRLVVNISDLG-----YPKSLHTLVL 768          

HSP 4 Score: 62.003 bits (149), Expect = 5.095e-9
Identity = 46/173 (26.59%), Postives = 82/173 (47.40%), Query Frame = 1
Query: 2482 LDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNG 3000
            LDRE+  ++  KI+  D      SSTAI+Q+ + DVNDN P++        EV++     +G  +  L+A D D+G N ++ Y          F T       +V+ ++        +F L+ +TG I + + +   +  + K+ V ASD  +   +    + IN+ +V+ N 
Sbjct:  209 LDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVF---KESQIEVHIPESSPVGTSVVQLQATDADVGANAEIKYM---------FGT-------QVSPAT------RRLFALNSTTGLITVQRPLDREETANHKLSVLASDGSSSSARAT--VTINVTDVNDNA 354          

HSP 5 Score: 52.7582 bits (125), Expect = 3.039e-6
Identity = 44/182 (24.18%), Postives = 75/182 (41.21%), Query Frame = 1
Query: 2479 VLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNGHGSSQGQF 3024
            +LD E    + FKI A+D  +  L+ TA+V++++ D NDNPP++  P     E+ VS        +  + A D D G N ++ Y++ P++                             FDLD  TG +  ++     D       V A D GT   +    + + I++ + N    +   F
Sbjct:  425 LLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPV---IELTVSENNKRDLYLTTITATDEDSGRNAEIVYQLGPNA---------------------------SFFDLDRKTGVLTASRVFDREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKFTHNHF 576          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 234.958 bits (598), Expect = 9.224e-63
Identity = 243/865 (28.09%), Postives = 389/865 (44.97%), Query Frame = 1
Query:  421 MLVLIRFCILLSYFFNKEIHGQIEIHFKVVEESPTNSVIGNIHNQA---LKQKGGVGSGDYY---YKSITDIEPFFLDSKTYE-FRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGR-DHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHS-DQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTI----NASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIG-ETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNT-HNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLH 2970
            +LVLI  C L+S  + +E        + V EE P N  IGN+       L     + S   +   YK+  D+    +++ T E F  + R+DRE +C      +    R  Y+ I+  ++ DE  +       ++ +   I DINDN+P + S  I +S+PE++ I     +P A DPD    N  Q Y++       G  +  +   D + +L  IV ++ DRE + T  +K+K  DG   P S    + ++++D+ND +P FK + +   + EN P+ + + QL A D D     ++ F F N +    +  F I+  TG I     +D E    + + V+ +DG  +  +AT+ + V +VNDN P I   Y+      T          L+EN      +A ++V+D+D +       +N  + C  D H     L+       D F L T    D E T +Y  +++  DS    L+TS    I I D NDN P+F  P          SI E    GT ++++ ATD D G+NA+I YSL   +   F+IDP SG L      D EK EK+  T+    N SNP+      +L+         ++D ND  P F    Y F V E                     Y +     +++     D+ D+ + T S  +    F I  +TG+I  N+   DRE+ SS++F ++A D      +S A V I ++DVNDN P++V P++ ++Y++ V +    G  +  + A D D G N ++ Y I+  S                            +F +D +TGNI + +K+  +D G  ++ V+  D G P     E LH
Sbjct:   49 VLVLILTC-LVSLCWAQEKD------YTVKEEQPENVRIGNLRTDLDLNLDPNIKLSSALQFKPVYKT-GDVPLVRVEASTGEIFTTANRIDRERLC----SGVFNEKRCFYE-IEVAVLPDEIFR-------LVKIRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVG-INGIQHYELVKSVSEFGLDIIETPEGDKWPQL--IVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGT--------VLLSENAPLNTKIALITVTDRDAD-------LNGKVTCYTD-HDVPFRLK---PVFNDQFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEI------QLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLI---------VQDQNDNSPAFTHAEYNFYVPEN-----------------LPLYGTVGLITVTD----ADAGDNAIVTLSIINGKDNFIIDPKTGVIKPNI-TFDREQQSSYTFVVKAVDSGLIQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDL-VPFTTNPGSVVTRVFAIDNDTGMNAELQYSIIGGS-------------------------PRGLFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLGQP-----ESLH 803          

HSP 2 Score: 96.2857 bits (238), Expect = 1.441e-19
Identity = 151/642 (23.52%), Postives = 240/642 (37.38%), Query Frame = 1
Query: 1117 PNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTG-------EILTAGYIDYEIKSEYTIPVIVTDGKH---SDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGE---LRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIG-ETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTH-NYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            P+ +   + I   + DIND  P F+ T I+  I EN  + +      A D D        +E   SV E     F ++ +         +++    +D E K  + + + V DG +   S  A L + V +VNDN P                + S+    + EN   G  V  L  +D D  S     Q++     +I P  +      S + LI        +  DRE  S    +LI   SD ++  +  T  +++TDVNDN P  +  +  +    +  + E   + T I  +  TDRD   N  +    D      F + P+  +   L      DYE   ++ + I AS+          L T   + + I+D ND  PVF +     ++ E                   +   +   KI +   D    S++ +  +   DA   F I   +G++ V+   LDREK   +SF + A D    PL S   V++ + D NDN P +    TH  Y   V     +   +  +   D D GDN  VT  I+                           N  + F +D  TG I            S    V+A D G        ++ IN+V+V+ N
Sbjct:  156 PDEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYELVKSVSE-----FGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVF--------------KDSEVEVNVPENAPMGTSVTQLHATDADLGSNA---QIHFSFSNQISPATKRHFAIDSSTGLI-----TVKQPLDRE--SNPVHKLIVLASDGSATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTDH--DVPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASD-----SGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPEN------------------NDPGTQLIKITATDAD--SGSNALIIYSLGPDAPDGFNIDPRSGILSVS-KRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAF----THAEYNFYVPENLPLYGTVGLITVTDADAGDNAIVTLSII---------------------------NGKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSGLIQTTSYAKVTINVVDVNDN 709          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 234.572 bits (597), Expect = 1.033e-62
Identity = 234/870 (26.90%), Postives = 393/870 (45.17%), Query Frame = 1
Query:  400 IDSRNYSMLVLIRFCILLSYFFNKEIHGQIEIHFKVVEESPTNSVIGNIH---NQALKQKGGVGSGDYYYKSITDI--EPFF-LDSKTYE-FRVSKRVDREEIC----------RFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYK-ISYQSVNDGFKLKHSGRDHYEKL-SLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSD-QATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDP-GFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGE-TGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTP 2943
            +D +++ +L  +  C+ L     +E+       + + EE   N +IGNI    N +        S +  Y+ ++     P   + S T E F  S R+DRE++C           F+++ ++      ++ I+ +I+  +   T+D++P                  + SP I +S+PE++ I +   +P A DPD  P N+  KY+ ++ QS    F L        EK   LIV ++ DRE++ T  +K+K  DG     S    + +++TD+ND +P FK++ I   I E+ P+ + ++QL+A D D     ++++ F   V    R  F +N  TG I     +D E  + + + V+ +DG  S  +AT+TI V +VNDN P I + Y+      T          L   KDP    +A ++VSDKD +       +N  + C I+       L+       + + L T+ + D E T +Y  +++  DS   SL+ +    + + D NDNPPIF  P      +   ++ E       +  + ATD D G NA I Y L   +++ F +D  +G L    VFD E  E+F  T+ A +       ++ L +   + V I D ND  P F  + + F V E                    KY++     +++     D+ ++ + + S  + ++ F +   TG+I  NV   DRE+ SS++F ++A D    P SS A V I ++DVNDNPP+ ++P ++     V      G  +A + A D D G N ++ Y IV                           N   +F +D  TGNI + +K   +D G  ++ V  SD G P
Sbjct:    1 MDLKDFYLLATLVACLWLDPAIAQELI------YPIREELQENVLIGNIPKDLNISHMNTATGASNNLVYRLVSKAGDNPLLRVMSNTGEIFTTSNRIDREKLCPGPSYEDSECSFEIEVVILPNDY-FRLIKIKIVVKD---TNDNAPM-----------------FPSPVINISIPENTLINSRFAIPSATDPDMGP-NSVYKYELVNGQS---AFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPESSPVGTSVVQLQATDADVGANAEIKYMFGTQVSPATRRLFALNSTTGLITVQRPLDREETANHKLSVLASDGSSSSARATVTINVTDVNDNAPNIDLRYIISPTNGT---------VLLSEKDPVNTKIALITVSDKDTD-------VNGKVICFIE-KDVPFHLKAVYD---NQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQP------VIELTVSENNKRDLYLTTITATDEDSGRNAEIVYQLGP-NASFFDLDRKTGVLTASRVFDREDQERFLFTVTARD-----NGTRALQSQAAVIVTILDQNDNSPKFTHNHFQFFVSEN-----------------LPKYSTVGVITVTD----ADAGENAVVSLSILNDNENFILDPYTGVIKSNVS-FDREQQSSYTFDVRAVDSGHPPCSSAAKVTINVIDVNDNPPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIV-------------------------NGNNKGLFRIDPVTGNITLEEKPTEADSGLHRLVVNISDLGYP 760          

HSP 2 Score: 112.464 bits (280), Expect = 1.441e-24
Identity = 154/653 (23.58%), Postives = 248/653 (37.98%), Query Frame = 1
Query: 1117 PNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGE----ILTAGYIDYEIKSEYTIPVIVTDG---KHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPF--QGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAI------IRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIG----------ETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHN-YEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            PN     + I I + D ND  P F    I+  I EN  + S      A D D       ++E  N   ++      +    GE    ++    +D E K  Y + + V DG   + S  A L + V +VNDN P                + SQ   ++ E+   G  V  L  +D D  +     ++ ++   ++ P    L    S + LI        +  DREET+ +  +L    SD +S S   T  I++TDVNDN P  ++ +    + G    S K+ V     ++ V   D D+    I      + + L ++   Q+ ++  +       + DYE  +++   I AS+      N   L     + V +ED ND  P+F + +   TV E                              +N  D+Y ++ +    +S  +A   +++G          +TG++  +  V DRE    F F + A D   + L S A V + ILD NDN P +    THN ++  VS        +  +   D D G+N  V+  I                            N +E F LD  TG I            S    V A D G PP     ++ IN+++V+ N
Sbjct:  118 PNDYFRLIKIKIVVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDMGPNSVYKYELVNG--QSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVF--------------KESQIEVHIPESSPVGTSVVQLQATDADVGANA---EIKYMFGTQVSPATRRLFALNSTTGLI-----TVQRPLDREETANH--KLSVLASDGSSSSARATVTINVTDVNDNAPNIDLRYIISPTNGTVLLSEKDPVNTKIALITVSDKDTDVNGKVICFIEKDVPFHLKAVYDNQYLLETSA-------LLDYEGTKEYIFKIVASDSGKPSLNQTAL-----VRVRLEDENDNPPIFTQPVIELTVSE------------------------------NNKRDLYLTTITATDEDSGRNAEIVYQLGPNASFFDLDRKTGVLTASR-VFDREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKF----THNHFQFFVSENLPKYSTVGVITVTDADAGENAVVSLSI---------------------------LNDNENFILDPYTGVIKSNVSFDREQQSSYTFDVRAVDSGHPPCSSAAKVTINVIDVNDN 670          

HSP 3 Score: 67.3958 bits (163), Expect = 1.153e-10
Identity = 133/607 (21.91%), Postives = 238/607 (39.21%), Query Frame = 1
Query:  484 QIEIHFKVVEESPTNSVIGNIHNQALKQKGGVGS-GDYYYKSITDIEP-----FFLDSKTYEFRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTD-GKHS--DQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLI--TTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAI-GTTIVQVKATDRDIGNNAIIRYSL-DSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTV 2265
            QIE+H       P +S +G    Q       VG+  +  Y   T + P     F L+S T    V + +DREE    ++  +  +   +       I        +D++P I +  +        SP   +    + L E   + T+I L    D D   T+   K  I +   +  F LK    + Y    L  +   D E       K+ A D     L+    + + L D ND  P F +  I   ++EN      +  + A DED     ++ ++   +      + F ++  TG +  +   D E +  +   V   D G  +   QA + + + + NDN+P+ +               + ++ +++EN      V  ++V+D D          N ++   I        L  +++ ++D +  +  +   FDRE+ S Y   +   DS     S++    I++ DVNDNPPI   P   +    S+ +    AI G+ + +V A D D G NA ++Y++ +  +   F IDP++G                       N  +E K ++    L ++ VNI D+      + K L+T  +
Sbjct:  255 QIEVHI------PESSPVGTSVVQLQATDADVGANAEIKYMFGTQVSPATRRLFALNSTTGLITVQRPLDREETANHKLSVLASDGSSSSARATVTI---NVTDVNDNAPNIDLRYII-------SPTNGT----VLLSEKDPVNTKIALITVSDKD---TDVNGKV-ICFIEKDVPFHLKAVYDNQY---LLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLTTITATDEDSGRNAEIVYQLGPNA-----SFFDLDRKTGVLTASRVFDREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKFT--------------HNHFQFFVSENLPKYSTVGVITVTDADAGE-------NAVVSLSI--------LNDNENFILDPYTGVIKSNVSFDREQQSSYTFDVRAVDSGHPPCSSAAKVTINVIDVNDNPPIVIYPPSNT----SFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVNGNNKGLFRIDPVTG-----------------------NITLEEKPTEADSGLHRLVVNISDLG-----YPKSLHTLVL 768          

HSP 4 Score: 62.003 bits (149), Expect = 5.176e-9
Identity = 46/173 (26.59%), Postives = 82/173 (47.40%), Query Frame = 1
Query: 2482 LDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNG 3000
            LDRE+  ++  KI+  D      SSTAI+Q+ + DVNDN P++        EV++     +G  +  L+A D D+G N ++ Y          F T       +V+ ++        +F L+ +TG I + + +   +  + K+ V ASD  +   +    + IN+ +V+ N 
Sbjct:  209 LDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVF---KESQIEVHIPESSPVGTSVVQLQATDADVGANAEIKYM---------FGT-------QVSPAT------RRLFALNSTTGLITVQRPLDREETANHKLSVLASDGSSSSARA--TVTINVTDVNDNA 354          

HSP 5 Score: 52.7582 bits (125), Expect = 3.484e-6
Identity = 44/182 (24.18%), Postives = 75/182 (41.21%), Query Frame = 1
Query: 2479 VLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNGHGSSQGQF 3024
            +LD E    + FKI A+D  +  L+ TA+V++++ D NDNPP++  P     E+ VS        +  + A D D G N ++ Y++ P++                             FDLD  TG +  ++     D       V A D GT   +    + + I++ + N    +   F
Sbjct:  425 LLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPV---IELTVSENNKRDLYLTTITATDEDSGRNAEIVYQLGPNA---------------------------SFFDLDRKTGVLTASRVFDREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKFTHNHF 576          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 235.728 bits (600), Expect = 1.370e-62
Identity = 243/865 (28.09%), Postives = 389/865 (44.97%), Query Frame = 1
Query:  421 MLVLIRFCILLSYFFNKEIHGQIEIHFKVVEESPTNSVIGNIHNQA---LKQKGGVGSGDYY---YKSITDIEPFFLDSKTYE-FRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGR-DHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHS-DQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTI----NASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIG-ETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNT-HNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLH 2970
            +LVLI  C L+S  + +E        + V EE P N  IGN+       L     + S   +   YK+  D+    +++ T E F  + R+DRE +C      +    R  Y+ I+  ++ DE  +       ++ +   I DINDN+P + S  I +S+PE++ I     +P A DPD    N  Q Y++       G  +  +   D + +L  IV ++ DRE + T  +K+K  DG   P S    + ++++D+ND +P FK + +   + EN P+ + + QL A D D     ++ F F N +    +  F I+  TG I     +D E    + + V+ +DG  +  +AT+ + V +VNDN P I   Y+      T          L+EN      +A ++V+D+D +       +N  + C  D H     L+       D F L T    D E T +Y  +++  DS    L+TS    I I D NDN P+F  P          SI E    GT ++++ ATD D G+NA+I YSL   +   F+IDP SG L      D EK EK+  T+    N SNP+      +L+         ++D ND  P F    Y F V E                     Y +     +++     D+ D+ + T S  +    F I  +TG+I  N+   DRE+ SS++F ++A D      +S A V I ++DVNDN P++V P++ ++Y++ V +    G  +  + A D D G N ++ Y I+  S                            +F +D +TGNI + +K+  +D G  ++ V+  D G P     E LH
Sbjct:   49 VLVLILTC-LVSLCWAQEKD------YTVKEEQPENVRIGNLRTDLDLNLDPNIKLSSALQFKPVYKT-GDVPLVRVEASTGEIFTTANRIDRERLC----SGVFNEKRCFYE-IEVAVLPDEIFR-------LVKIRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVG-INGIQHYELVKSVSEFGLDIIETPEGDKWPQL--IVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGT--------VLLSENAPLNTKIALITVTDRDAD-------LNGKVTCYTD-HDVPFRLK---PVFNDQFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEI------QLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLI---------VQDQNDNSPAFTHAEYNFYVPEN-----------------LPLYGTVGLITVTD----ADAGDNAIVTLSIINGKDNFIIDPKTGVIKPNI-TFDREQQSSYTFVVKAVDSGLIQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDL-VPFTTNPGSVVTRVFAIDNDTGMNAELQYSIIGGS-------------------------PRGLFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLGQP-----ESLH 803          

HSP 2 Score: 97.0561 bits (240), Expect = 9.745e-20
Identity = 151/632 (23.89%), Postives = 236/632 (37.34%), Query Frame = 1
Query: 1138 LDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTG----EILTAGYIDYEIKSEYTIPVIVTDGKH---SDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGE---LRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIG-ETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTH-NYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            + I   + DIND  P F+ T I+  I EN  + +      A D D        +E   SV E   +   I    G    +++    +D E K  + + + V DG +   S  A L + V +VNDN P                + S+    + EN   G  V  L  +D D  S     Q++     +I P  +      S + LI        +  DRE  S    +LI   SD ++  +  T  +++TDVNDN P  +  +  +    +  + E   + T I  +  TDRD   N  +    D      F + P+  +   L      DYE   ++ + I AS+          L T   + + I+D ND  PVF +     ++ E                   +   +   KI +   D    S++ +  +   DA   F I   +G++ V+   LDREK   +SF + A D    PL S   V++ + D NDN P +    TH  Y   V     +   +  +   D D GDN  VT  I+                           N  + F +D  TG I            S    V+A D G        ++ IN+V+V+ N
Sbjct:  163 VKIRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYELVKSVSEFGLD--IIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVF--------------KDSEVEVNVPENAPMGTSVTQLHATDADLGSNA---QIHFSFSNQISPATKRHFAIDSSTGLI-----TVKQPLDRE--SNPVHKLIVLASDGSATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTDH--DVPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASD-----SGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPEN------------------NDPGTQLIKITATDAD--SGSNALIIYSLGPDAPDGFNIDPRSGILSVS-KRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAF----THAEYNFYVPENLPLYGTVGLITVTDADAGDNAIVTLSII---------------------------NGKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSGLIQTTSYAKVTINVVDVNDN 709          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010725.1 (pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 gene:ENSPMAG00000009713.1 transcript:ENSPMAT00000010725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 200.675 bits (509), Expect = 6.512e-53
Identity = 211/816 (25.86%), Postives = 350/816 (42.89%), Query Frame = 1
Query:  649 EFRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKL--------------------KHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKI-INENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDE-TVRNRFYINPLTGEILT--AGYIDYEIKSEYTIPVIVTDGKH---SDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRID-PHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVP--FQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQ-----FSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVF------EKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYF--RIGET--GLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIA-NLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKI 2958
            E  V+ R+DRE +C  +       CR T      ++    KGQ S S+  ++ V + + DIND++P + +PH+ +S+ E   +G  + LP A+DPD   TN+ Q Y+IS  S  DG +L                       G  H   L L   +  DRE   +  + L   DG    LSG + + I + D ND  P F       + I E+  + + ++QL A D D      + + F   +     +   +++  TG +    A  +D E    + + V+  DG     S   T+T+E+ + NDN P   V+ L G      G        + EN   G  V  +SVSD D  S       +  +D R++ P    L    S +K+   F L TT++ D EE  QY   ++  D  +  LS  +   IS+ D+NDN P+F  P   +G   ++  S++E    GT ++ + ATD D G N  I ++L  L+  +     FS++  +G+L      D EK  ++EL++ A +    ++ ++ +     + V + D ND  P F         +Y F V+E                         Y   +S   D+ +  ++++  N   +A   +    G+T  G++   V VLDRE    +   ++A D     LS++  V I + D NDN P+   PNT++   +V      G  +  ++ AND D GDNG+  Y I                         I  N   +F L+  +G + +A+ +   D G  ++ V   D+G    +++
Sbjct:   82 ELSVALRLDREALCMEEPDA----CRSTGFMHTVQVAAMAKGQGS-SNLRLLDVQLLVRDINDHAPAFRAPHLNVSISESEAVGRRVPLPRAIDPDAG-TNSIQHYRISAAS-GDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLEL--REQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGG------VKIVENLPSGTPVVLISVSDPDLGS-------SGTVDVRLEFPTGAELA---SPNKV--QFLLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAI-----VRVTVLDENDNAPTFVGVSNSTNCMYQFFVEE-------------------ETSVGTYVGTVST-SDLDEGDNARVALNLVREAGPDWIGGAGDTPGGVVRTLV-VLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTNDNAPVITSPNTNDTWKHVRTFSPAGMLVGVSVTANDIDAGDNGRPLYEI-------------------------IGGNPKGIFLLNADSGALSLARTVSSLDEGLHRLVVRVRDRGGSGSRRV 819          

HSP 2 Score: 106.301 bits (264), Expect = 2.351e-23
Identity = 115/457 (25.16%), Postives = 175/457 (38.29%), Query Frame = 1
Query: 1690 HRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYS----LDSLSS-TQFSIDPISG--ELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQ-KITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISN-----PHDIYDSSDSQMYTNSNSDASQYFRIG-------ETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFP-----NTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVN 2985
            HR  LELR               +  DRE    Y   L   D  +  LS SV   I + D NDN P+F  P           I E   +GT++VQ++A D D G N  I YS    L SL++     +D  +G   +RN +  D E M    L +      + R   QL  +    +TV + D ND  PVFE                                     KI+ N     P  +   SD  + ++   D    F  G       +   +     +LD E+   ++  + AADR    LS    + I ++D+NDN P+++ P     +   YEV++      G  + NL A D D G NG +T           F  +E +    V           E+F L+  TG + +A  +        ++ VEA D G+P +K    + + +++
Sbjct:  220 HRALLELR---------------EQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPT-----RPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVV------VARDGGQLSRSASVTVTVELNDDNDNAPVFE-----------------------VIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAELASPNKVQFLLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAIT-----------FTLSELAGGESVA----------ELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLD 606          

HSP 3 Score: 55.4546 bits (132), Expect = 9.025e-8
Identity = 97/418 (23.21%), Postives = 157/418 (37.56%), Query Frame = 1
Query: 1849 FEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISG--------------------------ELRNIDVFDYEKMEKFELTI---NASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHV-NVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLW-VFPNTHNY----EVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
             ++ + D+ND+ P F  P        + SI E  A+G  +   +A D D G N+I  Y + + S     + P S                           ELR  +  D E +  +EL +   +  NP  +   S LL      T+ + D ND  PVF  D  T  V+           +       +S          + P+     S     T+  + A+ +   G TGL+ V N   LDRE +      + A D  +   S++  V +++ D NDN P++ V      Y     V +      G  +  +  +DPDLG +G V  R+    FP            E+   + ++F       LD      Y              + V A+D+GTP   K+  L I++V+++ N
Sbjct:  130 VQLLVRDINDHAPAFRAPHL------NVSISESEAVGRRVPLPRAIDPDAGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELR--EQLDREAVPSYELLLWGEDGGNP--KLSGSVLL------TIVVVDANDNAPVF-VDPPTRPVR-----------ITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVD-GTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRL---EFP---------TGAELASPNKVQFLLKTTRLLDYEEAQQY-------------NVSVLAADRGTPKLSKLLNLIISVVDINDN 493          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 174.096 bits (440), Expect = 2.533e-44
Identity = 180/740 (24.32%), Postives = 314/740 (42.43%), Query Frame = 1
Query:  841 SPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKI--SYQSVNDGFKLKHSGRDHYEKLS-LIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEF-----DNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTD---------------GKHSDQATLTIEVKNVNDNNPEISVLYLS-GSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASN---PIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIG-ETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQ-KKIERLHI 2973
            +P +++P + +S+PE++  G    +  A DPD    N  ++Y++  S  +    F+L  +   + EK+  L+V K  DRE++    + L+A DG   P SG   + I++TD ND  P F +  ++  I EN P+ + ++QL A D D     ++ +            +  +  F ++  +G +   G ++ E    Y I ++ TD                   +  + TIE++++    P   V+Y+S  S+   P                   VA ++VSD D  +       N  + C I  +   +  +  +    + + L T +  D E  ++Y  Q+   D+ + SLS +++  I + D NDN P+F  P       +  S+ E   IG  ++ V ATDRD+  NA + Y L   + T F +DP +G +   +  D EK   +  TI A +   P++E   +        + VN+ DVND  P F    + F V E                  +   +S    +     D  ++   ++ +   +D  Q F I  E+G+I  NV   DRE+   +  ++QA D  E   SST  V I ++D+NDN P+ + P ++     V  +   G  +  + A D D   N ++ Y IV                           N H +F +D   GNI + + +  +  G  ++ V  SD G   Q   +  +H+
Sbjct:  150 APAFAAPVLTVSVPENAPAGKRFPIQPANDPDSE-ANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDI--VAPVNGVIYISEASHVNLP-------------------VALITVSDPDIGA-------NGAVTCYI--YNPEVPFQLKKLTYPNQYLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEP------TYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDAPTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNAT--------VIVNVLDVNDNRPRFSLAEFDFYVNE------------------NVPKHSTVGMVTVADSDEGENGRVRL-SILGTDNRQLFSIDPESGMIRSNVG-FDREQRHYYVLEVQATDGGEPVRSSTVKVVIHVMDINDNSPIVLMPPSNTTYKFVVPRTLPGTIVTEVSAVDNDAEINAELRYHIVGG-------------------------NPHNLFHIDPVIGNITLMEPLTETHHGLHRLVVRVSDIGIAVQHHAVALVHV 799          

HSP 2 Score: 83.5741 bits (205), Expect = 2.500e-16
Identity = 160/676 (23.67%), Postives = 265/676 (39.20%), Query Frame = 1
Query: 1063 DREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPL--RSPILQLEAKDEDESDQHKLRFE-----------FDNSVDETVRNRFYINPLTGE----ILTAGYIDYEIKSEYTIPVIVTDG---KHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTK-MFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEV-----PFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIG-NNAIIRYSLDSLSSTQFS--IDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIG-ETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNY-EVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            D   +  V V++      P P    +++ I++ DIND  P F    +   + EN P   R PI    A D D       R+E           F+ SV ET           GE    ++    +D E +  Y + +   DG    HS  A L I V + NDN+P   V   +  N + P           EN   G  V  L  SD+D  S     ++ + L             +R   +L  +  L+T   + +REE+  Y   ++  D     +  + T  +++TDVNDN P  E+     P  G        I E   +   +  +  +D DIG N A+  Y  +     Q      P    L   +  DYE   ++ + I A++       +  L     +T+ + D ND  PVF +  Y  +V E                  ++    +   + +   D+    +++M      DA   F +  ETG+I +    LDREK +++SF I A D+    L   A V + +LDVNDN P +       Y   NV     +G     +   D D G+NG+V   I+ +     F+ + ES  +     S++ F+R +         + Y+ +             V+A+D G P +    ++ I++++++ N
Sbjct:  112 DPGDECHVDVQVGVLPVQPGPFFKLIEVRINVEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQP--ANDPDSEANGVRRYELLPSDPATVSAFELSVTETA---------NGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSP---VFDQAEVNVEIP-----------ENSPVGTHVVQLHASDRDAGSNA---EVVYRLGTSTGGAGSGQGGKR-LFRLDQNSGLVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGV-----IYISEASHVNLPVALITVSDPDIGANGAVTCYIYNPEVPFQLKKLTYPNQYLLETRETLDYETKNEYVVQIKAAD-----AGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPE------------------NNVIGKHLITVSATDRDM--DKNAEMVYFLGPDAPTMFHMDPETGIISLT-EQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGM----VTVADSDEGENGRVRLSILGTDNRQLFSIDPESGMIR----SNVGFDREQR--------HYYVLE-------------VQATDGGEPVRSSTVKVVIHVMDINDN 698          

HSP 3 Score: 62.003 bits (149), Expect = 8.993e-10
Identity = 69/248 (27.82%), Postives = 102/248 (41.13%), Query Frame = 1
Query: 1345 INPLTGEILTAG------------------YIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRES-LELRRSQSKLIDHFQ-LITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSL 2028
            +NP TGE+  AG                  ++D ++     +P  V  G       + I V+++NDN P  +   L+ S              + EN   G        +D D E+   G +   LL    DP   S  EL  +++   +    L+  K  DREE   Y   L   D  S   S S    I++TD NDN P+F+   Q    +    I E   +GT +VQ+ A+DRD G+NA + Y L
Sbjct:   88 VNPRTGELFAAGRKMDREALCGGQDPGDECHVDVQVG---VLP--VQPGPFFKLIEVRINVEDINDNAPAFAAPVLTVS--------------VPENAPAGKRFPIQPANDPDSEAN--GVRRYELLPS--DPATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFD---QAEVNVE---IPENSPVGTHVVQLHASDRDAGSNAEVVYRL 306          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: si:ch211-199f5.1 (protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660])

HSP 1 Score: 155.992 bits (393), Expect = 7.949e-39
Identity = 131/478 (27.41%), Postives = 214/478 (44.77%), Query Frame = 1
Query:  841 SPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGR-DHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSD---QATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDC--RIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSL------DSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVF 2238
            +P ++   +++ + E   +GT + L  A D D    N  + Y +     N+ F L    R D  +   L+V    DRE++   +++L A+DG   P SG   + I++ D ND  P F +TS +  + E+    + +L L A D DE    ++ + F + VD  VR  F ++P TG++   G +D+E+ SEY I +   D   S       + + V+++NDN PEI + ++  S   T         +++E       V  ++VSD D       +  N L+ C  R  PH + L  R       D + ++T    DRE+ + YF  L   D  +     +  F + + D NDN P F       R  +  S+ E  + G  +  V A D D  +N +I Y++       +  ST  SI+P SG +  +   DYE M      + A +  +       L T   ++V I D ND  PV 
Sbjct:  133 APDFARSEMHVEISESVALGTRVPLEGARDLDVG-GNALRAYHLDE---NERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDT--------VFVSEGAAYESFVGLVTVSDID-------SAENGLVACHLRGHPHFKLLPYR-------DDYVVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFH------RSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVPP-----LVTNATVSVRIVDENDNAPVV 573          

HSP 2 Score: 107.842 bits (268), Expect = 8.185e-24
Identity = 136/579 (23.49%), Postives = 236/579 (40.76%), Query Frame = 1
Query: 1060 FDREKQA----TVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLT-----GEILTAGYIDYEIKSEYTIPVIVTDGK---HSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPH-RESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPF-QGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNI--DVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIG-ETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYE--VNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIV 2739
             DRE+Q     +  ++       P  L   +   + L DIND  P F ++ +H  I+E++ L + +    A+D D        +      DE  R    +   T      E++    +D E + EYT+ +   DG     S    + I V + NDN+P   V   +  N             + E+  PG V+ +L+ +D D        ++ +     +D   R   +L     KL    QL      D E  S+Y   +   D   +S+       + + D+NDN P  ++ F   SRG   + + EG A  + +  V  +D D   N ++   L       F + P   +   +     D E+M  + L + AS+       +      ++ TV + D ND  P F +  Y  ++ E                  +   ++ +  +I+     Y+  +S++   + +  S Y  I   +G I+   P LD E ++S +F++QA D    PL + A V ++I+D NDN P+   P   N    V +     +GY +  ++A D D   NG+++YRIV
Sbjct:   90 IDREQQCGQAPSCVIRFDVLCTLPRGLFQLVHAEVELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHL----DENERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSP---VFAQTSCNVT-----------VREDATPGTVLLTLNATDVDEGPN---GEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQL------DHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVF-VSEGAAYESFVGLVTVSDIDSAENGLVACHLR--GHPHFKLLPYRDDYVVVTNSSLDREQMADYFLVLEASD-----GGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLE------NNSPGAYVTTVTAWDADAEHNGMIA-----YNVVESEV---AGASVSTYVSINPSSGAIYALRP-LDYEAMTSLTFQVQARDDGVPPLVTNATVSVRIVDENDNAPVVTHPPLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIV 618          

HSP 3 Score: 94.3597 bits (233), Expect = 1.078e-19
Identity = 103/458 (22.49%), Postives = 190/458 (41.48%), Query Frame = 1
Query: 1714 RSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQ----FSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLY------TFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIG--ETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNGHGSSQGQFNKRSGLSRV 3051
            R+++    + +L+     DRE+  +Y  QL  +D      S +    I++ D NDN P+F      ++   + +++E    GT ++ + ATD D G N  + YS  S    +    F +DP +G+L      D+E   ++E++I A +          +    K+ V++ED+ND  P  + D        T  V EG                  + Y S  F  +    DI DS+++ +    +     +F++       + V    LDRE+++ +   ++A+D    P  +     +++LD NDN P +   +   YE ++    + G  +  + A D D   NG + Y +V S               EV  +S   +       ++ S+G IY  + +    + S    V+A D G PP      + + IV+ + N    +       +G+ R+
Sbjct:  186 RARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVF------AQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARD-----MGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEG------------------AAYES--FVGLVTVSDI-DSAENGLVA-CHLRGHPHFKLLPYRDDYVVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRF---HRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVES---------------EVAGASVSTY-----VSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVPPLVTNATVSVRIVDENDNAPVVTHPPLRNGTGVVRL 587          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006996.1 (pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 gene:ENSPMAG00000006222.1 transcript:ENSPMAT00000006996.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 149.443 bits (376), Expect = 2.706e-36
Identity = 165/627 (26.32%), Postives = 269/627 (42.90%), Query Frame = 1
Query:  922 AMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDES---DQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDG-----KHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQY-FAQL---ICFDSDSNS----LSTSVTFEISITDVNDNPPIF-EVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLD-SLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIG-ETGLIHVNVPVLDREKISSFSFKIQAADR--SEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIV 2739
            A D D PP N      +   + +  F +  SG   Y  ++L    D+++    T+S+ + A DG   PL+  +   + + D ND  P F + S    I ENI   + +L + A D D+S    Q  L +  + S       +F IN  +G+I +   +D E  S+Y + V   DG     + +  AT+ I + +VNDN+P                R   Y   + EN   G  + ++S +D D          N  L   IDP      +  +  K+       T    DRE+ +   FA +   +   +D  S     + S T  + + DVNDN P F  +P+       +  + EG+   +T+ QV ATD D G N  + YS+  +L    F +D  +G +  +   D E +  ++L + A++     + +  L +   +++ + DVND  P F       ++ E  ++D  V  +   D D       ++F                  T  N D    F +G   GL+   V  LDRE  +S+S  I+A D   +    + T  + + +LDVNDN PL++     +YEV+V      G  I  ++A D D G NG+V YRI+
Sbjct:  155 ATDEDSPPNNQITYSILPTSAYSSYFSITVSG--GYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSPEYGQLSLIYSLEGS------TQFRINARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPA--------------WRDLPYAVTIVENTPGGTDIFTVSAADPDLNE-------NGTLVYAIDPPNPFYRINAASGKI-----RTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPY-------ALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRPDFQLDAATGLITTLVQLDREAVAAYQLRLVATD-----RGTPALSSTTTLSLVVLDVNDNAPTFHPARSAVSLMESVARDSVVISLNCTDADSGLNAELSFF-----------------ITGGNQDGQ--FSVGFRDGLVRTVVS-LDRETKASYSLVIEAIDNGPAGSRRTGTTTLDVLVLDVNDNRPLFL---EGSYEVSVPENVTRGAIILQVQATDIDEGINGRVWYRII 712          

HSP 2 Score: 119.398 bits (298), Expect = 4.333e-27
Identity = 151/641 (23.56%), Postives = 267/641 (41.65%), Query Frame = 1
Query: 1132 GQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQAT-LTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLIT-TKMFDREETSQYFAQL--ICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRD----IGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRI-GETGLIHVNVPVLDREKISSFSFK------IQAADRSEKPLSSTAIVQIQIL--DVNDNPPLWV-FPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNG 3000
            G   ++I+L + ND +P F     +  + EN  L + ++Q+ A D D     ++ + F +  D     +F ++P +G I  A  +D+E    +T+ V+  DG   + A  + I + +VNDN P                +   Y     EN +    V  +  +D+D       NQ+ + +      +     +  S       + ++T  +  D E+       L  +  D  S  L+++VT  + + D NDN PIF+      R  +S +I E +  G T++ V ATD D     G  ++I YSL+   STQF I+  SG++ +  + D E + ++ L + A +      N Q    +  + + + DVND  P +    Y  T+ E                  ++   ++ F + +   D+   +++     +    + ++RI   +G I      LDRE ++  SF       +  ADR   P  +TA   + +L  DVNDN P +V  P    Y + V         +  + A DPD G NG VTY +  ++ P                           F LD +TG I    ++    V + ++ + A+D+GTP       L + +++V+ N 
Sbjct:   12 GSARVHITLINENDNRPIFSLPLYNVSVWENATLGTSVVQVLATDLDAGVFGQVSYHFSDDSD-----KFSLDPASGLISVAAALDFEATPRFTVTVMARDGGGQETAGRVRINLLDVNDNTPVF--------------QRDSYVGTARENDNSLTPVVRVRATDEDSPPN---NQITYSI-LPTSAYSSYFSITVSGG-----YGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFD------RNSYSIAIPENILAGATVLYVNATDGDQSPEYGQLSLI-YSLEG--STQFRINARSGDITSTTLLDREAVSQYILIVRAVDG--GDGNDQKT-GIATVNITLLDVNDNDPAWRDLPYAVTIVE------------------NTPGGTDIFTVSAADPDL---NENGTLVYAIDPPNPFYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLP----YALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMT-AALP------------------------RPDFQLDAATGLITTLVQLDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNA 562          

HSP 3 Score: 119.013 bits (297), Expect = 5.629e-27
Identity = 163/646 (25.23%), Postives = 276/646 (42.72%), Query Frame = 1
Query:  844 PKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTI--PVIVTDGKH---SDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDS-DSNSLSTSV-TFEISITDVNDNPPIF-EVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDV-FDYEKMEKFELTINASNPI--IERKNSQLLYTLQK-ITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRI-GETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGY--CIANLKANDPDLGDNGKVTYRI 2736
            P +S P   +S+ E++ +GT +   LA D D        +    +   +D F L  +       +S+    DF+   + TV+V   A DG     +G++ IN  L D+ND  P F++ S      EN    +P++++ A DED    +++ +    +   +      ++   G +  A  +DYE     TI   ++  DG     +   T  +EV + NDN+P                R+S Y   + EN   G  V  ++ +D D +S   G Q++ +         E     R  ++  D   + +T + DRE  SQY   +   D  D N   T + T  I++ DVNDN P + ++P+       + +I E    GT I  V A D D+  N  + Y++D   +  + I+  SG++R   +  D E +         S  +   +R +     T    +TV ++DVND  P F    Y   V EG                     NS  F++ +   D   ++ +  Y+ + +     F++   TGLI   V  LDRE ++++  ++ A DR    LSST  + + +LDVNDN P +     H     VS  E++     + +L   D D G N ++++ I
Sbjct:   28 PIFSLPLYNVSVWENATLGTSVVQVLATDLD---AGVFGQVSYHFSDDSDKFSLDPAS----GLISVAAALDFEATPRFTVTVM--ARDGGGQETAGRVRIN--LLDVNDNTPVFQRDSYVGTARENDNSLTPVVRVRATDEDSPPNNQITYSILPTSAYSSYFSITVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFD-------------RNS-YSIAIPENILAGATVLYVNATDGD-QSPEYG-QLSLIYSL------EGSTQFRINARSGD---ITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPY-------AVTIVENTPGGTDIFTVSAADPDLNENGTLVYAIDP-PNPFYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEG------------------LPANSTLFQVTATDPD-EGANGNVTYSMTAALPRPDFQLDAATGLITTLVQ-LDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPTF-----HPARSAVSLMESVARDSVVISLNCTDADSGLNAELSFFI 604          

