5-hydroxytryptamine receptor

Overview
Name5-hydroxytryptamine receptor
Smed IDSMED30005147
Length (bp)2028
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 5-hydroxytryptamine receptor (SMED30005147) t-SNE clustered cells

Violin plots show distribution of expression levels for 5-hydroxytryptamine receptor (SMED30005147) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 5-hydroxytryptamine receptor (SMED30005147) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 5-hydroxytryptamine receptor (SMED30005147) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005147

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30005147SMESG000010648.1 SmedASXL_007471SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30005147SMESG000010648.1 dd_Smed_v6_30729_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30005147SMESG000010648.1 OX_Smed_1.0.12835ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Human
Match: HTR1A (5-hydroxytryptamine receptor 1A [Source:HGNC Symbol;Acc:HGNC:5286])

HSP 1 Score: 134.42 bits (337), Expect = 2.222e-33
Identity = 88/208 (42.31%), Postives = 133/208 (63.94%), Query Frame = 2
Query:  170 ILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVT-QINFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRSTKFRPPDIHTLSNLNP 790
            +L  LI   ++GN  VVAAI LE++LQ+V+NYLI SLAV DLMV+VLV+P++ + ++ + W +G   CD++I  DVLCCT+S+LHL AIA+DRYWA+T  I+++ K++  R   LI +   W +  +ISIP    G R     S+   C ++ +H Y I +  GAF++P+L+M+ +Y RI+  A+ +IRK   K       T    +P
Sbjct:   42 LLGTLIFCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISL--TWLIGFLISIPPML-GWRTPEDRSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADTRHGASP 246          

HSP 2 Score: 76.6406 bits (187), Expect = 3.651e-14
Identity = 36/91 (39.56%), Postives = 56/91 (61.54%), Query Frame = 2
Query: 1709 SRIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKIL 1981
            ++ K+   RERK  +TL II G F++CWLPF    ++    +S      + +   L+ + I WLGY+NS LNP+IY  F+ DF+ +F+KI+
Sbjct:  331 AKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCES------SCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKII 415          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Human
Match: HTR1B (5-hydroxytryptamine receptor 1B [Source:HGNC Symbol;Acc:HGNC:5287])

HSP 1 Score: 121.324 bits (303), Expect = 4.556e-29
Identity = 79/193 (40.93%), Postives = 123/193 (63.73%), Query Frame = 2
Query:  170 ILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVT-QINFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNHT-YIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRS 742
            +L ++ L T + N FV+A +   + L + +NYLI SLAV DL+V++LVMPIS +  ++  W +G  +CD W+  D+ CCTAS+LHL  IA+DRYWA+T  + +  K++  R  ++I +  VW  SI IS+P  F   R      E   C +NT+H  Y + + +GAF+ P L+++A+Y RIYV A+ +I K++
Sbjct:   55 LLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIAL--VWVFSISISLPPFF--WRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRILKQT 243          

HSP 2 Score: 76.2554 bits (186), Expect = 4.407e-14
Identity = 46/137 (33.58%), Postives = 70/137 (51.09%), Query Frame = 2
Query: 1613 AHMCTKEPACRQSLAKNKNRL--------SNAMWHQLKIR------SRIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKIL 1981
            A + T  P    S+    +R+        S    +Q+K+R       + K+   RERKA +TL II G F++CWLPF   +++  I           +  L I  F  WLGY NS +NPIIYT+ + DF+++F K++
Sbjct:  254 AQLITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALLEKKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPIC------KDACWFHLAIFDFFTWLGYLNSLINPIIYTMSNEDFKQAFHKLI 384          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Human
Match: ADRA2A (adrenoceptor alpha 2A [Source:HGNC Symbol;Acc:HGNC:281])

HSP 1 Score: 115.931 bits (289), Expect = 7.032e-27
Identity = 74/197 (37.56%), Postives = 121/197 (61.42%), Query Frame = 2
Query:  179 MLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQ-INFIRKKSGAR-KQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRSTKFRPPD 763
            +L+L T+ GNV V+ A+   + L++  N  ++SLA AD++VA LV+P S+ NE+   W+ G + C+I++  DVL CT+S++HL AI++DRYW++TQ I +  K++  R K I+I ++ + +V     + S             +  C +N    Y+I + IG+FF P LIM+ +Y+RIY  AKR+ R   ++ R PD
Sbjct:   57 LLMLLTVFGNVLVIIAVFTSRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAWCEIYLALDVLFCTSSIVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIITVWVISAVISFPPLISIEKKGGGGGPQPAEPRCEINDQKWYVISSCIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSR-RGPD 252          

HSP 2 Score: 75.8702 bits (185), Expect = 7.207e-14
Identity = 37/91 (40.66%), Postives = 52/91 (57.14%), Query Frame = 2
Query: 1709 SRIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKIL 1981
            SR +  Q RE++    LA++ G F++CW PF     +  +  S      T +K      F  W GY NS LNP+IYT+F+ DFRR+F+KIL
Sbjct:  375 SRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAVGCS---VPRTLFK------FFFWFGYCNSSLNPVIYTIFNHDFRRAFKKIL 456          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Human
Match: HTR1D (5-hydroxytryptamine receptor 1D [Source:HGNC Symbol;Acc:HGNC:5289])

HSP 1 Score: 112.849 bits (281), Expect = 3.120e-26
Identity = 80/202 (39.60%), Postives = 125/202 (61.88%), Query Frame = 2
Query:  170 ILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVT-QINFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNH-TYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRSTKFRPPDIH 769
            +L ++ L T++ N FV+  I+L + L + +NYLI SLA  DL+V++LVMPIS+   I+ +W  G  LCDIW+  D+ CCTAS+LHL  IA+DRYWA+T  + + ++++      +I I  VW++SI ISIP  F   R      E   C +NT+  +Y I +  GAF++P ++++ +Y RIY  A+ +I        PP ++
Sbjct:   44 VLSVITLATVLSNAFVLTTILLTRKLHTPANYLIGSLATTDLLVSILVMPISIAYTITHTWNFGQILCDIWLSSDITCCTASILHLCVIALDRYWAITDALEYSKRRTAGHAATMIAI--VWAISICISIPPLF--WRQAKAQEEMSDCLVNTSQISYTIYSTCGAFYIPSVLLIILYGRIYRAARNRI------LNPPSLY 235          

HSP 2 Score: 79.337 bits (194), Expect = 4.231e-15
Identity = 41/90 (45.56%), Postives = 55/90 (61.11%), Query Frame = 2
Query: 1712 RIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKIL 1981
            R +I   RERKA + L II G F+ICWLPF   +++      P   +       L D F  WLGY NS +NPIIYTVF+ +FR++F+KI+
Sbjct:  288 RKRISAARERKATKILGIILGAFIICWLPFFVVSLV-----LPICRDSCWIHPALFD-FFTWLGYLNSLINPIIYTVFNEEFRQAFQKIV 371          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Human
Match: ADRA2B (adrenoceptor alpha 2B [Source:HGNC Symbol;Acc:HGNC:282])

HSP 1 Score: 113.235 bits (282), Expect = 5.383e-26
Identity = 66/186 (35.48%), Postives = 114/186 (61.29%), Query Frame = 2
Query:  179 MLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQINFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRK 736
             LIL+TI GN  V+ A++  ++L++  N  ++SLA AD++VA L++P S+ NE+   W+   + C++++  DVL CT+S++HL AI++DRYWAV++      K   R+   I++      +++   P  + G +          C++N    YI+ ++IG+FF P LIM+ +Y+RIY+ AKR  R+
Sbjct:   21 FLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANELLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEYNSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQGPQPRGRP-QCKLNQEAWYILASSIGSFFAPCLIMILVYLRIYLIAKRSNRR 205          

HSP 2 Score: 75.0998 bits (183), Expect = 1.214e-13
Identity = 34/90 (37.78%), Postives = 51/90 (56.67%), Query Frame = 2
Query: 1712 RIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKIL 1981
            R + +  RE++    LA++ G F++CW PF     +  I        H  ++      F  W+GY NS LNP+IYT+F+ DFRR+FR+IL
Sbjct:  358 RRRAQLTREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPKHCKVPHGLFQ------FFFWIGYCNSSLNPVIYTIFNQDFRRAFRRIL 441          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Celegans
Match: ser-4 (SERotonin/octopamine receptor family; Serotonin receptor [Source:UniProtKB/TrEMBL;Acc:G5EGH0])