HSP 4 Score: 118.627 bits (296), Expect = 6.443e-27
Identity = 197/822 (23.97%), Postives = 329/822 (40.02%), Query Frame = 1
Query:  625 FFLDSKTYEFRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITL---PLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIP-LRSPILQLEAKDEDES--DQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGK---HSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQS---KLIDHFQ--LITTKMFDREETSQYFAQLICFDSDSNSLSTSVT------FEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFS---IDPISGELRNIDVFDYEKMEKFELTINASNPIIER-----KNSQLLYTLQKITVNIEDVNDCLPVF-EKDLYTFTVKE--GPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGET-GLIHVNVPV-LDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVD 2991
            F+ DS+T    V++ +DRE +  +++               +  + D     S +  +  ++ V I+D NDNSP +S       +PE+S  GT +T+   P+         N T  Y +   S    + L    R +   +S+ + +  DRE      ++L     D    +  + + +++ D+ND  P F  TS    + EN P + + ++ ++A D D    D   +R+   +  ++T    F I+  TG I+T   IDYE + EY + V+ TD     H+    L + ++N  D     S+              + Y+A L+E   PG VV  ++        K     +   L   +    E    ++ +S   +LI   Q  + T    DRE T  Y   ++  D         +T        +++TD NDN P FE    GS  +    ++E  A GT +  + ATDRD G+N  +     + + T+     I  I  E   + + D  K +  E T   S  I+ R       S    T   ++V + DVND +P+F     Y  +V E   P   V                            D     + Q+     S       IG + G+I V     +DRE  ++++  + A DR   PLS +AIV++ + DVND  P ++ P      V+V    ++G  +A +KA +   G N K TY+I               KN          F  H    L  ST  +   ++  L+ V        A+D G PP      L++ +++V+
Sbjct: 1440 FYADSQTGLVYVNRPLDRERVAEYRL---------------TLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSLLGGS--SAYFLIDRDRGN---VSMALGQGLDREGIPGGRLELTILVQDGGRRNATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGNDT----FGIDESTGLIVTVAPIDYETRPEYLLMVVATDQAPPFHTASCELRVSLQNELDEKLSFSL--------------AAYQAALSEAAVPGTVVVRVAAPQMKAPPK-----LPLPLAILVQKWHEDKRHKQQESDNAELIAALQGEITTQAALDREATDSYMLTVLSRDGGPREAIAVLTNKPGAYVYVNVTDENDNSPEFE---AGSATL--VEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNE-SGVTIVDVAKADFVEKT---SQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVPIFLSPGGYAVSVVELGAPGTLVASVWAT----------------------DADAGPNGQVTFRIESGGGDKLSIGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAP---VQTVSVLESLSVGSFVATVKATENYKGHNTKYTYKIA-----------GIGKN---------AFTVHATSGLVTSTRLLKSYERFNLTAV--------ATDHGRPPLWGQAGLYVEVLDVN 2156          

HSP 5 Score: 93.9745 bits (232), Expect = 2.421e-19
Identity = 93/398 (23.37%), Postives = 164/398 (41.21%), Query Frame = 1
Query: 1057 DFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDG------KHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLS----VSDKDYESKR------LGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIG--NNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASN--PIIERKNSQLLYTLQ 2190
            + DRE QA  ++ + A D    PL+  L + + + D++D  P F     +  ++E   + + + ++ A D +E        +   +        FY +  TG +     +D E  +EY + + V D          D   + + + + NDN+P  S +               Y A + EN   G V+  L+     SD D+          LG    + L   ID  R ++ +   Q               DRE       +L     D    + +V   +++ DVNDN P F V  Q      ++ ++   A+GT+++ VKA DRD+G  +   +RYS+ S  +  F ID  +G +  +   DYE   ++ L + A++  P     + +L  +LQ
Sbjct: 1346 ELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQV--------------TYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSLLGGSSAYFL---IDRDRGNVSMALGQG-------------LDREGIPGGRLELTILVQDGGRRNATVRLGVTVLDVNDNTPTFNVTSQ-----TAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGNDTFGIDESTGLIVTVAPIDYETRPEYLLMVVATDQAPPFHTASCELRVSLQ 1708          

HSP 6 Score: 92.4337 bits (228), Expect = 6.222e-19
Identity = 139/572 (24.30%), Postives = 238/572 (41.61%), Query Frame = 1
Query: 1123 PLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRS-PILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSE-YTIPVIVTDG------KHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLL---DCR----IDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIF-EVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNN--AIIRYSLDSLSSTQ--FSIDPISGELRNIDVFDYEKMEKFELTI----NASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSN------SDASQYFRIG-ETGLIHVNVPV-LDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLG--DNGKVTYRI 2736
            P      + I +TD ND  P F   +   ++ E        +  + A D DE D  ++ +     V       F I+  TG +     +D+E+ +  Y + V  TD       + +  AT+++ V +VND  P     +L         RS +    ++E + PG  +A+   SD+D     L  ++ + +   D R    I P    L +RR       + +L      DRE  + Y   ++  D  +  L++++T  + + DV+DN P+F  +P   S       + E  A+   + +V+A+D + G N  A++++S  S  + +  F  D  +G +      D E++ ++ LT+    N  NP   RK+S ++       V I D ND  PVF +  Y   + E                      N     +++ P  IY +SD+    N+         +S YF I  + G + + +   LDRE I     ++    +     ++T  + + +LDVNDN P   F  T      +    A+G  +  +KA D DLG  D G V Y I
Sbjct: 1151 PAQATTSVLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVYAI---VSGNTAATFGIDNGTGVLTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTP----WFL---------RSYEGPIDVSEGQ-PGPRIATFMASDQD---SGLNGELEYSIIDGDPRNEFVISPADGDLRVRR-------YVEL------DRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANAS-------LSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMI------VTILDENDNSPVFSQVTYEAEIPENSP-------------------NGTVLTVLNGP--IY-ASDADFGVNATLAYSLLGGSSAYFLIDRDRGNVSMALGQGLDREGIPGGRLELTILVQDGGRRNATVRLGVTVLDVNDNTP--TFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSI 1652          

HSP 7 Score: 90.8929 bits (224), Expect = 1.958e-18
Identity = 139/533 (26.08%), Postives = 215/533 (40.34%), Query Frame = 1
Query: 1429 TDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSL--DSLSSTQFSIDPISGELRNIDV---FDYEKME--KFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAI--VQIQILDVNDNPPLWV-FPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            T G+H   A + I + N NDN P  S+                Y   + EN   G  V  +  +D D  +   G    H  D   D  + SL+     S LI           D E T ++   ++  D      +  V   I++ DVNDN P+F+      R  +  + +E     T +V+V+ATD D   N  I YS+   S  S+ FSI  +SG    + +    DYEK+      LTI A    ++  +  L  T+  I V + D ND  P+F+++ Y+  + E       V  V   D D S +Y                    Q+    + + S  FRI        +  +LDRE +S +   ++A D  +     T I  V I +LDVNDN P W   P    Y V +      G  I  + A DPDL +NG + Y I P + PF +  N  S  +  T    ++ +R ++                 +S    + I V  +D+G+PP++      + ++  D N
Sbjct:    6 TSGEHWGSARVHITLINENDNRPIFSL--------------PLYNVSVWENATLGTSVVQVLATDLD--AGVFGQVSYHFSD---DSDKFSLD---PASGLIS-----VAAALDFEATPRFTVTVMARDGGGQETAGRV--RINLLDVNDNTPVFQ------RDSYVGTARENDNSLTPVVRVRATDEDSPPNNQITYSILPTSAYSSYFSIT-VSGGYGVVTLARALDYEKIPGGTISLTIMA----LDGGSPPLNSTVTAI-VEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSPEYG-------------------QLSLIYSLEGSTQFRINARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLP----YAVTIVENTPGGTDIFTVSAADPDLNENGTLVYAIDPPN-PF-YRINAASGKIRTT---GLQLDREDL---------------NPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVN 454          

HSP 8 Score: 81.6481 bits (200), Expect = 1.354e-15
Identity = 114/452 (25.22%), Postives = 184/452 (40.71%), Query Frame = 1
Query:  844 PKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKL-KHSGRDHYEKLSLIVNKDFDREKQATVS------VKLKAFD--GDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTD---GKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSD--SNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQ---FSIDPISGEL-RNIDVFDYEKMEKFELTINASN 2145
            P W      +++ E++  GT+I    A DPD    N T  Y I     N  +++   SG+     L L      DRE    +S      + +   D    P   +    + + L D+ND +P F        + E +P  S + Q+ A D DE     + +    ++    R  F ++  TG I T   +D E  + Y + ++ TD      S   TL++ V +VNDN P              P RS+     L E+     VV SL+ +D D     L  +++  +       + S+  R    +        T    DRE  + Y   +   D+    +  + + T ++ + DVNDN P+F    +GS   +  S+ E V  G  I+QV+ATD D G N  + Y +  +S  Q   F ++  SG + R     D E +    L + A N
Sbjct:  346 PAWRDLPYAVTIVENTPGGTDIFTVSAADPDLN-ENGTLVYAI--DPPNPFYRINAASGKIRTTGLQL------DREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALP---RPDFQLDAATGLITTLVQLDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPTFH-----------PARSA---VSLMESVARDSVVISLNCTDAD---SGLNAELSFFITGGNQDGQFSVGFRDGLVR--------TVVSLDRETKASYSLVIEAIDNGPAGSRRTGTTTLDVLVLDVNDNRPLF---LEGS---YEVSVPENVTRGAIILQVQATDIDEGINGRVWYRI--ISGNQDGNFLVNVSSGLISRGATPLDRETVALHALQVEAFN 752          

HSP 9 Score: 80.8777 bits (198), Expect = 2.152e-15
Identity = 91/354 (25.71%), Postives = 153/354 (43.22%), Query Frame = 1
Query: 1711 RRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSI--KEGVAI-GTTIVQVKATDRDIGNNAIIRYSLDSL-SSTQFSIDPISGELRNIDVFDYE-KMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYC--IANLKANDPDLGDNGKVTYRIVPSSF 2751
            +++  K+    Q + TK+  +   S    + IC  +     +TSV   I ITD NDN P F        G  +Y +   EG +  G  +  V A+D D G+NA + Y++ S  ++  F ID  +G L  +   D+E     + L + A++    R  ++ L +   ++V++ DVND  P F +        EGP               ++S  +S     +   + I D      +  S +D     R             LDRE  + ++  I A D    PL+ST  V +++LDV+DN P+++     N   N S  EA      ++ ++A+D + G N     +  P+SF
Sbjct: 1115 KQASIKITTITQRLCTKVLVKRAASAS-TRGICLTATPAQATTSVL--IRITDENDNAPAF--------GAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVYAIVSGNTAATFGIDNGTGVLTAVKALDFEVSAGLYLLVVTATDQ--PRDPARRLTSTATVSVHVADVNDVTPWFLRSY------EGPIDVSEGQPGPRIATFMASDQDSGLNGELE--YSIIDGDPRNEFVISPADGDLRVR---------RYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFL-----NLPANASLSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSF 1433          

HSP 10 Score: 78.5666 bits (192), Expect = 1.200e-14
Identity = 84/333 (25.23%), Postives = 154/333 (46.25%), Query Frame = 1
Query: 1123 PLSGQLDINISLTDINDKQPHFKKTSIHKIIN--ENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRN--RFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDG----KHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAY-LAENKDPGFVVASLS-VSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSN---SLSTSVTFE-----------ISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAI----GTTIVQVKATDRDIGNNAIIRYSLDSL 2037
            PL GQ  + + + D+ND +P F       ++N  E +P+   I+++ A D DE     +R+ F ++     R+   F IN  +G I TA  +D E ++ Y++ ++ +D      +     L + + +++DN P   VL         P   + Y+++ + E+  PG  V ++S   D D  +       N ++   I    E  +   S+  L     L+     DRE  S Y+A ++   S+ N   +++T   F+           + + D+ND  P+F          H Y+   GVA+    G+ ++Q++A DRD+GNN+I+ Y + S+
Sbjct: 2141 PLWGQAGLYVEVLDVNDHRPVFVLPPNGTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFRINATSGIISTARALDRESQAVYSLILLASDQGQPVSYESTQPLQVVLDDIDDNEPVFIVL---------PDGGAPYQSFSIPEHSPPGTAVGNVSGAVDADVGA-------NAIVYYFIAAGNEGNKFNLSRWGL-----LVVLSDLDRE-VSPYYAIIVKASSNPNWTPAVTTGPEFDPSKDRTLREVRVYLEDINDQWPVFTN--------HEYT--AGVAVDAKVGSELLQLEAVDRDVGNNSIVLYRILSI 2441          

HSP 11 Score: 78.1814 bits (191), Expect = 1.221e-14
Identity = 125/504 (24.80%), Postives = 211/504 (41.87%), Query Frame = 1
Query:  844 PKWSSPHIY-LSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFD-GDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYI-DYEIKSEYTIPVIVTDGKHS---DQATLTIEVKNVNDNNPEISVLYLSGSNFKTPG------RSSQYRAYLAENKDPGFVVASL----SVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSN---SLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVK-ATDRDIGNNAIIRYSLDSLS-STQFSIDPISGELRNIDVFDYEKMEKFELTINASN-----PIIERK---NSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVK 2268
            P + SP  Y +S+ E    GT +    A D D  P N    ++I       G KL     D   +++   N   DRE +A  ++ + A D G+P PLSG   + + + D+ND++P F        + E++ + S +  ++A +  +    K  ++    +    +N F ++  +G + +   +  YE    + +  + TD        QA L +EV +VND+ P + VL  +G+            R  +  A   +    G V  S      V  +D+ES R+                       + S +I      T +  DRE  SQ    LI   SD     S  ++   ++ + D++DN P+F V   G     S+SI E    GT +  V  A D D+G NAI+ Y + + +   +F++    G L  +   D E    + + + AS+     P +      +     TL+++ V +ED+ND  PVF    YT  V 
Sbjct: 1951 PIFLSPGGYAVSVVELGAPGTLVASVWATDADAGP-NGQVTFRIES---GGGDKLSIGPSDGIIRVAPGAN--IDRETRAAYTLMVVAVDRGNP-PLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKATENYKGHNTKYTYK----IAGIGKNAFTVHATSGLVTSTRLLKSYE---RFNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRP-VFVLPPNGTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFRI----------------------NATSGIIS-----TARALDRE--SQAVYSLILLASDQGQPVSYESTQPLQVVLDDIDDNEPVFIVLPDGGAPYQSFSIPEHSPPGTAVGNVSGAVDADVGANAIVYYFIAAGNEGNKFNLSRW-GLLVVLSDLDREVSPYYAIIVKASSNPNWTPAVTTGPEFDPSKDRTLREVRVYLEDINDQWPVFTNHEYTAGVA 2409          

HSP 12 Score: 74.3294 bits (181), Expect = 2.158e-13
Identity = 94/409 (22.98%), Postives = 166/409 (40.59%), Query Frame = 1
Query: 1060 FDREKQATVSVKLKAFDGDPNPLSGQLD------INISLTDINDKQPHFKKTSIHKI-INENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYI---NPLTGEILTAGYIDY-EIKSEYTI-PVIVTDGKHSDQAT---LTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHR-ESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVF 2238
             DRE   +  + + + DG P      L       + +++TD ND  P F+  S   + + E+    + +  L A D D      +           +  ++ +   N     I+     D+ E  S++ +  ++  DG    ++T   L++ V +VNDN P           F +PG    Y   + E   PG +VAS+  +D D          N  +  RI+    + L +  S   +    ++      DRE  + Y   ++  D  +  LS S    + + DVND  P F  P Q      + S+ E +++G+ +  VKAT+   G+N    Y +  +    F++   SG + +  +   +  E+F LT  A++          L+    + V + DVND  PVF
Sbjct: 1791 LDREATDSYMLTVLSRDGGPREAIAVLTNKPGAYVYVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVPI----------FLSPG---GYAVSVVELGAPGTLVASVWATDADAGP-------NGQVTFRIESGGGDKLSIGPSDGII----RVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQ------TVSVLESLSVGSFVATVKATENYKGHNTKYTYKIAGIGKNAFTVHATSGLVTSTRLL--KSYERFNLTAVATD-----HGRPPLWGQAGLYVEVLDVNDHRPVF 2162          

HSP 13 Score: 49.2914 bits (116), Expect = 8.416e-6
Identity = 30/97 (30.93%), Postives = 49/97 (50.52%), Query Frame = 1
Query: 2536 SEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAI-GYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFN 2823
            +  P  +T  V I+I D NDN P +       YEV ++   +  G  +AN+ A+DPD GDN +V Y IV  +   +F  +  +  L   ++ D + +
Sbjct: 1148 TATPAQATTSVLIRITDENDNAPAF---GAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVYAIVSGNTAATFGIDNGTGVLTAVKALDFEVS 1241          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 147.517 bits (371), Expect = 8.936e-36
Identity = 160/637 (25.12%), Postives = 273/637 (42.86%), Query Frame = 1
Query:  841 SPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKH---SDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKM-FDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQ---FSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTY 2730
            +P+++      +L E +  G+ +    AMD D   +    K + S  S ND   L     D    L +  +   DRE  ++V + + A D    P +    + ++L D+ND+ P F +T       EN      ++ + A D D  +   +R+ FD  +    R  F ++ LTG++ T   +D E   EY + V   D         A +T+ V ++NDN+P   V Y             QY A + EN+  G  V +++ +D D   +     + + L           +  R Q   +     ++T++  DREE + Y  Q+   D       +     I++ D  D PP F      +R  +S+ + E VA GT +  V A+  D+  NA + Y +  +S  Q   FSI+   G +   +  D E+   ++L + A        NS  +     ++V + DVN+  PVF++  Y  ++ E                      NS +F + +   D   + + + Y     +  + F I   G ++V    LDRE    +S  + A D   +PLSS+  V + +LDVNDN PL+   N+ +Y  +   ++ +G  +  ++A D D G NG VTY
Sbjct:  338 APRFALSAYAAALSEGAPAGSYVKDVTAMDAD---SGLNAKLRYSIVSGND---LGWFSVDESTGL-VTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHP---VFY-----------PVQYFASILENEPGGTAVTTVTATDPD---RGANGTVRYQLTAG--------DAARFQVNAVTG--AVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTF------ARDDYSFVVFENVAPGTLVGSVSASTLDL--NANVTYLI--VSGDQRGSFSIEWSGGRIFTANAIDREEQAFYQLRVVA--------NSGGVAGEASVSVLVHDVNNHAPVFDRASYEVSIAE------------------DEPVNSRFFSVRATDKDSGKNGEVK-YEIGEGNGGEKFGIFPDGQLYVRYE-LDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLF---NSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTY 899          

HSP 2 Score: 147.517 bits (371), Expect = 9.644e-36
Identity = 152/658 (23.10%), Postives = 270/658 (41.03%), Query Frame = 1
Query: 1060 FDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDED-ESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKM------EKFELTINASN-----PIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
             DRE++A   +++ A DG          + I++ D  D  P F +     ++ EN+   + +  + A   D  ++   L    D       R  F I    G I TA  ID E ++ Y + V+   G  + +A++++ V +VN++ P         S  +    +S++ +  A +KD G          K+ E K    + N      I P                  QL      DRE   +Y   +   D+    LS+SVT  +++ DVNDN P+F      +   + +   E   +G+ +  V+ATD D G+N  + YS +      F +D  +G + ++ VFD E +        F  ++ A++     P+ +R   Q+          ++DVND  P F K +Y  +V E  S                    +   ++ ++  D   +   +   N  ++  ++     TG I + +  LDRE+ +S++  + A D    PL+++  V +Q+LD NDNPP +         V+      +G  +  L A+D D G +G V Y IV                           N H  F +D STG++++A+++        ++ V A D G PP+     L +++ + + N
Sbjct:  616 LDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDLNANVTYLIVSGDQ------RGSFSIEWSGGRIFTANAIDREEQAFYQLRVVANSGGVAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSG----------KNGEVKYEIGEGNGGEKFGIFPDG----------------QLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLF------NSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEK-PQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVF---------VQDVNDNPPQFAKSVYQASVSESASNL------------------TQLLRVTASDVDEGVNGALRYAINEGNEGGKFTVDASTGQITL-LGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRF---TESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAG-------------------------NTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDN 1178          

HSP 3 Score: 142.124 bits (357), Expect = 4.538e-34
Identity = 167/653 (25.57%), Postives = 277/653 (42.42%), Query Frame = 1
Query:  841 SPKWSSPHIY-LSLPEHSKIGTEITLPLAMDPDQPPTNTTQ-KYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKH---SDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKR--------LGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSN-SLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQ-FSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNS--NYFKIISNPHDIYDSSDSQMYTNSNSDA-SQY---FRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRI 2736
            +P +  P +  ++  E + +G ++ L  A+D D  P       YKI      +G  +          L L      DRE   + ++ ++A DG      G+L +N+++ D ND  P F+K +    + E+ P+ + +     +D     +  L   FD              P TG + T   +D+E + +YT+ +   DG +   S +AT  I++ +VNDN+P I  +YL       P   S   A + E+  PG V A ++V+D D  +           GN+  H +     P    L + +  S+L            DRE    Y   ++  D+    + S + +  + + DVND+ P F      +   ++ ++ EG   G+ +  V A D D G NA +RYS+ S +    FS+D  +G +      D E      L I+A +   + K +   YT   +TV + DVND  P+F +  Y  T  E                      NS    F +  +  D     +  +  N + D  +QY   FR+         +  LDRE++  +   +QA DR   PL STA V + + D+NDN P++ +P    Y  ++   E  G  +  + A DPD G NG V Y++
Sbjct:   20 APSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHAYKI-VSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAAL-----RDLLHRGRGPLAVPFD--------------PKTGMVSTRQPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLP------PAARS---ASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHA--PGVPGLRVLKVASQL------------DRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRF------ALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTA---YT--SLTVTLLDVNDEPPLFTQTKYVATAVE----------------------NSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVF-YP--VQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQL 593          

HSP 4 Score: 122.865 bits (307), Expect = 3.191e-28
Identity = 146/637 (22.92%), Postives = 250/637 (39.25%), Query Frame = 1
Query: 1123 PLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLS---GSNFKTPGRSSQY--RAYLAENKDPG---FVVASLSVS-DKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLS-STQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRI----GETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVD 2991
            P+S    + IS+ D+ND  P F    +   + EN      I  L A D D+     + +    SV       F ++  +G +  +  +D E ++ Y + V  +DG H+  A L++ V++ NDN+P  S    S     +    G++++      LA + D G    V  +L+ S D D+     G          + P   +L +               T+  DRE  + Y   L    +D   L+ +    +++ D NDN P  +          +  + E    GT+++++ ATD D G NA + +S+ S     +F++    G+L      D E+   + L +  S+    R     L +  ++++ + DVND  P F         ++ P   V      V  D   + Y                ++D +            F +    GE  L+      LDRE   S++  + A D+   PL+STA + + + D NDN P   FP    YE  ++  E  G  +  L A DPD G NG++ Y I                      S D   +    F LD   G + +A+ +      S ++ V A D G P +     + + + +V+
Sbjct: 1495 PMSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTY----SVLSGSEGAFVVDAASGVLRASRRLDREERASYLLTVRASDGTHATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFG----------LHPVTGALNV---------------TRPLDRESRACYV--LRARATDGGGLAATARLYVNVLDANDNAPSVQ------NDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVGN-DGQLSVARALDRERQSFYNLVVRVSD--RARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYAL-----------ATDGEEGGGGAGAGPGPFALNTVTGEVRLVRE----LDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPR--FPR-REYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIA---------------------SGDPTGD----FRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVN 2048          

HSP 5 Score: 120.553 bits (301), Expect = 1.759e-27
Identity = 154/657 (23.44%), Postives = 267/657 (40.64%), Query Frame = 1
Query:  844 PKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIP-----LRSPILQLEAKDEDESDQHKLRFEFDNSVD-ETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKH-SDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRI---DPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSD-----SNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDS----------LSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQM-YTNSNSDASQYFRIGET-GLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVND-NPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTY 2730
            P ++ P + L + E++  G  I    A D DQ   N    Y +   S         SG        L  ++  DRE++A+  + ++A DG     +    +++++ D ND  P F + +    + E+        R+ I  + A D D     ++ +    S D +     F ++P+TG +     +D E ++ Y +    TDG   +  A L + V + NDN P +              ++    A + E+  PG  +  +S +D D         +N  L+  I   DP          +  + +  QL   +  DRE   Q F  L+   SD        LS++V   + +TDVNDN P F  P        S    E   +G  +  V+A D D G N+ + Y+L +               F+++ ++GE+R +   D E  + + LT+ A +     K    L +   + V + D ND  P F +  Y   + E                       +   ++  +  D  + ++ ++ Y  ++ D +  FR+    G + V  P LDRE+ +S+   ++A D      S TA V++ + DVND +P   + P T +   N      +   I  + A D DLG +G+VTY
Sbjct: 1514 PVFAVPEMELEVEENTGEGEVIFTLSATDADQG-QNALVTYSVLSGSEGAFVVDAASG-------VLRASRRLDREERASYLLTVRASDGT---HATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGGLAATARLYVNVLDANDNAPSV--------------QNDSLAAEVPEDAPPGTSLLRISATDDD-------EGVNAELEFSISSGDPE--------GRFAVGNDGQLSVARALDRER--QSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSP-------RSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVD-----KGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAE------------------DEPPGTEVLRL--SAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAVARP-LDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENTQGPPVL---ILQVVARDDDLGSSGQVTY 2092          

HSP 6 Score: 118.242 bits (295), Expect = 7.524e-27
Identity = 144/649 (22.19%), Postives = 261/649 (40.22%), Query Frame = 1
Query:  949 NTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEI------KSEYTIPVIVTDGKH----SDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSS-TQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVF-EKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIG-ETGLIHVNVPVLDREKISS-FSFKIQAADRS---EKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDL 2844
            N   KY+I   +  + F +   G+       L V  + DRE +   S+ + A D    PLS  + +N+++ D+ND +P F  +S      E   + S +  ++A D D      + + F     E  +  F ++  TG I +    D E        + ++  V+ TDG       D+AT+ + V++VNDN P+ +               S Y+A ++E+      +  ++ SD D         +N  L   I+   E  +     S      Q+      DREET+ Y   +   DS ++ L+ S T  + + D NDNPP F      +  + S    E   +G  ++ + A+D D G +  +RY++ + ++   F+ID  +G +      D+E    + L ++A +     ++S  +     + V++ D ND  P F   D++   ++  P                     +    + +   D   + +             +F I  E+G I      +DRE     F   ++A D++       S+   V + + D NDN P +V P     +     + A G  +  L+A+DPD  +N  V Y +        F  +  +  +E +   D + + H  F L
Sbjct:  790 NGEVKYEIGEGNGGEKFGIFPDGQ-------LYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSF-----EKPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFA--------------KSVYQASVSESASNLTQLLRVTASDVD-------EGVNGALRYAINEGNEGGKFTVDAST----GQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRF------TESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATI-----LVVHVRDFNDNPPAFLPGDVFASIMENIP-------------------IGTRVITVTARDPDADVNGELHYSIARQFPPGAHFTIDPESGEI-CTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTAILVD---GLRAAAGSVVGTLQASDPDEAENAAVRYAVTGGDAAILFRLDRRTGIIETSTELD-RESGHGAFTL 1366          

HSP 7 Score: 115.546 bits (288), Expect = 6.063e-26
Identity = 137/566 (24.20%), Postives = 222/566 (39.22%), Query Frame = 1
Query:  625 FFLDSKTYEFRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVND----GFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVK------NVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDP-GFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKM-----FDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSST-QFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKE 2271
            F +D+ +   R S+R+DREE   + +     +         S  + D     +D+SP             D +P   +          + IGT     LA D D  P      Y ++    +D     F L      H    +L V +  DRE +A   ++ +A DG     + +L +N+   D ND  P  +  S+   + E+ P  + +L++ A D+DE    +L F   +   E    RF +    G++  A  +D E +S Y + V V+D      A L+  V+      +VNDN P           F +P      R+ LA    P G VVA++   D D       +  N  ++  +    E                 +T ++      DRE    Y   ++  D     L+++ T  +++ D NDN P F       R  +  +I E    GT ++++ A D D G N  +RY + S   T  F +DP+ G L      D E+   +EL + A +                + V + DVNDC P F+   YT   +E
Sbjct: 1563 FVVDAASGVLRASRRLDREERASYLLTVRASDGTHATDARLSVAVRD----ANDNSPRFSRHAYSFDVAEDAAPDGKT--------TRAVIGTV----LAGDADSGPFGEV-TYALAPSEDSDWADGAFGL------HPVTGALNVTRPLDRESRACYVLRARATDGGGLAATARLYVNV--LDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPE---GRFAVGN-DGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPA----------FTSP------RSALAPEDSPVGAVVATVQAVDPD-------SGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRF------PRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARD-----GGGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHARE 2065          

HSP 8 Score: 107.071 bits (266), Expect = 2.278e-23
Identity = 145/650 (22.31%), Postives = 244/650 (37.54%), Query Frame = 1
Query: 1141 DINISLTDINDKQPHFKKTSIHKI-INENIPLRSPILQLEAKDEDES----DQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDG---KHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQ----LITTKM-FDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRD------------IGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASN---PIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQM-YTNSNSDASQYFRIGE-TGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAI-GYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            ++ + + D+ND  P F +  + ++   E+  +   +L   A D D      + H  +    N     V  R         + T G +D E    Y + V   DG   +   +  + + V++ NDN P           F+ P     YRA +AE+   G  +  L                                L R +  L   F     +++T+   D E   QY   L   D  +  LS   T  I + DVNDN P     +       S S+ E  A GT    V  TD D            +G N    + L +       +  ++ +L      D E++  + LTI AS+   P+     + L+       V + DVND  P F    Y   + EG                       +Y K ++   D     ++++ Y+  + +   +F + E TGL+  +  V DRE  SS    I A D+  +P ++   + + +LDVND PPL+    T    V  + + ++ G  + ++ A D DLG+NG V Y   P                      D+     EMF LD  TG +   + +   ++    + V+A D+G+PP     ++ + + +++ N
Sbjct:    8 EVRVVVGDVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHAYKIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPA----------FEKPA----YRASVAEDSPVGAALRDL--------------------------------LHRGRGPLAVPFDPKTGMVSTRQPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYL-PPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQL------DRERIPMYNLTILASDNGKPVARSATASLV-------VYVNDVNDHAPRFALSAYAAALSEGAPA-------------------GSYVKDVTA-MDADSGLNAKLRYSIVSGNDLGWFSVDESTGLVTTDGKV-DREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLF----TQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDP----------------------DMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDN 550          

HSP 9 Score: 96.2857 bits (238), Expect = 4.428e-20
Identity = 157/651 (24.12%), Postives = 256/651 (39.32%), Query Frame = 1
Query:  844 PKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATV-SVKLKAFDGDPNPL----SGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIK-SEYTIPVIVTDGK----HSDQATLTIEVKNVNDNNP--------EISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRID-PHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGE-TGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRI 2736
            P +    ++ S+ E+  IGT +    A DPD    N    Y I+ Q     F          E   +    + DRE    +  V ++A D    P+    S   ++ + +TD ND  P F   +   +        S +  L+A D DE++   +R+      D  +   F ++  TG I T+  +D E     +T+ V+  + K     + +A  TI   ++  N+P        E  +  L G     P      R +L    +   V  +L           LG    H +   +D P R S +L      ++  F  + + + D    S     +  F+            EIS+ DVNDNPP+F VP           ++E    G  I  + ATD D G NA++ YS+ S S   F +D  SG LR     D E+   + LT+ AS+            T  +++V + D ND  P F +  Y+F V E  + D    + V+         +  + ++    + +  S DS         A   F +   TG ++V  P LDRE  + +  + +A D     L++TA + + +LD NDN P        +    V      G  +  + A D D G N ++ + I
Sbjct: 1180 PAFLPGDVFASIMENIPIGTRVITVTARDPDAD-VNGELHYSIARQ-----FPPGAHFTIDPESGEICTAAEIDREVTGGLFEVTVRATD-KAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTAILVDGLRAAAGSVVGTLQASDPDEAENAAVRYAVTGG-DAAIL--FRLDRRTGIIETSTELDRESGHGAFTLEVVAVEAKAAAPRTQRAENTIIANSMTFNHPLPRFPQDYESPINLLQGQTIPMPSSYLFLRHHLDWEPEGQLVFFTL----------LLGVTRGHGVINPLDAPWRVSFDLTARCMFIV--FSSLLSSLRDNGAGSFIRPPMSSFNQ----------VEISVEDVNDNPPVFAVPEM------ELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEGAFVVDAASGVLRASRRLDREERASYLLTVRASD--------GTHATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVT---YALAPSEDSDW-------ADGAFGLHPVTGALNVTRP-LDRESRACYVLRARATDGGG--LAATARLYVNVLDANDNAPSV---QNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSI 1768          

HSP 10 Score: 95.9005 bits (237), Expect = 5.703e-20
Identity = 105/456 (23.03%), Postives = 190/456 (41.67%), Query Frame = 1
Query:  841 SPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNP---LSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDN------SVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKH---SDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLL-------DCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEV-PFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRY-SLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASN 2145
            +P   +  +   +PE +  GT +    A D D+   N   ++ IS       F + + G+       L V +  DRE+Q+  ++ ++  D   +P   LS  + +++ LTD+ND  P F       +  E+ P+ + +  ++A D D      + +                   F +N +TGE+     +D E +  Y + V+  D      +  ATL + V + NDN P            + P R  +Y A +AE++ PG  V  LS  D D  +     ++ + +       D R+DP   +L + R                 DRE T+ Y   +   D    + S + +  ++++DVND  P F++ P+     +H+    +G  +   I+QV A D D+G++  + Y +        FS+ P  G +  +   D E   +  L I A++
Sbjct: 1726 APSVQNDSLAAEVPEDAPPGTSLLRISATDDDEG-VNAELEFSISSGDPEGRFAVGNDGQ-------LSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPR-SALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAP------------RFPRR--EYEAAIAEDEPPGTEVLRLSAWDPDEGAN---GELRYDIASGDPTGDFRLDPVLGTLAVARP---------------LDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYT----VHARENTQGPPV--LILQVVARDDDLGSSGQVTYAAAGGNDGGAFSVSP-DGHVHLLRSLDREAQPQHVLIITATD 2133          

HSP 11 Score: 90.1225 bits (222), Expect = 2.766e-18
Identity = 118/526 (22.43%), Postives = 201/526 (38.21%), Query Frame = 1
Query: 1465 IEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKE-----GVAIGTTIVQVKATDRDIGNNAIIRYSL----DS-LSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQM-YTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKP---LSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNG 3000
            I V++VNDN P  +V               +    + EN   G V+ +LS +D D          N L+   +    E   +  + S +     L  ++  DREE + Y   L+   +   + +T     +++ D NDN P F      SR  +S+ + E     G      I  V A D D G    + Y+L    DS  +   F + P++G L      D E    + L   A+       +   L    ++ VN+ D ND  P  + D     V E                   +   ++  +I +   D  +  ++++ ++ S+ D    F +G  G + V    LDRE+ S ++  ++ +DR+  P   LSS   V + + DVNDN P +  P +            +G  +A ++A DPD G N  V Y +                  +  E           F L+  TG + + +++      S  + V A D+G PP      L + + + + N 
Sbjct: 1504 ISVEDVNDNPPVFAV--------------PEMELEVEENTGEGEVIFTLSATDAD-------QGQNALVTYSVLSGSEGAFVVDAASGV-----LRASRRLDREERASY---LLTVRASDGTHATDARLSVAVRDANDNSPRF------SRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARAT-------DGGGLAATARLYVNVLDANDNAPSVQNDSLAAEVPE------------------DAPPGTSLLRISATDDD--EGVNAELEFSISSGDPEGRFAVGNDGQLSV-ARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRS----ALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALA----------------TDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNA 1946          

HSP 12 Score: 73.9442 bits (180), Expect = 2.356e-13
Identity = 122/535 (22.80%), Postives = 207/535 (38.69%), Query Frame = 1
Query:  466 NKEIHGQIEIHFKVVEESPTNSVIGNIHNQALKQKGGVGSGDYYYKSITDIEPFFLDSKTYEFRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKH---SDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESK-----RLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVT----FEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGV--AIGTTIVQVKATDRDIGNNAIIRYSL 2028
            NK +       F   EE    S++G +  QA     G   G  Y      +  F LDS+T      +  DRE + R       Q    ++ F      G       D +     V V + D+NDN P+++      S+ E +   T++    A D D+   N   +Y I+  +    F +  S      +++L+     DRE+ A+ ++ + A D   +PL+    + + + D ND  P F ++ +     E+  +   ++ L A DED      +R+     V       F I+  TG +  A  +D+E +  Y + V   DG     S    L + V++ NDN P     +L G  F          A + EN   G  V +++  D D +        +  Q        IDP               +  ++ T    DRE T   F   +     +  + T  +      + +TD NDN P F  P        +  + +G+  A G+ +  ++A+D D   NA +RY++
Sbjct:  858 NKPLFNSSSYVFHFCEEQEVGSLVGAV--QATDADAGSNGGVTYSFEKPQVN-FELDSETGRIASLRVFDREALIR-------QGGAASFSFSVVATDGGRPKPLQDRA----TVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEG-VNGALRYAINEGNEGGKFTVDAS----TGQITLL--GSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAI---VAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPA----FLPGDVF----------ASIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGAHFTIDP---------------ESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTP--------TAILVDGLRAAAGSVVGTLQASDPDEAENAAVRYAV 1331          

HSP 13 Score: 52.373 bits (124), Expect = 9.521e-7
Identity = 65/274 (23.72%), Postives = 120/274 (43.80%), Query Frame = 1
Query:  625 FFLDSKTYEFRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKT--SIHKIINENIPLRSP--ILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTD 1434
            F L++ T E R+ + +DRE              R +Y      ++  +KG+   +S     + V + D NDN+P++       ++ E    GTE+    A DPD+   N   +Y I+       F+L           +L V +  DRE+ A+  + ++A DG     S    + ++L+D+ND  P F+ +  ++H   N   P   P  ILQ+ A+D+D     ++ +    +        F ++P  G +     +D E + ++ + +  TD
Sbjct: 1892 FALNTVTGEVRLVRELDRE-------------ARQSYALT---VLAVDKGRPPLTS--TATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEG-ANGELRYDIASGDPTGDFRLDPV------LGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENTQGP---PVLILQVVARDDDLGSSGQVTY---AAAGGNDGGAFSVSP-DGHVHLLRSLDREAQPQHVLIITATD 2133          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 176.407 bits (446), Expect = 2.250e-44
Identity = 205/726 (28.24%), Postives = 310/726 (42.70%), Query Frame = 1
Query:  844 PKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGK---HSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESK-RLGNQM---NHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNG 3000
            P +SS     S+ E   IG  +    A D D    N   +Y  +  + N  F L     D    + + V++  D E++++ ++ L   D    PL+    + I++ DIND  P F  ++    + EN P  +   Q+ A D D S    L F      D+ V   F I+  TG I  A   DYE K+ Y + V   D       D A +TI +++VND++P  S               S Y   + E+   G  V +++ +D D   + RL  ++   N      ID +  S+   R  S+L            DRE T  Y  Q+   D  S S S+S    I++ D+NDN PIF+ P+        + + E  + G  I QV ATD D  +N  +RY+L S ++  FSI+  +G +      DYEK  ++ +T+ A +     ++S     L  + V ++DVND  P F K LYT TV E  +  V V  V   D D  +    +Y  +  N +  +              A   F    TG I   VP LDRE I+S+S  I A D S     +   V I I D NDN P +  P+      N+S     G  +  L A D D+G NG VTY I                         I  N+   F LD  +G + +   +    + S  + V+ASD G+P Q     +H+++++V+ N 
Sbjct:  269 PVFSSAQYTASVDEDVAIGAAMVTVTASDKDNG-NNADLRYSFTSGNTNHAFTL-----DAVTGV-VTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGT---QVSATDRDSSTNGALVFGIIKGNDDGV---FTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFS--------------PSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSI---RVSSEL------------DRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGPYV-------FRVSESSSPGHQIGQVAATDADDSSNGDVRYAL-SDNTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSS-----LTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAF--------------AMDRF----TGEITTRVP-LDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPS----RFNISEDSPTGTRVGQLTATDRDIGPNGAVTYAI-------------------------ISGNQGNSFQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNA 891          

HSP 2 Score: 173.326 bits (438), Expect = 2.194e-43
Identity = 187/739 (25.30%), Postives = 310/739 (41.95%), Query Frame = 1
Query:  841 SPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKL-KHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLT---IEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQL-ITTKM-FDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQ---FSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNGHGSSQGQFNK 3030
            SP +S  +    +PE + IG+ +    A D D  P    + Y++   +V   F +  +SG       S+ V+ + DRE   + S++++A DG     S    + I+L DIND  P F+   + ++   + P    I Q+ A D D+S    +R+   ++ D      F IN  TG I     +DYE K++Y + V   DG    +++LT   + V +VNDN P+ +               S Y   + EN   G  V  ++ +D D       +  N  +   I    E++         +D F   ITT++  DRE  + Y   +   D        + T  ISI D NDN P F  P +       ++I E    GT + Q+ ATDRDIG N  + Y++  +S  Q   F +DP SG L      D E +  + L + AS+       S        I V++ DVND  P FEK L++  ++E                   +  +S   ++     D  + S+  +  + + + S  F I  TG +    P LD E  +++   + A D      S+TA V+I I++VNDN P +V P       ++    AI   +  L A D D                P +F+               ++ N    F +D S+G I +A+++      +  + V A++ G+  +       I +++V+ N    + G + K
Sbjct:  475 SPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLE-YRLISGNVKGAFNIDANSG-------SIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGPYVFRVSESSSPGHQ-IGQVAATDADDSSNGDVRYALSDNTD-----VFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFA--------------KSLYTCTVGENLAAGVAVCYVTATDAD-------SGANGKISYSILSGNENMAF------AMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPSR-------FNISEDSPTGTRVGQLTATDRDIGPNGAVTYAI--ISGNQGNSFQLDPRSGILSVRSTLDRETIPSYTLVVKASD-----AGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIRE------------------DASVHSTVLQVKVEDKD--EGSNGAITLSLSGEGSDNFTIDSTGFVLSKTP-LDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSP---AQVTSIPEDVAINTHVVKLNATDSD--------------GTPLTFDI--------------VEGNAGSSFKIDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAK 1106          

HSP 3 Score: 171.4 bits (433), Expect = 7.333e-43
Identity = 191/723 (26.42%), Postives = 310/723 (42.88%), Query Frame = 1
Query:  844 PKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLK-HSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDG---KHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRI-GETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            P ++ P  + ++ E S  GT +    A D D  P N    Y I   +  + F+L   SG        L V    DRE   + ++ +KA D      S    I++S+ D+ND  P F+K+     I E+  + S +LQ++ +D+DE     +      S+     + F I+  TG +L+   +DYE  + Y + V   DG     S  A + I + NVNDN P          +F +P + +     +A N      V  L+ +D D      G  +    D        S ++ +S S LI        K  DRE T+ Y   +   ++ S   S      I + DVNDN P+F      + G ++ S+ E + IG T+ +V ATDRD G NA + Y L    +++F ++P +G +      D E    + L + A +     K SQ    +  IT+ I D+ND  P F +  YT TV E  +                    SN  +++++  D   ++    Y+  + +    FRI   TG I V V V+DRE ++S++  I A D    P  STA V I + D NDN P++   N  +Y ++     +IG  +A + A D D G N +V Y IV                                F ++   G + + +++    V +  + + ASD+G+P     + L + + +V+ N
Sbjct:  788 PTFTGPSRF-NISEDSPTGTRVGQLTATDRDIGP-NGAVTYAIISGNQGNSFQLDPRSGI-------LSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITL----SLSGEGSDNFTIDS-TGFVLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVP----------SFVSPAQVTSIPEDVAINTH----VVKLNATDSD------GTPLT--FDIVEGNAGSSFKIDQS-SGLIS-----VAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVF------NPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKFEVNPATGLVTTKRPLDREDQASYSLRVTAMD---HGKPSQ--SAVAAITLTINDLNDNSPQFSQSKYTLTVTENTAN------------------GSNILRVLASDPD-AGANGRVTYSIISGNHGNAFRIDSTTGRITV-VGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFA-SNETSYGIDEGV--SIGSRVAVVTATDRDEGSNAQVFYSIVRGD--------------------------TSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDN 1408          

HSP 4 Score: 165.622 bits (418), Expect = 4.249e-41
Identity = 166/591 (28.09%), Postives = 250/591 (42.30%), Query Frame = 1
Query: 1054 KDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSK--LIDHFQLITTK-MFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQ-FSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRI-GETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSD 2811
            + FDRE ++   + + A D       G+  + I + D ND  P F   S    I EN P  + +  + A D D      + +   +       N+F +N  TGEI T   +D+E K  YT+ +   DGKH+    L I V +VNDN P  ++              S Y+  + E+   G +V  L+  D               LD  I+  R S  L    +    +D   +I TK  FDRE  + Y   L   D  S S S   T EI I DVNDN P+F      S   ++ S+ E VAIG  +V V A+D+D GNNA +RYS  S ++   F++D ++G +      D+E+   + L ++ ++     + S  L     + +N+ D+ND  PVF    Y   VKE       V           +      F II    D                    F I G TG+I +     D E  + +   +QA DR       TA V I I DVND+ P++   +  NY   +     IG  +  + A D D G  G++ YR++  +   +FN +  S ++ V+   D
Sbjct:   26 RKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTPA-AQVAIVTATDRDSGTNAAITYSLFSG-----ENKFMMNSKTGEIRTVTPLDHETKDSYTMRISAFDGKHTTFVPL-ITVDDVNDNAPFFAL--------------SVYKTGVYEDVAVGSIVRQLTAVD---------------LDVGINA-RLSYSLVSGDTSYFTVDSQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVF------SSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTD-----RGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGTQVSATDRDSSTNGAL----VFGIIKGNDD------------------GVFTIDGSTGIISI-AKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVF---SPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSELD 542          

HSP 5 Score: 162.54 bits (410), Expect = 3.701e-40
Identity = 183/727 (25.17%), Postives = 310/727 (42.64%), Query Frame = 1
Query:  844 PKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLI-VNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTD-GK--HSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESK-RLGNQM---NHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGET-GLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            P + SP    S+PE   I T +    A D D  P      + I   +    FK+  S         LI V K  DRE  A  ++ ++A +      S   +  I + D+ND  P F   S  K ++EN+P+   + ++ A D DE +  K+ +E   SV +T  ++F +NP TG + T   +D E ++ Y++ V   D GK   S  A +T+ + ++NDN+P+ S               S+Y   + EN   G  +  +  SD D  +  R+   +   NH    RID                   ++    + DRE  + Y   +   DS      ++    I++ D NDN PIF      +    SY I EGV+IG+ +  V ATDRD G+NA + YS+    ++ F+I+ ++G L      + E +  + LTI AS+     + S ++ + +++TV + DVND  PVF    Y  +V+E                  +S  +++   + ++  D+  ++  +    S +D  + F+I  T G+I    P LD E+ S +  ++ A D      ++   V I+++++ND  P +      NY  +V         +  + A+D D    G ++Y IV                              + F +D  +G I  A  +    V    I V  +D G PP   +  + I I++ + N
Sbjct:  995 PSFVSPAQVTSIPEDVAINTHVVKLNATDSDGTPLT----FDIVEGNAGSSFKIDQSS-------GLISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYEL--SVGDT--SKFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFS--------------QSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDSTTG---------------RITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIF------ASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASD-----RGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRE------------------NSAQSTSVLTVAADDSDVGANAVLRYSIISGND-EKRFKINSTSGVIMTTTP-LDFEEKSQYGLEVTATD---SKYTAKTNVTIRVINLNDITPAFT---QQNYTASVRENSPTSTSVVKVSASDRD--SFGSLSYSIVGG-------------------------KDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDN 1613          

HSP 6 Score: 159.844 bits (403), Expect = 2.813e-39
Identity = 170/714 (23.81%), Postives = 297/714 (41.60%), Query Frame = 1
Query:  874 SLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQ-SVNDGFKLKHSGRDHYEKLSLIVNKD-FDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGK---HSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSY--SIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLS-STQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVD 2991
            SL E+  IG  +    A D D+      +  K++Y+ SV D  K + +         L+  K   DRE QA+ S+++ A D      S    I +++ D+ND  P F ++     + EN    S IL++ A D D     ++ +     +     N F I+  TG I   G +D E  + Y + +   D         A + I V + NDN+P      +  SN  + G        + E    G  VA ++ +D+D  S    N        R D    ++              L   K  +RE    Y   +   D  S  +++     + + DVNDNPP+F           SY  S++E  A  T+++ V A D D+G NA++RYS+ S +   +F I+  SG +      D+E+  ++ L + A++     K          +T+ + ++ND  P F +  YT +V+E                      +++  K+ ++  D + S    +    +SD    F I +   I     VLDRE +S ++ +++  D    PLS+   V I+ILD NDN P +   +  +  +  S   +  + +A   A D D G N ++TY +                            +R++ F +  S+G I +AQ +   +  +  + ++A D GTPPQ     + + +++++
Sbjct: 1107 SLHENLPIGQTVAKVTATDRDEG-----ENAKVTYELSVGDTSKFEVN-----PATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSI---ISGNHGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSP------IFASNETSYG--------IDEGVSIGSRVAVVTATDRDEGS----NAQVFYSIVRGDTSAFAINAMNGV--------LTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNS--------QSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDSKYTAKT--------NVTIRVINLNDITPAFTQQNYTASVRENSPT------------------STSVVKVSASDRDSFGSLSYSIVGGKDSDK---FSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLA---ATDADEGTNARITYNL----------------------------SRNDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDIN 1713          

HSP 7 Score: 153.295 bits (386), Expect = 3.142e-37
Identity = 176/739 (23.82%), Postives = 307/739 (41.54%), Query Frame = 1
Query:  841 SPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDG---KHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRL-------GNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGE-TGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNGHGSSQGQF 3024
            SP +  P+++  + E S  G +I    A D D   +N   +Y +S  +  D F +  S       ++L    D++++ Q  V+V  K  DG     S    + + + D+ND  P F K+     + EN+     +  + A D D     K+ +   +  +      F ++  TGEI T   +D E  + Y++ +   DG   +     T+ I + + NDN P           F  P R +     ++E+   G  V  L+ +D+D             GNQ N     ++DP    L +R +                DRE    Y   +   D+ S   S + +  +S+ DVNDN P FE      + + S  I+E  ++ +T++QVK  D+D G+N  I  SL    S  F+ID  +G + +    DYE    ++LT+ A +     K++       ++ + I +VND +P F       ++ E                      N++  K+ +   D         +     +A   F+I + +GLI V    LDRE  ++++  ++A +   +  S      I++LDVNDN P++   N  +Y  ++     IG  +A + A D D G+N KVTY                   L V ++S         F+++ +TG +   + +   D  S  + V A D G P Q  +  + + I +++ N    SQ ++
Sbjct:  580 SPIFQGPYVF-RVSESSSPGHQIGQVAATDADDS-SNGDVRYALSDNT--DVFSINTS----TGLITLKTQLDYEKKTQYMVTVTAK--DGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMA---FAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQP----------TFTGPSRFN-----ISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNSF---QLDPRSGILSVRST---------------LDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFE------KSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSDNFTIDS-TGFVLSKTPLDYETTAAYQLTVTARDGGSPSKSAT-----AQVKITIINVNDNVPSFVSPAQVTSIPE------------------DVAINTHVVKLNATDSD----GTPLTFDIVEGNAGSSFKIDQSSGLISV-AKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVF---NPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYE------------------LSVGDTS--------KFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKY 1208          

HSP 8 Score: 132.109 bits (331), Expect = 7.407e-31
Identity = 173/695 (24.89%), Postives = 282/695 (40.58%), Query Frame = 1
Query:  625 FFLDSKTYEFRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAI--GYCIANLKANDPD 2703
            F +DS T    V   VDRE +  + +  I         ++ +  +       +D+SP                  ++S      + E   IG+ + +  A D D+  +N    Y I  +     F +      +     L V K+ +RE   T ++ ++A D     ++   ++ + + D+ND  P F   S    + EN    + +L + A D D      LR+   +  DE    RF IN  +G I+T   +D+E KS+Y + V  TD K++ +  +TI V N+ND  P  +                 Y A + EN      V  +S SD+D      G+    ++  + D  + S++ R   S +I      T  + DRE  S Y  Q+   D+ +  LS      I I D NDN P F+          S SI E  A  +   ++ ATD D G NA I Y+L    +  F I   SG +      D E    ++L I A +     + S +      I V + D+ND  P+        +V+E                  +    ++  +I+++  D   +++      SN   S +     TG I   VP LDRE+ + ++ +I  AD+    LSS A V I ++D +DN P +        E NV+  E++  G  I  + A D D
Sbjct: 1251 FRIDSTTGRITVVGVVDREALASYNL-TISAKDSGVPPWVSTAFVAITVADENDNSPI-----------------FASNETSYGIDEGVSIGSRVAVVTATDRDEG-SNAQVFYSI-VRGDTSAFAI------NAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDE---KRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDSKYTAKTNVTIRVINLNDITPAFT--------------QQNYTASVRENSPTSTSVVKVSASDRD----SFGSLSYSIVGGK-DSDKFSIDQR---SGIIS-----TADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSY------SSSILENSAPSSFSFKLAATDADEGTNARITYNLSR--NDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSI-----TIRVTVIDINDHRPLINSSSLRGSVRE------------------NQPKETHVMRILASDADTGLNAELTFSLLSNEHKSVFTLDNTTGDISTKVP-LDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRF-----QPTEYNVTISESLPRGASIVQVTARDID 1852          

HSP 9 Score: 127.487 bits (319), Expect = 2.340e-29
Identity = 177/730 (24.25%), Postives = 312/730 (42.74%), Query Frame = 1
Query:  841 SPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHS-GRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQAT----LTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSL-DSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTI---NASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQM-YTNSNSDASQYFRIG-ETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            SP++S     L++ E++  G+ I   LA DPD    N    Y I   +  + F++  + GR       + V    DRE  A+ ++ + A D    P      + I++ D ND  P F        I+E + + S +  + A D DE    ++ +    S+     + F IN + G +     I+ E    YT+ +  +D + S   T    LT+ V +VNDN P  +              S  Y   + EN      V +++  D D  +       N +L   I    +    + + +  +    ++TT   D EE SQY  ++   DS   +  T+VT  I + ++ND  P F      ++  ++ S++E     T++V+V A+DRD  +   + YS+     S +FSID  SG +   DV D E +  + + +   +A NP         L  L  +T+ I D ND  P F+   Y+ ++ E  +                   +S  FK+ +   D  + +++++ Y  S +DA   F IG  +G+I +  P LDRE  S++   IQA D    P +S+  +++ ++D+ND+ PL    N+ +   +V   +     +  + A+D D G N ++T         FS  +NE                   +F LD +TG+I     +         + +  +D+G P    +  + I++++ D N
Sbjct: 1200 SPQFSQSKYTLTVTENTANGSNILRVLASDPDAG-ANGRVTYSIISGNHGNAFRIDSTTGR-------ITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFY----SIVRGDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASD-RGSPMMTSDKELTVVVNDVNDNPPVFN--------------SQSYIGSVRENSAQSTSVLTVAADDSDVGA-------NAVLRYSIISGNDEKRFKINSTSGV----IMTTTPLDFEEKSQYGLEVTATDSKYTA-KTNVT--IRVINLNDITPAF------TQQNYTASVRENSPTSTSVVKVSASDRD--SFGSLSYSIVGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNP--------PLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAP------------------SSFSFKLAATDAD--EGTNARITYNLSRNDA---FMIGASSGVITLAQP-LDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLI---NSSSLRGSVRENQPKETHVMRILASDADTGLNAELT---------FSLLSNEH----------------KSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDN 1820          

HSP 10 Score: 121.324 bits (303), Expect = 1.516e-27
Identity = 140/557 (25.13%), Postives = 238/557 (42.73%), Query Frame = 1
Query: 1339 FYINPLTGEILTAGY-IDYEIKSEYTIPVIVTDGK---HSDQATLTIEVKNVNDNNPEISV-LYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRI-GETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVD 2991
            F I+  TG I T G   D E +S Y + V+  D     H  +  + I+VK+ NDN PE  +  Y+      TP  ++Q     A ++D G   A+++ S    E+K + N              ++ E+R             T    D E    Y  ++  FD       T+    I++ DVNDN P F +       ++   + E VA+G+ + Q+ A D D+G NA + YSL S  ++ F++D   G +R    FD E    +++ + A +     ++ Q       + + I DVND  PVF    YT +V E                       +    + ++  D  +++D + Y+ ++ + +  F +   TG++ V+   LD E+ SS++  +   DR   PL+ T+ + I + D+NDNPP++   +   Y+  V      G  ++   A D D   NG + + I                         IK N   +F +DGSTG I IA+     +     + V+A D+G P +    ++ I I +V+
Sbjct:   12 FTIDSSTGSITTTGRKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTP--AAQVAIVTATDRDSG-TNAAITYSLFSGENKFMMNS-------------KTGEIR-------------TVTPLDHETKDSYTMRISAFDGKH----TTFVPLITVDDVNDNAPFFAL------SVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSYFTVDS-QGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQ-----ATVEIEILDVNDNRPVFSSAQYTASVDE------------------DVAIGAAMVTVTASDKDNGNNADLR-YSFTSGNTNHAFTLDAVTGVVTVSRS-LDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVF---SPSAYQSRVKENTPAGTQVS---ATDRDSSTNGALVFGI-------------------------IKGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVN 472          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO40470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S751])

HSP 1 Score: 165.236 bits (417), Expect = 8.156e-41
Identity = 191/707 (27.02%), Postives = 308/707 (43.56%), Query Frame = 1
Query:  919 LAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKL--SLIVNKD---FDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQ----ATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQ-----FSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            +A+D D   +N+TQ Y I   +V + FKL  S RD    L   L+VN      DRE+  +  + + A DG      G L ++I++ D ND +P F   S    I ENI + + ILQ+ A D+D     ++++  +   D   +  F I+P TG I+    +DYE K  Y I V   D   S Q    A + IEV +VNDNNP I V Y  G +++           + EN   G  VA +SVSD D  S + G ++N  L+          ++      L D   +   +  DRE    +F + +C D      +T  +F I++ DVND  P F+      R  +   + E   + T +  V A D+D G+N+ + Y++ + + ++     F+IDP SG +      D E++ +  LT+     ++  + S  L     + VN+ D ND  P F +  Y  ++ E                       S   ++++   DI    +S +  +  +  + +F     GL+  N   LD E  SS++F++ A D   +  S  A V + + D+NDN P++   +  +Y V       IG  I  LKA D D                         S    +T     + N  E+F +DGS G I +A+ +      +  + V+A D G   Q  + +  +NI  +D N
Sbjct:   80 IAVDSDFG-SNSTQSYTIVSGNVGNVFKLI-SKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDP--QAIFGIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQ-----------VTENATIGTQVARVSVSDAD--SGKNG-EVNVTLEGGDGYFSMKFDV------LNDESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFD------RHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTV-----LVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPS------------------GSPVVQLLAQDPDI--GENSLILYSILTPNTPFFLDPRKGLV-TNSRTLDHEVQSSYTFQVAATDGGGR--SCNATVHVSLTDLNDNQPVF---DPSSYSVEYFENTRIGQSICQLKAIDRD-------------------------SPKFAITRFIIEQGNADEVFSVDGS-GLITLAKLLDRETQDNYLLTVKAVDGGG--QDSVNKAIVNITVLDVN 697          

HSP 2 Score: 156.762 bits (395), Expect = 3.214e-38
Identity = 199/740 (26.89%), Postives = 318/740 (42.97%), Query Frame = 1
Query:  844 PKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQ------ATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRI---DPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDS-LSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGE-TGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNGHGSSQGQFNK 3030
            P + +   + ++PE   IG+ +   LA+D DQ   N   +YKI   + +  FK+  +       +S +   DF+   +  + V            S QL + I + D ND +P F K  I   I EN+P+ + +  ++A D+D     ++ +  D+   ++ R  F IN  TG I T   ID E  SEY++ V  TD   ++Q      ATL I ++++NDN P+                 S+   Y+ E++   F V S++  D D  + + GN     ++ RI   D  + SL+L+    KLI           D E+  QY   +   D  S  L++   F + + DVNDNPP F      +R +   ++ E    GT++V+V A DRD G+NA + YS+ S +   +FSID  SG +    + D EK + + LT++A+      + S        + +N+ D ND  P F   + T  V E     +                    + +     D Y ++   +Y+  + +    F IG  TG +      LDRE  +S+   +QA D +    ++ A + I I D NDNPP++       Y   +S     G  I NL A+D D G NG + Y                      T S+D     + ++ +D  TG +Y A + + S       +  A DQG  P+  I  + I I   D N H     QF K
Sbjct: 1222 PVFINETTFKTVPEKLPIGSVVAAVLAVDSDQG-DNGKVRYKIVNGNTDGTFKINET----TGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQL-VTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDS---QSPRAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFV---------------SRNLTYVMEDEPFNFQVTSITALDPD--TGQGGN-----VEYRIVSPDTGKFSLDLKTGVLKLIGSL--------DYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEF------TRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMDKFSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVSS-----TSVRINVMDRNDNPPKFISPVVTLKVPENSPARL-------------------IYTLTVQDLD-YGNNTKVLYSIMSGNTDGAFTIGRSTGELSTTTK-LDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVF---QQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVY----------------------TLSND----TYGVYSIDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKI--EDKNNHAP---QFTK 1856          

HSP 3 Score: 154.066 bits (388), Expect = 1.884e-37
Identity = 171/675 (25.33%), Postives = 300/675 (44.44%), Query Frame = 1
Query:  844 PKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSE-YTIPVIVTDGK---HSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINA----SNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGE-TGLIHVNVPVLDREKISSFSFKIQAADR-SEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKF-NRHEM 2835
            P +S      ++ EHS+  + I    A+  D+  TN    Y IS  + ++   +  +G       +L +  + D EK  ++ + ++A D    PL G  ++ I++ DIND  P F  +SI   + E+ P+      +   D D     ++ F    S+       F ++  TG +     IDY   +  YT+PV   DG     S  A L ++V +VND +P                 +  Y A++ E   P   +  +  +D D        ++++  D ++D  +  L   R+  K+      I +K+ DRE+  +Y  ++I  D  +   S+S   ++ + DVNDN P F+   Q S   +++ +KE   + T +  V A+D D G+N  + Y  D+    QF +D  +G++    V D E    +  +I A    S+P +++          ++TV + DVNDC P F K+ Y+ TV E       +  ++  DDD     +   + I++ P                    + F + + TG++ +  P LDRE        + A+D+   + L +   ++I +LDVNDN P+++   T      V  +  IG  +A + A D D GDNGKV Y+IV  +   +F  NE +  +    + D +  NR+ +
Sbjct:  701 PIFSKAEYNFTIQEHSQALSVIGHVHAISRDKG-TNAEVVYSISKGNTDNIVLINSTG-------TLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQFNSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSF----SLLSNPGTLFNLDSNTGALSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFG--------------NWSYTAHVLETTPPDSNIIEVVATDVDSGEN---GRISYAFDSKVDTSKFGL---RNGGKI-----FIKSKL-DREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQ---QAS---YAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRFDT-QVAQFIVDKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVDKT---------QVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGP--------------------KAFSLNQVTGVLTLVSP-LDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFK---TVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTDGTFKINETTGVISTLRALDFEVTNRYVL 1297          

HSP 4 Score: 151.369 bits (381), Expect = 1.296e-36
Identity = 181/721 (25.10%), Postives = 305/721 (42.30%), Query Frame = 1
Query:  883 EHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLI-VNKDFDREKQATVSVKLKAFD-GDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVD-ETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKH---SDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRES-LELRRSQSKLIDHFQLIT-TKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIK--EGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQ-FSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQ---MYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVG----SKKIWVEASDQGTPPQKKIERLHINIVNVD 2991
            E++ IGT++      D D   +    +  ++ +  +  F +K    D     S+I V +  DRE      +K    D GDP P + +    I++ D+ND  P F + +    + EN  + + +  + A D+D     +L +   N+ +  +  + F I+P +G I TA  +D E   +  + V+V D      SD  ++ + + + NDN+P  +               S Y A L EN   G  V  L   D D     L      +L   + P+    L+ R+          L+T ++  D E  S Y  Q+    +D    S + T  +S+TD+NDN P+F+          SYS++  E   IG +I Q+KA DRD    AI R+ ++  ++ + FS+D  SG +    + D E  + + LT+ A +        Q       + + + DVND  P+F K  Y FT++E                      +S    +I + H I     +    +Y+ S  +      I  TG +++   V D EKI S    +QA D+   PL   A V I ++D+NDN P +   N+ +  V +     IG+    +   D D G  G+V++ ++                           N   +F+LD +TG + +    KL D G    S  + V+A D G+PP+     L + +V+V+
Sbjct:  293 ENATIGTQVARVSVSDAD---SGKNGEVNVTLEGGDGYFSMKF---DVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDP-PRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFN--------------QSSYNASLFENSPSGSPVVQLLAQDPDIGENSL------ILYSILTPNTPFFLDPRKG---------LVTNSRTLDHEVQSSYTFQVAA--TDGGGRSCNATVHVSLTDLNDNQPVFDP--------SSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNADEVFSVDG-SGLITLAKLLDRETQDNYLLTVKAVD-----GGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQE----------------------HSQALSVIGHVHAISRDKGTNAEVVYSISKGNTDNIVLINSTGTLYLQSEV-DHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQF---NSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLS--------------------------NPGTLFNLDSNTGALSLT---KLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVN 906          

HSP 5 Score: 142.124 bits (357), Expect = 8.215e-34
Identity = 161/651 (24.73%), Postives = 270/651 (41.47%), Query Frame = 1
Query: 1057 DFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGK-HSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKL-IDHFQLIT-TKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEG-PXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            D DRE+   V + +   D    PLS    + ++LTD ND  P+F ++S +  + EN P  SP++QL A+D D  +   + +        T    F+++P  G +  +  +D+E++S YT  V  TDG   S  AT+ + + ++NDN P                  S Y     EN   G  +  L   D+D                +    R  +E   +     +D   LIT  K+ DRE    Y   +   D             I++ DVND PPIF      S+  ++++I+E     + I  V A  RD G NA + YS+   ++    +   +G L      D+EK+    LT+ A +     K +  L+    +T+ + D+ND  P F        + E  P    +    V   D       S  F ++SNP  +++        +SN+ A    ++ + G               S++  +QA D    P SSTA+++++++DVND  P  VF N  +Y  +V         I  + A D D G+NG+++Y         +F++  ++           KF          + G I+I  K+   D+    + V A D GTP +     + + + +V+ N
Sbjct:  455 DLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSI-----LTPNTPFFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGGGRSCNATVHVSLTDLNDNQPVFD--------------PSSYSVEYFENTRIGQSICQLKAIDRD--------------SPKFAITRFIIEQGNADEVFSVDGSGLITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIF------SKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGNTDNIVLINSTGTLYLQSEVDHEKIPSLYLTVQAKD-----KGTPPLFGYANVTIAVIDINDNSPQFNSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVS--FSLLSNPGTLFN-------LDSNTGALSLTKLIDYG-----------NSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSP--VFGN-WSYTAHVLETTPPDSNIIEVVATDVDSGENGRISY---------AFDSKVDTS----------KFGLR-------NGGKIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDN 1012          

HSP 6 Score: 132.88 bits (333), Expect = 5.835e-31
Identity = 197/800 (24.62%), Postives = 331/800 (41.38%), Query Frame = 1
Query:  475 IHGQIEIHFKVVEESPTNSVIGNIHNQALKQKGGVGSGDYYYKSITDIEPFFLDSKTYEFRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPX--XXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDG--FKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDET---VRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDG---KHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRD-IGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQM-YTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPL-SSTAIVQIQILDVNDNPP--------LWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSD 2811
            I  + E +F + E S   SVIG++H  A+ +  G  +   Y  S  + +   L + T    +   VD E+I               Y  +Q++    +KG    + P      V + +IDINDNSP+++S  I + LPE + IG         D D   +    +   S  S N G  F L      +   LSL    D+    ++  ++ ++A DG   P S    + + + D+ND  P F   S    + E  P  S I+++ A D D  +  ++ + FD+ VD +   +RN        G+I     +D E   EY + VI  D    + S  A + + V +VNDNNP                + + Y  ++ EN+     + ++S SD D  S       N  +  R D       + +   K      + T+++ DRE  + Y   ++  D  S+         + + DVND  P F      S+  +S ++ E + +G++++ + ATD D  G N+ I Y + +     FS++ ++G L  +   D E   +  L + AS    ++  +Q L T+  I +N+ DVND  PVF  +    TV E                       S    +++   D  D+   +    N N+D +  F+I ET  +   +  LD E  + +  ++ A D  +K   +S  +V I + D NDN P         W++ N             I   +  +KA+D D G N ++ Y I   S    F  N E+  ++ T   D
Sbjct:  702 IFSKAEYNFTIQEHSQALSVIGHVH--AISRDKGTNAEVVYSISKGNTDNIVLINSTGTLYLQSEVDHEKIPSL------------YLTVQAK----DKG----TPPLFGYANVTIAVIDINDNSPQFNSSSILVRLPEDTPIGHTFYTVSVFDAD---SGVLGRVSFSLLS-NPGTLFNLDS----NTGALSLTKLIDYGNSARS-YTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFGLRNG-------GKIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHF--------------QQASYAFFVKENEPVATYLGAVSASDSDEGS-------NGHVTYRFDTQVAQFIVDKQTGK------ITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKF------SKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVA-GPKAFSLNQVTGVLTLVSPLDREVTHRHILHVVAS----DKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPE------------------KLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTDGT--FKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENV-----------PINTNVTTIKAHDDDSGLNSRIWYTIDSQSPRAHFKINSETGLIQTTHPID 1394          

HSP 7 Score: 130.568 bits (327), Expect = 2.979e-30
Identity = 199/788 (25.25%), Postives = 322/788 (40.86%), Query Frame = 1
Query:  484 QIEIHFKVVEESPTNSVIGNIHNQALKQKGGVGSGDYYYKSITDIEPFFLDSKTYEFRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXX--SPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFD-GDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQAT----LTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELR-RSQSKLIDHFQLITTKMFDREETSQYFAQLICFD---SDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQE-AIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSD 2811
            Q    F V E  P  + +G +      +     +G   Y+  T +  F +D +T +   S+ +DRE              + +Y F    I+  + G    SSP +    V +I  + N  SPK+S     +++ E   +G+ +   +A D DQ   N+   Y I        F L          L+L+     DRE      + + A D G    L     I I++ D+ND  P F   +  K + E +P+ S +  + A D D+ D  K+R++    V+      F IN  TG I T   +D+E+ + Y + V  TD     Q T    +TI V++ NDN P            K P        ++ EN      V ++   D D       + +N  +   ID        +  S++ LI      TT   DREE S+Y  ++   D   ++ + L  + T +I I D+NDN P F      SR + +Y + E       +  + A D D G    + Y + S  + +FS+D  +G L+ I   DYE + ++ L I+A++       S  L + Q   V + DVND  P F +DL+  TV E                       ++  K+ +   D   +++      S  +  ++     +GLI  N  +LDREK  ++   + A   S     S+  V+I ++D NDNPP ++ P      V +   E +    I  L   D D G+N KV Y I+  +   +F     +  L  T   D
Sbjct: 1018 QASYAFFVKENEPVATYLGAVSASDSDEGS---NGHVTYRFDTQVAQFIVDKQTGKITTSQVLDRE-------------AKASYVF---SIVATDGG----SSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGP--KAFSLNQV----TGVLTLV--SPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKI---VNGNTDGTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFD---------KNP-----IITWIYENVPINTNVTTIKAHDDD-------SGLNSRIWYTIDSQSPRAHFKINSETGLIQ-----TTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFV-----SRNL-TY-VMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSPDTGKFSLDLKTGVLKLIGSLDYEDVPQYTLHISATD-----LGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPT------------------GTSVVKVTAYDRDSGSNAELTYSIPSGVEMDKFSIDKHSGLIVTN-SILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISP-----VVTLKVPENSPARLIYTLTVQDLDYGNNTKVLYSIMSGNTDGAFTIGRSTGELSTTTKLD 1709          

HSP 8 Score: 120.553 bits (301), Expect = 3.266e-27
Identity = 166/645 (25.74%), Postives = 264/645 (40.93%), Query Frame = 1
Query:  883 EHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQAT--------LTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLD-----CRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYS--IKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDS-LSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPD-LGDNGKVTYRIVPSSFPFSFN 2766
            E+++IG  I    A+D D P    T ++ I   + ++ F +  SG     KL        DRE Q    + +KA DG       +  +NI++ D+ND+ P F K   +  I E+    S I  + A   D+    ++ +           N   IN  TG +     +D+E      IP +    +  D+ T        +TI V ++NDN+P+ +              SS     L E+   G    ++SV D D  S  LG     LL        +D +  +L L    +KLID+                Y   +   D  S   S++   E+ + DVND  P+F        G  SY+  + E     + I++V ATD D G N  I Y+ DS + +++F +    G++      D E +E++ L + A +    R++S        + V ++DVND  P F++  Y F VKE                       + Y   +S   D  + S+  +    ++  +Q+    +TG I  +  VLDRE  +S+ F I A D    P      V + + DVND  P +   + + Y V V+    +G  +  L A D D  G N  +TY IV     FS N
Sbjct:  610 ENTRIGQSICQLKAIDRDSPKFAIT-RFIIEQGNADEVFSVDGSGLITLAKL-------LDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKG---NTDNIVLINS-TGTLYLQSEVDHE-----KIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQFN--------------SSSILVRLPEDTPIGHTFYTVSVFDAD--SGVLGRVSFSLLSNPGTLFNLDSNTGALSL----TKLIDY----------GNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVF--------GNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFGLRN-GGKIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSS-----ADVKVIVDDVNDNNPHFQQASYAFFVKENEPV-------------------ATYLGAVS-ASDSDEGSNGHVTYRFDTQVAQFIVDKQTGKITTS-QVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKF---SKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGPKAFSLN 1169          

HSP 9 Score: 119.783 bits (299), Expect = 5.998e-27
Identity = 173/728 (23.76%), Postives = 294/728 (40.38%), Query Frame = 1
Query:  844 PKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTD-GKHSDQATLTIEVKNVNDNN--PEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIF--EVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQ-FSIDPISG--ELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQM-YTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFP------FSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGS-KKIWVEASDQGTPPQKKIERLHINI 2979
            PK+ SP + L +PE+S      TL +  D D    NT   Y I   + +  F +   GR   E   L      DRE +A+  + ++A D  P   +   +I I + D ND  P F+++     I+E  P  + IL L A D+D      + +   N         + I+  TG + +A   +  IK EY    I  D G+    A + + +K  + NN  P+ +         KTP     Y  ++  N     +V  ++ +D D +        N  +  R+D  + S  L   +S   +   + T+  F      ++   +I  D  S  L      +I I ++ D+PP F  + P +        SI E   +G+ I  V+A      ++A + YS+ S +  + F +DP +G   + + D  DYE  + F L + A+       N  ++     + +N+ D ND  P F        + E                          F +     D+   ++ ++ Y+    + +  F I  T        +LDRE  +SF   I+  D    P S+   V++ + D+NDNPPL+        EVN+      G  + ++ A D D     ++TY +  +S P       S    +   N ++  S  I  +    + +D  TG I   + + +    S  +I V+A DQG PPQ+ +  + I I
Sbjct: 1644 PKFISPVVTLKVPENSPARLIYTLTV-QDLDYG-NNTKVLYSIMSGNTDGAFTI---GRSTGE---LSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSND----TYGVYSIDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFT---------KTP-----YEVHIFPNTSASALVTMVTATDADTD-----KSTNGKVTYRLDDSKNSTSLFVVES---NTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPAR-------VSIPENSKVGSYITTVRAR---ASSDAQVTYSIISGNKGRAFYVDPFTGVISVASADALDYESTKNFRLHLVATPQGWVSLNGYMI-----LDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPR------------------FVVKVTATDVDSGTNGKVTYSIWTGNEAGVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLF----DPLSEVNIREDTRTGAVVTSVVATDTD--KESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIII 2298          

HSP 10 Score: 108.612 bits (270), Expect = 1.353e-23
Identity = 173/749 (23.10%), Postives = 297/749 (39.65%), Query Frame = 1
Query:  844 PKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNK-DFDREKQATVSVKLKAFD-GDPNPLSGQLDINISLTDINDKQP--HFKKTSIHKI-INENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGK---HSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYES-KRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKM-FDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQE---AIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNGHGSSQGQFNKRSGLSRV 3051
            P++S+     ++PE+  +GT I    A D D   TN   +Y I   S        H          +IVN    D E + +  + +KA D G  + LS    + I + D+ND  P  H   T      + EN  + + + ++   D D     ++    +   D     +F +      I     +D E    + +  +  D      + + +  I V +VND  P+                   Y   + EN     +VA ++  D+D+ S   L   + +  + R   H  +++             +ITT    DRE+  Q    ++  D  S  LS + +  +++TD NDN P F      ++  ++ S+ E    G+ +VQ+ A D DIG N++I YS+ +  +T F +DP  G + N    D+E    +   + A++      N+        + V++ D+ND  PVF+   Y+    E                  +   +S  F I               +     +A + F +  +GLI +   +LDRE   ++   ++A D   +   + AIV I +LDVND PP++        E N + QE   A+   I ++ A   D G N +V Y I                          K N   +  L  STG +Y+  ++    + S  + V+A D+GTPP      + I +++++ N       QFN  S L R+
Sbjct:  170 PEFSNVSYSGTIPENIDVGTSILQVSASDKDI-GTNAEIQYSIETHSDPQAIFGIH------PTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGG-DGYFSMKFDVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFD--------------RHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSG---------MITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYF------NQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSILT-PNTPFFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGGGRSCNA-------TVHVSLTDLNDNQPVFDPSSYSVEYFEN------TRIGQSICQLKAIDRDSPKFAI-------------TRFIIEQGNADEVFSVDGSGLITL-AKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIF-----SKAEYNFTIQEHSQALS-VIGHVHAISRDKGTNAEVVYSIS-------------------------KGNTDNIV-LINSTGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSP-----QFNSSSILVRL 816          