HSP 1 Score: 117.472 bits (293), Expect = 6.788e-28
Identity = 81/232 (34.91%), Postives = 136/232 (58.62%), Query Frame = 2
Query:  170 ILVMLILWTIIGNVFVVAAIILEKNLQSVSNY-LIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQINFIRKKSGARKQILIMI--FCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQI---RKRSTKFRPPD--IHTLSNLNPKSTRTGKENKIVYFSSI 841
            +L++LIL   IGN+FV+ AII+E++L+    Y LI SLAVADL+V ++V P+     ++ +W +G+ +CD WI  DVL CTAS+LHLVAIA+DRYW++T I +++ ++  R  +++ +  F    +S+      +  G  ++ L S   VC ++   +Y + +   AF++P++ ++ +Y +I   AK++    R R T  RPP   I     + PK ++       V  S I
Sbjct:   57 VLLVLILSCFIGNLFVILAIIMERDLRGRPQYYLIFSLAVADLLVGMIVTPLGAWFTVTGTWNLGVVVCDFWISVDVLVCTASILHLVAIALDRYWSITDICYVQNRTPKRITLMLAVIWFTSLLISLAPFAGWKDEGFSDRVLKSH--VCLISQQISYQVFSTATAFYIPLIAIICVYWKIMRAAKKRFKRERDRRTVIRPPPDAIDEKKAMMPKKSKKCPLPPAVVISDI 286          

HSP 2 Score: 83.1889 bits (204), Expect = 1.326e-16
Identity = 44/89 (49.44%), Postives = 55/89 (61.80%), Query Frame = 2
Query: 1724 EQRRERKAARTLAIITGCFLICWLPFATQNMINLISD---SPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKIL 1981
            E +RERKA RTLAIITG F+ CW PF   ++   I     SP           +++   LWLGY NS LNPIIYTVFS DFR +F++I+
Sbjct:  359 EMKRERKAWRTLAIITGTFVACWTPFFLVSIYRPICGCQISP-----------VLEQVTLWLGYLNSALNPIIYTVFSQDFRAAFKRII 436          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Celegans
Match: ser-4 (SERotonin/octopamine receptor family; Serotonin receptor [Source:UniProtKB/TrEMBL;Acc:G5EGH0])

HSP 1 Score: 117.472 bits (293), Expect = 6.788e-28
Identity = 81/232 (34.91%), Postives = 136/232 (58.62%), Query Frame = 2
Query:  170 ILVMLILWTIIGNVFVVAAIILEKNLQSVSNY-LIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQINFIRKKSGARKQILIMI--FCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQI---RKRSTKFRPPD--IHTLSNLNPKSTRTGKENKIVYFSSI 841
            +L++LIL   IGN+FV+ AII+E++L+    Y LI SLAVADL+V ++V P+     ++ +W +G+ +CD WI  DVL CTAS+LHLVAIA+DRYW++T I +++ ++  R  +++ +  F    +S+      +  G  ++ L S   VC ++   +Y + +   AF++P++ ++ +Y +I   AK++    R R T  RPP   I     + PK ++       V  S I
Sbjct:   57 VLLVLILSCFIGNLFVILAIIMERDLRGRPQYYLIFSLAVADLLVGMIVTPLGAWFTVTGTWNLGVVVCDFWISVDVLVCTASILHLVAIALDRYWSITDICYVQNRTPKRITLMLAVIWFTSLLISLAPFAGWKDEGFSDRVLKSH--VCLISQQISYQVFSTATAFYIPLIAIICVYWKIMRAAKKRFKRERDRRTVIRPPPDAIDEKKAMMPKKSKKCPLPPAVVISDI 286          

HSP 2 Score: 83.1889 bits (204), Expect = 1.326e-16
Identity = 44/89 (49.44%), Postives = 55/89 (61.80%), Query Frame = 2
Query: 1724 EQRRERKAARTLAIITGCFLICWLPFATQNMINLISD---SPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKIL 1981
            E +RERKA RTLAIITG F+ CW PF   ++   I     SP           +++   LWLGY NS LNPIIYTVFS DFR +F++I+
Sbjct:  359 EMKRERKAWRTLAIITGTFVACWTPFFLVSIYRPICGCQISP-----------VLEQVTLWLGYLNSALNPIIYTVFSQDFRAAFKRII 436          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Celegans
Match: ser-2 (Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-Prot;Acc:O02213])

HSP 1 Score: 102.834 bits (255), Expect = 4.830e-23
Identity = 70/188 (37.23%), Postives = 125/188 (66.49%), Query Frame = 2
Query:  176 VMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSS-WWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAV-TQINFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIR 733
            +++I  T++GN  VV A+   + L+ V NY ++SLA +DL VA+ VMP+ V+  ++   W +G+++C  +   D+L CT+S+L+L AIA+DRYWA+   IN+ +K++   K + I+I  VW +S++IS+P     +  Q    ED  C ++T   +++ +  G+FFLP+L+MV +Y++I++ A+++IR
Sbjct:   62 LVIIAMTVVGNTLVVVAVFSYRPLKKVQNYFLVSLAASDLAVAIFVMPLHVVTFLAGGKWLLGVTVCQFFTTADILLCTSSILNLCAIALDRYWAIHNPINYAQKRTT--KFVCIVIVIVWILSMLISVPPIIGWNNWQENMMEDS-CGLSTEKAFVVFSAAGSFFLPLLVMVVVYVKIFISARQRIR 246          

HSP 2 Score: 69.707 bits (169), Expect = 2.497e-12
Identity = 35/93 (37.63%), Postives = 52/93 (55.91%), Query Frame = 2
Query: 1703 IRSRIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKIL 1981
            +R R KI   +E++AA+T+A+I   F  CWLPF    +I    +       T      ++    WLGY NS LNP +Y + + +FRR+F+KIL
Sbjct:  327 LRKREKISVAKEKRAAKTIAVIIFVFSFCWLPFFVAYVIRPFCE-------TCKLHAKVEQAFTWLGYINSSLNPFLYGILNLEFRRAFKKIL 412          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Celegans
Match: ser-2 (Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-Prot;Acc:O02213])

HSP 1 Score: 102.834 bits (255), Expect = 5.299e-23
Identity = 70/188 (37.23%), Postives = 125/188 (66.49%), Query Frame = 2
Query:  176 VMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSS-WWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAV-TQINFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIR 733
            +++I  T++GN  VV A+   + L+ V NY ++SLA +DL VA+ VMP+ V+  ++   W +G+++C  +   D+L CT+S+L+L AIA+DRYWA+   IN+ +K++   K + I+I  VW +S++IS+P     +  Q    ED  C ++T   +++ +  G+FFLP+L+MV +Y++I++ A+++IR
Sbjct:   65 LVIIAMTVVGNTLVVVAVFSYRPLKKVQNYFLVSLAASDLAVAIFVMPLHVVTFLAGGKWLLGVTVCQFFTTADILLCTSSILNLCAIALDRYWAIHNPINYAQKRTT--KFVCIVIVIVWILSMLISVPPIIGWNNWQENMMEDS-CGLSTEKAFVVFSAAGSFFLPLLVMVVVYVKIFISARQRIR 249          

HSP 2 Score: 69.707 bits (169), Expect = 2.702e-12
Identity = 35/93 (37.63%), Postives = 52/93 (55.91%), Query Frame = 2
Query: 1703 IRSRIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKIL 1981
            +R R KI   +E++AA+T+A+I   F  CWLPF    +I    +       T      ++    WLGY NS LNP +Y + + +FRR+F+KIL
Sbjct:  353 LRKREKISVAKEKRAAKTIAVIIFVFSFCWLPFFVAYVIRPFCE-------TCKLHAKVEQAFTWLGYINSSLNPFLYGILNLEFRRAFKKIL 438          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Celegans
Match: ser-2 (Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-Prot;Acc:O02213])

HSP 1 Score: 102.449 bits (254), Expect = 5.556e-23
Identity = 70/188 (37.23%), Postives = 125/188 (66.49%), Query Frame = 2
Query:  176 VMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSS-WWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAV-TQINFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIR 733
            +++I  T++GN  VV A+   + L+ V NY ++SLA +DL VA+ VMP+ V+  ++   W +G+++C  +   D+L CT+S+L+L AIA+DRYWA+   IN+ +K++   K + I+I  VW +S++IS+P     +  Q    ED  C ++T   +++ +  G+FFLP+L+MV +Y++I++ A+++IR
Sbjct:   65 LVIIAMTVVGNTLVVVAVFSYRPLKKVQNYFLVSLAASDLAVAIFVMPLHVVTFLAGGKWLLGVTVCQFFTTADILLCTSSILNLCAIALDRYWAIHNPINYAQKRTT--KFVCIVIVIVWILSMLISVPPIIGWNNWQENMMEDS-CGLSTEKAFVVFSAAGSFFLPLLVMVVVYVKIFISARQRIR 249          