HSP 11 Score: 95.9005 bits (237), Expect = 1.123e-19
Identity = 165/725 (22.76%), Postives = 295/725 (40.69%), Query Frame = 1
Query:  844 PKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFD---GDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKH---SDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSS-TQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYT-LQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDL--GDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNV 2988
            P +    I   + E+  I T +T   A D D    N+   Y I  QS    FK+        E   +      DRE+ +  S+K++A D    + + L     + I + D+ND  P F   ++  ++ E+ P    +  + A D D      + +     +      +F ++  TG +   G +DYE   +YT+ +  TD      +      + V +VNDN PE +     G+              ++ENK  G  V  ++  D+D  S     ++ + +   ++  + S++     S LI     +T  + DRE+   YF  +           +S +  I++ D NDNPP F  P      + +  + E  +    I  +   D D GNN  + YS+ S ++   F+I   +GEL      D E    ++L++ A      +  +   YT    IT+ IED ND  PVF++ LY+ T+ E                   +   ++   + ++  D   S+ + +YT SN     Y     TG+++ +    +      ++F   A D+ + P  +   V+I+I D N++ P +       YEV++    +    +  + A D D     NGKVTYR+            ++SK            N   +F ++ +TG++  +        G   +++ A D G+PP +    + I I N+
Sbjct: 1328 PTFDKNPIITWIYENVPINTNVTTIKAHD-DDSGLNSRIWYTIDSQSPRAHFKINS------ETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLTYVM-EDEPFNFQVTSITALDPDTGQGGNVEYR----IVSPDTGKFSLDLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGT--------------VSENKPTGTSVVKVTAYDRDSGSNA---ELTYSIPSGVEMDKFSID---KHSGLI-----VTNSILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISP------VVTLKVPEN-SPARLIYTLTVQDLDYGNNTKVLYSIMSGNTDGAFTIGRSTGELSTTTKLDRETKASYQLSVQA------KDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISE------------------LTPPGTSILNLTASDKD-SGSNGNIVYTLSNDTYGVYSIDSRTGIVY-SAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQF---TKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRL------------DDSK------------NSTSLFVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNI 1955          

HSP 12 Score: 92.4337 bits (228), Expect = 1.131e-18
Identity = 147/655 (22.44%), Postives = 259/655 (39.54%), Query Frame = 1
Query:  871 LSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKD-FDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSP--ILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQAT---LTIEVKNVNDNNPEISVLYLSGSNFKTPGRS---------------SQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNH--------LLDCRIDPHRESLELRRS-QSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSY--SIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIV 2739
            +S+PE+SK+G+ IT   A          +   +++Y S+  G K +    D +  +  + + D  D E      + L A       L+G + ++I++ D ND  P F  +++   + E+     P  ++++ A D D     K+ +      +  V   F I+  TGEI TA  +D E  + + + +  TD     ++T   + + V ++NDN P    L  S  N +   R+               S+    L     PG  +  +S +D+D  S     Q+ +         +D +ID     +  RR+   ++ D F  I  +  D+    Q                  V   I IT      P FE+P        SY   + E   +GT+++ V+ TD   G   + R S +  +S  F I   SG +      DYE   +F L ++A +     K  ++      + +N+ DVND  PVF +  Y     EG                      +    + +   D   +        S  D   +    +TG+I      LD E I +    ++A D    P+ +   V I++LD+NDNPP++  P  +  +V V     +   +  + A D D G N ++++ ++
Sbjct: 1970 VSIPENSKVGSYITTVRA--------RASSDAQVTY-SIISGNKGRAFYVDPFTGVISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGV---FTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPL--SEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNA---QIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQ---------------RALVYVRIIIT----REPKFELP--------SYFGKVPENAMMGTSVLTVRVTDNAAGL-PLGRISYNIENSNYFRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRV-----PVYINVSDVNDEKPVFGQSGYMAQWSEG------------------IPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGSFAIDRKTGVIRTQ-RALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPN--DVQVLENLPLNSRLYEINATDRDSGANARLSFTVI 2553          

HSP 13 Score: 92.0485 bits (227), Expect = 1.545e-18
Identity = 165/684 (24.12%), Postives = 269/684 (39.33%), Query Frame = 1
Query: 1060 FDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKI-INENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNR-FYINPLTG--EILTAGYIDYEIKSEYTIPVIVT-DGKHS--DQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKD---PGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPF------------------------QGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQ--FSIDPISGELRNIDVFDYEKMEKF-ELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGE-TGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            F    Q   ++ + A D    PL G   + I + +I D  P F   +  ++ I EN  + S I  + A+   ++       +   S+    + R FY++P TG   + +A  +DYE    + + ++ T  G  S      L I V + NDN+P                  S   A LAE+     P FVV    V+  D +S       N  +   I    E+       +      ++ T K+ DRE T+ +   +   DS     ST+   ++ +TD+NDNPP+F+ P                         + SR   +Y++K     G  I++V ATD+D G+NA I+YS    +S Q  + ID  +G +      D    + F ++ + A +  +  + + L+Y   +I +  E      P FE   Y   V E       V                   ++  N   +     S    NSN     YFRIG+ +G+I VN P LD E    F   + A D +         V I + DVND  P++       Y    S    +G  + N+ A D D G NG+V + I                     +S D K +    F +D  TG I   + +    + +  + V A+D+G+PP      + I +++++ N
Sbjct: 1920 FSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSYITTVRARASSDA-------QVTYSIISGNKGRAFYVDPFTGVISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAF--------------HPSNMLAQLAEDTGAFKPRFVV---KVTATDVDSG-----TNGKVTYSIWTGNEAGVFTIDSTT----GEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFD-PLSEVNIREDTRTGAVVTSVVATDTDKESR--LTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRA-LVYV--RIIITRE------PKFELPSYFGKVPENAMMGTSVLT----------------VRVTDNAAGLPLGRISYNIENSN-----YFRIGQRSGVISVNKP-LDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVF---GQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAI---------------------QSGDDKGS----FAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDN 2508          

HSP 14 Score: 83.5741 bits (205), Expect = 5.098e-16
Identity = 97/404 (24.01%), Postives = 164/404 (40.59%), Query Frame = 1
Query: 1066 REKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDES-DQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYS-LDSLSSTQFSIDPISGELRNIDVFDYE--KMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTV 2265
            R + + + + ++A D    P    + + I +T    ++P F+  S    + EN  + + +L +   D        ++ +  +NS      N F I   +G I     +DYE K  + + V   D     +        NV+D N E  V   SG           Y A  +E    G +V ++S +DKD      G         +    + S  + R    +       T +  D E    +   +   D  S  + T V+  I + D+NDNPP+F VP     G +   + E + + + + ++ ATDRD G NA + ++ +       F ID  SG L     FDYE   + ++ LTI A++       +  L +   I VN+ D ++  P F +  Y F V
Sbjct: 2268 RIRDSFIQIPVQAMDQGVPPQRALVYVRIIIT----REPKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIENS------NYFRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSG-----------YMAQWSEGIPVGTIVVNVSAADKDS-----GANGRVWFAIQSGDDKGSFAIDRKTGVIR------TQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVP-----GPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATD-----AGNPPLSSNITIIVNVADEDEYDPSFNRMDYKFDV 2629          

HSP 15 Score: 74.7146 bits (182), Expect = 3.131e-13
Identity = 94/355 (26.48%), Postives = 151/355 (42.54%), Query Frame = 1
Query: 1747 LITTK-MFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFE-------VPFQ----------------GSRGIHSYSIKEG-VAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINAS---NPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADR-SEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKV 2724
            +ITTK + DRE+ S Y   ++ F +   S     T  + + D+NDN P F        V F+                GS    SY+I  G V     ++  + TD D+  + ++  S                   +I V D E+++ + L I+AS   NP     N   L    ++++ +ED ND  P F    Y+ T+ E                       ++  ++ ++  DI  +++ Q    ++SD    F I  T  + VN   LD E   S+   ++A D+ S   LSS+AIV+I++LDVNDN P+     T      V+    IG  +A +  +D D G NG+V
Sbjct:   13 VITTKTVLDREKVSAYNLTIVEFSTPPKSY----TVLVYVQDLNDNSPSFVRGTSAKLVVFENDKDFRQKLIAVDSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDGDLYADLVVNAS-------------------SIGV-DRERLDSYVLNISASDGGNP----ANHGFL----RLSITVEDTNDNKPEFSNVSYSGTIPEN------------------IDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAIFGIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEV 317          

HSP 16 Score: 73.559 bits (179), Expect = 6.627e-13
Identity = 98/424 (23.11%), Postives = 184/424 (43.40%), Query Frame = 1
Query:  844 PKWSSPHIYLSLPEHSKIGTEI-TLPLAMDPDQPPTNTTQKYKISYQSVNDG-FKL-KHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGK----HSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSK---LIDHFQ--LITTKMFDREETS--QYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISG 2073
            PK+  P  +  +PE++ +GT + T+ +  +    P       +ISY   N   F++ + SG        + VNK  D E +    + + A D        ++ + I+++D+ND++P F ++      +E IP+ + ++ + A D+D     ++ F   +  D   +  F I+  TG I T   +D+E    + + V  TD      H+D  ++TI V ++NDN P           F+ PG +      + EN      +  ++ +D+D  +                  R S  +     +   LID F   L T   FD E T+  QY   +   D+ +  LS+++T  +++ D ++  P F      +R  + + +     IG  + QV ATDRD G+   + +   + +S    ++  +G
Sbjct: 2302 PKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLG-----RISYNIENSNYFRIGQRSG-------VISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDD---KGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTD-VSVTIRVLDLNDNPPV----------FRVPGPND---VQVLENLPLNSRLYEINATDRDSGANA----------------RLSFTVIGGTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSF------NRMDYKFDVPGNAKIGDFVGQVTATDRDSGDQGRVFFVFYNPTSNALKMNATTG 2674          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO35412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK9])

HSP 1 Score: 162.155 bits (409), Expect = 4.530e-40
Identity = 191/713 (26.79%), Postives = 295/713 (41.37%), Query Frame = 1
Query:  883 EHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTD---GKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQL-------ITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYS-LDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVN--DCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGET-GLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINI 2979
            E+S I T I   L  D D   TN+  + KI+       FK++  G  ++ +L     K  DRE     ++ L   D      S    + I +TD+ND  P F   +    I+E     S +LQL A D DE D   + +      D      F ++  +G + TA  +D E  S  TI +   D      +   T+T+ + + NDN P                  S Y+  ++E    G  V  +S +D D                  D  R + E+  S +++   F+L        T    DRE  S Y   ++  D     L +SV  E++I+D+NDN P+F  P +     +  SI E    G  ++QV ATD D G NA+I Y  +   ++  FSID  +G +  +   D+E  E F L       II  K+    Y  +   VN+  +N  D LPVF  ++Y FTV E   K   VG+V                          D + S  Y   + D +  F +  T G+I +N   +DRE+ + +   + A   + KPLS+ A V I++LD NDN P +   +T +  V++     +G  + N  A D D G NG V Y++                            N   +  ++ ++G I +A+K+   D     + V ASD G+PPQ     +HI +
Sbjct:  330 ENSLINTNIAYILVTDKDSN-TNSQTELKITNGDDEGCFKVEFLGF-YFIQL----QKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGND---LGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRF--------------MKSSYKGTISEGASIGATVLQVSATDVDSG----------------DNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVF-YPVE-----YFASIMENEPPG-KLLQVTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVISTLASLDHEVEEFFSL-------IISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTK---------------------DKNGSISYAIVSGDPTNLFLVDSTGGIIKINGD-MDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQF---STSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTS--------------------------NAEGLLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHITL 938          

HSP 2 Score: 150.984 bits (380), Expect = 1.518e-36
Identity = 186/692 (26.88%), Postives = 292/692 (42.20%), Query Frame = 1
Query:  844 PKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDG---KHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSST-QFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQ--MYTNSNSDA--SQYFRIG-ETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDL-----DGSTGNIYIAQ 2877
            P++ + +  L + E   + T   +  A DPD    N T  Y I+       F L  +       L +I  K  DRE      + + A D     L G   INI++ D ND  P F + S    I EN      IL++ A D D      +++  D    ++  + F ++  TG I T   +D+E+K+ YT  VI +DG     +D AT+TI V + NDN+P++ + YL   N          +A  +EN      +A + V+DKD       +  N   + +I    +    +    + +  + +   K  DRE    Y   L   D    S ST     I +TDVNDN P F      +   ++ +I E    G+ ++Q+ ATD D G+N  + YS+   +    F +D  SG +      D E++    +TI A +     K          +TV I D ND  P F K  Y  T+ EG S                         ++       DS D+    Y  S+SDA  +  F +  +TG++      LDRE  S +SF + A D  +  L S+  V++ I D+NDN P++ +P    Y  ++   E  G  +  + A D D G N  ++Y I+  +   +F+ +  +  +    S D +    E F L     DG  GN Y A+
Sbjct:   93 PRFPTLYYTLRIRESMDVNTTNPINTATDPDAG-NNGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQS-NSIFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGD--------KAIRSENSLINTNIAYILVTDKD-------SNTNSQTELKITNGDDEGCFKV---EFLGFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAF------TSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGS-----TTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGA---------------------TVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQ-LDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVF-YP--VEYFASIMENEPPGKLL-QVTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVISTLASLDHEV--EEFFSLIISAKDG--GNKYAAK 723          

HSP 3 Score: 129.798 bits (325), Expect = 3.555e-30
Identity = 161/658 (24.47%), Postives = 273/658 (41.49%), Query Frame = 1
Query: 1048 VNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTD-GKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQ-SKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQK-----ITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNG 3000
            +N D DRE++A   + + A  G   PLS Q  +NI + D ND  P F  +S+   I+    +   +    A D D      +R++  ++ +       +IN  +G I  A  +    +++YT+ V+ +D G     +T+TI +    ++ P+ ++         +   S Q+   +A ++D G        + + + S   GN+        I P  + L +R+S    L   + LI                +   D    S S SV   I I D ND+  +F            +++ E  + GT +  + A   D      I YSL S S + F++D  SG++      D E++ K       SN  I +  +    T  K     + V + D+ND  PVF + +Y  TV E                   S   S  F+I +   D  D++       S +   ++F    TG +H++   LDRE  SS++  ++A D S   L STA ++I + D ND  P  VFP + +Y VN++    IG  + NL A+D D+G NG + Y I                            N   MFD++ +TG + +A+ +        ++ + A D G  P      + +N+++V+ N 
Sbjct:  798 INGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAE----GLLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHITLSINHPPKFTLSSYVTHVLASQPLSYQFFYVVAVDQDSG-------KNGQLFYSIPQGNEEGLF---GIFPGGK-LYIRKSLLQALKGSYDLI----------------VRATDGGVPSFSASVPVTIYIQDSNDHRSLF------VNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLIS-SESHFAVDVRSGQITTRVRLDREELIKN----TGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSE------------------LSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTGELHLS-KTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRP--VFPES-DYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSIS-------------------------NGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNA 1366          

HSP 4 Score: 117.472 bits (293), Expect = 2.452e-26
Identity = 201/855 (23.51%), Postives = 355/855 (41.52%), Query Frame = 1
Query:  496 HFKVVEESPTNSVIGNIHNQALKQKGGVGSGDYYYKSITDIEPFFLDSKTYEFRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDG---KHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQL------ITTKM-FDREE------TSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSST-QFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRI-GETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNGHG 3006
            +F V E  P  +++G ++     + G +    Y   S      F +DS     +++  +DREE  ++ +  I +             +G  K  ++ ++     VN+E++D NDN+P++S+  + + +     +G  +    A+D D    N   +Y+++  +  +G    +S     +    + + D   E Q TV V L +  G P P    + I+I+L+ IN   P F  +S    +  + PL      + A D+D     +L +      +E +   F I P  G++     +   +K  Y + V  TDG     S    +TI +++ ND+      L+++ +          +R  +AEN  PG +V +L               + H LD     H  + ++  S      HF +      ITT++  DREE      ++ Y  Q     +D+          +++TD+NDN P+F      SR +++ ++ E    G+ + ++KA D D G+NA   YSL S +   +F I+  +GEL      D E    + L + A+    +  N+ L Y+  KI + + D ND  PVF +  YT  + E                   +   S    + ++  DI  +   + Y+ SN + +  F +   TG + V    LD E    +   I A D    PLSST  V + +LDVNDN PL  FP T    + V      G+ +    A+D D G N  + + +   +   +F+ N  S   E+T  + I                         +   S ++ V A+DQG+P     + + + + + + N  G
Sbjct:  747 NFTVYENVPKGTLVGRVYATTKDKNGSI---SYAIVSGDPTNLFLVDSTGGIIKINGDMDREEKAQYLLAVIAR-------------VGTVKPLSAQAT-----VNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGK-NGLVRYQLTSNA--EGLLWINSTSGVIKLARKLTDGD---ETQYTVQV-LASDSGSP-PQHSTMTIHITLS-IN-HPPKFTLSSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQGNEEGL---FGIFP-GGKLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRS----LFVNNT----------FRFAVAENSSPGTLVGTL---------------VAHALD-----HSRTKDIVYSLISSESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVF------SRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTGELHLSKTLDRETTSSYNLVVKAT----DASNANL-YSTAKIEITVGDSNDQRPVFPESDYTVNITE------------------DALIGSLVINLNASDKDIGQNGLIK-YSISNGNLAAMFDVESATGRLIV-AKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPL--FP-TQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSVN--SATCEITTIAAIDLETMP-------------------AGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPG 1477          

HSP 5 Score: 114.39 bits (285), Expect = 1.933e-25
Identity = 139/612 (22.71%), Postives = 250/612 (40.85%), Query Frame = 1
Query: 1042 LIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYE--IKSEYT-IPVIVTDGKHSD------QATLTIEVKNVNDNNPEIS--VLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKD----YESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLS-STQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQY-------FRIGETGLIHVNVPVLDREKI----SSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEV 2796
            L + K   +  + +  + ++A DG     S  + + I + D ND +  F   +    + EN    + +  L A   D S    + +   +S      + F ++  +G+I T   +D E  IK+  + + ++  +  ++D      +A + + V ++NDN P  S  V  ++ S    PG              P F + ++   + D    + S   G  M+      I+     L L               +K  DRE TS Y   +   D+ + +L ++   EI++ D ND  P+F          ++ +I E   IG+ ++ + A+D+DIG N +I+YS+ + + +  F ++  +G L      D+E  + +ELTI A +  +   +S +      +TVN+ DVND  P+F     T TV+E                      N+ +      P     +SD    TN++   S Y       F +         +  +D E +     SF   + A D+    LS+   + +Q+ D NDN P +V P         +        +  + A DPD   NGKVTY I+  +  + FN +  +  L++
Sbjct: 1002 LYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISS-----ESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGS-------------PVFRIKAMDADEGDNAKFFYSLVSGTGMDKFF---INSSTGELHL---------------SKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFP------ESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTV-----NVTVNVLDVNDNAPLFPTQPVTLTVRE--------------------NVNTGF------PVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPP--------AAAAGSSLNVMTITAEDPDRNSNGKVTYSIISGNNGY-FNLHPSTGQLQM 1531          

HSP 6 Score: 107.457 bits (267), Expect = 2.504e-23
Identity = 167/717 (23.29%), Postives = 297/717 (41.42%), Query Frame = 1
Query:  841 SPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLT-----IEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRL-------GNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLST-SVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQ-FSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIE--DVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTP 2943
            SP ++S     ++ E ++ G+ +    A DPD+    T     +SY S+  G  L     D    L +   K  DRE+ ++V++ + A D    P +G   + +++ D ND +P F K+S    I+E   + + +LQ+ A D D  D  ++ +E  +S D  V   F +N  TG + T   +D E KS Y+  V+  D  H D   ++     + + ++NDN P   V Y             +Y A + EN+ PG ++  ++ +D D  +  +       GN   +     ID     +    S    +DH            E  ++F+ +I      N  +  +    +++ +  DN P+F         ++++++ E V  GT + +V AT +D   N  I Y++ S   T  F +D   G ++     D E+  ++ L + A    ++  ++Q        TVNIE  D ND  P F        + +G      V       D  + K     +++ SN   +       ++ NS S           G+I +   + D ++ + ++ ++ A+D    P  ST  + I  L +N +PP +      +Y  +V   + + Y    + A D D G NG++ Y I P         NEE                  +F +    G +YI + +  +  GS  + V A+D G P
Sbjct:  422 SPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGT-----VSY-SITGGNDLGWFQVDFQSGL-VTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSS-DAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKD--HGDPQLMSSVKVELTISDINDNAP---VFY-----------PVEYFASIMENEPPGKLL-QVTATDADEGTNAVISYDIIGGNNNGNF---SIDSSTGVISTLAS----LDH------------EVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYE------MYNFTVYENVPKGTLVGRVYATTKD--KNGSISYAIVSGDPTNLFLVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQA-------TVNIEVLDRNDNAPQFSTSSVIVDI-DGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAEGL-------LWINSTS-----------GVIKLARKLTDGDE-TQYTVQVLASDSGSPPQHSTMTIHIT-LSIN-HPPKFTL---SSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSI-PQG-------NEEG-----------------LFGI-FPGGKLYIRKSLLQALKGSYDLIVRATDGGVP 1028          

HSP 7 Score: 105.145 bits (261), Expect = 1.197e-22
Identity = 144/661 (21.79%), Postives = 262/661 (39.64%), Query Frame = 1
Query: 1060 FDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEF---DNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTD-GKHS--DQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKM-FDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEV----PFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQ-FSIDPISGELRNIDV-FDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIG-ETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNG 3000
             DRE    +S++L+  +    P+S Q+ ++    DIND +P F        I E++ + +      A D D  +   + +     DN+   ++         T  ++T   +D E    Y + +  TD G  +      + I + + ND+ P  +               + Y   +AEN  PG  +  +S +D+D  S      + + +D          +L  S         +I TK   D E  + Y   +I  D    S +   T  I++ D NDN P  ++    P  G + I S    E   I T I  +  TD+D   N+     + +      F ++ +      +    D E +  + LT+N ++  +  ++     TL  + +++ DVND  P F  + YT  + E                      N +Y   ++        + +  Y+ +  +   +F++  ++GL+    P LDRE++SS +  I A D    P + +  V + I+D NDN P ++     +Y+  +S   +IG  +  + A D D GDNG++TY I                      SSD + N   +F+L+  TG ++   ++           V A D G P      ++ + I +++ N 
Sbjct:   57 IDRETTTQISLQLRTLNPSNQPISVQVQVD----DINDNEPRFPTLYYTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFT--------------QNSYLGSIAENTKPGVSILRVSAADRDSGSN---GDIKYAIDWDAIQSNSIFDLDSSTG-------VIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRS----ENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKVEFLGFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRS-----TLGFVLIDVTDVNDNSPAFTSNAYTANISE-------------------LAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSGLVTTAKP-LDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFM---KSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEI---------------------SSSDAQVNG--LFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNA 634          

HSP 8 Score: 87.4261 bits (215), Expect = 3.131e-17
Identity = 164/714 (22.97%), Postives = 282/714 (39.50%), Query Frame = 1
Query:  496 HFKVVEESPTNSVIGNIHNQALKQKGGVGSGDYYYKSITDIEPFFLDSKTYEFRVSKRVDREEICRFQMQN--IMQNCRM----TYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGK---HSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREE--TSQYFAQLICFDSDSNS--LSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKI-SSFSFKIQAADR-SEKPLSSTAIVQIQILDVN 2592
             F V E S   +++G +   AL       + D  Y  I+    F +D ++ +     R+DREE+ +    N  IMQ   M    T K  ++ +I                  V + D+NDN+P +S     +++ E S  G+ +    AMD D+   N    Y +   +  D F +  S  +      L ++K  DRE  ++ ++ +KA D     L     I I++ D ND++P F ++     I E+  + S ++ L A D+D      +++   N     +   F +   TG ++ A  +D+E    Y + +   D      S    +T+ V +VNDN P           F T   +   R    EN + GF V   + SD+D      G   +           ++  +  +        ++ T    D E     +   QL+   +D  S  LST  +  + +TD NDN P F  P   + G               ++ + A D D  +N  + YS+ S ++  F++ P +G+L+ I     +    ++LTI AS+     + +Q + ++ K     E      P F    Y  +V E       V  V+      S   N  Y                  Y  S+S    +  +  TG++     + DRE + +SF+  + A D+      +S+A V I + DVN
Sbjct: 1056 RFAVAENSSPGTLVGTLVAHALDHSR---TKDIVYSLISSESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVI------------------VTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGD-NAKFFYSLVSGTGMDKFFINSSTGE------LHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNG---NLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPL----------FPTQPVTLTVR----ENVNTGFPVGRCTASDRD-----TGTNAHIAFSMYSQTPSKTFSVNSATC------EITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPPAAAAGSS-----------LNVMTITAEDPDRNSNGKVTYSIISGNNGYFNLHPSTGQLQMIHQIP-DNPTIYQLTIQASDGGQPSRQTQTVVSVFK-----EGPIGGGPTFSSADYQGSVTENKVAGTSVVTVLAAYPQSSLNGNIEY------------------YLTSDSSKGGFEVVKSTGVVKTTRGI-DREGMGASFNLVVYAVDKQGPSARTSSATVTITVQDVN 1677          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO39230 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAP5])

HSP 1 Score: 160.229 bits (404), Expect = 2.549e-39
Identity = 158/575 (27.48%), Postives = 259/575 (45.04%), Query Frame = 1
Query: 1060 FDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLIT-TKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEV-PFQGSRGIHSYSIKEGVAIGTTIVQVKATDRD---IGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKM-EKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSS--TAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGY--CIANLKANDPDLGDNGKVTYRIVPSSFP 2754
             DRE      V++ A DG  N  S  L   I++ D ND+ P F   S    + E+ P+ + +L + A D D  +  K+ + F +  D   +     +P+ GE++  G +D+E KS YT+ V  TDGK SD A +T+ +++VND  P  S              S  Y + + EN  PG  V  ++ SD D  +      ++  LD R   + +   +R S    +    + T +K  DREE+      +I  D    +        +++TDVNDN P F   P+ G        ++E    GT+++ ++A D D    G NA + Y L   +  +FSIDP+SG ++    FD E+   KF++ + A+    +  N +L  ++  I +++ D ND  P F +  Y  +V E                        +  ++ +   D+  +++ +      +D   ++     G + V+  +LD EK   ++  +  ADR   PL    TA V I+ILD NDN P ++ P  +    N S  E +G    +  + A D D G NG  T+ I P S P
Sbjct: 2633 LDREVTPKYDVEVTAKDG-VNKESAIL--YITVVDQNDQPPVFAPKSYAISVPEDSPIGTSVLDIYATDADVGENAKITY-FISKGDPEGKFSIVTSPVKGELVVNGKLDFETKSSYTLEVTATDGKFSDTAVVTVTIQDVNDLPPVFS--------------SPLYESRIQENTGPGAGVVMVTASDIDSPT------ISFSLDDRGKDYFQITPIRASGPGNVWVGDIRTGSKQLDREESPVKVFTVIANDGKHTA---QAEIRVNLTDVNDNAPRFPASPYIG-------YVEENKPSGTSVMYIQAVDDDDPLAGGNAKLSYELTDSAGDKFSIDPLSGLIKTKVTFDREQTPNKFKVRVKAT----DAGNPRLSASVDGI-IHVSDANDHKPKFTEKFYRGSVAENAPP------------------GYSVLRVTATDEDVGPNAEFEFVVVQGNDPHAFYIDPFNGTVLVS-GILDYEKKKEYTITLTVADRGMPPLQGDETAYVVIEILDANDNAPEFI-PKIY----NASVLEDVGARQPVLTVTAVDKDSGPNGNFTFAIDPRSDP 3144          

HSP 2 Score: 141.354 bits (355), Expect = 1.513e-33
Identity = 200/745 (26.85%), Postives = 312/745 (41.88%), Query Frame = 1
Query:  844 PKWSSPHIY-LSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPL---------TGEILTAG-YIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQ------LITTKM-FDREETSQYF-AQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQ-FSIDPISGELRNIDVFDYEKMEKFELTIN-ASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKII---SNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFP-NTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQ-GTPPQKKIERLHINIVNVDGNG 3000
            P   +P  Y +S+PE S IGT +    A D D       +  KI+Y       + K S      K  L+VN   D E +++ ++++ A DG     S    + +++ D+ND  P F        I EN    + ++ + A D    D   + F    S+D+  ++ F I P+          G+I T    +D E        VI  DGKH+ QA + + + +VNDN P                 +S Y  Y+ ENK  G  V  +   D D +    GN             + S EL  S     D F       LI TK+ FDRE+T   F  ++   D+ +  LS SV   I ++D ND+ P F   F   RG    S+ E    G ++++V ATD D+G NA   + +   +    F IDP +G +    + DYEK +++ +T+  A   +   +  +  Y    + + I D ND  P F   +Y  +V E          + V   D  S  N N+   I   S+P D +      +  N N+           G+I   VP LD+EK  SF  K+ A D     L     V+I ++DVNDN P +V P      +  VS ++     +  LKA DPD     +V   I  S +  +   N +   + VT  S +  + + +FD + +                  KI +EA D  G  PQK    +++++++V+ N 
Sbjct: 2669 PPVFAPKSYAISVPEDSPIGTSVLDIYATDAD-----VGENAKITYFISKGDPEGKFSIVTSPVKGELVVNGKLDFETKSSYTLEVTATDGK---FSDTAVVTVTIQDVNDLPPVFSSPLYESRIQENTGPGAGVVMVTASD---IDSPTISF----SLDDRGKDYFQITPIRASGPGNVWVGDIRTGSKQLDREESPVKVFTVIANDGKHTAQAEIRVNLTDVNDNAPRFP--------------ASPYIGYVEENKPSGTSVMYIQAVDDD-DPLAGGNA------------KLSYELTDSAG---DKFSIDPLSGLIKTKVTFDREQTPNKFKVRVKATDAGNPRLSASVDGIIHVSDANDHKPKFTEKFY--RG----SVAENAPPGYSVLRVTATDEDVGPNAEFEFVVVQGNDPHAFYIDPFNGTVLVSGILDYEKKKEYTITLTVADRGMPPLQGDETAY----VVIEILDANDNAPEFIPKIYNASVLE--DVGARQPVLTVTAVDKDSGPNGNFTFAIDPRSDPDDAF-----TIEPNPNN--------ASIGIIRTRVP-LDQEKTPSFHLKVTATDAGG--LQGEGEVRINVIDVNDNGPWFVPPFFVGQIKEGVSARQ----FVTKLKAYDPDAFVKDQV---ITFSIYNGTVGENFKLDPVSVTNES-VDLHSYGVFDREAAP---------------VWKIGIEAVDNVGPKPQKNFTYVYVDVLDVNDNA 3317          

HSP 3 Score: 114.005 bits (284), Expect = 3.362e-25
Identity = 164/664 (24.70%), Postives = 273/664 (41.11%), Query Frame = 1
Query:  844 PKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNK--DFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDED-----ESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTD-GKHSDQAT--LTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSL-DSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTV-KEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNV-PV-LDREKISSFSFKIQAAD-------RSEKPLSSTAIVQIQILDVNDNPP-----LWVFPNTHNYEVN--VSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSF 2751
            P++S    +  + E +K  + + + LA    +  +     YKI   +V D F     GR       +++N   DF+R+ Q   ++K+KA +  P+ L   +D+ I + + ND  P+F +      I E+  +   + ++ AKD D           L +  + S ++    +FYI+P TG+I  +  +DYE +  + + V  TD GK S Q    + + + NVNDN P                  S Y   +AE    G  +A +   D D      G+ + +           +L+    QS       +IT         +QY  Q++  DS   + + SVTF ++  D N+N P F           + SI+E     T I Q+ ATD D G N  I YS+ D+ S T FSI+P +G +R++   D E  + +   I A +   ++  S+ L     +T+N+EDVND  P F    Y  +V    P+                    SN   + +   D    S++++       A   FR+  +G++  N  P  L  E       ++ A D       +  KP   T   QI+IL  N+ PP     ++      N E    V+   A     A +   + D     K+ +R+ P  +
Sbjct: 1936 PRFSKVSYHFMVSEDAKYLSLVGIILA----RSISGARLDYKIVSGNVGDKFIAMGDGR-------ILLNSLLDFERD-QTQYNLKVKATEQIPDGLDSTVDVKIDVINANDHFPYFDQQLYSVQIPESTAVGVLVQEVTAKDCDCLSSCTCSPGFLTYSIEPSKEQG--GKFYIDPATGKISVSVALDYEDQRYHLLKVYATDKGKKSFQGLCFVNVTLTNVNDNRPTF--------------LKSAYEFRVAEGAATGESLAIVVAVDAD------GDAVTY------SKAGGALQFSVDQST-----GVITLNSALDPNKNQYTLQVMAKDSGGLTSTVSVTFNVA--DANNNVPQFT-------NCGTVSIRENDPRDTKITQLTATDADRGQNGQITYSIEDASSQTLFSIEPRTGVVRSLTSLDRENKDSYNAIIKAEDGSSKQDESERLLWYCYLTINVEDVNDNRPYFLAAKYFGSVFSSAPN-------------------GSNILTVQATDAD--SGSNAKIKYALLDSAGGLFRLDSSGILRTNTNPARLQLETGKKLLLEVSAKDVESIAGTQPGKPTKYTT--QIEILVSNEEPPKFSQQVYTASINENMETGSTVTRITATSSTGAEISYENVDTNPRAKILFRVQPDGY 2522          

HSP 4 Score: 87.4261 bits (215), Expect = 3.622e-17
Identity = 148/633 (23.38%), Postives = 252/633 (39.81%), Query Frame = 1
Query: 1048 VNKDFDREKQATVSVKLKAFDGDPNPLSGQLD---INISLTDINDKQPHFKKTSIHKIINENIPLRSPIL-QLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDG----KHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVE 2922
            V K  DREK A  ++ ++        L   +D   + ++LTDIND  PHF      + I E +   + IL  + A D D     K+ +   + V       F I+  TG+I T   +DYE    +T+ +   D     + S  A + I+V + NDN+P  +  +              YRA ++     G  V  L V   D +S + G     ++        E+  +      L+D  + +TT   D+     +  ++   D +++  S SVT EI++  + D PP+F V       +  Y +KEGV     +  VKA   +    A+    L    +  F I+P +G L      DYE+  ++EL I A     + ++   +  L  I VNI   ND  P F        + +G      +G     D            ++I+     +D    ++      D    F+I   G++    P+ D  KI  + F ++A D  E P  +   V++  +           P+  +  VNV      G  IA ++   P    NG V+  ++P    FS   N +   L   +    +F+R  + +  G+  N    + + L    ++ IW+E
Sbjct: 1275 VAKSLDREKVAGYTLGMRV------TLGQHVDDTTVYVNLTDINDDAPHFTSAIYRRSIKEGLAEDTEILPPVIAVDHDFGSNGKILYSILSGVHPDWDKYFNIDSATGKITTKMTLDYETHKSHTLFIRAEDNGSPKRLSGIAQVDIDVIDRNDNSPVFAAAF--------------YRAKISLGAVKGTSV--LQVHATDLDSGQNGQITYSIIQGN---EEEAFTINEQGVILVD--KSLTTVAADK-----FSLKVEARDKNASPRSGSVTVEINVY-LPDGPPMFVV-----SPVTVY-VKEGVPANHRVAGVKAATSE----ALTYTLLSGNEAGMFRINPSTGSLDATRELDYEERRRYELKIEAR----DTRDRSAMVELIIIVVNI---NDNKPTF------VDIVDGQIDRKAIGTCSPTDIAEG--------EVITR-LGAFDRDGDEITFIVPDDVKDLFKIDSRGVVTAKKPIEDLPKI--YPFNVKALDNGEPPQETDVKVRLVFVHYR--------PDQKHVRVNVREDTPTGSVIATVRRYFP----NGIVSL-LLPEKANFSVRANGDVILLTPLDYESQQFHRMTVREELGNQTNDVDVEVVVLDVNDNRPIWME 1827          

HSP 5 Score: 84.7297 bits (208), Expect = 2.848e-16
Identity = 132/564 (23.40%), Postives = 231/564 (40.96%), Query Frame = 1
Query: 1090 VKLKAFDGDPNPLSG--QLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDE-----SDQHKLRFEFDNSVDETVRNRFYINPLTGEILTA-GYIDYEIKSEYTIPVIVTDGK---HSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFE-VPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKE--GPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIV 2739
            + + A D  P  LS   QL I I   D N   P F        I+EN+   S +  + A D D      S   K+ +     V  T    F ++  TGE+  A   +D E  S+YT+ V  +D      S +  L I + + +DN P  S                 Y A + EN+  G  V  +   D D         +   +  +I+P    +                T+K  D+ E S    Q+I   S + S +      I++    + PP+F+  P+       S  + E +     +  + A D     +  ++Y+L   +   F +D  SG L   + F+YE ++++ L I A    ++   S  L      TV + +  D LP F  D Y  TV E   P   +  G +++  D  S +++ +  + I++ H +Y+   +Q           + R+   G        LD    S ++F ++A DR+ + + +TA V++ ++DVND+ P ++     +Y ++V      G  +  ++A D D+G N +V Y ++
Sbjct:  444 LTVTATDQGPGSLSATTQLLIEIQDVDENKNSPRFDPQQAILEISENLKQNSLVTTVSATDSDSVGNPSSPDGKVVYSI---VGGTGLGVFRVDSNTGEVKVAVPSLDREGTSQYTLVVKASDNATFPRSSRLFLMINLLDEDDNFPYFS--------------QPIYIAQVPENQPSGTFVTVVVGRDADEGFNPSYTVITPGVPYKIEPSTGVIR---------------TSKSLDQSELSTRELQVIVRVSTAGSKTADGQVNITVISKVNRPPVFKNTPY-------SVKVPEEMGPLPNLFCIAAVDS---LSRPVQYTLAPGADGLFEVDKDSGRLHTKNSFNYENVDRYNLRIEARTSSVQEVASASL------TVEVTEEKD-LPKFSSDSYQLTVDESAAPGTTLAPGLLIIDSDTSSDQFDCS-MEAITSLHTLYNFEVTQQ------SGRCFLRVQAGGK-------LDAHLASKYTFNVRATDRNFRNMFATAQVEVNVIDVNDHKPEFL---QESYWLSVPSSTPAGSSLVTVQAEDMDIGTNAQVRYELL 941          

HSP 6 Score: 82.0333 bits (201), Expect = 1.626e-15
Identity = 136/582 (23.37%), Postives = 232/582 (39.86%), Query Frame = 1
Query: 1060 FDREKQATVSVKLKAFDG-----DPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNS------VDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGET---GLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPD-------LGDNGKVTYRIVP 2742
             DRE + + +  +KA DG     +   L     + I++ D+ND +P+F        +  + P  S IL ++A D D     K+++   +S      +D +   R   NP   ++ T   +  E+ ++    +  T      + T  IE+   N+  P+ S                 Y A + EN + G  V  ++       +   G ++++     +D +  +  L R Q    D + +IT    D E  + Y  Q    D  +  L ++V   I+I DVND  P F +         +  + E     T ++ +KA D D G+    R + +   +  F ID  +G +      D E   K+++ + A + +   K S +LY      + + D ND  PVF    Y  +V E                   S   ++   I +   D+ +++    Y  S  D    F I  +   G + VN   LD E  SS++ ++ A D      S TA+V + I DVND PP++  P    YE  +      G  +  + A+D D       L D GK  ++I P
Sbjct: 2310 LDRENKDSYNAIIKAEDGSSKQDESERLLWYCYLTINVEDVNDNRPYFLAAKYFGSVFSSAPNGSNILTVQATDADSGSNAKIKYALLDSAGGLFRLDSSGILRTNTNPARLQLETGKKLLLEVSAKDVESIAGTQPGKPTKYTTQIEILVSNEEPPKFS--------------QQVYTASINENMETGSTVTRITA------TSSTGAEISYE---NVDTNPRAKILFRVQP---DGY-IITGDRPDYERGTTYNMQFAAKDKKT-LLYSTVKVVINIIDVNDVSPAFLLAIN----TRNARVLENKPAPTKVISMKAIDDD-GSEPHRRVTYEMKDNPNFQIDASTGMITTKTTLDREVTPKYDVEVTAKDGV--NKESAILY------ITVVDQNDQPPVFAPKSYAISVPE------------------DSPIGTSVLDIYATDADVGENA-KITYFISKGDPEGKFSIVTSPVKGELVVNGK-LDFETKSSYTLEVTATDGK---FSDTAVVTVTIQDVNDLPPVFSSP---LYESRIQENTGPGAGVVMVTASDIDSPTISFSLDDRGKDYFQITP 2824          