HSP 2 Score: 69.707 bits (169), Expect = 2.737e-12
Identity = 35/93 (37.63%), Postives = 52/93 (55.91%), Query Frame = 2
Query: 1703 IRSRIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKIL 1981
            +R R KI   +E++AA+T+A+I   F  CWLPF    +I    +       T      ++    WLGY NS LNP +Y + + +FRR+F+KIL
Sbjct:  330 LRKREKISVAKEKRAAKTIAVIIFVFSFCWLPFFVAYVIRPFCE-------TCKLHAKVEQAFTWLGYINSSLNPFLYGILNLEFRRAFKKIL 415          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Fly
Match: 5-HT1A (gene:FBgn0004168 transcript:FBtr0086577)

HSP 1 Score: 159.844 bits (403), Expect = 1.289e-40
Identity = 93/184 (50.54%), Postives = 133/184 (72.28%), Query Frame = 2
Query:  170 ILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQINFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTS-EDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFA 718
            +L ++IL TIIGNVFV+AAIILE+NLQ+V+NYL+ SLAVADL VA LVMP+  + EIS  W +G  LCDIW   DVLCCTAS+LHLVAIA+DRYWAVT I++I  ++  R  + +MIFCVW+ ++++S+  +F      +L   E   C ++ + +Y + A    F++P+L+++A+Y +IY  A
Sbjct:  232 LLGLMILVTIIGNVFVIAAIILERNLQNVANYLVASLAVADLFVACLVMPLGAVYEISQGWILGPELCDIWTSCDVLCCTASILHLVAIAVDRYWAVTNIDYIHSRTSNR--VFMMIFCVWTAAVIVSLAPQFGWKDPDYLQRIEQQKCMVSQDVSYQVFATCCTFYVPLLVILALYWKIYQTA 413          

HSP 2 Score: 102.449 bits (254), Expect = 3.198e-22
Identity = 51/111 (45.95%), Postives = 68/111 (61.26%), Query Frame = 2
Query: 1706 RSRIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINL------ISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKILFGR----YYHRGK 2008
            + +  +E +RERKAA+TLAIITG F++CWLPF    +         ISDS             + S  LWLGY NS LNP+IYT+FSP+FR++F++ILFG     +Y  GK
Sbjct:  736 KRKETLEAKRERKAAKTLAIITGAFVVCWLPFFVMALTMPLCAACQISDS-------------VASLFLWLGYFNSTLNPVIYTIFSPEFRQAFKRILFGGHRPVHYRSGK 833          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Fly
Match: 5-HT1A (gene:FBgn0004168 transcript:FBtr0474126)

HSP 1 Score: 159.844 bits (403), Expect = 1.444e-40
Identity = 93/184 (50.54%), Postives = 133/184 (72.28%), Query Frame = 2
Query:  170 ILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQINFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTS-EDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFA 718
            +L ++IL TIIGNVFV+AAIILE+NLQ+V+NYL+ SLAVADL VA LVMP+  + EIS  W +G  LCDIW   DVLCCTAS+LHLVAIA+DRYWAVT I++I  ++  R  + +MIFCVW+ ++++S+  +F      +L   E   C ++ + +Y + A    F++P+L+++A+Y +IY  A
Sbjct:  232 LLGLMILVTIIGNVFVIAAIILERNLQNVANYLVASLAVADLFVACLVMPLGAVYEISQGWILGPELCDIWTSCDVLCCTASILHLVAIAVDRYWAVTNIDYIHSRTSNR--VFMMIFCVWTAAVIVSLAPQFGWKDPDYLQRIEQQKCMVSQDVSYQVFATCCTFYVPLLVILALYWKIYQTA 413          

HSP 2 Score: 102.064 bits (253), Expect = 4.247e-22
Identity = 51/111 (45.95%), Postives = 68/111 (61.26%), Query Frame = 2
Query: 1706 RSRIKIEQRRERKAARTLAIITGCFLICWLPFATQNMIN------LISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKILFGR----YYHRGK 2008
            + +  +E +RERKAA+TLAIITG F++CWLPF    +         ISDS             + S  LWLGY NS LNP+IYT+FSP+FR++F++ILFG     +Y  GK
Sbjct:  736 KRKETLEAKRERKAAKTLAIITGAFVVCWLPFFVMALTMPLCAACQISDS-------------VASLFLWLGYFNSTLNPVIYTIFSPEFRQAFKRILFGGHRPVHYRSGK 833          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Fly
Match: 5-HT1B (gene:FBgn0263116 transcript:FBtr0330056)

HSP 1 Score: 157.532 bits (397), Expect = 1.996e-40
Identity = 93/194 (47.94%), Postives = 139/194 (71.65%), Query Frame = 2
Query:  170 ILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQINFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTS-EDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRSTK 748
            +L ++IL TIIGNVFV+AAIILE+NLQ+V+NYL+ SLAVADL VA LVMP+  + EIS+ W +G  LCDIW   DVLCCTAS+LHLVAIA DRYW VT I++   ++  R  + +MIFCVW  ++++S+  +F      ++   E+  C ++ +  Y I A    F++P+L+++ +Y +IY+ A+++I++R+ K
Sbjct:   96 VLGLMILVTIIGNVFVIAAIILERNLQNVANYLVASLAVADLFVACLVMPLGAVYEISNGWILGPELCDIWTSCDVLCCTASILHLVAIAADRYWTVTNIDYNNLRTPRR--VFLMIFCVWFAALIVSLAPQFGWKDPDYMKRIEEQHCMVSQDVGYQIFATCCTFYVPLLVILFLYWKIYIIARKRIQRRAQK 287          

HSP 2 Score: 105.145 bits (261), Expect = 3.167e-23
Identity = 51/99 (51.52%), Postives = 67/99 (67.68%), Query Frame = 2
Query: 1691 HQLKIRSRIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKILFG 1987
            HQ   + R  +E +RERKAA+TLAIITG F+ICWLPF    +   +S       HT+     + S  LWLGY NS LNP+IYT+F+P+FRR+F++ILFG
Sbjct:  514 HQKLAKRRQLLEAKRERKAAQTLAIITGAFVICWLPFFVMALT--MSLCKECEIHTA-----VASLFLWLGYFNSTLNPVIYTIFNPEFRRAFKRILFG 605          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Fly
Match: 5-HT1B (gene:FBgn0263116 transcript:FBtr0086599)

HSP 1 Score: 157.532 bits (397), Expect = 2.073e-40
Identity = 93/194 (47.94%), Postives = 139/194 (71.65%), Query Frame = 2
Query:  170 ILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQINFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTS-EDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRSTK 748
            +L ++IL TIIGNVFV+AAIILE+NLQ+V+NYL+ SLAVADL VA LVMP+  + EIS+ W +G  LCDIW   DVLCCTAS+LHLVAIA DRYW VT I++   ++  R  + +MIFCVW  ++++S+  +F      ++   E+  C ++ +  Y I A    F++P+L+++ +Y +IY+ A+++I++R+ K
Sbjct:   96 VLGLMILVTIIGNVFVIAAIILERNLQNVANYLVASLAVADLFVACLVMPLGAVYEISNGWILGPELCDIWTSCDVLCCTASILHLVAIAADRYWTVTNIDYNNLRTPRR--VFLMIFCVWFAALIVSLAPQFGWKDPDYMKRIEEQHCMVSQDVGYQIFATCCTFYVPLLVILFLYWKIYIIARKRIQRRAQK 287          

HSP 2 Score: 105.145 bits (261), Expect = 3.181e-23
Identity = 51/99 (51.52%), Postives = 67/99 (67.68%), Query Frame = 2
Query: 1691 HQLKIRSRIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKILFG 1987
            HQ   + R  +E +RERKAA+TLAIITG F+ICWLPF    +   +S       HT+     + S  LWLGY NS LNP+IYT+F+P+FRR+F++ILFG
Sbjct:  514 HQKLAKRRQLLEAKRERKAAQTLAIITGAFVICWLPFFVMALT--MSLCKECEIHTA-----VASLFLWLGYFNSTLNPVIYTIFNPEFRRAFKRILFG 605          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Fly
Match: 5-HT1B (gene:FBgn0263116 transcript:FBtr0330055)