HSP 7 Score: 78.5666 bits (192), Expect = 2.014e-14
Identity = 153/677 (22.60%), Postives = 259/677 (38.26%), Query Frame = 1
Query:  844 PKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVK----LKAFD-GDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSP--ILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQA-------TLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRE---SLELRRSQSKLIDHFQLITTKMFDREET-----SQYFAQLICFDSDSNSLSTSVTFEISITDVND-NPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSL------DSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRI-GETGLIHVNVPVLDREKISSFSFKIQAADR-SEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEES 2781
            P++     +LS+P  +  G+ +    A D D   TN   +Y++  Q             ++ E+  L  N         T +V+    ++A D    NP S Q+ + +S+   ++    F K+S     N+N+P  S    L   AK         + +E      +     F I P TG++     +D+E KS + I V     K+S  A          + + +VNDN P                      A+   +K    V+ S S  D          Q+   LD       E    ++  RS S L  +  + T  +F   E      S Y   ++  D  ++       F +++  ++   PP F       +  +S  + E   +G T+  V+A       NA ++Y+       ++     F I  ++  L      D EK+  + L +  +  + +  +   +Y      VN+ D+ND  P F   +Y  ++KEG ++D  +   V+  D          + I+S  H  +D               +YF I   TG I   +  LD E   S +  I+A D  S K LS  A V I ++D NDN P++       Y   +S     G  +  + A D D G NG++TY I+  +   +F  NE+ 
Sbjct:  899 PEFLQESYWLSVPSSTPAGSSLVTVQAEDMDIG-TNAQVRYELLRQ-------------ENSERFILNDNNQLSTASTLTPNVRYQLLIRASDSATRNPSSAQVPVYVSVYSPSESPIVFDKSSY----NQNLPEDSSANTLVFTAKATRSGSSSGITYELVGGYKQIGEAMFSIKPDTGQVYLIKKLDFETKSYFPIAV---RAKYSGGAIELASEVVAKVTIVDVNDNGPRF--------------------AFHESSKT--VVIDSFSAKD---------TQLARALDADSGSLGEVTYGIDGGRSTSNLPFNINVKTGMIFATREILYTQGSSYIIIVVATDGATDGSQKIQKFTVNVQVLDTPRPPSF------PQKTYSAPVTETAGVGDTVTTVRAVYSK--PNAFLKYTFVSGNEDNTFCVNGFGIISVAKSL------DREKVAGYTLGMRVT--LGQHVDDTTVY------VNLTDINDDAPHFTSAIYRRSIKEGLAEDTEILPPVIAVDHDFGSNGKILYSILSGVHPDWD---------------KYFNIDSATGKITTKM-TLDYETHKSHTLFIRAEDNGSPKRLSGIAQVDIDVIDRNDNSPVFA---AAFYRAKISLGAVKGTSVLQVHATDLDSGQNGQITYSIIQGNEEEAFTINEQG 1482          

HSP 8 Score: 74.3294 bits (181), Expect = 3.671e-13
Identity = 99/413 (23.97%), Postives = 180/413 (43.58%), Query Frame = 1
Query: 1084 VSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTD----GKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKD--YESKRLGNQM--NHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDV--NDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRD-IGN----NAIIRYSLDSLSSTQ-FSIDPISGELR-NIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKE 2271
            + + ++  DG     SG  +I +++ D ND+ P F+ +   + I EN P+++ +L++ A D+D+     + +   N V+    + F I+ +TG I  A  +DY  + ++T+ +   D     + S +AT+ I ++  N     +        N K     S+Y   + E+  P   +  +  +D D    +KRL   +  N +    IDP    + L  S    +D+       ++D   T+         D    SLS +    I I DV  N N P F+ P Q         I E +   + +  V ATD D +GN    +  + YS+   +    F +D  +GE++  +   D E   ++ L + AS+     ++S+L      + +N+ D +D  P F + +Y   V E
Sbjct:  216 IMLTVQVTDGGNPSHSGTANIRVNVEDANDQTPVFESSQYRETIAENTPIQTSVLRVRATDKDDGTNGGIYYYMKNPVN----SYFTIDAITGVIRVAKTLDYNARDKHTLYISARDRGDPPRTSAEATVEISLRE-NIQGWPLPDSADPKENTKPYFPQSRYTFSIREDFPPKGALLVMRAADNDPIGPNKRLRYSLSGNGVSKFAIDPESGVVTLTDS----VDYENTPNNHVYDLTVTAT--------DQGPGSLSATTQLLIEIQDVDENKNSPRFD-PQQA-----ILEISENLKQNSLVTTVSATDSDSVGNPSSPDGKVVYSIVGGTGLGVFRVDSNTGEVKVAVPSLDREGTSQYTLVVKASDNATFPRSSRLF-----LMINLLDEDDNFPYFSQPIYIAQVPE 600          

HSP 9 Score: 72.4034 bits (176), Expect = 1.297e-12
Identity = 126/494 (25.51%), Postives = 201/494 (40.69%), Query Frame = 1
Query: 1414 IPVIVTDG---KHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKR-----LGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVP---------FQGSRGIHSYSIKEGVAIGTTIVQVKATDRD-IGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEK---FELTINASN--PIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQM-YTNSNSDASQYFRI-GETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPF----SFNTNEESKNLEVTESS 2808
            + V VTDG    HS  A + + V++ ND  P                 SSQYR  +AEN      V  +  +DKD  +       + N +N      ID     + +    +K +D+          R++ + Y +       D    S   T EIS+ +     P+ +           F  SR  +++SI+E       ++ ++A D D IG N  +RYSL     ++F+IDP SG +   D  DYE       ++LT+ A++  P      +QLL  +Q +     D N   P F+       + E   ++  V  V   D D            + NP     S D ++ Y+         FR+   TG + V VP LDRE  S ++  ++A+D +  P SS   + I +LD +DN P +  P    Y   V   +  G  +  +   D D G N   +Y ++    P+    S      SK+L+ +E S
Sbjct:  218 LTVQVTDGGNPSHSGTANIRVNVEDANDQTPVF--------------ESSQYRETIAENTPIQTSVLRVRATDKDDGTNGGIYYYMKNPVNSYF--TIDAITGVIRV----AKTLDYNA--------RDKHTLYISARD--RGDPPRTSAEATVEISLRENIQGWPLPDSADPKENTKPYFPQSR--YTFSIREDFPPKGALLVMRAADNDPIGPNKRLRYSLSGNGVSKFAIDPESGVVTLTDSVDYENTPNNHVYDLTVTATDQGPGSLSATTQLLIEIQDV-----DENKNSPRFDPQQAILEISENLKQNSLVTTVSATDSDS-----------VGNPS----SPDGKVVYSIVGGTGLGVFRVDSNTGEVKVAVPSLDREGTSQYTLVVKASDNATFPRSSRLFLMINLLDEDDNFPYFSQP---IYIAQVPENQPSGTFVTVVVGRDADEGFNP--SYTVITPGVPYKIEPSTGVIRTSKSLDQSELS 654          

HSP 10 Score: 61.2326 bits (147), Expect = 3.553e-9
Identity = 149/745 (20.00%), Postives = 286/745 (38.39%), Query Frame = 1
Query:  844 PKWSSPHIYLSLPEHSKIGTEITLPLAM-DPDQPPTNTTQKYKISYQSVNDGFKL------KHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVV----ASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRG---IHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQ---FSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCL-PVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQM-YTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIAN-------LKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQ-KKIERLHINIVNVDGN 2997
            PK+SS    L++ E +  GT +   L + D D     ++ ++  S +++     L      + SGR     L +      D    +  +  ++A D +   +     + +++ D+ND +P F + S    +  + P  S ++ ++A+D D     ++R+E    + +    RF +N    ++ TA  +   ++ +  I       + SD AT     +N +     + V   S S        S Y   L E+     +V    A+ S S      + +G         +I     S++    Q  LI      T   F     ++Y    I        L++ V  +++I DVNDN P F   F  S     I S+S K+           +A D D G+   + Y +D   ST    F+I+  +G +       Y +   + + + A++   +   SQ    +QK TVN++ ++    P F +  Y+  V E                       +     ++    +Y   ++ + YT  + +    F +   G+I V    LDREK++ ++  ++              V + + D+ND+ P +          +  Y+ +I   +A        + A D D G NGK+ Y I+    P                      +  + F++D +TG I     +      S  +++ A D G+P +   I ++ I++++ + N
Sbjct:  787 PKFSSDSYQLTVDESAAPGTTLAPGLLIIDSD----TSSDQFDCSMEAITSLHTLYNFEVTQQSGRCF---LRVQAGGKLDAHLASKYTFNVRATDRNFRNMFATAQVEVNVIDVNDHKPEFLQESYWLSVPSSTPAGSSLVTVQAEDMDIGTNAQVRYEL---LRQENSERFILND-NNQLSTASTLTPNVRYQLLI-------RASDSAT-----RNPSSAQVPVYVSVYSPSESPIVFDKSSYNQNLPEDSSANTLVFTAKATRSGSSSGITYELVGGYK------QIGEAMFSIKPDTGQVYLIKKLDFETKSYFPIAVRAKYSGGAI-------ELASEVVAKVTIVDVNDNGPRFA--FHESSKTVVIDSFSAKD-------TQLARALDADSGSLGEVTYGIDGGRSTSNLPFNINVKTGMIFATREILYTQGSSYIIIVVATDGATD--GSQ---KIQKFTVNVQVLDTPRPPSFPQKTYSAPVTE----------------------TAGVGDTVTTVRAVYSKPNAFLKYTFVSGNEDNTFCVNGFGIISV-AKSLDREKVAGYTLGMRVTLGQH---VDDTTVYVNLTDINDDAPHF---------TSAIYRRSIKEGLAEDTEILPPVIAVDHDFGSNGKILYSILSGVHP----------------------DWDKYFNIDSATGKITTKMTLDYETHKSHTLFIRAEDNGSPKRLSGIAQVDIDVIDRNDN 1424          

HSP 11 Score: 60.4622 bits (145), Expect = 5.595e-9
Identity = 96/436 (22.02%), Postives = 178/436 (40.83%), Query Frame = 1
Query: 1753 TTKMFDREETSQYFAQLI-CFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINA---SNPIIERKNSQLLYTLQK------ITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISS---FSFKIQAADRSEKPLSSTA--IVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDN-----GKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIA-QKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            T K   R++ + Y    +   D  + S S +    +++ D ND  P+FE         +  +I E   I T++++V+ATD+D G N  I Y + +  ++ F+ID I+G +R     DY   +K  L I+A    +P      + +  +L++      +  + +   +  P F +  YTF+++E                            + +  +D    +    Y+ S +  S++    E+G++ +   V D E   +   +   + A D+    LS+T   +++IQ +D N N P +  P     E++ + ++     +  + A D D   N     GKV Y IV  +             L V             F +D +TG + +A   +         + V+ASD  T P+     L IN+++ D N
Sbjct:  203 TGKPIVRDDNNPYIMLTVQVTDGGNPSHSGTANIRVNVEDANDQTPVFE------SSQYRETIAENTPIQTSVLRVRATDKDDGTNGGIYYYMKNPVNSYFTIDAITGVIRVAKTLDYNARDKHTLYISARDRGDPPRTSAEATVEISLRENIQGWPLPDSADPKENTKPYFPQSRYTFSIRE------------------DFPPKGALLVMRAADNDPIGPNKRLRYSLSGNGVSKFAIDPESGVVTLTDSV-DYENTPNNHVYDLTVTATDQGPGSLSATTQLLIEIQDVDENKNSPRF-DPQQAILEISENLKQ--NSLVTTVSATDSDSVGNPSSPDGKVVYSIVGGT------------GLGV-------------FRVDSNTGEVKVAVPSLDREGTSQYTLVVKASDNATFPRSSRLFLMINLLDEDDN 585          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO30364 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T100])

HSP 1 Score: 157.918 bits (398), Expect = 1.013e-38
Identity = 182/730 (24.93%), Postives = 309/730 (42.33%), Query Frame = 1
Query:  841 SPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLD----INISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKH--SDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDY--ESKRLGNQMNHLLD-CRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLI-CFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNG 3000
            SP +     Y+++ E +  G  I    A D D+   N    Y  S       F +  S  D      +IV+   DRE +    + + A     N ++G  D    ++I++TD+ D +P+F  +S+   ++EN  + + + ++ A D+D  D   + +   N         F I+ +TGEI T   +D E  ++Y + V   D  +  SD   + ++V++VNDN P           F  PG + +Y     E    G  +  +   D D    +  L + + ++ D   ++     + L  SQ               DRE   +YF   I   DS   S S++ +  I + D+NDN P+F      +   ++Y ++E    GT ++ V A+D+D+G NA + Y L  +  T+F+IDP +G +   +  + E+   + LT+ A +  I  +         ++ + + D ND +P F +  Y F+V+E                    K      ++ +   DI D++  + Y  S+ + S  F + ET  I      LDRE+ +S++  I A D     L S   V I I DVNDN PL+   +   Y V +     +   +  + A DPD G NG+ TY+I                            +  ++F +D +TG I I  K+         + V A D GTPP      + I++ +VD N 
Sbjct: 1086 SPLFEKSMYYVNVSESASRGIVIGRVTATDRDEG-INAIIFY--SSNGAEAKFYVSRSTGD------IIVDSPLDREFKNVYILNVTA----ANIVAGAQDTTTQVHITVTDVIDDKPYFNSSSLTVKLSENASIGTNVTKITALDKDIGD--TISYSIANG---DPYGLFTIDNVTGEIRTVAELDRENVTQYELFVQAKDSVNLVSDLLKVVVQVEDVNDNPPV----------FSMPGYTIEYW----EESPEGTSILQVKAIDADIGDNAAVLYSIVENVTDYVTVNAITGVISLGSSQ--------------LDRE-VEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFN-----NTDYYAY-VRENQPAGTPVLVVTASDKDVGTNAKLSYVLSGVLYTRFAIDPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGT-----TRVIITVTDANDHVPQFTQSGYAFSVRE------------------DVKVGHTVGRVATTDEDINDNARVRYYI-SSGNTSLMFSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLF---SKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKITAG-------------------------DTDDVFYIDANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNA 1710          

HSP 2 Score: 152.525 bits (384), Expect = 4.589e-37
Identity = 206/849 (24.26%), Postives = 352/849 (41.46%), Query Frame = 1
Query:  625 FFLDSKTYEFRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTD-GKHSDQAT---LTIEVKNVNDNNPEISVLYLSG----------------------------SNFKTPG---------------------RSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSL-DSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTV-KEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGE-TGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNGH 3003
            F LD  T E  V K +DRE         + +N +   +F+      D+    SD     + V++ + D NDNSP++ S +    L E ++ G+ +    A D D        K K+ Y ++ DG     + +   EKL     + ++  K+  V  K      +      +  + I + D+ND  P F ++     + EN P  +P+L++ A D D+    K+ ++  N   +   + F IN +TGEI  AG ID E    + + V   D G+ S + T   + I VK+ NDN P+ S     G                            S+ + P                        S Y   ++E+   G V+  ++ +D+D         +N ++    +       + RS   +I    L      DRE  + Y   +   +  + +  T+    I++TDV D+ P F      +    +  + E  +IGT + ++ A D+DIG+   I YS+ +      F+ID ++GE+R +   D E + ++EL + A + +       L+  L K+ V +EDVND  PVF    YT    +E P                     ++  ++ +   DI D++ + +Y+    + + Y  +   TG+I +    LDRE    F+F I+A D      SSTA V I+++D+NDN P  VF NT +Y   V   +  G  +  + A+D D+G N K++Y +                       S + + R   F +D  TGNI   + +   + GS  + + A D     ++   R+ I +   D N H
Sbjct:  758 FRLDPVTGELSVRKELDRES------PQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLSEAARPGSNVIQVSATDQDLE-----YKGKVIY-NITDG---DENRKCEVEKLV----RHYNWHKKNCVLCKESKCSVE------RTYVVIYVDDVNDNDPVFNQSKYAADVLENSPTGTPVLRVHASDRDQGANGKITYKLTNGNKD---DAFSINNVTGEITVAGVIDREAVHTFVLTVQAEDQGEPSSRKTFAEVVITVKDENDNFPQFSFTGYEGEIAENSPVGSTITMVPDQKISSSTLRPRSSPRAPAALLTAREKRPITLINDESPLFEKSMYYVNVSESASRGIVIGRVTATDRD-------EGINAIIFYSSNGAEAKFYVSRSTGDIIVDSPL------DREFKNVYILNVTAANIVAGAQDTTTQVHITVTDVIDDKPYF------NSSSLTVKLSENASIGTNVTKITALDKDIGDT--ISYSIANGDPYGLFTIDNVTGEIRTVAELDRENVTQYELFVQAKDSV------NLVSDLLKVVVQVEDVNDNPPVFSMPGYTIEYWEESPE-------------------GTSILQVKAIDADIGDNA-AVLYSIV-ENVTDYVTVNAITGVISLGSSQLDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSP--VFNNT-DYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYVL-----------------------SGVLYTR---FAIDPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITV--TDANDH 1499          

HSP 3 Score: 135.961 bits (341), Expect = 6.444e-32
Identity = 202/822 (24.57%), Postives = 338/822 (41.12%), Query Frame = 1
Query:  586 GDYYYKSITDIEP---FFLDSKTYEFRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKI-----SYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQ-FSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGE-TGLIHVNVP---VLDREKISSFSFKIQAADRSEKPLSSTAI-VQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIG----YCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            GD    SI + +P   F +D+ T E R    +DRE + ++++            F+Q++   D     SD    ++ V V++ D+NDN P +S P   +   E S  GT I    A+D D    N    Y I      Y +VN    +   G               DRE +   +  ++A D      S    + I L DIND  P F  T  +  + EN P  +P+L + A D+D     KL +         +  RF I+P TG I T   ++ E    YT+ +   D     +   T  +  V D N  +     SG  F            + E+   G  V  ++ +D+D          N  +   I     SL    +++       + TT   DRE+ + Y   +   D    +L ++ +  I+I DVNDN P+F      S+ +++ +++E V + T +VQV ATD D G N    Y + +  +   F ID  +G +      DYEK   + LT++A +       +  L     + +++ DV+D  PVF K  Y+  + E  ++  +V  V   D D  + +   Y++I S                 N+D+   F IGE +G+I +N      L+RE  + +  ++ A  R       + +   I +LDVNDN P +   ++ +Y  +V   E  G      I  +KA D D G++G++ + IV                           N + +F +D  TG +   + +   D     + V A D+G P       ++I +++++ N
Sbjct: 1222 GDTISYSIANGDPYGLFTIDNVTGEIRTVAELDRENVTQYEL------------FVQAK---DSVNLVSD----LLKVVVQVEDVNDNPPVFSMPGYTIEYWEESPEGTSILQVKAIDADIGD-NAAVLYSIVENVTDYVTVNAITGVISLGSSQ-----------LDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFNNTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYVLSG----VLYTRFAIDPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYAFS-----------VREDVKVGHTVGRVATTDEDIND-------NARVRYYISSGNTSLMFSVNETTG----IISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLF------SKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKITAGDTDDVFYIDANTGLITIKAKLDYEKTSLYNLTVSAQD-----LGTPPLTGACFVEIHVSDVDDNAPVFHKPRYSAELYENVTRGHHVITVNATDIDAEASHKRVYYRIES----------------GNTDS--MFLIGEQSGVITLNCTPSGCLNRETHARYELQVAAISRVNLTEQKSLVPAVITVLDVNDNAPRF---DSESYVRSV--LEDTGPITDATILTVKAQDGDEGESGEIIFTIVSG-------------------------NENGVFQMDNKTGVLTRTRPLDREDTSFYSLVVMAEDKGEPALSSSVTVNITVLDMNDN 1927          

HSP 4 Score: 121.324 bits (303), Expect = 1.775e-27
Identity = 143/557 (25.67%), Postives = 238/557 (42.73%), Query Frame = 1
Query: 1156 LTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLT---IEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHF--QLITTKMFDREETSQYFAQLICFDSDS-NSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIK--EGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELR-NIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVF-EKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSN----SDASQYFRIG---ETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNE 2775
            +T IND+ P F+K+  +  ++E+      I ++ A D DE   + + F   N  +     +FY++  TG+I+    +D E K+ Y + V   +     Q T T   I V +V D+ P  +              SS     L+EN   G  V  ++  DKD     +G+ +++ +    DP+             ID+   ++ T    DRE  +QY  +L     DS N +S  +   + + DVNDNPP+F +P         Y+I+  E    GT+I+QVKA D DIG+NA + YS+    +   +++ I+G +       D E  E F  TI A++  +  K+S        + + + D+ND  PVF   D Y +  +  P+                             P  +  +SD  + TN+          Y R     +TG I    P L+RE+  S++  ++A D + +    T  V I + D ND+ P +       Y  +V     +G+ +  +   D D+ DN +V Y I   +    F+ NE
Sbjct: 1079 ITLINDESPLFEKSMYYVNVSESASRGIVIGRVTATDRDEG-INAIIFYSSNGAEA----KFYVSRSTGDIIVDSPLDREFKNVYILNVTAANIVAGAQDTTTQVHITVTDVIDDKPYFN--------------SSSLTVKLSENASIGTNVTKITALDKD-----IGDTISYSI-ANGDPY---------GLFTIDNVTGEIRTVAELDRENVTQY--ELFVQAKDSVNLVSDLLKVVVQVEDVNDNPPVFSMP--------GYTIEYWEESPEGTSILQVKAIDADIGDNAAVLYSIVENVTDYVTVNAITGVISLGSSQLDREVEEYFNFTIRATDSGVPSKSST-----ASVAIKLVDINDNSPVFNNTDYYAYVRENQPA---------------------------GTPVLVVTASDKDVGTNAKLSYVLSGVLYTRFAIDPDTGNITTREP-LNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFT---QSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYISSGNTSLMFSVNE 1555          

HSP 5 Score: 118.242 bits (295), Expect = 1.338e-26
Identity = 146/565 (25.84%), Postives = 236/565 (41.77%), Query Frame = 1
Query: 1126 LSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQ----ATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIH-SYSIKEGVAIGTTIV-QVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELR-NIDVFDYEKMEKFELTINAS-NPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKD------LYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGE-TGLIHVNVPVLDREKI---------SSFSFKIQAADRSEKPL----SSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRI 2736
             S    + ++L ++ND +P F K+S +  ++E I   + I  + A D D      L +E            F +N   G I  A  +DY+   +Y   ++V DG    Q    AT+T+ +++VNDN+PE + +               Y + +AEN   G +V  ++ +DKD       +  N  L   I    +      + S L+      T +  DRE  + Y   +  +D   +S    V   +++ D NDN P      Q + G+  + +I EG   GT ++  + A D D G+N  + YS+ S   ++F+++  +G L+ +    D E  + ++L IN + N      NS  ++      V I DVND  P F+ +       Y  TV EGP                      N   I  N  D    ++ ++  + + D   +FR+   TG + V    LDRE             F   I A D++  P+    S+T  V I + D NDN P +    + NYE  +S     G  +  + A D DL   GKV Y I
Sbjct:  369 FSANASVTLTLINVNDNKPMFAKSSYNYTMDEEITPGTHIADITATDADLGTFGALTYELRGGQ----AAYFSVNADNGTISAAQILDYDTLRQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEFTGM--------------PYTSDIAENLPAGTIVFQVTATDKD-------SGENGRLSFNISAGDDGGHFSINGSGLV-----TTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTP------QITDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSM-SGGDSRFTLNSATGRLQISPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVH------VTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTI-------------------NKTLIDINATDPDADANGKVAYSLSGDEHGFFRLDPVTGELSVRKE-LDRESPQMSRNAQGDGRFLLDITATDQA-TPISDRKSATVRVSITVRDTNDNSPQF---QSQNYETRLSEAARPGSNVIQVSATDQDLEYKGKVIYNI 866          

HSP 6 Score: 115.931 bits (289), Expect = 7.440e-26
Identity = 166/756 (21.96%), Postives = 308/756 (40.74%), Query Frame = 1
Query:  841 SPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDG--FKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRA-YLAENKD----PGFVVA-SLSVSDKDYESKRLGNQMNHLLDC-----RIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFA-------------QLICFDSD-SNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLY---TLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTN-SNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIG---YCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQK---MKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            +P ++       + E++++GT I    A+D D   TN+  +YK S  +      F L     +      L +    D E   +  + + A D     L  +  + I +TDI+D  P F ++   K I EN P+ S ++ +EA+D D    + + +E  +   + V   F I+  TG I   G ID E                +D   +T++   V D N   +V  +         R +  ++ Y+ + ++    PG VV+  L V+D D ++      + HL+        IDP   +L +    +K +D+ + I    FD E                    +++  ++D S   S + +  +++ +VNDN P+F      ++  ++Y++ E +  GT I  + ATD D+G    + Y L    +  FS++  +G +    + DY+ + +++ ++         K+    Y    +  +TV ++DVND  P F    YT  + E                       +  F++ +   D     + ++  N S  D   +F I  +GL+      LDRE I++++  + A D           + + +LD NDN P      T    +  +  E  G     ++++ A DPD G NG++TY +      F+ N+                           +TG + I+      +L D  S  + +  +D G+PP      +H+ I++V+ N
Sbjct:   43 APVFTEQPYMAKIAENARVGTTILKISAIDADSG-TNSQVQYKFSNATATQTPFFSLNSVNGE------LTLGGPLDFEVARSYMLVVIAEDLGVPKLESRTTVIIEVTDISDMPPRFLQSFYLKEIEENTPIGSTVVTVEARDGDVGINNPILYEIISGNSDGV---FTIDSNTGVITVNGSIDAE---------------KTDVFRITVKASEVPDPNSNTTVTVVVTVVDVNDNRPAFLQSVYIFDVREDVALPGRVVSDQLQVTDGD-KNPVFRRVLYHLVGADSDKFAIDPTSGTLYI----NKTLDYEKQINF-TFDWERGCGSGGGSGWDWTGRGEEKKVVATETDTSEKFSANASVTLTLINVNDNKPMF------AKSSYNYTMDEEITPGTHIADITATDADLGTFGALTYELRGGQAAYFSVNADNGTISAAQILDYDTLRQYQFSLVV-------KDGGGFYQEIAIATVTVTLQDVNDNDPEFTGMPYTSDIAEN------------------LPAGTIVFQVTATDKD--SGENGRLSFNISAGDDGGHFSINGSGLV-TTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQI----TDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSMSGGDSRFTLNS---------------------------ATGRLQISPTGLDRELKD--SYDLIINVTDNGSPPNTNSTTVHVTILDVNDN 700          

HSP 7 Score: 94.3597 bits (233), Expect = 2.469e-19
Identity = 143/607 (23.56%), Postives = 252/607 (41.52%), Query Frame = 1
Query:  841 SPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQA-----TLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKM-FDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDI-GNNAIIRYSLDSLSS-TQFSIDPISGELR----NIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKE--GPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFP 2619
            SP +++   Y  + E+   GT + +  A D D   TN    Y +S      G        D  +  ++   +  +RE+  + ++ L+A D       G   + I++TD ND  P F ++     + E++ +   + ++   DED +D  ++R+   +         F +N  TG I T   +D E  + YT+  I+T   H   A     ++ I +++VNDN P  S    + +  ++    +Q    +A + D G        ++  +  K      + +    ID +                  LIT K   D E+TS Y   +   D  +  L+ +   EI ++DV+DN P+F  P       +S  + E V  G  ++ V ATD D   ++  + Y ++S ++ + F I   SG +          + E   ++EL + A    I R N     +L    + + DVND  P F+ + Y  +V E  GP                    ++    + +   D  +S +      S ++   +    +TG++    P LDRE  S +S  + A D+ E  LSS+  V I +LD+NDN P+   P
Sbjct: 1396 SPVFNNTDYYAYVRENQPAGTPVLVVTASDKDVG-TNAKLSYVLS------GVLYTRFAIDP-DTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYISSG---NTSLMFSVNETTGIISTTSTLDREQNASYTL--IITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQVIATDPDEG--------ANGQFTYKITAGDTDDVF--YIDANT----------------GLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFHKPR------YSAELYENVTRGHHVITVNATDIDAEASHKRVYYRIESGNTDSMFLIGEQSGVITLNCTPSGCLNRETHARYELQVAA----ISRVNLTEQKSLVPAVITVLDVNDNAPRFDSESYVRSVLEDTGPIT------------------DATILTVKAQDGDEGESGEIIFTIVSGNENGVFQMDNKTGVLTRTRP-LDREDTSFYSLVVMAEDKGEPALSSSVTVNITVLDMNDNLPILQTP 1934          

HSP 8 Score: 88.1965 bits (217), Expect = 1.921e-17
Identity = 139/608 (22.86%), Postives = 241/608 (39.64%), Query Frame = 1
Query: 1042 LIVNKDFDREKQATVSVKLKAFD-GDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPIL--QLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTI-----------------------PVIVTDG----KHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLI----DHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSV-TFEISITDVNDNPPIFE-VPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLS-STQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDL-YTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPN----THNYEVNVSYQEA-IGYCIANLKANDPDLGDNGKVTYRI 2736
            + VN   D EK     + +KA +  DPN  +    +   +   +++ P F ++     + E++ L   ++  QL+  D D++   +         D    ++F I+P +G +     +DYE +  +T                         V+ T+     K S  A++T+ + NVNDN P  +               S Y   + E   PG  +A ++ +D D     LG     L          + ELR  Q+       D+  +   ++ D +   QY   L+  D        ++ T  +++ DVNDN P F  +P+       +  I E +  GT + QV ATD+D G N  + +++ +      FSI+  SG +      D E +  + LT++A +  +  ++  +     ++TVN+ D ND  P     L  T  + EG      +   +                      D    S+ Q+  + +   S++     TG + ++   LDRE   S+   I   D    P +++  V + ILDVNDN P +  PN       Y + V      I   + ++ A DPD   NGKV Y +
Sbjct:  210 ITVNGSIDAEKTDVFRITVKASEVPDPNSNTTVTVVVTVVDVNDNR-PAFLQSVYIFDVREDVALPGRVVSDQLQVTDGDKNPVFRRVLYHLVGADS---DKFAIDPTSGTLYINKTLDYEKQINFTFDWERGCGSGGGSGWDWTGRGEEKKVVATETDTSEKFSANASVTLTLINVNDNKPMFA--------------KSSYNYTMDEEITPGTHIADITATDAD-----LGT-FGAL----------TYELRGGQAAYFSVNADNGTISAAQILDYDTLRQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEFTGMPY-------TSDIAENLPAGTIVFQVTATDKDSGENGRLSFNISAGDDGGHFSING-SGLVTTARELDRETIATYTLTVSAYDHGVSSRHKHV-----QLTVNVLDENDNTPQITDGLTITTNISEGAGGGTVLLSSIAAV-------------------DPDAGSNGQLTYSMSGGDSRFTLNSATGRLQISPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAF-DPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSL 750          

HSP 9 Score: 86.6557 bits (213), Expect = 5.610e-17
Identity = 111/447 (24.83%), Postives = 187/447 (41.83%), Query Frame = 1
Query:  844 PKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHK---LRFEFDNSVDETVRNRFYINPLTGEILT----AGYIDYEIKSEYTIPVI-VTDGKHSDQATLT---IEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQG--SRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASN 2145
            P +S     ++L E   + T++   +A DPD+   N    YKI+    +D F +     D    L + +    D EK +  ++ + A D    PL+G   + I ++D++D  P F K      + EN+     ++ + A D D    HK    R E  N+      + F I   +G I      +G ++ E  + Y + V  ++    ++Q +L    I V +VNDN P                 S  Y   + E+  P      L+V  +D +    G     ++   +  +   +    +++ +     L  T+  DRE+TS Y   ++  D    +LS+SVT  I++ D+NDN PI + P          ++S+KE +  G  +  V A D D   N I  Y  ++     F ++  SGELR     D E      L + ASN
Sbjct: 1606 PLFSKSVYNVTLRESVFLKTQVVQVIATDPDEG-ANGQFTYKITAGDTDDVFYI-----DANTGL-ITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFHKPRYSAELYENVTRGHHVITVNATDIDAEASHKRVYYRIESGNT-----DSMFLIGEQSGVITLNCTPSGCLNRETHARYELQVAAISRVNLTEQKSLVPAVITVLDVNDNAPRFD--------------SESYVRSVLEDTGPITDATILTVKAQDGDEGESG----EIIFTIVSGNENGVFQMDNKTGV-----LTRTRPLDREDTSFYSLVVMAEDKGEPALSSSVTVNITVLDMNDNLPILQTPMDVLIPERRTTFSVKENLDAGVPVGVVAAQDLDT-KNLIYYYITNTEEQKYFILNETSGELRTRITLDREDSSVHYLYVKASN 2016          

HSP 10 Score: 82.8037 bits (203), Expect = 9.156e-16
Identity = 101/428 (23.60%), Postives = 179/428 (41.82%), Query Frame = 1
Query: 1060 FDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHF-----KKTSIHKIINENIP--LRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEI---------KSEYTIPVIVTD------GKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSL-DSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEG 2274
             DRE + +  + +   D    P +    +++++ D+ND  P F     +  + + I  +  P  +   ++ + A D D     K+ +    S DE     F ++P+TGE+     +D E             + + +  TD       + S    ++I V++ NDN+P+               +S  Y   L+E   PG  V  +S +D+D E K  G  + ++ D   D +R+         KL+ H+                   ++C +S  +   T V   I + DVNDN P+F      ++  ++  + E    GT +++V A+DRD G N  I Y L +      FSI+ ++GE+    V D E +  F LT+ A     ++       T  ++ + ++D ND  P F     +FT  EG
Sbjct:  662 LDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSL--SGDE--HGFFRLDPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQF--------------QSQNYETRLSEAARPGSNVIQVSATDQDLEYK--GKVIYNITDG--DENRKC-----EVEKLVRHYNWHKKNC------------VLCKESKCSVERTYVV--IYVDDVNDNDPVF------NQSKYAADVLENSPTGTPVLRVHASDRDQGANGKITYKLTNGNKDDAFSINNVTGEITVAGVIDREAVHTFVLTVQAE----DQGEPSSRKTFAEVVITVKDENDNFPQF-----SFTGYEG 1033          

HSP 11 Score: 73.1738 bits (178), Expect = 7.289e-13
Identity = 138/654 (21.10%), Postives = 242/654 (37.00%), Query Frame = 1
Query: 1162 DINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTD---GKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFD-SDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIV--QVKATDRDIGNNAIIR---YSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKF-----------------------ELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVN--------VPVLDREKISSFSFKIQAADRSE-KPLSSTAIVQIQILDVNDNPPLWV-FPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            D ND  P F +      I EN  + + IL++ A D D     +++++F N+   T    F +N + GE+   G +D+E+   Y + VI  D    K   + T+ IEV +++D  P                  S Y   + EN   G  V ++   D D          N +L   I  + + +    S + +I           D E+T  +   +   +  D NS +T       +   ++ P   +        ++ + ++E VA+   +V  Q++ TD D   N + R   Y L    S +F+IDP SG L      DYEK   F                       E  + A+    E   S+       +T+ + +VND  P+F K  Y +T+ E                           +I    H I D + +     +    +   R G+     VN          +LD + +  + F +   D        + A V + + DVNDN P +   P T +   N+      G  +  + A D D G+NG++++ I                            +    F ++GS G +  A+++    + +  + V A D G   + K  +L +N+++ + N
Sbjct:   38 DYNDNAPVFTEQPYMAKIAENARVGTTILKISAIDADSGTNSQVQYKFSNAT-ATQTPFFSLNSVNGELTLGGPLDFEVARSYMLVVIAEDLGVPKLESRTTVIIEVTDISDMPPRF--------------LQSFYLKEIEENTPIGSTVVTVEARDGDVGIN------NPILYEIISGNSDGVFTIDSNTGVI-----TVNGSIDAEKTDVFRITVKASEVPDPNSNTTVTVVVTVVDVNDNRPAFLQ-------SVYIFDVREDVALPGRVVSDQLQVTDGD--KNPVFRRVLYHLVGADSDKFAIDPTSGTLYINKTLDYEKQINFTFDWERGCGSGGGSGWDWTGRGEEKKVVAT----ETDTSEKFSANASVTLTLINVNDNKPMFAKSSYNYTMDE---------------------------EITPGTH-IADITATDADLGTFGALTYELRGGQAAYFSVNADNGTISAAQILDYDTLRQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEFTGMPYTSDIAENL----PAGTIVFQVTATDKDSGENGRLSFNISAG-------------------------DDGGHFSINGS-GLVTTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDN 594          

HSP 12 Score: 67.0106 bits (162), Expect = 5.194e-11
Identity = 127/564 (22.52%), Postives = 227/564 (40.25%), Query Frame = 1
Query: 1054 KDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKK-TSIHKIINENIPLRSPIL-QLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEI-LTAGYIDYEIKSEYTIPVIVTDGK---HSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAY-LAENKDPGFVVASL---SVSDKDYESKRLGNQMNHLLDC------RIDPHRESL----ELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSL-DSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGE-TGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSST-AIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCI 2676
            ++ DRE  AT ++ + A+D   +     + + +++ D ND  P      +I   I+E     + +L  + A D D     +L +           +RF +N  TG + ++   +D E+K  Y + + VTD     +++  T+ + + +VNDN P              P  +     Y +  ++ PG +  +L   + +D D ++     ++ + L        R+DP    L    EL R   ++  + Q     + D   T Q  A  I     S+  S +V   I++ D NDN P F+     +R      + E    G+ ++QV ATD+D+     + Y++ D   + +  ++ +        V  Y   +K  +    S   +ER           + + ++DVND  PVF +  Y   V E                       +   ++ ++  D   ++    Y  +N +    F I   TG I V   V+DRE + +F   +QA D+ E     T A V I + D NDN P + F     YE  ++    +G  I
Sbjct:  554 RELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQITDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSMSGG-----DSRFTLNSATGRLQISPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFD-----------PNPAQSLATYVITVDEGPGTINKTLIDINATDPDADAN---GKVAYSLSGDEHGFFRLDPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQ--ATPI-----SDRKSATVRVSITVRDTNDNSPQFQSQNYETR------LSEAARPGSNVIQVSATDQDLEYKGKVIYNITDGDENRKCEVEKL--------VRHYNWHKKNCVLCKESKCSVERT---------YVVIYVDDVNDNDPVFNQSKYAADVLENSPT------------------GTPVLRVHASDRD-QGANGKITYKLTNGNKDDAFSINNVTGEITV-AGVIDREAVHTFVLTVQAEDQGEPSSRKTFAEVVITVKDENDNFPQFSF---TGYEGEIAENSPVGSTI 1045          