HSP 1 Score: 156.762 bits (395), Expect = 2.091e-40
Identity = 93/194 (47.94%), Postives = 139/194 (71.65%), Query Frame = 2
Query:  170 ILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQINFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTS-EDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRSTK 748
            +L ++IL TIIGNVFV+AAIILE+NLQ+V+NYL+ SLAVADL VA LVMP+  + EIS+ W +G  LCDIW   DVLCCTAS+LHLVAIA DRYW VT I++   ++  R  + +MIFCVW  ++++S+  +F      ++   E+  C ++ +  Y I A    F++P+L+++ +Y +IY+ A+++I++R+ K
Sbjct:   96 VLGLMILVTIIGNVFVIAAIILERNLQNVANYLVASLAVADLFVACLVMPLGAVYEISNGWILGPELCDIWTSCDVLCCTASILHLVAIAADRYWTVTNIDYNNLRTPRR--VFLMIFCVWFAALIVSLAPQFGWKDPDYMKRIEEQHCMVSQDVGYQIFATCCTFYVPLLVILFLYWKIYIIARKRIQRRAQK 287          

HSP 2 Score: 104.76 bits (260), Expect = 3.316e-23
Identity = 51/99 (51.52%), Postives = 67/99 (67.68%), Query Frame = 2
Query: 1691 HQLKIRSRIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKILFG 1987
            HQ   + R  +E +RERKAA+TLAIITG F+ICWLPF    +   +S       HT+     + S  LWLGY NS LNP+IYT+F+P+FRR+F++ILFG
Sbjct:  459 HQKLAKRRQLLEAKRERKAAQTLAIITGAFVICWLPFFVMALT--MSLCKECEIHTA-----VASLFLWLGYFNSTLNPVIYTIFNPEFRRAFKRILFG 550          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Zebrafish
Match: htr1aa (5-hydroxytryptamine (serotonin) receptor 1A a [Source:ZFIN;Acc:ZDB-GENE-071203-1])

HSP 1 Score: 138.658 bits (348), Expect = 3.779e-35
Identity = 87/193 (45.08%), Postives = 132/193 (68.39%), Query Frame = 2
Query:  173 LVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQ-INFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRSTK 748
            L  LIL+ I+GN  V+AAI LE++LQ+V+NYLI SLAV DLMV+VLV+P++ + ++ + W +G  +CDI+I  DVLCCT+S+LHL AIA+DRYWA+T  I+++ K++  R  ILI +   W +   ISIP    G R     ++   C ++ +H Y I +  GAF++P+++M+ +Y RI+  A+ +IRK   K
Sbjct:   35 LAALILFAILGNACVIAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQEMCDIFISLDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAILISL--TWLIGFSISIPPML-GWRKPEDRADPDACTISQDHGYTIYSTFGAFYIPLILMLVLYGRIFRAARFRIRKTVKK 224          

HSP 2 Score: 72.0182 bits (175), Expect = 6.192e-13
Identity = 43/118 (36.44%), Postives = 64/118 (54.24%), Query Frame = 2
Query: 1646 QSLAKNKNRLSNAMWHQLKIR------SRIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKIL 1981
            QS++KN   L N      + R      ++ K+   RERK  +TL II G F+ CWLPF    ++ L+     +     +   +I+    WLGY+NS LNP+IY  F+ DF+ +F+KIL
Sbjct:  281 QSISKNHLSLPNNPQPCFENRNEKNTEAKRKVALARERKTVKTLGIIMGTFIFCWLPFF---IVALVLPFCQDCFMPEWLGAVIN----WLGYSNSLLNPVIYAYFNKDFQNAFKKIL 391          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Zebrafish
Match: htr1b (5-hydroxytryptamine (serotonin) receptor 1B [Source:ZFIN;Acc:ZDB-GENE-081022-141])

HSP 1 Score: 132.88 bits (333), Expect = 2.926e-33
Identity = 86/199 (43.22%), Postives = 129/199 (64.82%), Query Frame = 2
Query:  158 TCGPILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVT-QINFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNHT-YIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRSTK 748
            T   +L ++ L TI+ N FV+A I   + LQ+ +N+LI SLAV DL+V+VLVMPI V+  ++  W +G  +CDIW+  D+ CCTAS+LHL  IA+DRYWA+T  + + +K++ AR     M+   W ++I IS+P  F     Q    E   C +NT+H  Y I +  GAF++P L+++A+Y RIYV A+++I K+S K
Sbjct:   48 TLSSVLGLITLATILSNAFVIATISQSRKLQTPANFLIASLAVTDLLVSVLVMPICVLYTVTREWTLGQVICDIWLSSDITCCTASILHLCVIALDRYWAITDAVEYAKKRTQARAA--GMVATAWIIAISISLPPFFW---RQVKAGELTTCSVNTDHIFYTIYSTFGAFYIPTLLLIALYGRIYVEARKRILKQSPK 241          

HSP 2 Score: 77.411 bits (189), Expect = 1.226e-14
Identity = 48/147 (32.65%), Postives = 74/147 (50.34%), Query Frame = 2
Query: 1610 NAHMCTKEPAC----------RQSLAKNKNRLSNAMWHQLKIR------SRIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKILFGRYYHR 2002
            +AH+ T  PA           RQ L  +   L +   +Q+++        + +I   RERKA +TL II G +++CWLPF    ++  +  S        +   L D F  WLGY NS +NPIIYT+ + DF+++F K++  R   R
Sbjct:  249 SAHLSTNSPASVASTSPLHCGRQDLCSDSGSLGSD--NQIRVTVSDSLLEKKRISAARERKATKTLGIILGAYIVCWLPFFIYTLLIPLCSS-------CFSPELFD-FFTWLGYVNSLINPIIYTMSNDDFKKAFHKVISFRCCRR 385          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Zebrafish
Match: htr1ab (5-hydroxytryptamine (serotonin) receptor 1A b [Source:ZFIN;Acc:ZDB-GENE-090409-2])

HSP 1 Score: 124.405 bits (311), Expect = 3.128e-30
Identity = 83/190 (43.68%), Postives = 126/190 (66.32%), Query Frame = 2
Query:  182 LILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQ-INFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRSTK 748
            LIL +I GN  VVAAI LE++LQ+V+NYLI SLAV DLMV+VLV+P++ + ++   W +G   CDI+I  D+LCCT+S+LHL AIA+DRYWA+T  I++++K++  R  +LI +   W V   ISIP          + S+   C ++ +  Y I +   AF++P+++M+ +Y RI+  A+ +IRK   K
Sbjct:   45 LILCSIFGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLDKWTLGQVTCDIFISLDILCCTSSILHLCAIALDRYWAITDPIDYMKKRTLKRAALLITV--TWFVGFSISIPPML------IMKSQPKTCMISHDPWYTIYSTFCAFYIPLILMLVLYGRIFKAARFRIRKTVRK 226          

HSP 2 Score: 77.411 bits (189), Expect = 1.119e-14
Identity = 38/97 (39.18%), Postives = 55/97 (56.70%), Query Frame = 2
Query: 1691 HQLKIRSRIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKIL 1981
            H+    ++ K+   RERK  +TL II G F++CWLPF  + ++            T    L +   I WLGY+NS LNPIIY  F+ DF+ +F+KI+
Sbjct:  307 HEKNTEAKRKLALARERKTVKTLGIIMGTFILCWLPFFIKALVMPFCP-------TCVMPLWLQDVINWLGYSNSLLNPIIYAYFNKDFQSAFKKII 396          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Zebrafish
Match: htr1ab (5-hydroxytryptamine (serotonin) receptor 1A b [Source:ZFIN;Acc:ZDB-GENE-090409-2])

HSP 1 Score: 124.405 bits (311), Expect = 3.128e-30
Identity = 83/190 (43.68%), Postives = 126/190 (66.32%), Query Frame = 2
Query:  182 LILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQ-INFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRSTK 748
            LIL +I GN  VVAAI LE++LQ+V+NYLI SLAV DLMV+VLV+P++ + ++   W +G   CDI+I  D+LCCT+S+LHL AIA+DRYWA+T  I++++K++  R  +LI +   W V   ISIP          + S+   C ++ +  Y I +   AF++P+++M+ +Y RI+  A+ +IRK   K
Sbjct:   45 LILCSIFGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLDKWTLGQVTCDIFISLDILCCTSSILHLCAIALDRYWAITDPIDYMKKRTLKRAALLITV--TWFVGFSISIPPML------IMKSQPKTCMISHDPWYTIYSTFCAFYIPLILMLVLYGRIFKAARFRIRKTVRK 226          

HSP 2 Score: 77.411 bits (189), Expect = 1.119e-14
Identity = 38/97 (39.18%), Postives = 55/97 (56.70%), Query Frame = 2
Query: 1691 HQLKIRSRIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKIL 1981
            H+    ++ K+   RERK  +TL II G F++CWLPF  + ++            T    L +   I WLGY+NS LNPIIY  F+ DF+ +F+KI+
Sbjct:  307 HEKNTEAKRKLALARERKTVKTLGIIMGTFILCWLPFFIKALVMPFCP-------TCVMPLWLQDVINWLGYSNSLLNPIIYAYFNKDFQSAFKKII 396          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Zebrafish
Match: adra2c (adrenoceptor alpha 2C [Source:NCBI gene;Acc:266752])

HSP 1 Score: 124.79 bits (312), Expect = 3.882e-30
Identity = 82/199 (41.21%), Postives = 130/199 (65.33%), Query Frame = 2
Query:  170 ILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQ-INFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRSTKFRPPD 763
            ++  LIL+TI+GNV VV A++  + L+   N  ++SLA AD++VA L++P S+ NE+   W+ G   C+I++  DVL CT+S++HL AI++DRYW+VTQ + +  K++  R + +I++  VW +S VIS P      RN  +     +C++N +  YI+ ++IG+FF P +IM+ +YIRIY  AK + R  S K R PD
Sbjct:   41 LVSFLILFTIVGNVLVVIAVLTSRALKPPQNLFLVSLASADILVATLIIPFSLANELMGYWFFGEVWCNIYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKGMIVV--VWLISAVISFPPLISMDRNT-VDERRPMCQLNDHTWYILYSSIGSFFAPCVIMILVYIRIYQVAKTRTRNMSEKRRDPD 236          

HSP 2 Score: 81.6481 bits (200), Expect = 6.795e-16
Identity = 39/91 (42.86%), Postives = 53/91 (58.24%), Query Frame = 2
Query: 1709 SRIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKIL 1981
            SR KI Q RE++    LA++ G F++CW PF     +  I   P       +K      F  W+GY NS LNP+IYT+F+ DFRR+F+KIL
Sbjct:  340 SRKKISQAREKRFTFVLAVVMGVFVVCWFPFFFSYSLYGICREPCAIPDPLFK------FFFWIGYCNSSLNPVIYTIFNQDFRRAFQKIL 424          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Xenopus
Match: ENSXETT00000046867.1 (5-hydroxytryptamine (serotonin) receptor 1A, G protein-coupled [Source:NCBI gene;Acc:100488829])

HSP 1 Score: 130.183 bits (326), Expect = 6.016e-32
Identity = 86/188 (45.74%), Postives = 126/188 (67.02%), Query Frame = 2
Query:  173 LVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQ-INFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIR 733
            L  LIL  I GN  V+AAI LE+ LQ+V+NYLI SLAV DLMV+VLV+P++  N++ + W +G   CDI+I  DVLCCT+S+LHL AIA+DRYWA+T  I+++ K++  R  +LI I   W V   ISIP    G R     S+   C+++ +  Y I +  GAF++P+++M+ +Y +I+  A+ +IR
Sbjct:   36 LGTLILCAIFGNACVIAAIALERCLQTVANYLIGSLAVTDLMVSVLVLPMAAHNQVLNKWTLGQVTCDIFISLDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAVLISI--TWIVGFSISIPPML-GWRTPEDRSDPNACKISEDPGYTIYSTFGAFYIPLILMLVLYGKIFKAARFRIR 220          

HSP 2 Score: 74.3294 bits (181), Expect = 1.763e-13
Identity = 40/95 (42.11%), Postives = 57/95 (60.00%), Query Frame = 2
Query: 1709 SRIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKILFGRY 1993
            ++ K+   RERK  +TL II G F+ CWLPF    ++    +    T H  +  LL D  I WLGY+NS LNPIIY  F+ DF+ +F+KI+  ++
Sbjct:  320 AKRKVALARERKTVKTLGIIMGTFIFCWLPFFIVALVLPFCE----TCHMPH--LLFD-VINWLGYSNSLLNPIIYAYFNKDFQSAFKKIIKCKF 407          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Xenopus
Match: adra2c (adrenoceptor alpha 2C [Source:NCBI gene;Acc:100145449])

HSP 1 Score: 127.872 bits (320), Expect = 5.213e-31
Identity = 87/209 (41.63%), Postives = 133/209 (63.64%), Query Frame = 2
Query:  137 FSWLHVWTCGPILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQ-INFIRKKSGAR-KQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGV---CRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRSTK 748
            +S   VW    I+  LI++TI+GNVFVV A++  + L++  N  ++SLA AD++VA LVMP S+ NE+   W+ G   CDI++  DVL CT+S++HL AI++DRYW+VTQ + +  K++  R K I++ ++    +S VIS P      R+    +ED V   C++N +  YI+ + IG+FF P +IM+ +YIRIY  AK + R  S K
Sbjct:   26 YSMTSVWCLAAIVGFLIIFTIVGNVFVVIAVLTSRALKAPQNLFLVSLASADILVAALVMPFSLANELMGYWYFGNVWCDIYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRIKGIIVTVW---LISAVISFPPLISMDRD----TEDDVYPQCKLNDDTWYILSSCIGSFFAPCIIMILVYIRIYQVAKLRTRTLSEK 227          

HSP 2 Score: 76.6406 bits (187), Expect = 3.834e-14
Identity = 35/87 (40.23%), Postives = 50/87 (57.47%), Query Frame = 2
Query: 1721 IEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKIL 1981
            + Q RE++    LA++ G F++CW PF     +  I         T +K      F  W+GY NS LNP+IYT+F+ DFRRSF+KI+
Sbjct:  343 LSQAREKRFTFVLAVVMGVFVVCWFPFFFSYSLYGICREACEVPETLFK------FFFWIGYCNSSLNPVIYTIFNQDFRRSFKKII 423          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Xenopus
Match: HTR1B (5-hydroxytryptamine receptor 1B [Source:HGNC Symbol;Acc:HGNC:5287])

HSP 1 Score: 122.094 bits (305), Expect = 1.387e-29
Identity = 76/184 (41.30%), Postives = 120/184 (65.22%), Query Frame = 2
Query:  203 GNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVT-QINFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNHT-YIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRSTK 748
             N FV+  +   + L + +NYLI SLA  DL+V++LV+PI+++  ++  W +G  +CD+W+  D+ CCTAS+LHL  IA+DRYWA+T  + + +K++  R   ++MI  VW  SI IS+P  F     Q    E  VC +NT+H  Y + + +GAF++P L+++A+Y RIYV A+ +I K+S K
Sbjct:   35 SNAFVITTVYQTRKLHTPANYLIASLAFTDLLVSILVLPIAIVYTVTGKWTLGQIICDMWLSSDITCCTASILHLCVIALDRYWAITDAVEYTKKRTPKRA--VVMIALVWVFSISISMPPLFW---RQSKAEEIAVCAVNTDHILYTVYSTVGAFYIPTLLLIALYGRIYVEARSRILKQSPK 213          

HSP 2 Score: 72.4034 bits (176), Expect = 5.461e-13
Identity = 35/88 (39.77%), Postives = 54/88 (61.36%), Query Frame = 2
Query: 1718 KIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKIL 1981
            KI   RERKA +TL +I G +++CWLPF   +++      P   +   +   + D F  WLGY NS +NPIIYT+ + DF+++F K++
Sbjct:  270 KIMAARERKATKTLGVILGAYIVCWLPFFIISLV-----MPICKDACWFHPAIFD-FFNWLGYLNSLINPIIYTMSNEDFKQAFHKLI 351          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Xenopus
Match: HTR1D (5-hydroxytryptamine receptor 1D [Source:HGNC Symbol;Acc:HGNC:5289])

HSP 1 Score: 122.094 bits (305), Expect = 1.507e-29
Identity = 80/220 (36.36%), Postives = 134/220 (60.91%), Query Frame = 2
Query:  158 TCGPILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVT-QINFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNH-TYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRSTKFRPPDIH----TLSNLNPKST 799
            T   +L ++ L T++ NVFV+  I++ + L + +NYLI SLA  DL+V++LVMPIS+   ++ +W  G  +CDIW+  D+ CCTAS+LHL  IA+DRYWA+T  + + + ++  R  ++I++  + S+ I I          ++ LT    VC +NT+  +Y I +  GAF++P ++++ +Y +IY+ A+ +I K      PP I+    T + L P ST
Sbjct:   36 TLAVLLSIITLATLLSNVFVIITIVMTRKLHTPANYLIGSLAFTDLLVSILVMPISIAYTVTHTWTFGQIVCDIWLLSDITCCTASILHLCVIALDRYWAITDALEYTKHRTARRAAVMILVVWIISICISIPPLFWRQAKAHEELT----VCTINTDQISYTIYSTCGAFYIPTVLLILLYGKIYIAARSRILK------PPSIYGKRFTTAQLIPGST 245          