HSP 13 Score: 58.5362 bits (140), Expect = 2.012e-8
Identity = 39/145 (26.90%), Postives = 72/145 (49.66%), Query Frame = 1
Query: 1849 FEISITDVNDNPPIF-EVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQ---FSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKE 2271
            F + + D NDN P+F E P+          I E   +GTTI+++ A D D G N+ ++Y   + ++TQ   FS++ ++GEL      D+E    + L + A +  + +  S+       + + + D++D  P F +  Y   ++E
Sbjct:   32 FFLIVDDYNDNAPVFTEQPYMAK-------IAENARVGTTILKISAIDADSGTNSQVQYKFSNATATQTPFFSLNSVNGELTLGGPLDFEVARSYMLVVIAEDLGVPKLESR-----TTVIIEVTDISDMPPRFLQSFYLKEIEE 164          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: dchs1a (protocadherin-16 [Source:NCBI gene;Acc:101175097])

HSP 1 Score: 248.054 bits (632), Expect = 8.359e-66
Identity = 200/666 (30.03%), Postives = 327/666 (49.10%), Query Frame = 1
Query:  841 SPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLK-HSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQ---ATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSL---DSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHD--IYDSSDSQMYTNSNSDASQYFRIG-ETGLIHVNVPVLDREK-ISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTES 2805
            +PK+        +PE + IGT   L  A+D D+    TTQ Y I   +    F L+   G +    L L+VN   DREK++T ++ L+AFDG     + Q+ ++I++ DIND  P F+++  H II+EN+   + ILQ+ A D DE     + +E  N         F I+  +G I     +D+E++  + + +   D     +   A +T+ V++ NDN P +++++LS                ++E   PG  VA +SV+D DY     G   N  ++  ++       L    S +   + +   ++ DREE   Y  +++  DS S  L    +F I +TDVNDNPP+F+ P      ++  +I E V  G+ ++QV A D+D G N  I YS+    S+  + FSID ++G +      DYEK     +T+ AS+       +  L +   + + ++D+ND  PVFE++ Y  ++KE                  ++   +   ++ +   D   + S    + + SN   S  F IG ETG I  N  VLDR++   SF F + A D     LSS A V++ + D+NDN P + +P    Y VN+S Q A G  +A + A DPDLG+NG++TY+ VP      F  N+++  + ++ S
Sbjct:   19 APKFPRKRAKFQIPEQTAIGTRFPLEPAVDKDKGQL-TTQGYLIKDGNTGQAFTLETRRGSNEVLYLDLVVNTILDREKRSTYTLTLEAFDGGSPIRTDQMTLDITVQDINDNAPVFQQSRYHTIISENLQPGNSILQVFASDSDEGQNGMVSYEI-NRRQSDPDQYFVIDSHSGVITLNKPLDFEMRRVHELVIQAQDNATQPEVSNAFVTVHVRDYNDNQPTMTIIFLSEDG----------SPRISEGAQPGQYVARISVTDPDY-----GEYAN--VNVSLEGGDGKFALTTKDSII---YLVCVDQILDREERDTYELRVMATDSGSPPLRAESSFIIEVTDVNDNPPLFDQP------VYRQAIPEVVFPGSFVLQVTARDKDQGPNGDISYSILKDQSVYHSWFSIDSVTGIITTSSQLDYEKNPNPSITVVASD-----GGNPPLSSTAVVNILLQDINDNEPVFERNFYNVSIKE------------------NTAPGTCILEVTAVDADGGTFGSVTYSLASGSNIAISSQFTIGKETGQICTNA-VLDRDQGPDSFDFTVMAVDGGG--LSSEAYVRVDLEDINDNRPAF-YP--LGYAVNLSTQSAPGTYVAKVMAYDPDLGENGRITYKTVPGGDSPYFTLNKDTGVISLSRS 627          

HSP 2 Score: 140.584 bits (353), Expect = 6.344e-33
Identity = 134/474 (28.27%), Postives = 218/474 (45.99%), Query Frame = 1
Query:  844 PKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFD-GDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGK---HSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEK--FELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKD 2247
            P + SP   +S+ E   +G  +   +A D DQ   N    Y+I   +    F L  +        SL ++K  DRE+Q   ++ + A D G P   S QL + I + D+ND+ P F++      I+EN P  + +L + A D D+    ++ +             F IN +TG I T   +D E +  YT+ V   DG    +  +AT+ I+V +VNDN P    LY              Y   + EN++    + +L  +D D  S     ++N+ +    DP  +   L R    L       T++  DRE+T+ Y   ++  D    SLS++ T ++++ D+NDN P F+         ++  I EGV IG+ +++VKA D D G N+ + Y L   S + F ID  +G +      D E+     FE+    S+P   R ++       ++T+ I+DVND  P F +D
Sbjct: 1416 PVFMSP-TAVSVMEDQTMGFVVLFVIARDADQG-ENGRVTYRIQSGNTRGTFSLNSN------TGSLSISKPLDREEQDVFNLTIVAEDHGIPQHSSSQL-LRIHVIDVNDETPLFEEAQYEAQISENQPAGTTVLTVSASDSDQGINGQITY------GGISHGAFSINSVTGVITTTKSLDRESQDCYTVTVYAKDGGLPPNYAKATVKIKVVDVNDNAPIFGRLY--------------YNVEVPENQE-ALPLFTLRATDPDAGSS---GEINYRIAAG-DPSGD-FHLDRHSGVLS------TSRPLDREKTAGYSLTIVAQDQGRPSLSSTSTVKVAVLDINDNSPQFQ------SNSYTADISEGVPIGSLVLEVKARDADFGPNSQVMYFLSRGSKSMFVIDENTGRIITAAPLDRERTASYTFEVCATDSSPADPRNST------AQVTIYIQDVNDNAPFFIQD 1836          

HSP 3 Score: 138.658 bits (348), Expect = 3.001e-32
Identity = 202/845 (23.91%), Postives = 341/845 (40.36%), Query Frame = 1
Query:  493 IHFKVVEESPTNSVIGNIHNQALKQKGGVGSGDYYYKSITDIE---PFFLDSKTYEFRVSKRVDREEICRFQMQNIMQNCRMT---YKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLS---GQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDG---KHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLS-STQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRS-EKPLSSTAIVQIQILDVNDNPPLWVF-PNTHNYEV-NVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINI 2979
            I F  VE++   S+IG++    L  +GG+  G   Y  +   +    F LD  T +  ++  +D E+  R+ ++  + +  +       +   II ++                       ++P+++   I + + E+   G+ +    A D D    N+  KY I +QS +    L     D    + L +    D E  +T+ + +KA D   +        +  ++ +TD ND  P F   +   ++ E+  +   +L + A+D D+ +  ++ +   +      R  F +N  TG +  +  +D E +  + + ++  D    +HS    L I V +VND  P    L+            +QY A ++EN+  G  V ++S SD D   + +  Q+ +     I     S+    S + +I      TTK  DRE    Y   +   D          T +I + DVNDN PIF       R  ++  + E       +  ++ATD D G++  I Y + +   S  F +D  SG L      D EK   + LTI A +     +    L +   + V + D+ND  P F+ + YT  + EG                      S   ++ +   D +  +   MY  S    S +     TG I    P LDRE+ +S++F++ A D S   P +STA V I I DVNDN P ++  P   N  V N+S +      +A +KA D D G NG V YR       F+ N+                            TG+I   +K +      + + V+A DQG P Q  +  + I I
Sbjct: 1205 ISFNSVEDTSPGSIIGSV---CLHDRGGLEEGKVTYTVVGGTDRDGTFVLDRLTGDVYLAHPLDYEQEVRYNLEIEVDDFSLVPPRSSLVHLDIIIEDNND--------------------HTPEFAEDPITIVISENMDPGSSVYTFQATDRDGSGANSAIKYSILHQSPSTPGLLT---LDPVTGI-LSLGHKLDYETTSTLILVVKATDSAVDVSQRRWSSVTASVYVTDENDNLPVFMSPTAVSVM-EDQTMGFVVLFVIARDADQGENGRVTYRIQSG---NTRGTFSLNSNTGSLSISKPLDREEQDVFNLTIVAEDHGIPQHSSSQLLRIHVIDVNDETP----LF----------EEAQYEAQISENQPAGTTVLTVSASDSD---QGINGQITY---GGISHGAFSIN---SVTGVI-----TTTKSLDRESQDCYTVTVYAKDGGLPPNYAKATVKIKVVDVNDNAPIF------GRLYYNVEVPENQE-ALPLFTLRATDPDAGSSGEINYRIAAGDPSGDFHLDRHSGVLSTSRPLDREKTAGYSLTIVAQD-----QGRPSLSSTSTVKVAVLDINDNSPQFQSNSYTADISEG------------------VPIGSLVLEVKARDAD-FGPNSQVMYFLSRGSKSMFVIDENTGRIITAAP-LDRERTASYTFEVCATDSSPADPRNSTAQVTIYIQDVNDNAPFFIQDPLIVNISVSNLSTRR----VLATMKAEDKDFGANGSVFYRFAIPVRGFTINS---------------------------LTGDIQATEKPQTLTQSQRTLIVQAMDQGKPAQSSLGVVIIYI 1927          

HSP 4 Score: 136.346 bits (342), Expect = 1.558e-31
Identity = 168/660 (25.45%), Postives = 271/660 (41.06%), Query Frame = 1
Query: 1057 DFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQH-KLRFEFDNSVDETVRNRFYINPLTGEILTAGY-IDYEIKSEYTIPVIVTDG------KHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIE--DVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIG-ETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQG-TPPQKKIERLHINIVNVDGNG 3000
            D+++E +  + +++  F   P P S  + ++I + D ND  P F +  I  +I+EN+   S +   +A D D S  +  +++   +    T      ++P+TG IL+ G+ +DYE  S   + V  TD       +     T ++ V + NDN P           F +P   S     + E++  GFVV  +   D D              + R+    +S   R + S   +   L  +K  DREE   +   ++  D      S+S    I + DVND  P+FE         +   I E    GTT++ V A+D D G N  I Y    +S   FSI+ ++G +      D E  + + +T+ A       K+  L     K TV I+  DVND  P+F +  Y   V E                          F + +   D   SS    Y  +  D S  F +   +G++  + P LDREK + +S  I A D+    LSST+ V++ +LD+NDN P +    +++Y  ++S    IG  +  +KA D D G N +V Y +   S                            MF +D +TG I  A  +      S    V A+D     P+    ++ I I +V+ N 
Sbjct: 1265 DYEQEVRYNLEIEVDDFSLVP-PRSSLVHLDIIIEDNNDHTPEFAEDPITIVISENMDPGSSVYTFQATDRDGSGANSAIKYSILHQSPST-PGLLTLDPVTG-ILSLGHKLDYETTSTLILVVKATDSAVDVSQRRWSSVTASVYVTDENDNLPV----------FMSPTAVS-----VMEDQTMGFVVLFVIARDADQGE-----------NGRVTYRIQSGNTRGTFSLNSNTGSLSISKPLDREEQDVFNLTIVAEDHGIPQHSSSQLLRIHVIDVNDETPLFE------EAQYEAQISENQPAGTTVLTVSASDSDQGINGQITYG--GISHGAFSINSVTGVITTTKSLDRESQDCYTVTVYA-------KDGGLPPNYAKATVKIKVVDVNDNAPIFGRLYYNVEVPENQEALP-------------------LFTLRATDPDA-GSSGEINYRIAAGDPSGDFHLDRHSGVLSTSRP-LDREKTAGYSLTIVAQDQGRPSLSSTSTVKVAVLDINDNSPQF---QSNSYTADISEGVPIGSLVLEVKARDADFGPNSQVMYFLSRGS--------------------------KSMFVIDENTGRIITAAPLDRERTASYTFEVCATDSSPADPRNSTAQVTIYIQDVNDNA 1830          

HSP 5 Score: 125.176 bits (313), Expect = 3.406e-28
Identity = 160/664 (24.10%), Postives = 273/664 (41.11%), Query Frame = 1
Query: 1042 LIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEF--DNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKH---SDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYES-----KRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRY-SLDSLSSTQFSIDPISGEL---RNIDVFDYEKMEKFELTINASNPII-ERKNSQLLYTLQKITVNIEDVNDCL--PVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIG-ETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINI 2979
            + V++  DRE++ T  +++ A D    PL  +    I +TD+ND  P F +    + I E +   S +LQ+ A+D+D+     + +    D SV     + F I+ +TG I T+  +DYE     +I V+ +DG +   S  A + I ++++NDN P          NF        Y   + EN  PG  +  ++  D D  +       L +  N  +  +    +E+              Q+ T  + DR++    F        D   LS+     + + D+NDN P F  P       ++ ++    A GT + +V A D D+G N  I Y ++    S  F+++  +G +   R+I    Y K        N+  PI+   ++   L+ L    VNI  V   +  PVFE+  Y FTV E                 + +   +   + IS             Y  S+ D + YF +  +TG +  ++P LD E  +S +  +QA   S  P+     V I I DVNDNPP  VF  + +  + +     +G  +  ++A D D G N ++++ +   SFP                         ++F +D ++G I +   +         + V A D G P       L ++I
Sbjct:  303 VCVDQILDREERDTYELRVMATDSGSPPLRAESSFIIEVTDVNDNPPLFDQPVYRQAIPEVVFPGSFVLQVTARDKDQGPNGDISYSILKDQSV---YHSWFSIDSVTGIITTSSQLDYEKNPNPSITVVASDGGNPPLSSTAVVNILLQDINDNEPVFE------RNF--------YNVSIKENTAPGTCILEVTAVDADGGTFGSVTYSLASGSNIAISSQFTIGKET-------------GQICTNAVLDRDQGPDSF-DFTVMAVDGGGLSSEAYVRVDLEDINDNRPAF-YPLG-----YAVNLSTQSAPGTYVAKVMAYDPDLGENGRITYKTVPGGDSPYFTLNKDTGVISLSRSI----YGKA-------NSVIPIVVSAQDGGGLFALVNAKVNISIVAGLVAPPVFEQTQYHFTVSE-------DALRGTMVGTVQASSKTGISRDIS-------------YAISSGDPTGYFTVDPDTGALRTSLP-LDHESQASLNLDLQARSGS-PPVFGQTRVHINIADVNDNPP--VFLPSSSESLLLPEHTEMGTVVYRVQAEDKDSGVNEELSFDL---SFPIGL---------------------QKVFSIDRNSGEIRLVGSLCYETTPRYDLQVIAKDSGVPQLSSTLMLVVHI 870          

HSP 6 Score: 121.709 bits (304), Expect = 3.617e-27
Identity = 164/645 (25.43%), Postives = 279/645 (43.26%), Query Frame = 1
Query:  841 SPKWSSPHIYLSLPEHSKIGTEITLPL----AMDPDQPPTNTTQKYKISYQSVNDGFKL-KHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSD----QATLTIEVKNVNDNNP----EISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQG---SRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSST-QFSIDPISGEL--RNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIIS-NPHDIYDSSDSQM-YTNSNSDASQYFRIGE-TGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLG 2709
            +P +   +  + +PE+ +      LPL    A DPD   +     Y+I+    +  F L +HSG        L  ++  DREK A  S+ + A D     LS    + +++ DIND  P F+  S    I+E +P+ S +L+++A+D D     ++ +          ++ F I+  TG I+TA  +D E  + YT  V  TD   +D     A +TI +++VNDN P    +  ++ +S SN  T    +  +   AE+KD G   A+ SV  + +     G  +N L    I    +   L +SQ  LI        +  D+ + +Q            +SL   + +            I E  +QG   SR     S++E    GT + +++A   D G+   I +S+ S +    F I+P++GE+  +  +  D+E+  +  L + A     E  +S    +   + + ++DVND LP F+   Y   ++E                       S+ F II    +D+    + Q+ Y+  +S  S  F+I   TG I     ++DRE  +     + A DR    L+ +A + + I+D+NDN P+   P     E+ V     +G  I  +  ND D G
Sbjct: 1621 APIFGRLYYNVEVPENQE-----ALPLFTLRATDPDAGSSGEI-NYRIAAGDPSGDFHLDRHSG-------VLSTSRPLDREKTAGYSLTIVAQDQGRPSLSSTSTVKVAVLDINDNSPQFQSNSYTADISEGVPIGSLVLEVKARDADFGPNSQVMYFLSRG----SKSMFVIDENTGRIITAAPLDRERTASYTFEVCATDSSPADPRNSTAQVTIYIQDVNDNAPFFIQDPLIVNISVSNLSTRRVLATMK---AEDKDFG---ANGSVFYR-FAIPVRGFTINSLT-GDIQATEKPQTLTQSQRTLI-------VQAMDQGKPAQ------------SSLGVVIIY------------IREQSYQGIRFSRVARDVSLQENAVKGTVVTKIQAQYPD-GSKTGISHSIFSGNRMDAFGINPVTGEIWVQKSEGLDFEETPRLRLVVKA-----ETASSS---SYMAVNLILQDVNDNLPRFQLQNYVAFIREA---------------------QSHDFPIIQIAANDLDQGQNGQVTYSIRSSSQSNLFKIDPLTGSIS-TAAIMDREIWTQTKLVVTATDRGTPRLAGSATLTVIIVDLNDNRPMIPLPR----EIRVPEDTLLGTVITQVTGNDVDSG 2174          

HSP 7 Score: 109.768 bits (273), Expect = 1.858e-23
Identity = 191/806 (23.70%), Postives = 325/806 (40.32%), Query Frame = 1
Query:  625 FFLDSKTYEFRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDP-NPLSGQLDINISLTDINDKQPHF-KKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRL------GNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYS--IKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLS-STQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQ-YFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHN-YEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLS-DVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNG 3000
            F LD  +     S+ +DRE+   + +                 I+  ++G+ S SS     V V ++DINDNSP++ S      + E   IG+ +    A D D  P N+   Y +S  S +     +++GR       +I     DRE+ A+ + ++ A D  P +P +    + I + D+ND  P F +   I  I   N+  R  +  ++A+D+D      + + F   V       F IN LTG+I          +S+ T+ V   D     Q++L + +  + + +         G  F    R       L EN   G VV  +     D     +      GN+M+      I+P    + +++S+               D EET +     +   +++ S S+ +   + + DVNDN P F+        + +Y   I+E  +    I+Q+ A D D G N  + YS+ S S S  F IDP++G +    + D E   + +L + A++     + +  L     +TV I D+ND  P+             P               + ++   N         D+ DS     YT     +SQ  F I   G        LD E+ + ++  ++ +D + +   S A + + + DVNDN P +    TH+ Y+V V      G  I  + A D D G+NGK+TYR++ ++                            +F +D S G ++  Q  +   +  S  + VEA DQG PP      + I + +V+ N 
Sbjct: 1671 FHLDRHSGVLSTSRPLDREKTAGYSLT----------------IVAQDQGRPSLSS--TSTVKVAVLDINDNSPQFQSNSYTADISEGVPIGSLVLEVKARDADFGP-NSQVMYFLSRGSKSMFVIDENTGR-------IITAAPLDRERTASYTFEVCATDSSPADPRNSTAQVTIYIQDVNDNAPFFIQDPLIVNISVSNLSTRRVLATMKAEDKDFGANGSVFYRFAIPV-----RGFTINSLTGDIQATEKPQTLTQSQRTLIVQAMDQGKPAQSSLGVVIIYIREQS-------YQGIRFSRVARD----VSLQENAVKGTVVTKIQAQYPDGSKTGISHSIFSGNRMDAF---GINPVTGEIWVQKSEG-------------LDFEETPRL---RLVVKAETASSSSYMAVNLILQDVNDNLPRFQ--------LQNYVAFIREAQSHDFPIIQIAANDLDQGQNGQVTYSIRSSSQSNLFKIDPLTGSISTAAIMDREIWTQTKLVVTATD-----RGTPRLAGSATLTVIIVDLNDNRPMI------------PLPREIRVPEDTLLGTVITQVTGN---------DV-DSGPPLSYTLHLDGSSQDMFGIHHFGGGVSLTGQLDYEERTWYTLTVRTSDSTHQ---SEANLTVLVDDVNDNAPSF----THDLYQVTVVEHLPAGSAIITVTATDRDSGNNGKITYRVMSTT--------------------------KGIFYIDPSNGTLFTGQNTEFDYEHPSILVVVEAQDQGFPPLSSTTTVQIQVSDVNDNA 2347          

HSP 8 Score: 108.227 bits (269), Expect = 5.654e-23
Identity = 135/549 (24.59%), Postives = 210/549 (38.25%), Query Frame = 1
Query: 1333 NRFYINPLTGEILT--AGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYE-------SKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIY--DSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDL-GDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTP 2943
            + F INP+TGEI    +  +D+E      + V       S    + + +++VNDN P   +                Y A++ E +   F +  ++ +D D         S R  +Q N     +IDP   S+                T  + DRE  +Q    +   D  +  L+ S T  + I D+NDN P+  +P           + E   +GT I QV   D D G        LD  S   F I    G +      DYE+   + LT+  S+   + +          +TV ++DVND  P F  DLY  TV E       +  V   D D  +     Y +++S    I+  D S+  ++T  N++                    D E   S    ++A D+   PLSST  VQIQ+ DVNDN P++       Y   VS    +G  +  L   D DL  DN    + I   +   +F              S + F     F    + G++ + +K+    + S  + V  SD+G P
Sbjct: 1982 DAFGINPVTGEIWVQKSEGLDFEETPRLRLVVKAETASSSSYMAVNLILQDVNDNLPRFQL--------------QNYVAFIREAQSHDFPIIQIAANDLDQGQNGQVTYSIRSSSQSNLF---KIDPLTGSIS---------------TAAIMDREIWTQTKLVVTATDRGTPRLAGSATLTVIIVDLNDNRPMIPLP-------REIRVPEDTLLGTVITQVTGNDVDSGPPLSYTLHLDGSSQDMFGIHHFGGGVSLTGQLDYEERTWYTLTVRTSDSTHQSE--------ANLTVLVDDVNDNAPSFTHDLYQVTVVEHLPAGSAIITVTATDRDSGNNGKITY-RVMSTTKGIFYIDPSNGTLFTGQNTE-------------------FDYEH-PSILVVVEAQDQGFPPLSSTTTVQIQVSDVNDNAPIF---KQSKYTATVSEDGLLGSTVLTLDPVDGDLFRDNCGFDFAIASGNLGNAFQIE-----------SSVHFLEGRGFQ---TVGSLILVEKLDFEALPSYNLTVVVSDRGIP 2445          

HSP 9 Score: 108.227 bits (269), Expect = 5.750e-23
Identity = 119/446 (26.68%), Postives = 193/446 (43.27%), Query Frame = 1
Query: 1699 SLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSS---TQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLP----VFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAI------GYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            +LE RR  ++++ +  L+   + DRE+ S Y   L  FD  S   +  +T +I++ D+NDN P+F    Q SR  +   I E +  G +I+QV A+D D G N ++ Y ++   S     F ID  SG +      D+E     EL I A +   + + S        +TV++ D ND  P    +F  +  +  + EG     YV ++ V D D     N N      +      + DS +Y                 L+ V+  +LDRE+  ++  ++ A D    PL + +   I++ DVNDNPPL+  P          Y++AI      G  +  + A D D G NG ++Y I+              K+  V          H  F +D  TG I  + ++      +  I V ASD G PP      ++I + +++ N
Sbjct:   71 TLETRRGSNEVL-YLDLVVNTILDREKRSTYTLTLEAFDGGSPIRTDQMTLDITVQDINDNAPVF----QQSR--YHTIISENLQPGNSILQVFASDSDEGQNGMVSYEINRRQSDPDQYFVIDSHSGVITLNKPLDFEMRRVHELVIQAQDNATQPEVSNAF-----VTVHVRDYNDNQPTMTIIFLSEDGSPRISEGAQPGQYVARISVTDPDYGEYANVNVSLEGGDGKFALTTKDSIIY-----------------LVCVD-QILDREERDTYELRVMATDSGSPPLRAESSFIIEVTDVNDNPPLFDQP---------VYRQAIPEVVFPGSFVLQVTARDKDQGPNGDISYSIL--------------KDQSV---------YHSWFSIDSVTGIITTSSQLDYEKNPNPSITVVASDGGNPPLSSTAVVNILLQDINDN 454          

HSP 10 Score: 100.908 bits (250), Expect = 8.669e-21
Identity = 142/560 (25.36%), Postives = 225/560 (40.18%), Query Frame = 1
Query: 1138 LDINISLTDINDKQPHFKKTSIHKIINEN--IPLRSPILQLEAKDEDE-SDQHKLRFEFDNSVDETVRNR------FYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGK---HSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSK-----LID-HFQLIT-TKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSI---DPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSD-SQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSS 2748
            +++ I + DIND  P F +      I E   I  R P+     KD+ + + Q  L  + +     T+  R       Y++ +   IL     D E +S YT+ +   DG     +DQ TL I V+++NDN P                + S+Y   ++EN  PG  +  +  SD D          N ++         S E+ R QS      +ID H  +IT  K  D E    +   +   D+ +    ++    + + D NDN P   + F    G  S  I EG   G  + ++  TD D G  A +  SL+     +F++   D I   +    + D E+ + +EL + A++       S  L       + + DVND  P+F++ +Y   + E                       S   ++ +   D   + D S       S    +F I     I      LD EK  + S  + A+D    PLSSTA+V I + D+NDN P++     + Y V++    A G CI  + A D D G  G VTY +   S
Sbjct:    6 VEVTIKVNDINDHAPKFPRKRAKFQIPEQTAIGTRFPLEPAVDKDKGQLTTQGYLIKDGNTGQAFTLETRRGSNEVLYLDLVVNTIL-----DREKRSTYTLTLEAFDGGSPIRTDQMTLDITVQDINDNAPVF--------------QQSRYHTIISENLQPGNSILQVFASDSD-------EGQNGMV---------SYEINRRQSDPDQYFVIDSHSGVITLNKPLDFEMRRVHELVIQAQDNATQPEVSNAFVTVHVRDYNDNQPTMTIIFLSEDG--SPRISEGAQPGQYVARISVTDPDYGEYANVNVSLEG-GDGKFALTTKDSIIYLVCVDQILDREERDTYELRVMATD-----SGSPPLRAESSFIIEVTDVNDNPPLFDQPVYRQAIPE------------------VVFPGSFVLQVTARDKDQGPNGDISYSILKDQSVYHSWFSIDSVTGIITTSSQLDYEKNPNPSITVVASDGGNPPLSSTAVVNILLQDINDNEPVF---ERNFYNVSIKENTAPGTCILEVTAVDADGGTFGSVTYSLASGS 501          

HSP 11 Score: 93.9745 bits (232), Expect = 1.103e-18
Identity = 127/584 (21.75%), Postives = 236/584 (40.41%), Query Frame = 1
Query: 1060 FDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETS---QYFAQLICFDSDSNS---LSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRD----------------IGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPS 2745
             DRE      + + A D     L+G   + + + D+ND +P        ++  E+  L + I Q+   D D           D S     ++ F I+   G +   G +DYE ++ YT+ V  +D  H  +A LT+ V +VNDN P  +                 Y+  + E+   G  + +++ +D+D      GN  N  +  R+           S +K I +       +F  + T    ++ + L+  ++       LS++ T +I ++DVNDN PIF+      +  ++ ++ E   +G+T++ +   D D                +GN   I  S+  L    F      G L  ++  D+E +  + LT+  S+  I + +S        + ++++D ND  P F +  YT  + EG                  +   +    + ++  D   + + Q + +S  +   +     TG + +  P LD +   S +  +QA D       + A V I++ D+ND+ P   FP  H    ++   +     +  L A D D G  G +TY ++ S
Sbjct: 2103 MDREIWTQTKLVVTATDRGTPRLAGSATLTVIIVDLNDNRPMIPLPREIRV-PEDTLLGTVITQVTGNDVDSGPPLSYTLHLDGSS----QDMFGIHHFGGGVSLTGQLDYEERTWYTLTVRTSDSTHQSEANLTVLVDDVNDNAPSFT--------------HDLYQVTVVEHLPAGSAIITVTATDRDS-----GN--NGKITYRV----------MSTTKGIFYIDPSNGTLFTGQNTEFDYEHPSILVVVEAQDQGFPPLSSTTTVQIQVSDVNDNAPIFK------QSKYTATVSEDGLLGSTVLTLDPVDGDLFRDNCGFDFAIASGNLGNAFQIESSVHFLEGRGFQ---TVGSLILVEKLDFEALPSYNLTVVVSDRGIPQHSSS-----VSVLISVKDANDNPPAFSRTDYTVVLSEG------------------TAAGTEILHLSASDPDSAPNGEVQYFISSGDETHLFQMDSWTGALRLQRP-LDSKTQLSHTIVVQAVDGQGH--YALAPVHIEVKDINDHKPF--FPLQH-ITASIKENQPENSLVTILHAIDQDRGAFGMLTYHMLDS 2612          

HSP 12 Score: 83.9593 bits (206), Expect = 1.122e-15
Identity = 93/381 (24.41%), Postives = 163/381 (42.78%), Query Frame = 1
Query: 1126 LSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQ-------HKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDG----KHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLA--ENKDPGFVVASLSVSDKDY-ESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQL------ITTKM-FDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVN 2205
            LS  L + + +   N++ P F   +    + E  P+ +  LQ+ A   D           + LR + D          F I   +G +     +D E+K  Y + V+ + G    + +  AT+ I V + NDN+P                R +Q R ++A  EN   G     +   D+D   + RL     H       P+R              HFQ+      I+T+M  DRE+ S +   ++  D  S S + + T  I++ D NDN P F +  Q  + I    + EG + G  +  ++A D D G N  + YSL    + +FS++ I+GELR+   F Y +  ++ L + A++  +  +++     +Q +++N
Sbjct:  860 LSSTLMLVVHIQAENNQGPVFDTLNYCVDLKEGTPMNTRFLQVRALSRDIPGSGLLIPLTYHLRPDGDAGA-------FGIASDSGWLFVKSTLDREVKDMYLLTVLASVGHGHLRKTGSATVRISVTDENDNSP----------------RFTQERIFMAVRENLPAGTGFGHVLAKDRDSGPNGRLSYSFLH-------PNR--------------HFQINTHTGEISTRMTLDREQQSSHQLAVVVHDGGSPSRTATGTVFITVLDDNDNDPTF-IHGQPGKSI-IIQVTEGQSPGVLLGTLQAKDPDEGENGTVFYSLSGPRAERFSLNAINGELRSSSPFSYSERAEYSLMVTATDRGLPPRSASCSLAIQVLSIN 1194          

HSP 13 Score: 82.0333 bits (201), Expect = 4.104e-15
Identity = 163/718 (22.70%), Postives = 285/718 (39.69%), Query Frame = 1
Query:  871 LSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHS--DQATLTIEVKNVNDNNP--EISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAII---RYSL-DSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQK-ITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIG-ETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPN-THNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVD 2991
            ++L   S  GT +   +A DPD       +  +I+Y++V  G     +       +SL  ++    +  + + + + A DG          +NIS+       P F++T  H  ++E+  LR  ++              + +   +S D T    F ++P TG + T+  +D+E ++   + +    G      Q  + I + +VNDN P    S          T   +  YR   AE+KD G V   LS       S  +G Q    +D      R S E+R           L+ +  +  E T +Y  Q+I  DS    LS+++   + I   N+  P+F+         +   +KEG  + T  +QV+A  RDI  + ++    Y L     +  F I   SG L      D E  + + LT+ AS       +  L  T    + +++ D ND  P F ++     V+E                  +    + +  +++   D   S  +   + S    +++F+I   TG I   +  LDRE+ SS    +   D      ++T  V I +LD NDN P ++      +  + V+  ++ G  +  L+A DPD G+NG V Y +   S P                       R E F L+   G +  +     S+     + V A+D+G PP+     L I +++++
Sbjct:  572 VNLSTQSAPGTYVAKVMAYDPD-----LGENGRITYKTVPGGDSPYFTLNKDTGVISL--SRSIYGKANSVIPIVVSAQDGGGLFALVNAKVNISIVAGLVAPPVFEQTQYHFTVSED-ALRGTMVGTVQASSKTGISRDISYAI-SSGDPT--GYFTVDPDTGALRTSLPLDHESQASLNLDLQARSGSPPVFGQTRVHINIADVNDNPPVFLPSSSESLLLPEHTEMGTVVYRVQ-AEDKDSG-VNEELSFD----LSFPIGLQKVFSID------RNSGEIR-----------LVGSLCY--ETTPRYDLQVIAKDSGVPQLSSTLMLVVHIQAENNQGPVFDTLN------YCVDLKEGTPMNTRFLQVRALSRDIPGSGLLIPLTYHLRPDGDAGAFGIASDSGWLFVKSTLDREVKDMYLLTVLAS-----VGHGHLRKTGSATVRISVTDENDNSPRFTQERIFMAVRE------------------NLPAGTGFGHVLAKDRD---SGPNGRLSYSFLHPNRHFQINTHTGEISTRM-TLDREQQSSHQLAVVVHDGGSPSRTATGTVFITVLDDNDNDPTFIHGQPGKSIIIQVTEGQSPGVLLGTLQAKDPDEGENGTVFYSL---SGP-----------------------RAERFSLNAINGELRSSSPFSYSERAEYSLMVTATDRGLPPRSASCSLAIQVLSIN 1194          

HSP 14 Score: 77.0258 bits (188), Expect = 1.509e-13
Identity = 150/683 (21.96%), Postives = 266/683 (38.95%), Query Frame = 1
Query: 1030 EKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRL------GNQMNHL-LDCRIDPHRESLEL-RRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQ--FSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSS---DSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAA-DRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAI--GYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNGHGSSQGQFNK 3030
            E   +  N   DR+ Q   S        D   LS +  + + L DIND +P F        ++      + + ++ A D D  +  ++ ++   +V       F +N  TG I  +  I Y  K+   IP++V+     D   L   V      N ++++  ++G         +QY   ++E+   G +V ++  S K   S+ +      G+   +  +D      R SL L   SQ+ L    Q        R  +   F Q                  I+I DVNDNPP+F      S  +  ++      +GT + +V+A D+D G N  + + L      Q  FSID  SGE+R +    YE   +++L + A +  + + +S L+     + V+I+  N+  PVF+   Y   +KEG                  +  N+ + ++ +   DI  S        +   + DA  +    ++G + V    LDRE    +   + A+        + +A V+I + D NDN P +         + ++ +E +  G    ++ A D D G NG+++Y                         S +  NRH  F ++  TG I     +      S ++ V   D G+P +     + I +++ + N      GQ  K
Sbjct:  514 ETGQICTNAVLDRD-QGPDSFDFTVMAVDGGGLSSEAYVRVDLEDINDNRPAFYPLGYAVNLSTQSAPGTYVAKVMAYDPDLGENGRITYK---TVPGGDSPYFTLNKDTGVISLSRSI-YG-KANSVIPIVVS---AQDGGGLFALV------NAKVNISIVAGLVAPPVFEQTQYHFTVSEDALRGTMVGTVQASSKTGISRDISYAISSGDPTGYFTVDPDTGALRTSLPLDHESQASLNLDLQA-------RSGSPPVFGQ--------------TRVHINIADVNDNPPVFLPSSSESLLLPEHT-----EMGTVVYRVQAEDKDSGVNEELSFDLSFPIGLQKVFSIDRNSGEIRLVGSLCYETTPRYDLQVIAKDSGVPQLSSTLM-----LVVHIQAENNQGPVFDTLNYCVDLKEG------------------TPMNTRFLQVRALSRDIPGSGLLIPLTYHLRPDGDAGAFGIASDSGWLFVK-STLDREVKDMYLLTVLASVGHGHLRKTGSATVRISVTDENDNSPRFT-----QERIFMAVRENLPAGTGFGHVLAKDRDSGPNGRLSY-------------------------SFLHPNRH--FQINTHTGEISTRMTLDREQQSSHQLAVVVHDGGSPSRTATGTVFITVLDDNDNDPTFIHGQPGK 1099          

HSP 15 Score: 76.2554 bits (186), Expect = 2.500e-13
Identity = 83/312 (26.60%), Postives = 143/312 (45.83%), Query Frame = 1
Query: 1162 DINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGK-HSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHF--QLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIF---EVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGEL 2079
            D ND  P F +T    +++E     + IL L A D D +   ++++ F +S DET  + F ++  TG +     +D + +  +TI V   DG+ H   A + IEVK++ND+ P   + +++ S              + EN+    +V  L   D+D  +   G    H+LD      +E +E       LI+    ++ T   FD E+ + +    +    D  + S +VT ++ IT  ++  P+F   E+ F+         + EG   G  I  V+A D D G + I+ YSL S SS  F ++  +G +
Sbjct: 2459 DANDNPPAFSRTDYTVVLSEGTAAGTEILHLSASDPDSAPNGEVQY-FISSGDET--HLFQMDSWTGALRLQRPLDSKTQLSHTIVVQAVDGQGHYALAPVHIEVKDINDHKPFFPLQHITAS--------------IKENQPENSLVTILHAIDQDRGA--FGMLTYHMLDSP----KEGVE-----GILINQTSGEVRTRSAFDFEKKNSF--HFVAIAVDPGNYSATVTVQVYITGEDEYDPVFTSSELLFE---------VPEGAKKGQVIGTVQARDEDEGVDGIVLYSL-SESSPYFEVNSSTGTI 2730          

HSP 16 Score: 72.7886 bits (177), Expect = 2.802e-12
Identity = 108/433 (24.94%), Postives = 172/433 (39.72%), Query Frame = 1
Query: 1051 NKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDED------------ESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTD---GKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLE----LRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIH-SYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPI-----SGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEG 2274
            N +FD E   ++ V ++A D    PLS    + I ++D+ND  P FK++     ++E+  L S +L L+  D D             S      F+ ++SV       F      G ++    +D+E    Y + V+V+D    +HS   ++ I VK+ NDN P  S               + Y   L+E    G  +  LS SD D        ++ + +    + H   ++      R Q  L    QL  T +    +   ++A                   I + D+ND+ P F  P Q     H + SIKE     + +  + A D+D G   ++ Y +  L S +  ++ I     SGE+R    FD+EK   F     A +P     N     T+Q + +  ED  D  PVF      F V EG
Sbjct: 2306 NTEFDYE-HPSILVVVEAQDQGFPPLSSTTTVQIQVSDVNDNAPIFKQSKYTATVSEDGLLGSTVLTLDPVDGDLFRDNCGFDFAIASGNLGNAFQIESSVHFLEGRGFQT---VGSLILVEKLDFEALPSYNLTVVVSDRGIPQHSSSVSVLISVKDANDNPPAFS--------------RTDYTVVLSEGTAAGTEILHLSASDPDSAPN---GEVQYFISSGDETHLFQMDSWTGALRLQRPLDSKTQLSHTIVVQAVDGQGHYAL--------------APVHIEVKDINDHKPFF--PLQ-----HITASIKENQPENSLVTILHAIDQDRGAFGMLTYHM--LDSPKEGVEGILINQTSGEVRTRSAFDFEKKNSFHFVAIAVDP----GNYSATVTVQ-VYITGEDEYD--PVFTSSELLFEVPEG 2687          