HSP 2 Score: 87.0409 bits (214), Expect = 8.877e-18
Identity = 48/131 (36.64%), Postives = 76/131 (58.02%), Query Frame = 2
Query: 1601 VNANAHM----CTKEPACRQSLAKNKNRLSNAMWHQLKIRSRIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKIL 1981
            +NAN HM     ++ P C   +   K +L+++      I  R ++   RE+KA +TL II G F++CWLPF   +++      P   +   +  LL D F  WLGY NS +NP+IYTVF+ DF+++F+K++
Sbjct:  252 INANVHMEHPHTSETPVCINHI---KIKLADS------IIERKRLSAAREKKATKTLGIILGAFIVCWLPFFVVSLV-----LPICRDACWFDPLLFD-FFTWLGYLNSLINPVIYTVFNEDFKKAFQKLI 367          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Xenopus
Match: ADRA2B (adrenoceptor alpha 2B [Source:NCBI gene;Acc:100485811])

HSP 1 Score: 122.865 bits (307), Expect = 1.719e-29
Identity = 81/221 (36.65%), Postives = 139/221 (62.90%), Query Frame = 2
Query:  170 ILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQ-INFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGH-RNQFLTSEDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRST----KFRPPDIHTLSN---LNPKSTRT 805
            I+  L+L+TI GNV V+ A++  ++L++  N  ++SLA AD++VA L++P S+ NE+   W+ G + C++++  DVL CT+S++HL AI++DRYW+V+Q I +  K++  R + +I+I      +++   P  + G  ++Q    E   C++N    YI+ ++I +FF P LIM+ +Y+RIY+ AKR+ RK ST    K   P + + +N   LN   T+T
Sbjct:   23 IITFLVLFTIFGNVLVIIAVLTSRSLKAPQNLFLVSLAAADILVATLIIPFSLANELMGYWYFGKTWCEMYLALDVLFCTSSIVHLCAISLDRYWSVSQAIEYNSKRTPKRIKCIILIV-WTLAALISLPPLIYKGKSKDQNAKPE---CKLNEEPWYILSSSICSFFAPCLIMILVYLRIYLIAKRRNRKNSTDKKLKKMAPGLFSRTNKHSLNSSHTQT 239          

HSP 2 Score: 70.8626 bits (172), Expect = 2.410e-12
Identity = 32/83 (38.55%), Postives = 47/83 (56.63%), Query Frame = 2
Query: 1733 RERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKIL 1981
            RE++    LA++ G F++CW PF     +  I           Y    +  F  W+GY NS LNP+IYT+F+ DFR++FR+IL
Sbjct:  330 REKRFTFVLAVVIGVFVLCWFPFFFTYSLGAIC------TELCYIPDSVFQFFFWIGYCNSSLNPVIYTIFNQDFRKAFRRIL 406          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Mouse
Match: Htr1a (5-hydroxytryptamine (serotonin) receptor 1A [Source:MGI Symbol;Acc:MGI:96273])

HSP 1 Score: 132.88 bits (333), Expect = 6.191e-33
Identity = 86/194 (44.33%), Postives = 129/194 (66.49%), Query Frame = 2
Query:  170 ILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQ-INFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRSTK 748
            +L  LI   ++GN  VVAAI LE++LQ+V+NYLI SLAV DLMV+VLV+P++ + ++ + W +G   CD++I  DVLCCT+S+LHL AIA+DRYWA+T  I+++ K++  R   LI +   W +  +ISIP    G R     S    C ++ +H Y I +  GAF++P+L+M+ +Y RI+  A+ +IRK   K
Sbjct:   42 LLGTLIFCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISL--TWLIGFLISIPPML-GWRTPEDRSNPNECTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKK 232          

HSP 2 Score: 75.8702 bits (185), Expect = 4.372e-14
Identity = 36/91 (39.56%), Postives = 56/91 (61.54%), Query Frame = 2
Query: 1709 SRIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKIL 1981
            ++ K+   RERK  +TL II G F++CWLPF    ++    +S      + +   L+ + I WLGY+NS LNP+IY  F+ DF+ +F+KI+
Sbjct:  331 AKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCES------SCHMPELLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKII 415          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Mouse
Match: Htr1b (5-hydroxytryptamine (serotonin) receptor 1B [Source:MGI Symbol;Acc:MGI:96274])

HSP 1 Score: 117.087 bits (292), Expect = 8.750e-28
Identity = 77/181 (42.54%), Postives = 118/181 (65.19%), Query Frame = 2
Query:  206 NVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVT-QINFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNHT-YIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRS 742
            N FV+A +   + L + +NYLI SLAV DL+V++LVMPIS +  ++  W +G  +CD W+  D+ CCTAS++HL  IA+DRYWA+T  + +  K++  R  I+I++  VW  SI IS+P  F   R      E   C +NT+H  Y + + +GAF+LP L+++A+Y RIYV A+ +I K++
Sbjct:   63 NAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSDITCCTASIMHLCVIALDRYWAITDAVEYSAKRTPKRAAIMIVL--VWVFSISISLPPFF--WRQAKAEEEMLDCFVNTDHVLYTVYSTVGAFYLPTLLLIALYGRIYVEARSRILKQT 239          

HSP 2 Score: 74.3294 bits (181), Expect = 1.083e-13
Identity = 43/127 (33.86%), Postives = 69/127 (54.33%), Query Frame = 2
Query: 1601 VNANAHMCTKEPACRQSLAKNKNRLSNAMWHQLKIRSRIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKIL 1981
            +N+ A     E      + + K R+S+A+  + K+ +       RERKA +TL II G F++CWLPF   +++  I           +  + I  F  WLGY NS +NPIIYT+ + DF+++F K++
Sbjct:  266 INSRAPDVPSESGSPVYVNQVKVRVSDALLEKKKLMAA------RERKATKTLGIILGAFIVCWLPFFIISLVMPIC------KDACWFHMAIFDFFNWLGYLNSLINPIIYTMSNEDFKQAFHKLI 380          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Mouse
Match: Htr1b (5-hydroxytryptamine (serotonin) receptor 1B [Source:MGI Symbol;Acc:MGI:96274])

HSP 1 Score: 117.087 bits (292), Expect = 8.750e-28
Identity = 77/181 (42.54%), Postives = 118/181 (65.19%), Query Frame = 2
Query:  206 NVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVT-QINFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNHT-YIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRS 742
            N FV+A +   + L + +NYLI SLAV DL+V++LVMPIS +  ++  W +G  +CD W+  D+ CCTAS++HL  IA+DRYWA+T  + +  K++  R  I+I++  VW  SI IS+P  F   R      E   C +NT+H  Y + + +GAF+LP L+++A+Y RIYV A+ +I K++
Sbjct:   63 NAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSDITCCTASIMHLCVIALDRYWAITDAVEYSAKRTPKRAAIMIVL--VWVFSISISLPPFF--WRQAKAEEEMLDCFVNTDHVLYTVYSTVGAFYLPTLLLIALYGRIYVEARSRILKQT 239          

HSP 2 Score: 74.3294 bits (181), Expect = 1.083e-13
Identity = 43/127 (33.86%), Postives = 69/127 (54.33%), Query Frame = 2
Query: 1601 VNANAHMCTKEPACRQSLAKNKNRLSNAMWHQLKIRSRIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKIL 1981
            +N+ A     E      + + K R+S+A+  + K+ +       RERKA +TL II G F++CWLPF   +++  I           +  + I  F  WLGY NS +NPIIYT+ + DF+++F K++
Sbjct:  266 INSRAPDVPSESGSPVYVNQVKVRVSDALLEKKKLMAA------RERKATKTLGIILGAFIVCWLPFFIISLVMPIC------KDACWFHMAIFDFFNWLGYLNSLINPIIYTMSNEDFKQAFHKLI 380          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Mouse
Match: Adra2a (adrenergic receptor, alpha 2a [Source:MGI Symbol;Acc:MGI:87934])

HSP 1 Score: 117.857 bits (294), Expect = 1.147e-27
Identity = 73/197 (37.06%), Postives = 123/197 (62.44%), Query Frame = 2
Query:  179 MLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQ-INFIRKKSGAR-KQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRSTKFRPPD 763
            +L+L+T+ GNV V+ A+   + L++  N  ++SLA AD++VA LV+P S+ NE+   W+ G   C+I++  DVL CT+S++HL AI++DRYW++TQ I +  K++  R K I++ ++ + +V     + S             +  C++N    Y+I ++IG+FF P LIM+ +Y+RIY  AKR+ R   ++ R PD
Sbjct:   57 LLMLFTVFGNVLVIIAVFTSRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKVWCEIYLALDVLFCTSSIVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIVTVWVISAVISFPPLISIEKKGAGGGQQPAEPSCKINDQKWYVISSSIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSR-RGPD 252          

HSP 2 Score: 76.2554 bits (186), Expect = 4.904e-14
Identity = 37/92 (40.22%), Postives = 54/92 (58.70%), Query Frame = 2
Query: 1709 SRIKIEQRRERKAARTLAIITGCFLICWLPFA-TQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKIL 1981
            SR +  Q RE++    LA++ G F++CW PF  T  +I +    P+           + +F  W GY NS LNP+IYT+F+ DFRR+F+KIL
Sbjct:  375 SRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLIAVGCPVPSQ----------LFNFFFWFGYCNSSLNPVIYTIFNHDFRRAFKKIL 456          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Mouse
Match: Adra2a (adrenergic receptor, alpha 2a [Source:MGI Symbol;Acc:MGI:87934])

HSP 1 Score: 117.857 bits (294), Expect = 1.147e-27
Identity = 73/197 (37.06%), Postives = 123/197 (62.44%), Query Frame = 2
Query:  179 MLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQ-INFIRKKSGAR-KQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRSTKFRPPD 763
            +L+L+T+ GNV V+ A+   + L++  N  ++SLA AD++VA LV+P S+ NE+   W+ G   C+I++  DVL CT+S++HL AI++DRYW++TQ I +  K++  R K I++ ++ + +V     + S             +  C++N    Y+I ++IG+FF P LIM+ +Y+RIY  AKR+ R   ++ R PD
Sbjct:   57 LLMLFTVFGNVLVIIAVFTSRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKVWCEIYLALDVLFCTSSIVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIVTVWVISAVISFPPLISIEKKGAGGGQQPAEPSCKINDQKWYVISSSIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSR-RGPD 252          

HSP 2 Score: 76.2554 bits (186), Expect = 4.904e-14
Identity = 37/92 (40.22%), Postives = 54/92 (58.70%), Query Frame = 2
Query: 1709 SRIKIEQRRERKAARTLAIITGCFLICWLPFA-TQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKIL 1981
            SR +  Q RE++    LA++ G F++CW PF  T  +I +    P+           + +F  W GY NS LNP+IYT+F+ DFRR+F+KIL
Sbjct:  375 SRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLIAVGCPVPSQ----------LFNFFFWFGYCNSSLNPVIYTIFNHDFRRAFKKIL 456          
BLAST of 5-hydroxytryptamine receptor vs. UniProt/SwissProt
Match: sp|Q25414|5HTR_LYMST (5-hydroxytryptamine receptor OS=Lymnaea stagnalis OX=6523 PE=2 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 1.499e-45
Identity = 110/211 (52.13%), Postives = 152/211 (72.04%), Query Frame = 2
Query:  104 WNITVPIFSPRFSWLHVWTCGPILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQINFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRK 736
            W++TV      +S  H+     IL + +L  IIGN FV+AA++LE++L +V+NYLILSLAVADLMVAVLVMP+SV++EIS  W++   +CD+WI  DVLCCTAS+LHLVAIA+DRYWAVT I++IR++S  R  IL+MI  VW V++ ISIP  F          + G C ++ +  Y I + +GAF+LPML+M+ IYIRI++ A+ +IRK
Sbjct:   85 WSLTV------YSHEHLVLTSVILGLFVLCCIIGNCFVIAAVMLERSLHNVANYLILSLAVADLMVAVLVMPLSVVSEISKVWFLHSEVCDMWISVDVLCCTASILHLVAIAMDRYWAVTSIDYIRRRSARR--ILLMIMVVWIVALFISIPPLFGWRDPNNDPDKTGTCIISQDKGYTIFSTVGAFYLPMLVMMIIYIRIWLVARSRIRK 287          

HSP 2 Score: 116.316 bits (290), Expect = 4.796e-26
Identity = 60/102 (58.82%), Postives = 70/102 (68.63%), Query Frame = 2
Query: 1706 RSRIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKILFGRYYHRGKR 2011
            R+R K+E +RERKAARTLAIITG FLICWLPF    +I    D P              SF+LWLGY NS LNPIIYT+FSP+FR +F+KILFG+ Y RG R
Sbjct:  416 RTREKLELKRERKAARTLAIITGAFLICWLPFFIIALIGPFVD-PEGIPP------FARSFVLWLGYFNSLLNPIIYTIFSPEFRSAFQKILFGK-YRRGHR 509          
BLAST of 5-hydroxytryptamine receptor vs. UniProt/SwissProt
Match: sp|P28285|5HT2A_DROME (5-hydroxytryptamine receptor 2A OS=Drosophila melanogaster OX=7227 GN=5-HT1A PE=2 SV=2)

HSP 1 Score: 159.844 bits (403), Expect = 1.292e-39
Identity = 93/184 (50.54%), Postives = 133/184 (72.28%), Query Frame = 2
Query:  170 ILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQINFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTS-EDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFA 718
            +L ++IL TIIGNVFV+AAIILE+NLQ+V+NYL+ SLAVADL VA LVMP+  + EIS  W +G  LCDIW   DVLCCTAS+LHLVAIA+DRYWAVT I++I  ++  R  + +MIFCVW+ ++++S+  +F      +L   E   C ++ + +Y + A    F++P+L+++A+Y +IY  A
Sbjct:  232 LLGLMILVTIIGNVFVIAAIILERNLQNVANYLVASLAVADLFVACLVMPLGAVYEISQGWILGPELCDIWTSCDVLCCTASILHLVAIAVDRYWAVTNIDYIHSRTSNR--VFMMIFCVWTAAVIVSLAPQFGWKDPDYLQRIEQQKCMVSQDVSYQVFATCCTFYVPLLVILALYWKIYQTA 413          

HSP 2 Score: 102.449 bits (254), Expect = 3.206e-21
Identity = 51/111 (45.95%), Postives = 68/111 (61.26%), Query Frame = 2
Query: 1706 RSRIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINL------ISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKILFGR----YYHRGK 2008
            + +  +E +RERKAA+TLAIITG F++CWLPF    +         ISDS             + S  LWLGY NS LNP+IYT+FSP+FR++F++ILFG     +Y  GK
Sbjct:  736 KRKETLEAKRERKAAKTLAIITGAFVVCWLPFFVMALTMPLCAACQISDS-------------VASLFLWLGYFNSTLNPVIYTIFSPEFRQAFKRILFGGHRPVHYRSGK 833          
BLAST of 5-hydroxytryptamine receptor vs. UniProt/SwissProt
Match: sp|P28286|5HT2B_DROME (5-hydroxytryptamine receptor 2B OS=Drosophila melanogaster OX=7227 GN=5-HT1B PE=2 SV=3)

HSP 1 Score: 157.532 bits (397), Expect = 2.078e-39
Identity = 93/194 (47.94%), Postives = 139/194 (71.65%), Query Frame = 2
Query:  170 ILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQINFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTS-EDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRSTK 748
            +L ++IL TIIGNVFV+AAIILE+NLQ+V+NYL+ SLAVADL VA LVMP+  + EIS+ W +G  LCDIW   DVLCCTAS+LHLVAIA DRYW VT I++   ++  R  + +MIFCVW  ++++S+  +F      ++   E+  C ++ +  Y I A    F++P+L+++ +Y +IY+ A+++I++R+ K
Sbjct:   96 VLGLMILVTIIGNVFVIAAIILERNLQNVANYLVASLAVADLFVACLVMPLGAVYEISNGWILGPELCDIWTSCDVLCCTASILHLVAIAADRYWTVTNIDYNNLRTPRR--VFLMIFCVWFAALIVSLAPQFGWKDPDYMKRIEEQHCMVSQDVGYQIFATCCTFYVPLLVILFLYWKIYIIARKRIQRRAQK 287          