HSP 17 Score: 69.3218 bits (168), Expect = 2.985e-11
Identity = 93/399 (23.31%), Postives = 154/399 (38.60%), Query Frame = 1
Query: 1837 TSVTFEISI--TDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSL-DSLSSTQFSIDPISG--ELRNID-----VFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRI-GETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDN-PPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            T VT E++I   D+ND+ P F       R    + I E  AIGT      A D+D G      Y + D  +   F+++   G  E+  +D     + D EK   + LT+ A +     +  Q+      + + ++D+ND  PVF++  Y   + E                      NS      S+  +  +   S       SD  QYF I   +G+I +N P LD E        IQA D + +P  S A V + + D NDN P + +   + +    +S     G  +A +   DPD G+   V   +      F+  T +    L                        + + Q +   +  + ++ V A+D G+PP +      I + +V+ N
Sbjct:    2 TGVTVEVTIKVNDINDHAPKFP------RKRAKFQIPEQTAIGTRFPLEPAVDKDKGQLTTQGYLIKDGNTGQAFTLETRRGSNEVLYLDLVVNTILDREKRSTYTLTLEAFDGGSPIRTDQM-----TLDITVQDINDNAPVFQQSRYHTIISE-----------------NLQPGNSILQVFASDSDEGQNGMVSYEINRRQSDPDQYFVIDSHSGVITLNKP-LDFEMRRVHELVIQAQDNATQPEVSNAFVTVHVRDYNDNQPTMTIIFLSEDGSPRISEGAQPGQYVARISVTDPDYGEYANVNVSLEGGDGKFALTTKDSIIYL------------------------VCVDQILDREERDTYELRVMATDSGSPPLRAESSFIIEVTDVNDN 347          

HSP 18 Score: 65.0846 bits (157), Expect = 5.730e-10
Identity = 72/264 (27.27%), Postives = 114/264 (43.18%), Query Frame = 1
Query:  844 PKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTD-GKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPG-RSSQYRAYLAENKDPGFVVASLSVSDKD 1629
            P +S     + L E +  GTEI    A DPD  P    Q Y IS       F++     D +   +L + +  D + Q + ++ ++A DG  +       ++I + DIND +P F    I   I EN P  S +  L A D+D      L +   +S  E V     IN  +GE+ T    D+E K+ +    I  D G +S  AT+T++V             Y++G +   P   SS+    + E    G V+ ++   D+D
Sbjct: 2465 PAFSRTDYTVVLSEGTAAGTEILHLSASDPDSAPNGEVQ-YFISSGDETHLFQM-----DSWTG-ALRLQRPLDSKTQLSHTIVVQAVDGQGH--YALAPVHIEVKDINDHKPFFPLQHITASIKENQPENSLVTILHAIDQDRGAFGMLTYHMLDSPKEGVEG-ILINQTSGEVRTRSAFDFEKKNSFHFVAIAVDPGNYS--ATVTVQV-------------YITGEDEYDPVFTSSELLFEVPEGAKKGQVIGTVQARDED 2703          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: ENSORLT00000005325.2 (protocadherin-16 [Source:NCBI gene;Acc:101171352])

HSP 1 Score: 244.588 bits (623), Expect = 1.005e-64
Identity = 197/669 (29.45%), Postives = 321/669 (47.98%), Query Frame = 1
Query:  841 SPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHS-GRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQAT---LTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHD--IYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDR-EKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVP-SSFPFSFNTNEESKNLEVTESSDIKFN 2823
            +P++      L +PEH+ +GT  +L  A D D+    TTQ Y I   +V   FKL+     +    L L+V+   DREK+++ S+ ++AFDG      G + + +++TDIND  P F ++  H II+E++P  S ILQ+ A DEDE D   + +E +    +  R  F I+  +G I     +DYE+K  + + V   D     + T   +TI V++ NDN P +++++LS                ++E   PG  VA +SV+D DY     G   N  +       + +L  + S   LI        ++ DREE   Y  +++  DS +  L    +F I +TDVNDNPP+F+      +  +  +I E V  G+ ++QV A D+D G N  +RYSL       FSIDPI+G +      D+E      +T+ A++          L +  K+ + ++DVND  PVF  + Y  +VKE                  ++   + + ++ +   D   + +    +   S       F I +          LDR E +  +   + A D     LSS   V+++++D+NDN P + +P    Y V++S   A G  +  + ANDPD G+NG++TYR VP  S PF F  N+++  + ++ S   K N
Sbjct:  123 APEFPKKKALLKIPEHTVVGTRFSLDPATDADKDQL-TTQGYAIKEGNVGHMFKLESKRSANKVLYLDLVVSGLLDREKRSSYSLVIEAFDGGSPRRVGFMTLEVTVTDINDHAPVFNQSRYHAIISESLPQGSSILQVFAADEDEGDNGLVLYEINRRQSDPER-YFVIDLKSGVITLNRPLDYELKRVHELVVQARDNASQPEVTNAFVTIHVRDFNDNQPTMTIIFLSEDG----------SPRISEGAQPGQYVARISVTDPDY-----GEYANVNVSLEGGDGKFALTTKDSIIYLI-----YVDQVLDREERDSYDLRVMATDSGTPPLRAESSFTIQVTDVNDNPPLFD------QQAYRQTIPEVVYPGSFVLQVTARDKDQGPNGDVRYSLLK-GKKWFSIDPITGIITTATALDFESEPAPSVTVIATD-----GGRPPLSSTAKVDIVVQDVNDNAPVFSSNFYNVSVKE------------------NTPAGTCFLEVSATDEDRGSFGTITYALTLKSGGTVQTPFTINKQTGQLCTASALDRDEGLEKYDLTVTATDGGG--LSSAVGVRVKVMDINDNRPTF-YPVL--YTVSLSTHSAPGTSVVKVTANDPDAGENGRITYRTVPGGSSPF-FTLNKDTGVISLSRSLHSKAN 733          

HSP 2 Score: 147.517 bits (371), Expect = 5.368e-35
Identity = 166/647 (25.66%), Postives = 270/647 (41.73%), Query Frame = 1
Query:  871 LSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEI-KSEYTIPVIVTDGKHSDQATLT---IEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRL--------GNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQ-FSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHD--IYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFN 2766
            + +PE++ IGTEITL    D D  P        +SY  + D   L   G   Y    + +    D E++   +V ++A D        + +I I + DIND  P F        + E+ P  S ++ + A D D  +  ++ +   +S  E     FYI+P  G +      +++  +    I +  +DG     ++LT   + + ++NDN P                  S+YRA ++E+  PG  +      D D   +          GN+ N     +I+     LE R  Q+       L+  +  D E  S Y   ++  D      S+SV   I+I DVNDNPP+F      SR  ++ ++ EG   GT I+++ ATD D   NA ++Y++ S      FSID  +G LR     D E      +       II+  + Q  + L  + V+++DVND  P F  +  T T++E                  +   NS    + +  HD  ++      M   S S    +     +G +   +P  D EKI+SF+F   A D      S+T  VQ+ +   ++  PL+    + ++   V      G  I  + A D D G +G V Y ++PSS  F  N
Sbjct: 2260 IRIPENTLIGTEITLVTGNDVDSSPA-------LSYSLLLDPTALGKFGIHRYTG-GVSITGPLDFEEKTWYTVTVQATDSQHQT---EANITIVVEDINDNAPLFTHDLYQISLPEHTPPGSAVITVTATDRDSGENGRVNYRVMSSTQEG----FYIDPSNGTLFINHRAEFDPERPSVNIVIEASDGGSPALSSLTTVQVHISDINDNAPVF--------------HQSEYRAMVSEDTFPGSTLLIFEAFDNDLSRENCGFDFAIANGNEGNVF---QIESSVRFLEGRGFQTV----GTLLLAEGLDFETKSLYNLTVVVSDRGVPQRSSSVAALITIGDVNDNPPVF------SRPEYTVALSEGAVSGTEIIRLTATDPDSTPNAEVQYTISSGDEMNLFSIDQWTGALRLQRALDREHQSTHVV-------IIQATDGQGYFALVPVIVDVKDVNDNHPYFPVETLTATIQE------------------NLPANSPVTVLHAIDHDTGVFGQLKYYMMERSGSGRDSFVIEQNSGEVRSKIP-FDFEKINSFNFVAVAVDSGNH--SATVTVQVFVTGEDEYDPLF---TSTDFAFEVPEGAKKGQSIGQVLARDEDGGVDGIVLYSLLPSSPYFDVN 2833          

HSP 3 Score: 140.969 bits (354), Expect = 5.272e-33
Identity = 169/664 (25.45%), Postives = 274/664 (41.27%), Query Frame = 1
Query: 1042 LIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKH---SDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRY-SLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINA------SNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGET-GLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNG 3000
            + V++  DRE++ +  +++ A D    PL  +    I +TD+ND  P F + +  + I E +   S +LQ+ A+D+D+     +R+          +  F I+P+TG I TA  +D+E +   ++ VI TDG     S  A + I V++VNDN P  S      SNF        Y   + EN   G     +S +D+D  S      + + L  +     ++      Q+      QL T    DR+E  + +  L    +D   LS++V   + + D+NDN P F  P      +++ S+    A GT++V+V A D D G N  I Y ++   SS  F+++  +G +        +      + I A      + P+  R N           V+I   +   PVFE+  Y FTV E   +   VG V        S               IY       Y+ S+ D   YF +  T G I   +P LD E  SS   +IQA   S  P    + V I I D+NDN P   F  + +  + +     +G  I  ++A D D G NG++++ ++ +    S                    +    F +D  +G + +   +    V    + V A D G P       L ++I   D  G
Sbjct:  407 IYVDQVLDREERDSYDLRVMATDSGTPPLRAESSFTIQVTDVNDNPPLFDQQAYRQTIPEVVYPGSFVLQVTARDKDQGPNGDVRYSLLKG-----KKWFSIDPITGIITTATALDFESEPAPSVTVIATDGGRPPLSSTAKVDIVVQDVNDNAPVFS------SNF--------YNVSVKENTPAGTCFLEVSATDEDRGSF---GTITYALTLKSGGTVQTPFTINKQTG-----QLCTASALDRDEGLEKY-DLTVTATDGGGLSSAVGVRVKVMDINDNRPTF-YPV-----LYTVSLSTHSAPGTSVVKVTANDPDAGENGRITYRTVPGGSSPFFTLNKDTGVISLSRSLHSKANTVISMVITAVDGDGLTAPVNARVN-----------VSIVGGSTSSPVFEQAQYFFTVSEDVLRGTAVGVVRAATKTGVS-------------KGIY-------YSISSGDPDGYFTVDSTSGTIRTALP-LDHETCSSLDLEIQARYGS-PPSYGISRVHISISDINDNAP--TFLPSSSESLLLPEVTKMGTVIYRIQATDKDSGHNGQLSFDLISAGAAGS--------------------SGQRTFGIDRGSGEVRLIGSLSYDSVPRYDLQVIAKDGGAPQLSSTFTLVVHIQAQDAQG 981          

HSP 4 Score: 137.887 bits (346), Expect = 5.287e-32
Identity = 172/719 (23.92%), Postives = 289/719 (40.19%), Query Frame = 1
Query:  841 SPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQ--SVNDGFKLKHSGRDHYEKLS--LIVNKDFDREKQATVSVKLKAFDGDPNPLS----GQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDG---KHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQ--LITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLS-STQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGE-TGLIHVNVPVLDREKISSFSFKIQAADRSEK-PLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQ 2949
            +P++S   + + +PE+ + G  I    A D D    N+  +Y I +Q    +D   L        + LS  L + +  DRE    + + ++A D   + LS    G +   + + D ND  P F   S   ++ E+ P+   IL + A D DE +  ++ +   +  +     RF ++P TG +     +D E +  + + ++  D    + S    L ++V +VND  P                + +++  ++ ENK PG  V  ++ +D+D  S        H+    +               +I+     + TTK  D E  + Y   +   D             + + DVNDN P+F   + G     +    E       +  VKATD D G    + Y + +      F +   +G L      D EK  K+ L + A +     + S  L     + V + DVND  PVF K+ YT  V E                         Y  +  +  D+ +  + ++    + +A   F + E TG I    P LDREK++S++F++ A D S   P++S+A V++ ILDVNDN P ++  +    EV+    + +   +A +KA D D G NG V YR       FS N+                            TG I   + +       + + VEA DQG+P Q
Sbjct: 1415 APQFSEDPVTIVIPENKEPGASIYAFQAGDQDGSGPNSELRYSIEHQWPQTSDLLAL--------DPLSGVLTIRQQLDRESTPFLYLVVRATDQAVD-LSQRRWGSVTARLFVKDENDNPPVFSSPSAISVM-EDQPVGFVILHVMAHDADEGENGRVSYRIQSGNNA---GRFSLSPNTGSLSILKALDREEQEVFNLTIVAEDHGIPQLSTSQVLCVQVIDVNDEAPMF--------------QQAEFGTHVMENKGPGTTVLKVTATDRDQGSN------GHITYGGV----------TEDGFVINPLTGVITTTKELDAELQNHYVLTVYARDGGLPPNFAKAVVRVEVQDVNDNAPVFAKMWYGLEVPENQPAVE-------LCFVKATDPDSGPGGELEYKIAAGDPDGDFQLHSRTGALSTSHGLDREKKPKYTLEVVAVD-----RGSPALSATATVEVKVLDVNDNSPVFSKNSYTVEVLE--------------------NAEEGYQVLQVSATDVDEGLNGKILYFLSQEADGAFAVDEDTGRITTAAP-LDREKLASYNFRVFAVDLSPSVPINSSAQVKVTILDVNDNAPFFI-QDPLIIEVSSRRSQRV---LATMKAEDKDFGANGSVFYRFATPVKGFSINS---------------------------LTGEIQATEPLGSLTQAQRTLIVEAMDQGSPAQ 2026          

HSP 5 Score: 121.324 bits (303), Expect = 4.855e-27
Identity = 154/597 (25.80%), Postives = 248/597 (41.54%), Query Frame = 1
Query: 1138 LDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTD---GKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLD----CRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGEL--RNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKII-SNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDV 2898
            +  N+ L D+ND  P F+  +    + E      PI+Q+ A+D D+    ++ +   +S   ++   F I+P+TG I T   +D EI ++  + V  TD    + +  ATLT+ + + NDN+P I +               + R  + EN   G  +  ++ +D D  S  L   +  LLD     +   HR +  +               T   D EE + Y   +   DS      T     I + D+NDN P+F      +  ++  S+ E    G+ ++ V ATDRD G N  + Y + S +   F IDP +G L   +   FD E+     + I AS+       S  L +L  + V+I D+ND  PVF +  Y   V E       +      D+D+S +     F I   N  +++    S  +          F+   T L+      LD E  S ++  +  +DR     SS+    I I DVNDNPP++  P    Y V +S     G  I  L A DPD   N +V Y I        F+ ++ +  L +  + D +     +  +  + G  Y A    + DV
Sbjct: 2133 MAFNLVLQDVNDNLPRFQLQNYVAFMKEAQGYEMPIIQVVAEDVDQGQNGQVTYSIQSS---SMSGLFKIDPVTGSITTTAIMDREIFTQTKLVVTATDRGSPRLAGLATLTVIIIDQNDNSPTIPL-------------PQEIR--IPENTLIGTEITLVTGNDVD-SSPALSYSL--LLDPTALGKFGIHRYTGGVS-------------ITGPLDFEEKTWYTVTVQATDSQHQ---TEANITIVVEDINDNAPLF------THDLYQISLPEHTPPGSAVITVTATDRDSGENGRVNYRVMSSTQEGFYIDPSNGTLFINHRAEFDPER-PSVNIVIEASD-----GGSPALSSLTTVQVHISDINDNAPVFHQSEYRAMVSEDTFPGSTLLIFEAFDNDLSRENCGFDFAIANGNEGNVFQIESSVRFLEGRG-----FQTVGTLLLAEG---LDFETKSLYNLTVVVSDRGVPQRSSSVAALITIGDVNDNPPVFSRP---EYTVALSEGAVSGTEIIRLTATDPDSTPNAEVQYTISSGDEMNLFSIDQWTGALRLQRALDREHQSTHVVIIQATDGQGYFALVPVIVDV 2669          

HSP 6 Score: 115.931 bits (289), Expect = 2.089e-25
Identity = 169/731 (23.12%), Postives = 298/731 (40.77%), Query Frame = 1
Query:  841 SPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKK----TSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTD-GKHSDQATLTIEVKNVNDNN--PEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQ--LITTKMFDREETSQYFAQLICFD-SDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRD-IGNNAIIRYSLD---SLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPP--QKKIERLHINIVN 2985
            SP+ S   ++L++ E+   GT      A D D    N    Y++ +   +  F++     +   +L+L      DRE+Q++  + +   DG   P S     +IS+ D ND  P F      T     + E +P  + +  + AKD DE +   + +    S  E    RF +NP TGE+ TA  + +  ++EYT  +   D G     +T  I ++ ++ +   P+ +VL ++                + E   PG ++ S+   DK  ES  L  Q+ +L+    D         R  + ++D  +  +   +  D E+ S Y   +   D S +   S  V  EI++ D ND+ P F      S    +  I E    G +I   +A D+D  G N+ +RYS++     +S   ++DP+SG L      D E      L + A++  ++   SQ  +      + ++D ND  PVF        +++ P   V                      ++++  D  ++        S ++A ++     TG + + +  LDRE+   F+  I A D     LS++ ++ +Q++DVND  P++       +  +V   +  G  +  + A D D G NG +TY  V       F  N  +  +  T+  D +   H            Y+             + V A D G PP   K + R+ +  VN
Sbjct: 1095 SPRLSQERVFLAVRENLVAGTGFGRVSATDRDAG-LNARLTYRLLH--ADKHFQINSQTGEISTRLAL------DREQQSSYQLFVVVQDGGTPPRSATGTAHISVLDENDHAPTFTHVRPDTERMFEVREGLPSGTMVGSVAAKDPDEGENGTVYYSLSGSRVE----RFSLNPNTGELKTASPLRWAERAEYTFTLTAADHGTPGLSSTCQIRIQVISSSRSIPKPNVLSMT--------------LNVVEGTAPGSIIGSVGQVDKP-ESNVLEGQVTYLVVDGTD---------RDGTFMVDRLRGDVYLVRELDYEKGSSYTLHVEVSDFSKAFPNSYLVKLEINVQDSNDHAPQF------SEDPVTIVIPENKEPGASIYAFQAGDQDGSGPNSELRYSIEHQWPQTSDLLALDPLSGVLTIRQQLDRESTPFLYLVVRATDQAVDL--SQRRWGSVTARLFVKDENDNPPVFSSPSAISVMEDQPVGFV-------------------ILHVMAHDADEGENGRVSYRIQSGNNAGRFSLSPNTGSLSI-LKALDREEQEVFNLTIVAEDHGIPQLSTSQVLCVQVIDVNDEAPMF---QQAEFGTHVMENKGPGTTVLKVTATDRDQGSNGHITYGGVTED---GFVINPLTGVITTTKELDAELQNH------------YV-------------LTVYARDGGLPPNFAKAVVRVEVQDVN 1729          

HSP 7 Score: 100.138 bits (248), Expect = 1.508e-20
Identity = 144/590 (24.41%), Postives = 235/590 (39.83%), Query Frame = 1
Query: 1039 SLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDY-ESKRLGNQM--NHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDI----------------GNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGE-TGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSS 2748
            S+      DRE      + + A D     L+G   + + + D ND  P        +I  EN  + + I  +   D D S        +   +D T   +F I+  TG +   G +D+E K+ YT+ V  TD +H  +A +TI V+++NDN P  +                 Y+  L E+  PG  V +++ +D+D  E+ R+  ++  +      IDP   +L         I+H        FD E  S     +   D  S +LS+  T ++ I+D+NDN P+F       +  +   + E    G+T++  +A D D+                GN   I  S+  L    F      G L   +  D+E    + LT+  S+  + +++S +        + I DVND  PVF +  YT  + EG                      +   ++ +   D   +++ Q YT S+ D    F I + TG + +    LDRE  S+    IQA D          IV ++  DVNDN P   FP        +         +  L A D D G  G++ Y ++  S
Sbjct: 2205 SITTTAIMDREIFTQTKLVVTATDRGSPRLAGLATLTVIIIDQNDNSPTIPLPQEIRI-PENTLIGTEITLVTGNDVDSSPA----LSYSLLLDPTALGKFGIHRYTGGVSITGPLDFEEKTWYTVTVQATDSQHQTEANITIVVEDINDNAPLFT--------------HDLYQISLPEHTPPGSAVITVTATDRDSGENGRVNYRVMSSTQEGFYIDPSNGTL--------FINH-----RAEFDPERPSVNIV-IEASDGGSPALSSLTTVQVHISDINDNAPVFH------QSEYRAMVSEDTFPGSTLLIFEAFDNDLSRENCGFDFAIANGNEGNVFQIESSVRFLEGRGFQ---TVGTLLLAEGLDFETKSLYNLTVVVSDRGVPQRSSSV-----AALITIGDVNDNPPVFSRPEYTVALSEGAVS------------------GTEIIRLTATDPDSTPNAEVQ-YTISSGDEMNLFSIDQWTGALRLQ-RALDREHQSTHVVIIQATDGQGYFALVPVIVDVK--DVNDNHPY--FP-VETLTATIQENLPANSPVTVLHAIDHDTGVFGQLKYYMMERS 2722          

HSP 8 Score: 99.7525 bits (247), Expect = 1.800e-20
Identity = 129/504 (25.60%), Postives = 213/504 (42.26%), Query Frame = 1
Query:  841 SPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVN--KDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQH-KLRFEFDNS-------VDETVR---NRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTD---GKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYE-------SKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSST---QFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEG 2274
            +P ++     +SLPEH+  G+ +    A D D    N    Y++   S  +GF +  S        +L +N   +FD E+  +V++ ++A DG    LS    + + ++DIND  P F ++    +++E+    S +L  EA D D S ++    F   N        ++ +VR    R +     G +L A  +D+E KS Y + V+V+D    + S      I + +VNDN P           F  P    +Y   L+E    G  +  L+ +D D         +   G++MN      ID    +L L+R+                DRE  S +   +I   +D       V   + + DVNDN P F V         + +I+E +   + +  + A D D G    ++Y +   S +    F I+  SGE+R+   FD+EK+  F     A    ++  N     T+Q + V  ED  D  P+F    + F V EG
Sbjct: 2351 APLFTHDLYQISLPEHTPPGSAVITVTATDRDS-GENGRVNYRV-MSSTQEGFYIDPSNG------TLFINHRAEFDPER-PSVNIVIEASDGGSPALSSLTTVQVHISDINDNAPVFHQSEYRAMVSEDTFPGSTLLIFEAFDNDLSRENCGFDFAIANGNEGNVFQIESSVRFLEGRGFQT--VGTLLLAEGLDFETKSLYNLTVVVSDRGVPQRSSSVAALITIGDVNDNPPV----------FSRP----EYTVALSEGAVSGTEIIRLTATDPDSTPNAEVQYTISSGDEMNLF---SIDQWTGALRLQRA---------------LDREHQSTHV--VIIQATDGQGYFALVPVIVDVKDVNDNHPYFPVE------TLTATIQENLPANSPVTVLHAIDHDTGVFGQLKYYMMERSGSGRDSFVIEQNSGEVRSKIPFDFEKINSFNFVAVA----VDSGNHSATVTVQ-VFVTGEDEYD--PLFTSTDFAFEVPEG 2796          

HSP 9 Score: 93.9745 bits (232), Expect = 1.002e-18
Identity = 150/678 (22.12%), Postives = 271/678 (39.97%), Query Frame = 1
Query: 1060 FDREKQATVSVKLKAFDGDPN-PLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSP--ILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRL------GNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYS--IKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLS-STQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQL--LYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYF---------RIGE------TGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHN-YEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLS-DVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNG 3000
             DREK A+ + ++ A D  P+ P++    + +++ D+ND  P F +     +I E    RS   +  ++A+D+D      + + F   V       F IN LTGEI     +    +++ T+ V   D     Q+   + V  V +          +G  F    R       + EN   G  VA       D   + +      GN+  HL                  S       + ++   D EET +     +   +++ S ++ + F + + DVNDN P F+        + +Y   +KE       I+QV A D D G N  + YS+ S S S  F IDP++G +    + D E   + +L + A+    +R + +L  L TL  I ++  D +  +P+ ++                                      I  P +    ++  + T ++ D+S             +G+      TG + +  P LD E+ + ++  +QA D   +   + A + I + D+NDN PL+    TH+ Y++++      G  +  + A D D G+NG+V YR++ S+                           E F +D S G ++I  + +   +  S  I +EASD G+P    +  + ++I +++ N 
Sbjct: 1901 LDREKLASYNFRVFAVDLSPSVPINSSAQVKVTILDVNDNAPFFIQ---DPLIIEVSSRRSQRVLATMKAEDKDFGANGSVFYRFATPV-----KGFSINSLTGEIQATEPLGSLTQAQRTLIVEAMDQGSPAQSAHGVVVVYVKEVE-------YNGIRFSKNARD----VSIQENASKGTAVAQAQAEYPDGTRQGISYSLFSGNK-KHLFKI---------------SSSTGEIWVESSNGLDFEETPRL---RLVVKAETVSSTSFMAFNLVLQDVNDNLPRFQ--------LQNYVAFMKEAQGYEMPIIQVVAEDVDQGQNGQVTYSIQSSSMSGLFKIDPVTGSITTTAIMDREIFTQTKLVVTAT----DRGSPRLAGLATLTVIIIDQNDNSPTIPLPQE--------------------------------------IRIPENTLIGTEITLVTGNDVDSSPALSYSLLLDPTALGKFGIHRYTGGVSITGP-LDFEEKTWYTVTVQATDSQHQ---TEANITIVVEDINDNAPLF----THDLYQISLPEHTPPGSAVITVTATDRDSGENGRVNYRVMSST--------------------------QEGFYIDPSNGTLFINHRAEFDPERPSVNIVIEASDGGSPALSSLTTVQVHISDINDNA 2456          

HSP 10 Score: 86.2705 bits (212), Expect = 2.475e-16
Identity = 94/378 (24.87%), Postives = 161/378 (42.59%), Query Frame = 1
Query: 1090 VKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQ------------HKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSD-----QATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLA--ENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQL------ITTKM-FDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASN 2145
            +++ A DG    LS    + + +   + + P+F   +    + EN PL +  LQ+ A + + S              ++LR + D +        F I P +G +     +D E K  Y + V+ T  +HS       AT+ + V + NDN+P                R SQ R +LA  EN   G     +S +D+D         +N  L  R+  H +             HFQ+      I+T++  DRE+ S Y   ++  D  +   S + T  IS+ D ND+ P F      +  +  + ++EG+  GT +  V A D D G N  + YSL      +FS++P +GEL+      + +  ++  T+ A++
Sbjct:  952 LQVIAKDGGAPQLSSTFTLVVHIQAQDAQGPNFDTLTYRVELRENAPLNTRFLQVRALNREASGNGGSSSSISSSISYRLRPDGDAA-------GFGIMPDSGWLFVRSSLDREAKDMYLLTVLATS-RHSGTGRTGSATVRVTVTDENDNSP----------------RLSQERVFLAVRENLVAGTGFGRVSATDRDA-------GLNARLTYRL-LHADK------------HFQINSQTGEISTRLALDREQQSSYQLFVVVQDGGTPPRSATGTAHISVLDENDHAPTFTHVRPDTERM--FEVREGLPSGTMVGSVAAKDPDEGENGTVYYSLSGSRVERFSLNPNTGELKTASPLRWAERAEYTFTLTAAD 1283          

HSP 11 Score: 69.707 bits (169), Expect = 2.663e-11
Identity = 91/399 (22.81%), Postives = 176/399 (44.11%), Query Frame = 1
Query:  898 GTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHS-----GRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGK-HSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKM-FDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISG 2073
            G+ + +  A D D    N    + I+  +  + F+++ S     GR      +L++ +  D E ++  ++ +   D      S  +   I++ D+ND  P F +      ++E     + I++L A D D +   ++++   +S DE   N F I+  TG +     +D E +S + + +  TDG+ +     + ++VK+VNDN+P   V  L+              A + EN      V  L   D D     +  Q+ + +  R    R+S  + ++  +       + +K+ FD E+ + +    +    DS + S +VT ++ +T  ++  P+F      +    ++ + EG   G +I QV A D D G + I+ YSL   SS  F ++  +G
Sbjct: 2475 GSTLLIFEAFDNDLSRENCGFDFAIANGNEGNVFQIESSVRFLEGRGFQTVGTLLLAEGLDFETKSLYNLTVVVSDRGVPQRSSSVAALITIGDVNDNPPVFSRPEYTVALSEGAVSGTEIIRLTATDPDSTPNAEVQYTI-SSGDEM--NLFSIDQWTGALRLQRALDREHQSTHVVIIQATDGQGYFALVPVIVDVKDVNDNHPYFPVETLT--------------ATIQENLPANSPVTVLHAIDHD---TGVFGQLKYYMMERSGSGRDSFVIEQNSGE-------VRSKIPFDFEKINSF--NFVAVAVDSGNHSATVTVQVFVTGEDEYDPLF------TSTDFAFEVPEGAKKGQSIGQVLARDEDGGVDGIVLYSLLP-SSPYFDVNKTTG 2837          

HSP 12 Score: 68.5514 bits (166), Expect = 5.729e-11
Identity = 103/431 (23.90%), Postives = 162/431 (37.59%), Query Frame = 1
Query: 1747 LITTKM-FDREETSQYFAQLICFDSDSNSLSTSVTFEISIT--DVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDS--------LSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNS-NSDASQYFRIG-ETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDN-PPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGN 2997
            +ITTK   DREE   Y    +          T +T E+SIT  D+ND+ P  E P + +       I E   +GT      ATD D        Y++          L S + +   +  +L    + D EK   + L I A +    R+          + V + D+ND  PVF +  Y   + E                  S    S+  ++ +   D  D+       N   SD  +YF I  ++G+I +N P LD E        +QA D + +P  + A V I + D NDN P + +   + +    +S     G  +A +   DPD G+   V   +      F+  T +    L                        IY+ Q +   +  S  + V A+D GTPP +      I + +V+ N
Sbjct:   83 IITTKRRLDREERDHYSFIAVTM--------TGITIEVSITVNDINDHAP--EFPKKKAL----LKIPEHTVVGTRFSLDPATDADKDQLTTQGYAIKEGNVGHMFKLESKRSANKVLYLDLVVSGLLDREKRSSYSLVIEAFDGGSPRR-----VGFMTLEVTVTDINDHAPVFNQSRYHAIISE------------------SLPQGSSILQVFAADEDEGDNGLVLYEINRRQSDPERYFVIDLKSGVITLNRP-LDYELKRVHELVVQARDNASQPEVTNAFVTIHVRDFNDNQPTMTIIFLSEDGSPRISEGAQPGQYVARISVTDPDYGEYANVNVSLEGGDGKFALTTKDSIIYL------------------------IYVDQVLDREERDSYDLRVMATDSGTPPLRAESSFTIQVTDVNDN 451          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: pcdh7b (protocadherin 7 [Source:NCBI gene;Acc:101166584])

HSP 1 Score: 226.483 bits (576), Expect = 9.985e-60
Identity = 238/905 (26.30%), Postives = 399/905 (44.09%), Query Frame = 1
Query:  412 NYSMLVLIRFCILLSYFFNKEIHGQIEIHFKVVEESPTNSVIGNIHNQALKQKGGVGSGDYYYKSITDIEPFFLDSKTYEFRVS-KRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKI-------------------SYQSVNDG------FKLKHSGRDHYEKL-SLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHS---DQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPH-----RESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIG--------------ETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINI 2979
            N + +  + +C+L+    ++    Q+ + +++ EE P +  +GN+   A       GS +  +   +  E F +D+ T E   + KR+DRE++ + QM      C + ++     +IG      + S  ++    V I+DINDN+P + SP + LS+ E+  IGT   LP A D D    N  ++Y++                     +  ++G      F+L+ +     EK   LI+    DRE++ +  + L+  DG   P S Q  + + +TD+ND  P F+K+     + EN    SPILQL+A D D     ++ + F  +  E+VR    ++  TG +     ID E  S+    V+  D       D+AT+ + +K+ NDN P I +  + G  F   G      A +AE+      +A + VSD+D          N ++ C +        + + E+   Q+K    + L T+   D E T +Y   ++  DS S SL+++ +  + + D NDNPPIF      S+ +   S  E  A G  +  V ATD D G NA I YSLDS  +  FSID  SG++R     D E+ E++E  +     I + K    L     + V ++D ND  P F +D++TF VKE                                  ++  +S   M T  ++D  Q   +G              ETG I   +   DRE+ ++++F+++A D  + P S+TA V + ++D NDN P   FP   +Y + +     +   +  + A D D G N  + Y I                         I  N   +F++DG+TG I +  K++    G  ++ V+ +D G P Q     +H+ +
Sbjct:    4 NAAAVDCLYYCMLILQLAHQPAAKQV-LRYRLAEEGPADVRVGNV---AADLGMVAGSREVTFTLESGSEFFKIDNITGELTTNEKRIDREKLQQCQMIFDENECFIDFEV---SVIG-----PAQSWVDLFEGKVIILDINDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFG-RNGIERYELIQDNGENSRRSGSSGDSYSGKRRFDEGASRSSVFELQVADTTDGEKQPQLIIKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVMITDVNDNNPRFEKSVYEADLPENSSPGSPILQLKAADADVGVNGQIEYVF-GAATESVRRLLRLDESTGWLSVLHRIDREEVSQLRFTVMARDRGQPPKMDKATVVLNIKDENDNVPAIEIRKI-GRIFLKDG-----VANVAEDVVVDTPIALVQVSDRDQGE-------NGIVTCTVVGDVPFQLKPASEMEGEQNK--KKYFLHTSAPLDYETTQEYNVVIVAVDSGSPSLTSNNSLLVKVGDTNDNPPIF------SKNVVQVSFPENNAPGERVTTVTATDADSGKNAEISYSLDSSVNGIFSIDSDSGDIRVNTNLDREQKERYEFKV-----IAKDKGINTLQGSATVVVLVDDKNDNEPKFMQDVFTFYVKE----------------------------------NLDPNSPVGMVTVIDADKGQNAEMGLFIEEEEEIFSIENETGTIFSTLS-FDREQKTTYTFRVKAVDGGDPPRSATATVSLFVMDENDNAPTVTFPINSSYTL-LPPSSTVRTVVRTVIATDTDTGINADLNYSI-------------------------IGGNPFRLFEIDGATGVISLMAKLEQKHYGLHRLVVQVTDNGQPSQSTTTLVHVYV 807          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: pcdh7b (protocadherin 7 [Source:NCBI gene;Acc:101166584])

HSP 1 Score: 226.098 bits (575), Expect = 1.361e-59
Identity = 235/891 (26.37%), Postives = 397/891 (44.56%), Query Frame = 1
Query:  412 NYSMLVLIRFCILLSYFFNKEIHGQIEIHFKVVEESPTNSVIGNIHNQALKQKGGVGSGDYYYKSITDIEPFFLDSKTYEFRVS-KRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKI-------------------SYQSVNDG------FKLKHSGRDHYEKL-SLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHS---DQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPH-----RESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINI 2979
            N + +  + +C+L+    ++    Q+ + +++ EE P +  +GN+   A       GS +  +   +  E F +D+ T E   + KR+DRE++ + QM      C + ++     +IG      + S  ++    V I+DINDN+P + SP + LS+ E+  IGT   LP A D D    N  ++Y++                     +  ++G      F+L+ +     EK   LI+    DRE++ +  + L+  DG   P S Q  + + +TD+ND  P F+K+     + EN    SPILQL+A D D     ++ + F  +  E+VR    ++  TG +     ID E  S+    V+  D       D+AT+ + +K+ NDN P I +  + G  F   G      A +AE+      +A + VSD+D          N ++ C +        + + E+   Q+K    + L T+   D E T +Y   ++  DS S SL+++ +  + + D NDNPPIF      S+ +   S  E  A G  +  V ATD D G NA I YSLDS  +  FSID  SG++R     D E+ E++E  +     I + K    L     + V ++D ND  P F +D++TF VKE                      + N    +    D     +++M      +   +    ETG I   +   DRE+ ++++F+++A D  + P S+TA V + ++D NDN P   FP   +Y + +     +   +  + A D D G N  + Y I                         I  N   +F++DG+TG I +  K++    G  ++ V+ +D G P Q     +H+ +
Sbjct:    4 NAAAVDCLYYCMLILQLAHQPAAKQV-LRYRLAEEGPADVRVGNV---AADLGMVAGSREVTFTLESGSEFFKIDNITGELTTNEKRIDREKLQQCQMIFDENECFIDFEV---SVIG-----PAQSWVDLFEGKVIILDINDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFG-RNGIERYELIQDNGENSRRSGSSGDSYSGKRRFDEGASRSSVFELQVADTTDGEKQPQLIIKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVMITDVNDNNPRFEKSVYEADLPENSSPGSPILQLKAADADVGVNGQIEYVF-GAATESVRRLLRLDESTGWLSVLHRIDREEVSQLRFTVMARDRGQPPKMDKATVVLNIKDENDNVPAIEIRKI-GRIFLKDG-----VANVAEDVVVDTPIALVQVSDRDQGE-------NGIVTCTVVGDVPFQLKPASEMEGEQNK--KKYFLHTSAPLDYETTQEYNVVIVAVDSGSPSLTSNNSLLVKVGDTNDNPPIF------SKNVVQVSFPENNAPGERVTTVTATDADSGKNAEISYSLDSSVNGIFSIDSDSGDIRVNTNLDREQKERYEFKV-----IAKDKGINTLQGSATVVVLVDDKNDNEPKFMQDVFTFYVKE--------------------NLDPNSPVGMVTVIDADKGQNAEMGLFIEEEEEIFSIENETGTIFSTLS-FDREQKTTYTFRVKAVDGGDPPRSATATVSLFVMDENDNAPTVTFPINSSYTL-LPPSSTVRTVVRTVIATDTDTGINADLNYSI-------------------------IGGNPFRLFEIDGATGVISLMAKLEQKHYGLHRLVVQVTDNGQPSQSTTTLVHVYV 807          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: pcdh7b (protocadherin 7 [Source:NCBI gene;Acc:101166584])

HSP 1 Score: 226.098 bits (575), Expect = 1.476e-59
Identity = 235/891 (26.37%), Postives = 397/891 (44.56%), Query Frame = 1
Query:  412 NYSMLVLIRFCILLSYFFNKEIHGQIEIHFKVVEESPTNSVIGNIHNQALKQKGGVGSGDYYYKSITDIEPFFLDSKTYEFRVS-KRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKI-------------------SYQSVNDG------FKLKHSGRDHYEKL-SLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHS---DQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPH-----RESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINI 2979
            N + +  + +C+L+    ++    Q+ + +++ EE P +  +GN+   A       GS +  +   +  E F +D+ T E   + KR+DRE++ + QM      C + ++     +IG      + S  ++    V I+DINDN+P + SP + LS+ E+  IGT   LP A D D    N  ++Y++                     +  ++G      F+L+ +     EK   LI+    DRE++ +  + L+  DG   P S Q  + + +TD+ND  P F+K+     + EN    SPILQL+A D D     ++ + F  +  E+VR    ++  TG +     ID E  S+    V+  D       D+AT+ + +K+ NDN P I +  + G  F   G      A +AE+      +A + VSD+D          N ++ C +        + + E+   Q+K    + L T+   D E T +Y   ++  DS S SL+++ +  + + D NDNPPIF      S+ +   S  E  A G  +  V ATD D G NA I YSLDS  +  FSID  SG++R     D E+ E++E  +     I + K    L     + V ++D ND  P F +D++TF VKE                      + N    +    D     +++M      +   +    ETG I   +   DRE+ ++++F+++A D  + P S+TA V + ++D NDN P   FP   +Y + +     +   +  + A D D G N  + Y I                         I  N   +F++DG+TG I +  K++    G  ++ V+ +D G P Q     +H+ +
Sbjct:    8 NAAAVDCLYYCMLILQLAHQPAAKQV-LRYRLAEEGPADVRVGNV---AADLGMVAGSREVTFTLESGSEFFKIDNITGELTTNEKRIDREKLQQCQMIFDENECFIDFEV---SVIG-----PAQSWVDLFEGKVIILDINDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFG-RNGIERYELIQDNGENSRRSGSSGDSYSGKRRFDEGASRSSVFELQVADTTDGEKQPQLIIKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVMITDVNDNNPRFEKSVYEADLPENSSPGSPILQLKAADADVGVNGQIEYVF-GAATESVRRLLRLDESTGWLSVLHRIDREEVSQLRFTVMARDRGQPPKMDKATVVLNIKDENDNVPAIEIRKI-GRIFLKDG-----VANVAEDVVVDTPIALVQVSDRDQGE-------NGIVTCTVVGDVPFQLKPASEMEGEQNK--KKYFLHTSAPLDYETTQEYNVVIVAVDSGSPSLTSNNSLLVKVGDTNDNPPIF------SKNVVQVSFPENNAPGERVTTVTATDADSGKNAEISYSLDSSVNGIFSIDSDSGDIRVNTNLDREQKERYEFKV-----IAKDKGINTLQGSATVVVLVDDKNDNEPKFMQDVFTFYVKE--------------------NLDPNSPVGMVTVIDADKGQNAEMGLFIEEEEEIFSIENETGTIFSTLS-FDREQKTTYTFRVKAVDGGDPPRSATATVSLFVMDENDNAPTVTFPINSSYTL-LPPSSTVRTVVRTVIATDTDTGINADLNYSI-------------------------IGGNPFRLFEIDGATGVISLMAKLEQKHYGLHRLVVQVTDNGQPSQSTTTLVHVYV 811          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000022791.1 (SMESG000022791.1)

HSP 1 Score: 2365.88 bits (6130), Expect = 0.000e+0
Identity = 1214/1221 (99.43%), Postives = 1216/1221 (99.59%), Query Frame = 1
Query:  373 MRIQMLKIQIDSRNYSMLVLIRFCILLSYFFNKEIHGQIEIHFKVVEESPTNSVIGNIHNQALKQKGGVGSGDYYYKSITDIEPFFLDSKTYEFRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNGHGSSQGQFNKRSGLSRVGFENDXXXXXXXXXXXXXXXXXXXXXXXXXRCRNTSRLMTSNKLNRDTCQSISASRSFLERRPDGHSCSPINDICPPYPGPKRSQTISTYLGQSAGSSQMFDLANGYLTDPNSRMQLDRDNCDSGMCQSMNRIPISRVNNSTFAKKYYTTLYRPNALWSNEGSPELSRRLCQKLNNNIENMNKLSATSPIQSEPSENTNDKERNNDFLPGNSTKKSITLPNFLTAIEECEDSTVHHLINDEPQFQQLSNYDRTQQRMSVTWLDKFNNETSLNANKKQGHQYKSADSCLNGPYLETHGNRDHEYTQLNVLPSESTPVKVTHMDYPVTYV 4035
            MRIQMLKIQIDSRNYSMLVLIRFCI LSYFFNKEIHGQIEIHFKVVEESPTNSVIGNIHNQALKQKGGVG GDYYYKSITDIEPFFLDSKTYEFRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPEIIVVNVEIIDINDNSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLEL RSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAII+YSLDSLS TQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDC PVFEKDLYTFTVKEGPSKDVYVGKVVVKDDDISSKYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNGHGSSQGQFNKRSGLSRVGFENDLMIMIVLVAIIILVAMVMVIIILMLRCRNTSRLMTSNKLNRDTCQSISASRSFLERRPDGHSCSPINDICPPYPGPKRSQTISTYLGQSAGSSQMFDLANGYLTDPNSRMQLDRDNCDSGMCQSMNRIPISRVNNSTFAKKYYTTLYRPNALWSNEGSPELSRRLCQKLNNNIEN+NKLSATSPIQSEPSENTNDKERNNDFLPGNSTKKSITLPNFLTAIEECEDSTVHHLINDEPQFQQLSNYDRTQQRMSVTWLDKFNNETSLNANKKQGHQYKSADSCLNGPYLETHGNRDHEYTQLNVLPSESTPVKVTHMDYPVTYV
Sbjct:    1 MRIQMLKIQIDSRNYSMLVLIRFCIWLSYFFNKEIHGQIEIHFKVVEESPTNSVIGNIHNQALKQKGGVGFGDYYYKSITDIEPFFLDSKTYEFRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPEIIVVNVEIIDINDNSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLEL-RSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIQYSLDSLSGTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCPPVFEKDLYTFTVKEGPSKDVYVGKVVVKDDDISSKYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNGHGSSQGQFNKRSGLSRVGFENDLMIMIVLVAIIILVAMVMVIIILMLRCRNTSRLMTSNKLNRDTCQSISASRSFLERRPDGHSCSPINDICPPYPGPKRSQTISTYLGQSAGSSQMFDLANGYLTDPNSRMQLDRDNCDSGMCQSMNRIPISRVNNSTFAKKYYTTLYRPNALWSNEGSPELSRRLCQKLNNNIENINKLSATSPIQSEPSENTNDKERNNDFLPGNSTKKSITLPNFLTAIEECEDSTVHHLINDEPQFQQLSNYDRTQQRMSVTWLDKFNNETSLNANKKQGHQYKSADSCLNGPYLETHGNRDHEYTQLNVLPSESTPVKVTHMDYPVTYV 1220          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000022791.1 (SMESG000022791.1)

HSP 1 Score: 2360.1 bits (6115), Expect = 0.000e+0
Identity = 1213/1223 (99.18%), Postives = 1216/1223 (99.43%), Query Frame = 1
Query:  373 MRIQMLKIQIDSRNYSMLVLIRFCILLSYFFNKEIHGQIEIHFKVVEESPTNSVIGNIHNQALKQKGGVGSGDYYYKSITDIEPFFLDSKTYEFRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNGHGSSQGQFNKRSGLSRVGFENDXXXXXXXXXXXXXXXXXXXXXXXXXRCRNTSRLMTSNKLNRDTCQSISASRSFLERRPDGHSCSPINDICPPYPGPKRSQTISTYLGQSAGSSQMFDLANGYLTDPNSRMQLDRDNCDSGMCQSMNRIPISRVNNSTFAKKYYT--TLYRPNALWSNEGSPELSRRLCQKLNNNIENMNKLSATSPIQSEPSENTNDKERNNDFLPGNSTKKSITLPNFLTAIEECEDSTVHHLINDEPQFQQLSNYDRTQQRMSVTWLDKFNNETSLNANKKQGHQYKSADSCLNGPYLETHGNRDHEYTQLNVLPSESTPVKVTHMDYPVTYV 4035
            MRIQMLKIQIDSRNYSMLVLIRFCI LSYFFNKEIHGQIEIHFKVVEESPTNSVIGNIHNQALKQKGGVG GDYYYKSITDIEPFFLDSKTYEFRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPEIIVVNVEIIDINDNSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLEL RSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAII+YSLDSLS TQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDC PVFEKDLYTFTVKEGPSKDVYVGKVVVKDDDISSKYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNGHGSSQGQFNKRSGLSRVGFENDLMIMIVLVAIIILVAMVMVIIILMLRCRNTSRLMTSNKLNRDTCQSISASRSFLERRPDGHSCSPINDICPPYPGPKRSQTISTYLGQSAGSSQMFDLANGYLTDPNSRMQLDRDNCDSGMCQSMNRIPISRVNNSTFAKKYYT  +LYRPNALWSNEGSPELSRRLCQKLNNNIEN+NKLSATSPIQSEPSENTNDKERNNDFLPGNSTKKSITLPNFLTAIEECEDSTVHHLINDEPQFQQLSNYDRTQQRMSVTWLDKFNNETSLNANKKQGHQYKSADSCLNGPYLETHGNRDHEYTQLNVLPSESTPVKVTHMDYPVTYV
Sbjct:    1 MRIQMLKIQIDSRNYSMLVLIRFCIWLSYFFNKEIHGQIEIHFKVVEESPTNSVIGNIHNQALKQKGGVGFGDYYYKSITDIEPFFLDSKTYEFRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPEIIVVNVEIIDINDNSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLEL-RSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIQYSLDSLSGTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCPPVFEKDLYTFTVKEGPSKDVYVGKVVVKDDDISSKYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNGHGSSQGQFNKRSGLSRVGFENDLMIMIVLVAIIILVAMVMVIIILMLRCRNTSRLMTSNKLNRDTCQSISASRSFLERRPDGHSCSPINDICPPYPGPKRSQTISTYLGQSAGSSQMFDLANGYLTDPNSRMQLDRDNCDSGMCQSMNRIPISRVNNSTFAKKYYTSSSLYRPNALWSNEGSPELSRRLCQKLNNNIENINKLSATSPIQSEPSENTNDKERNNDFLPGNSTKKSITLPNFLTAIEECEDSTVHHLINDEPQFQQLSNYDRTQQRMSVTWLDKFNNETSLNANKKQGHQYKSADSCLNGPYLETHGNRDHEYTQLNVLPSESTPVKVTHMDYPVTYV 1222          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000022791.1 (SMESG000022791.1)

HSP 1 Score: 2356.64 bits (6106), Expect = 0.000e+0
Identity = 1210/1217 (99.42%), Postives = 1212/1217 (99.59%), Query Frame = 1
Query:  385 MLKIQIDSRNYSMLVLIRFCILLSYFFNKEIHGQIEIHFKVVEESPTNSVIGNIHNQALKQKGGVGSGDYYYKSITDIEPFFLDSKTYEFRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNGHGSSQGQFNKRSGLSRVGFENDXXXXXXXXXXXXXXXXXXXXXXXXXRCRNTSRLMTSNKLNRDTCQSISASRSFLERRPDGHSCSPINDICPPYPGPKRSQTISTYLGQSAGSSQMFDLANGYLTDPNSRMQLDRDNCDSGMCQSMNRIPISRVNNSTFAKKYYTTLYRPNALWSNEGSPELSRRLCQKLNNNIENMNKLSATSPIQSEPSENTNDKERNNDFLPGNSTKKSITLPNFLTAIEECEDSTVHHLINDEPQFQQLSNYDRTQQRMSVTWLDKFNNETSLNANKKQGHQYKSADSCLNGPYLETHGNRDHEYTQLNVLPSESTPVKVTHMDYPVTYV 4035
            MLKIQIDSRNYSMLVLIRFCI LSYFFNKEIHGQIEIHFKVVEESPTNSVIGNIHNQALKQKGGVG GDYYYKSITDIEPFFLDSKTYEFRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPEIIVVNVEIIDINDNSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLEL RSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAII+YSLDSLS TQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDC PVFEKDLYTFTVKEGPSKDVYVGKVVVKDDDISSKYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNGHGSSQGQFNKRSGLSRVGFENDLMIMIVLVAIIILVAMVMVIIILMLRCRNTSRLMTSNKLNRDTCQSISASRSFLERRPDGHSCSPINDICPPYPGPKRSQTISTYLGQSAGSSQMFDLANGYLTDPNSRMQLDRDNCDSGMCQSMNRIPISRVNNSTFAKKYYTTLYRPNALWSNEGSPELSRRLCQKLNNNIEN+NKLSATSPIQSEPSENTNDKERNNDFLPGNSTKKSITLPNFLTAIEECEDSTVHHLINDEPQFQQLSNYDRTQQRMSVTWLDKFNNETSLNANKKQGHQYKSADSCLNGPYLETHGNRDHEYTQLNVLPSESTPVKVTHMDYPVTYV
Sbjct:    1 MLKIQIDSRNYSMLVLIRFCIWLSYFFNKEIHGQIEIHFKVVEESPTNSVIGNIHNQALKQKGGVGFGDYYYKSITDIEPFFLDSKTYEFRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPEIIVVNVEIIDINDNSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLEL-RSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIQYSLDSLSGTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCPPVFEKDLYTFTVKEGPSKDVYVGKVVVKDDDISSKYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNGHGSSQGQFNKRSGLSRVGFENDLMIMIVLVAIIILVAMVMVIIILMLRCRNTSRLMTSNKLNRDTCQSISASRSFLERRPDGHSCSPINDICPPYPGPKRSQTISTYLGQSAGSSQMFDLANGYLTDPNSRMQLDRDNCDSGMCQSMNRIPISRVNNSTFAKKYYTTLYRPNALWSNEGSPELSRRLCQKLNNNIENINKLSATSPIQSEPSENTNDKERNNDFLPGNSTKKSITLPNFLTAIEECEDSTVHHLINDEPQFQQLSNYDRTQQRMSVTWLDKFNNETSLNANKKQGHQYKSADSCLNGPYLETHGNRDHEYTQLNVLPSESTPVKVTHMDYPVTYV 1216          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000022791.1 (SMESG000022791.1)

HSP 1 Score: 2349.7 bits (6088), Expect = 0.000e+0
Identity = 1209/1219 (99.18%), Postives = 1212/1219 (99.43%), Query Frame = 1
Query:  385 MLKIQIDSRNYSMLVLIRFCILLSYFFNKEIHGQIEIHFKVVEESPTNSVIGNIHNQALKQKGGVGSGDYYYKSITDIEPFFLDSKTYEFRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNGHGSSQGQFNKRSGLSRVGFENDXXXXXXXXXXXXXXXXXXXXXXXXXRCRNTSRLMTSNKLNRDTCQSISASRSFLERRPDGHSCSPINDICPPYPGPKRSQTISTYLGQSAGSSQMFDLANGYLTDPNSRMQLDRDNCDSGMCQSMNRIPISRVNNSTFAKKYYT--TLYRPNALWSNEGSPELSRRLCQKLNNNIENMNKLSATSPIQSEPSENTNDKERNNDFLPGNSTKKSITLPNFLTAIEECEDSTVHHLINDEPQFQQLSNYDRTQQRMSVTWLDKFNNETSLNANKKQGHQYKSADSCLNGPYLETHGNRDHEYTQLNVLPSESTPVKVTHMDYPVTYV 4035
            MLKIQIDSRNYSMLVLIRFCI LSYFFNKEIHGQIEIHFKVVEESPTNSVIGNIHNQALKQKGGVG GDYYYKSITDIEPFFLDSKTYEFRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPEIIVVNVEIIDINDNSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLEL RSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAII+YSLDSLS TQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDC PVFEKDLYTFTVKEGPSKDVYVGKVVVKDDDISSKYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNGHGSSQGQFNKRSGLSRVGFENDLMIMIVLVAIIILVAMVMVIIILMLRCRNTSRLMTSNKLNRDTCQSISASRSFLERRPDGHSCSPINDICPPYPGPKRSQTISTYLGQSAGSSQMFDLANGYLTDPNSRMQLDRDNCDSGMCQSMNRIPISRVNNSTFAKKYYT  +LYRPNALWSNEGSPELSRRLCQKLNNNIEN+NKLSATSPIQSEPSENTNDKERNNDFLPGNSTKKSITLPNFLTAIEECEDSTVHHLINDEPQFQQLSNYDRTQQRMSVTWLDKFNNETSLNANKKQGHQYKSADSCLNGPYLETHGNRDHEYTQLNVLPSESTPVKVTHMDYPVTYV
Sbjct:    1 MLKIQIDSRNYSMLVLIRFCIWLSYFFNKEIHGQIEIHFKVVEESPTNSVIGNIHNQALKQKGGVGFGDYYYKSITDIEPFFLDSKTYEFRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPEIIVVNVEIIDINDNSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLEL-RSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIQYSLDSLSGTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCPPVFEKDLYTFTVKEGPSKDVYVGKVVVKDDDISSKYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNGHGSSQGQFNKRSGLSRVGFENDLMIMIVLVAIIILVAMVMVIIILMLRCRNTSRLMTSNKLNRDTCQSISASRSFLERRPDGHSCSPINDICPPYPGPKRSQTISTYLGQSAGSSQMFDLANGYLTDPNSRMQLDRDNCDSGMCQSMNRIPISRVNNSTFAKKYYTSSSLYRPNALWSNEGSPELSRRLCQKLNNNIENINKLSATSPIQSEPSENTNDKERNNDFLPGNSTKKSITLPNFLTAIEECEDSTVHHLINDEPQFQQLSNYDRTQQRMSVTWLDKFNNETSLNANKKQGHQYKSADSCLNGPYLETHGNRDHEYTQLNVLPSESTPVKVTHMDYPVTYV 1218          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000012836.1 (SMESG000012836.1)

HSP 1 Score: 320.857 bits (821), Expect = 1.366e-91
Identity = 292/977 (29.89%), Postives = 467/977 (47.80%), Query Frame = 1
Query:  469 KEIHGQIEIHFKVVEESPTNSVIGNIHNQALKQKGGVGSGDYYYKSITDIEPFFLDSKTYEFRVSKRVDREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPXXXXXXXXXXXXXXXSPKWSSPH--IYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKISYQSVNDG-------FKLKHSGRDHY-EKLSLIVNKDFDREKQATVSVKLKAFDGDPNPLSGQLDINISLTDINDKQPHFK-KTSIHKIINENIPLRSPILQLEAKDEDESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPVIVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYLAENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQSKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDVNDNPPIF-EVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRYSLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQLLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPXXXXXXXXXXXXXXXXXXXYNSNYFKIISNPHDIYDSSDSQMYT-NSNSDASQYFRIGET--GLIHVNVPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPNTHNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTNEESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVEASDQGTPPQKKIERLHINIVNVDGNGHGSSQGQFNKRSGLSRVG-FENDXXXXXXXXXXXXXXXXXXXXXXXXXRCRNTSRLMTSNKLNRDTCQSISASRSFLERRPDGHSCSPINDICPPYPGPKRSQTISTYLGQSAGSSQM 3351
            K I  ++ I   +VEE   NS++ +++N+         + D +++ +   + F+++ K  + R   R+DRE IC+    N   +C++      +  I    G+ + + P +I   + I+DIND++P W+  +  + L +PEHS I +   LP A+D D+ P N T+ Y IS     DG         +K S    Y  +LSLIV    DREKQ+   V + A DG   PLSG+L +NI +TDIND  P FK +  I+  ++EN  + S I    A+D D SD + LRF F ++ ++ V   F++   +GE++    +DYE K  YT  V VTDGKH     + ++V NVNDN+P+ISV   +G    T          ++EN + G  + ++ V+D D  S  L       + C ID  +  +EL     +  + F L T K FDRE  S     + C D+      +S T  + I DVNDN P+F   P +        +IKE +A+GT I Q+KA D D   NA  R+ L   S   F I+  +G++ +  +F+ E+  ++E++   ++ +             K+ +NIED+ND  P F+KD+Y F++ E                               N  DI + + +  Y     +D S    IG T  G I V    LDREK SSF+F I A D     LSS+A +QI++ D+NDN P W+ P+     +N++Y   +G+ +   +A D D G N ++ Y I                  E     DI       F L+ +TG++Y+ + + + D+ + ++ +   D+G P  ++     +NIV            Q     GLS  G FE DL+I++VLV + +++ + ++  I  L+C     L          C S   +       PDGHS SP ++I P +   +    IS  + +++ S +M
Sbjct:    3 KRITSEMSIELYLVEECSNNSIVTDLNNRFHSN----FNNDGHFRLLDQNKLFYIEEKFGKLRTKSRIDRESICKQVDAN--PDCKI------ALFILYHPGKRT-TKPVMIKSIIHILDINDHAPTWNKVNNLMTLQIPEHSPINSAFRLPEAVDLDRGPDNVTKSYTISKNK--DGEMKFDLRVIMKSSLNSKYGNELSLIVLGILDREKQSQYQVLITAMDGGVPPLSGELRVNIQVTDINDHSPRFKNQIPINISLHENTAINSIIFVFVAEDIDSSDANNLRFSFLSTTEDEVTQTFFLKEKSGELILQKSLDYETKMSYTFTVQVTDGKHFTSIYVEVKVLNVNDNSPKISVQSFAGGELLT----------VSENSESGQHIGAVVVTDADDNSGLLP------VFCSID--KPIVELSPLSDEARNKFLLKTLKPFDREIGSYQIFTIKCSDTGEPPKHSSYTSRLHILDVNDNAPVFLNEPMRA-------TIKENMAVGTLIYQLKAQDEDTELNANFRFYLQPDSEVNFRIESETGKIFSKIIFNAEESSRYEISAYVTDSL----EGTFHKVFGKVDLNIEDMNDNSPRFDKDIYHFSIYE-------------------------------NDSDISEINKAIRYNFKPGTDKSILKHIGVTQDGKIFVRSSQLDREKNSSFTFYIIAIDNGSPTLSSSAYIQIEVKDINDNSPEWIHPDPSLNHINITYHVPVGHEVIKFEAKDLDQGSNSELQYFIT-----------------EPNSGRDI-------FQLEPTTGSLYVKRTLTVHDLRTHRLNILVKDRGNPSLERTLTFKVNIVQ-----------QIETYHGLSLFGKFEGDLLIILVLVIVTLIICLGLISAIWFLKCGFRPSLW---------CHSTPFNPREHLSPPDGHSPSPSHEIIPVFMDRRHDSFISN-ITKTSCSEKM 859          
The following BLAST results are available for this feature:
BLAST of Protocadherin-9 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH11X1.301e-6328.91protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11Y2.153e-6329.27protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11Y2.153e-6329.27protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11Y2.406e-6329.27protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11Y2.520e-6329.27protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-14.666e-3223.39FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-12.401e-3024.84FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-17.188e-3025.46CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
hmr-12.826e-2322.96Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
hmr-12.826e-2322.96Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ds2.191e-5427.97gene:FBgn0284247 transcript:FBtr0078045[more]
ds2.191e-5427.97gene:FBgn0284247 transcript:FBtr0343249[more]
stan9.972e-4025.96gene:FBgn0024836 transcript:FBtr0304900[more]
stan1.181e-3925.96gene:FBgn0024836 transcript:FBtr0304899[more]
stan1.181e-3925.96gene:FBgn0024836 transcript:FBtr0300578[more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh93.713e-6326.70protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh95.334e-6326.70protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh95.334e-6326.70protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
CR847522.17.646e-6326.70pep chromosome:GRCz11:CHR_ALT_CTG6_1_1:4874141:487... [more]
pcdh7b4.869e-6126.72protocadherin 7b [Source:ZFIN;Acc:ZDB-GENE-081104-... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vapa9.966e-5927.59VAMP associated protein A [Source:Xenbase;Acc:XB-G... [more]
ENSXETT00000047804.11.163e-5627.21protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
ENSXETT00000047801.11.357e-5627.21protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
ENSXETT00000047798.15.667e-5627.31protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
ENSXETT00000027070.11.063e-5526.99pep primary_assembly:Xenopus_tropicalis_v9.1:3:190... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdh11x9.438e-6228.20protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x1.476e-6128.20protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x1.774e-6128.20protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh92.653e-6127.69protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh11x3.061e-6128.20protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q71M42|PC11X_PANTR1.335e-6329.16Protocadherin-11 X-linked OS=Pan troglodytes OX=95... [more]
sp|Q6WYY1|PC11X_PANPA1.346e-6329.16Protocadherin-11 X-linked OS=Pan paniscus OX=9597 ... [more]
sp|Q6X862|PC11X_GORGO4.138e-6329.20Protocadherin-11 X-linked OS=Gorilla gorilla goril... [more]
sp|Q6WXV7|PC11X_PONPY1.460e-6229.04Protocadherin-11 X-linked OS=Pongo pygmaeus OX=960... [more]
sp|Q9BZA7|PC11X_HUMAN1.799e-6228.91Protocadherin-11 X-linked OS=Homo sapiens OX=9606 ... [more]
back to top
BLAST of Protocadherin-9 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H2KRD81.468e-10229.38Protocadherin-9 OS=Clonorchis sinensis OX=79923 GN... [more]
A0A4S2M0G96.357e-10229.32Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2M1F53.013e-10129.32Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A074ZZF08.133e-10129.62Uncharacterized protein (Fragment) OS=Opisthorchis... [more]
A0A1S8WGR81.132e-9829.50Cadherin domain protein (Fragment) OS=Opisthorchis... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dchs1b3.566e-6628.61dachsous cadherin-related 1b [Source:ZFIN;Acc:ZDB-... [more]
pcdh95.449e-6326.90protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh119.224e-6328.09protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh91.033e-6226.90protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh111.370e-6228.09protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010725.16.512e-5325.86pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 ... [more]
pcdh112.533e-4424.32protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
si:ch211-199f5.17.949e-3927.41protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660][more]
ENSPMAT00000006996.12.706e-3626.32pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 g... [more]
ENSPMAT00000008517.18.936e-3625.12pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461892.250e-4428.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404708.156e-4127.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354124.530e-4026.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO392302.549e-3927.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303641.013e-3824.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dchs1a8.359e-6630.03protocadherin-16 [Source:NCBI gene;Acc:101175097][more]
ENSORLT00000005325.21.005e-6429.45protocadherin-16 [Source:NCBI gene;Acc:101171352][more]
pcdh7b9.985e-6026.30protocadherin 7 [Source:NCBI gene;Acc:101166584][more]
pcdh7b1.361e-5926.37protocadherin 7 [Source:NCBI gene;Acc:101166584][more]
pcdh7b1.476e-5926.37protocadherin 7 [Source:NCBI gene;Acc:101166584][more]
back to top
BLAST of Protocadherin-9 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022791.10.000e+099.43SMESG000022791.1[more]
SMESG000022791.10.000e+099.18SMESG000022791.1[more]
SMESG000022791.10.000e+099.42SMESG000022791.1[more]
SMESG000022791.10.000e+099.18SMESG000022791.1[more]
SMESG000012836.11.366e-9129.89SMESG000012836.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005148 ID=SMED30005148|Name=Protocadherin-9|organism=Schmidtea mediterranea sexual|type=transcript|length=4139bp
CTGAAGCATTTTATCAACATTAAAATGGGGGAAAAAATCCGCTTGCATTT
TCTGGTAAAAAAAGACTTTTCCTGAAATCTGATTGGCTGATTTGGAATTT
ATCTGGTTTTCAAATCATCATTACCAAATGGCATCGAGAAAATTCGCTAT
CAATTTCAAACAGAAAGTTGCATTTAATTTCATTTACACTCGAAATTAGC
ACATCCAATATATATTAAAACAAACATCATCACCTCGGCTTCAAGTTGCG
TATCTGTCAATTCATTAAACAAGCAAAAAAAGGAAAATATAGAAATTACA
GGGAAATTACATATCTGGTAATCGGATGCGAAATCAACACGCATTGGGAA
AATCTAACGAATCCGTGACCAGATGAGAATCCAGATGCTGAAAATTCAAA
TTGATTCACGTAATTATTCAATGCTTGTTCTGATTAGATTTTGTATCTTG
TTATCATACTTTTTCAATAAAGAAATTCATGGGCAAATTGAAATTCATTT
TAAAGTCGTCGAAGAAAGTCCTACCAATTCCGTCATTGGTAATATTCATA
ATCAAGCGTTGAAACAAAAAGGAGGAGTTGGATCCGGTGATTATTACTAT
AAAAGTATAACTGATATCGAACCATTCTTTCTGGATTCAAAGACTTATGA
ATTTCGAGTGTCTAAAAGAGTTGATAGAGAAGAGATTTGCAGATTTCAAA
TGCAAAATATAATGCAAAACTGTAGAATGACCTACAAGTTTATCCAGTCA
AGAATCATAGGGGACGAAAAAGGACAAACCTCTGATAGTTCTCCGGAAAT
TATTGTTGTCAATGTAGAAATAATAGATATAAATGATAATTCTCCAAAAT
GGTCTTCTCCTCACATTTATTTGAGTCTTCCTGAACATTCCAAAATCGGA
ACAGAAATAACCCTTCCGTTAGCTATGGATCCAGATCAACCACCAACAAA
CACCACACAAAAATATAAAATAAGTTATCAGTCTGTAAATGATGGATTCA
AATTGAAACATTCTGGTCGGGACCATTATGAAAAGCTTTCATTGATAGTA
AATAAAGATTTTGATAGGGAAAAGCAAGCCACTGTCAGTGTGAAATTGAA
AGCATTCGATGGAGATCCTAATCCATTGTCCGGCCAACTGGACATCAACA
TCTCTTTAACTGATATCAACGACAAACAGCCACATTTCAAGAAAACAAGC
ATTCATAAAATCATCAATGAAAATATTCCACTTCGGTCTCCAATTTTACA
GCTTGAAGCTAAAGACGAAGATGAATCAGATCAGCATAAATTACGTTTTG
AATTCGACAATTCAGTCGATGAAACTGTGAGAAATAGATTCTACATCAAT
CCGTTGACGGGGGAAATTCTAACAGCGGGATACATAGATTATGAAATAAA
GTCGGAGTATACAATTCCGGTTATTGTGACCGACGGAAAGCACTCCGATC
AAGCCACTCTTACGATTGAAGTAAAAAATGTAAATGACAATAATCCAGAA
ATTTCAGTTCTTTATTTAAGTGGATCAAATTTCAAAACTCCGGGACGAAG
TTCTCAATATCGCGCATATCTCGCGGAAAATAAAGATCCGGGATTTGTTG
TTGCGAGTTTGTCAGTTTCCGATAAAGATTACGAGTCAAAAAGACTTGGA
AATCAAATGAATCATCTTTTAGATTGTAGAATAGATCCCCACAGAGAAAG
TCTAGAATTGAGAAGATCTCAGTCGAAACTTATAGACCACTTTCAATTAA
TTACAACCAAAATGTTTGATAGGGAAGAAACATCGCAATATTTTGCACAG
TTGATTTGTTTTGATAGTGACAGCAATTCTCTCTCCACAAGCGTAACGTT
TGAAATCTCTATAACGGATGTGAATGATAATCCTCCGATTTTTGAGGTAC
CCTTCCAAGGTTCTCGTGGAATTCATAGTTACAGTATCAAAGAAGGAGTT
GCCATTGGAACAACAATAGTTCAAGTGAAAGCTACTGACCGTGACATAGG
TAATAATGCAATCATTCGATATTCGTTAGATTCACTTTCTAGCACCCAGT
TTAGCATTGATCCAATTTCCGGTGAATTGCGTAATATTGACGTATTTGAC
TATGAAAAGATGGAGAAATTCGAATTGACTATCAACGCATCCAACCCTAT
TATTGAGAGAAAGAATTCTCAACTTTTATACACTTTACAAAAGATTACCG
TAAATATTGAAGACGTAAACGATTGCCTGCCAGTATTCGAAAAGGATCTT
TATACTTTCACTGTGAAAGAAGGTCCCAGCAAGGATGTTTATGTTGGAAA
GGTTGTAGTAAAAGACGATGATATTAGTTCAAAATACAATTCAAACTATT
TTAAAATAATATCCAATCCACACGATATCTACGATTCATCGGATTCACAA
ATGTATACAAATAGCAACTCGGACGCTTCTCAATACTTTAGAATCGGTGA
AACCGGATTGATACATGTGAATGTTCCGGTTCTTGATCGAGAGAAAATAT
CCAGTTTCTCCTTTAAAATTCAAGCGGCTGACAGAAGCGAAAAACCTTTG
AGTAGTACTGCTATTGTTCAAATTCAGATTCTTGATGTAAATGACAACCC
ACCGCTTTGGGTTTTCCCAAATACTCATAACTATGAGGTCAATGTATCAT
ACCAGGAAGCCATAGGATATTGTATTGCTAATTTAAAGGCCAATGATCCG
GATTTGGGAGATAATGGTAAAGTCACCTATAGAATTGTTCCATCAAGCTT
TCCTTTTTCTTTCAATACTAATGAGGAGTCTAAGAATCTCGAAGTCACCG
AATCGTCAGATATTAAATTCAATCGTCACGAAATGTTTGATTTAGATGGT
TCAACGGGAAATATTTACATAGCGCAAAAAATGAAACTCAGTGACGTGGG
ATCGAAAAAGATTTGGGTTGAAGCTAGTGATCAAGGGACACCGCCTCAGA
AAAAGATTGAAAGACTTCATATAAATATTGTAAATGTTGACGGTAATGGT
CACGGATCATCTCAAGGTCAATTTAACAAACGATCAGGTTTGTCACGGGT
AGGATTTGAGAATGATTTGATGATAATGATTGTGTTGGTGGCCATTATTA
TTCTTGTTGCAATGGTCATGGTCATAATTATATTAATGCTCCGATGCCGA
AACACGAGCCGCTTGATGACATCTAACAAGCTCAATAGAGATACCTGCCA
AAGTATAAGTGCTAGTCGATCCTTCTTAGAAAGACGGCCCGATGGTCATT
CATGTTCCCCAATAAACGATATATGTCCTCCATATCCTGGACCAAAACGA
AGTCAAACAATTTCCACGTATTTAGGACAAAGTGCTGGCTCCAGTCAAAT
GTTTGATCTTGCGAATGGCTATCTGACCGATCCGAATTCGAGAATGCAGC
TTGATCGAGATAATTGCGACTCTGGAATGTGTCAGTCAATGAACCGGATT
CCCATCAGTCGAGTCAACAACAGCACATTTGCCAAGAAATATTACACCAC
TCTTTATCGTCCGAATGCTCTGTGGTCGAATGAAGGATCTCCTGAACTGT
CGAGGAGATTGTGTCAAAAACTCAACAACAACATTGAAAATATGAATAAA
TTATCCGCGACATCCCCAATTCAATCGGAACCGTCAGAAAATACAAATGA
CAAAGAGAGAAACAACGATTTTCTTCCCGGAAATTCAACAAAAAAATCTA
TCACTCTTCCGAATTTTCTTACTGCTATTGAAGAATGCGAAGATTCAACA
GTCCATCATTTGATTAACGACGAGCCTCAGTTTCAACAATTATCAAATTA
CGATAGAACTCAACAACGAATGTCGGTGACTTGGTTGGATAAATTTAATA
ATGAAACGTCTCTGAATGCCAATAAAAAGCAAGGACACCAATACAAATCT
GCTGACAGTTGTCTCAATGGTCCTTATTTGGAAACGCACGGGAATAGGGA
TCACGAATATACCCAATTAAATGTTTTGCCCAGCGAGTCGACTCCTGTCA
AAGTTACTCACATGGACTATCCGGTCACTTATGTTTGACAGAGAAAATAA
AAACAATATGCTTACTTAACACAACCACTCGGCAGCAGTGAATACATCAT
TTTCTAAGCATTGTACAAAATATGTTGATTCAGTTTCAT
back to top

protein sequence of SMED30005148-orf-1

>SMED30005148-orf-1 ID=SMED30005148-orf-1|Name=SMED30005148-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1222bp
MRIQMLKIQIDSRNYSMLVLIRFCILLSYFFNKEIHGQIEIHFKVVEESP
TNSVIGNIHNQALKQKGGVGSGDYYYKSITDIEPFFLDSKTYEFRVSKRV
DREEICRFQMQNIMQNCRMTYKFIQSRIIGDEKGQTSDSSPEIIVVNVEI
IDINDNSPKWSSPHIYLSLPEHSKIGTEITLPLAMDPDQPPTNTTQKYKI
SYQSVNDGFKLKHSGRDHYEKLSLIVNKDFDREKQATVSVKLKAFDGDPN
PLSGQLDINISLTDINDKQPHFKKTSIHKIINENIPLRSPILQLEAKDED
ESDQHKLRFEFDNSVDETVRNRFYINPLTGEILTAGYIDYEIKSEYTIPV
IVTDGKHSDQATLTIEVKNVNDNNPEISVLYLSGSNFKTPGRSSQYRAYL
AENKDPGFVVASLSVSDKDYESKRLGNQMNHLLDCRIDPHRESLELRRSQ
SKLIDHFQLITTKMFDREETSQYFAQLICFDSDSNSLSTSVTFEISITDV
NDNPPIFEVPFQGSRGIHSYSIKEGVAIGTTIVQVKATDRDIGNNAIIRY
SLDSLSSTQFSIDPISGELRNIDVFDYEKMEKFELTINASNPIIERKNSQ
LLYTLQKITVNIEDVNDCLPVFEKDLYTFTVKEGPSKDVYVGKVVVKDDD
ISSKYNSNYFKIISNPHDIYDSSDSQMYTNSNSDASQYFRIGETGLIHVN
VPVLDREKISSFSFKIQAADRSEKPLSSTAIVQIQILDVNDNPPLWVFPN
THNYEVNVSYQEAIGYCIANLKANDPDLGDNGKVTYRIVPSSFPFSFNTN
EESKNLEVTESSDIKFNRHEMFDLDGSTGNIYIAQKMKLSDVGSKKIWVE
ASDQGTPPQKKIERLHINIVNVDGNGHGSSQGQFNKRSGLSRVGFENDLM
IMIVLVAIIILVAMVMVIIILMLRCRNTSRLMTSNKLNRDTCQSISASRS
FLERRPDGHSCSPINDICPPYPGPKRSQTISTYLGQSAGSSQMFDLANGY
LTDPNSRMQLDRDNCDSGMCQSMNRIPISRVNNSTFAKKYYTTLYRPNAL
WSNEGSPELSRRLCQKLNNNIENMNKLSATSPIQSEPSENTNDKERNNDF
LPGNSTKKSITLPNFLTAIEECEDSTVHHLINDEPQFQQLSNYDRTQQRM
SVTWLDKFNNETSLNANKKQGHQYKSADSCLNGPYLETHGNRDHEYTQLN
VLPSESTPVKVTHMDYPVTYV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000240body wall musculature
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
IPR002620Alphavirus_nsp2pro
IPR002126Cadherin-like_dom
IPR013164Cadherin_N
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002126Cadherin-likePRINTSPR00205CADHERINcoord: 83..102
score: 26.1
coord: 272..301
score: 26.85
coord: 727..744
score: 44.31
coord: 485..504
score: 46.2
coord: 693..719
score: 21.93
coord: 619..632
score: 40.35
IPR002126Cadherin-likeSMARTSM00112CA_2coord: 182..270
e-value: 3.3E-10
score: 49.9
coord: 643..743
e-value: 9.0E-17
score: 71.7
coord: 534..619
e-value: 3.5E-19
score: 79.7
coord: 413..504
e-value: 5.4E-9
score: 45.9
coord: 294..375
e-value: 1.5E-16
score: 71.0
coord: 770..876
e-value: 3.4E-7
score: 39.9
IPR002126Cadherin-likePFAMPF00028Cadherincoord: 281..367
e-value: 3.0E-11
score: 43.6
coord: 518..599
e-value: 8.2E-15
score: 55.0
coord: 168..262
e-value: 1.7E-9
score: 38.0
coord: 626..736
e-value: 4.4E-9
score: 36.7
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 159..267
e-value: 1.2E-18
score: 69.6
coord: 617..741
e-value: 5.4E-22
score: 80.4
coord: 502..616
e-value: 1.0E-21
score: 79.5
coord: 268..377
e-value: 9.2E-23
score: 82.9
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 742..880
e-value: 8.6E-18
score: 66.8
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 385..501
e-value: 1.0E-14
score: 56.9
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 32..158
e-value: 1.3E-8
score: 37.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1077..1105
NoneNo IPR availablePANTHERPTHR24028FAMILY NOT NAMEDcoord: 35..590
coord: 601..1059
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 513..621
score: 21.643
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 622..745
score: 18.749
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 392..506
score: 17.938
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 749..883
score: 14.167
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 161..272
score: 17.149
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 37..160
score: 8.884
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 273..377
score: 21.117
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 40..156
e-value: 7.85035E-6
score: 43.8414
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 518..616
e-value: 4.11802E-24
score: 95.8433
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 164..267
e-value: 2.70108E-17
score: 76.1981
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 753..874
e-value: 2.01243E-13
score: 65.4125
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 395..502
e-value: 3.30667E-13
score: 64.6421
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 281..373
e-value: 2.49568E-21
score: 87.7541
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 626..741
e-value: 9.05532E-19
score: 80.4353
NoneNo IPR availableTMHMMTMhelixcoord: 900..922
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 148..158
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 494..504
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 733..743
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 370..499
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 265..369
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 738..869
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 499..613
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 609..747
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 153..264