HSP 2 Score: 105.145 bits (261), Expect = 3.189e-22
Identity = 51/99 (51.52%), Postives = 67/99 (67.68%), Query Frame = 2
Query: 1691 HQLKIRSRIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKILFG 1987
            HQ   + R  +E +RERKAA+TLAIITG F+ICWLPF    +   +S       HT+     + S  LWLGY NS LNP+IYT+F+P+FRR+F++ILFG
Sbjct:  514 HQKLAKRRQLLEAKRERKAAQTLAIITGAFVICWLPFFVMALT--MSLCKECEIHTA-----VASLFLWLGYFNSTLNPVIYTIFNPEFRRAFKRILFG 605          
BLAST of 5-hydroxytryptamine receptor vs. UniProt/SwissProt
Match: sp|Q0EAB6|5HT1A_HORSE (5-hydroxytryptamine receptor 1A OS=Equus caballus OX=9796 GN=HTR1A PE=2 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 5.800e-33
Identity = 90/217 (41.47%), Postives = 135/217 (62.21%), Query Frame = 2
Query:  170 ILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQ-INFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRSTKFRPPDIHTLSNLNPKSTRTGKEN 817
            +L  LI   ++GN  VVAAI LE++LQ+V+NYLI SLAV DLMV+VLV+P++ + ++ + W +G   CD++I  DVLCCT+S+LHL AIA+DRYWA+T  I+++ K++  R   LI +   W V  +ISIP    G R     S+   C ++ +H Y I +  GAF++P+L+M+ +Y RI+  A+ +IRK   K       +    +P   R    N
Sbjct:   42 LLGTLIFCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISL--TWLVGFLISIPPML-GWRTPEDRSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKKGADSRLGASPAPQRKKSAN 255          

HSP 2 Score: 78.9518 bits (193), Expect = 3.333e-14
Identity = 38/98 (38.78%), Postives = 59/98 (60.20%), Query Frame = 2
Query: 1709 SRIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKILFGRYYHR 2002
            ++ K+   RERK  +TL II G F++CWLPF    ++    +S      + +   L+ + I WLGY+NS LNP+IY  F+ DF+ +F+KIL  ++  R
Sbjct:  331 AKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCES------SCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKILKCKFCRR 422          
BLAST of 5-hydroxytryptamine receptor vs. UniProt/SwissProt
Match: sp|Q6XXY0|5HT1A_VULVU (5-hydroxytryptamine receptor 1A OS=Vulpes vulpes OX=9627 GN=HTR1A PE=3 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 8.387e-33
Identity = 88/208 (42.31%), Postives = 134/208 (64.42%), Query Frame = 2
Query:  170 ILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVT-QINFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRSTKFRPPDIHTLSNLNP 790
            +L  LI   ++GN  VVAAI LE++LQ+V+NYLI SLAV DLMV+VLV+P++ + ++ + W +G   CD++I  DVLCCT+S+LHL AIA+DRYWA+T  I+++ K++  R   LI +   W +  +ISIP    G R     S+   C ++ +H Y I +  GAF++P+L+M+ +Y RI+  A+ +IRK   K         S ++P
Sbjct:   42 LLGTLIFCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISL--TWLIGFLISIPPML-GWRTPEDRSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKAERKGADARSGVSP 246          

HSP 2 Score: 78.5666 bits (192), Expect = 4.422e-14
Identity = 49/145 (33.79%), Postives = 74/145 (51.03%), Query Frame = 2
Query: 1568 ISSREEKISLRVNANAHMCTKEPACRQSLAKNKNRLSNAMWHQLKIRSRIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKILFGRYYHR 2002
            + S +E + L   A A  C   PA   S  K   R + A         + K+   RERK  +TL II G F++CWLPF    ++    +S      + +   L+ + I WLGY+NS LNP+IY  F+ DF+ +F+KI+  ++  R
Sbjct:  298 VGSSKEHLPLPSEAGAIPCA--PA---SFEKKNERNAEA---------KRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCES------SCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIVRCKFCRR 422          
BLAST of 5-hydroxytryptamine receptor vs. TrEMBL
Match: A0A193KUE3 (GCR012 OS=Schmidtea mediterranea OX=79327 GN=gcr012 PE=2 SV=1)

HSP 1 Score: 1171.76 bits (3030), Expect = 0.000e+0
Identity = 639/640 (99.84%), Postives = 640/640 (100.00%), Query Frame = 2
Query:   98 MDWNITVPIFSPRFSWLHVWTCGPILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQINFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRSTKFRPPDIHTLSNLNPKSTRTGKENKIVYFSSILFRCISVKTNTKNNQDQLVFKDANHDNNVIKDSELDKVKGGKDIEHIGDYIMNPNNISKRQISLMSFGSQLSDIPYVDEDEVIKHDXXXXXXXXXXXXXXXXXXXXXXVTAIEKQAXXXXXXXXVTISGESSTQTMIASQFHRYSSDDTNEIRXXXXXXXXXXXGTDFQVDSESVFESNNSTKHGSQELFCENCINALDSELESSGFPISSTELEEHLACANEISSDHVISYGHQDDIVARSISSREEKISLRVNANAHMCTKEPACRQSLAKNKNRLSNAMWHQLKIRSRIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKILFGRYYHRGKRSQ 2017
            MDWNITVPIFSPRFSWLHVWTCGPILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADLMVAVLVMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQINFIRKKSGARKQILIMIFCVWSVSIVISIPSRFHGHRNQFLTSEDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRSTKFRPPDIHTLSNLNPKSTRTGKENKIVYFSSILFRCISVKTNTKNNQDQLVFKDANHDNNVIKDSELDKVKGGKDIEHIGDYIMNPNNISKRQISLMSFGSQLSDIPYVDEDEVIKHDSSLSKKNSPQPSKLSSPSCSS+VTAIEKQANNNINNNIVTISGESSTQTMIASQFHRYSSDDTNEIRSPSVSCRSSNSGTDFQVDSESVFESNNSTKHGSQELFCENCINALDSELESSGFPISSTELEEHLACANEISSDHVISYGHQDDIVARSISSREEKISLRVNANAHMCTKEPACRQSLAKNKNRLSNAMWHQLKIRSRIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKILFGRYYHRGKRSQ
Sbjct:    1 MDWNITVPIFSPRFSWLHVWTCGPILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADLMVAVLVMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQINFIRKKSGARKQILIMIFCVWSVSIVISIPSRFHGHRNQFLTSEDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRSTKFRPPDIHTLSNLNPKSTRTGKENKIVYFSSILFRCISVKTNTKNNQDQLVFKDANHDNNVIKDSELDKVKGGKDIEHIGDYIMNPNNISKRQISLMSFGSQLSDIPYVDEDEVIKHDSSLSKKNSPQPSKLSSPSCSSIVTAIEKQANNNINNNIVTISGESSTQTMIASQFHRYSSDDTNEIRSPSVSCRSSNSGTDFQVDSESVFESNNSTKHGSQELFCENCINALDSELESSGFPISSTELEEHLACANEISSDHVISYGHQDDIVARSISSREEKISLRVNANAHMCTKEPACRQSLAKNKNRLSNAMWHQLKIRSRIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKILFGRYYHRGKRSQ 640          
BLAST of 5-hydroxytryptamine receptor vs. TrEMBL
Match: A0A193KU56 (GCR006 OS=Schmidtea mediterranea OX=79327 GN=gcr006 PE=2 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 4.258e-60
Identity = 128/227 (56.39%), Postives = 169/227 (74.45%), Query Frame = 2
Query:  125 FSPRFSWLHVWTCGPILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQINFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQ---FLTSEDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRSTKFRPPDIHTLSNLNPKS 796
            FSPR SW+  +     L  +ILWTIIGNVFVVAAI+LE+ L++VSNYLILSLAVADLMVA+LVMPIS I E+SS+WW+G+ LCD+W  FDVL CTAS+LHLV IAIDRYWAVT IN++ +++ +R  I++MI  VW +S++IS+PSRFH HRN         +G C +N + +Y + +N+GAF+LPM  M  IY+RIY+FA+ +IR +  K +    H LSN + KS
Sbjct:   18 FSPRLSWIQFYITALFLGAIILWTIIGNVFVVAAIVLERTLKNVSNYLILSLAVADLMVAILVMPISAIKEVSSTWWLGIELCDLWTCFDVLSCTASILHLVVIAIDRYWAVTDINYLHRRTSSR--IILMIIGVWLISVIISVPSRFHTHRNNAEWLRVIVNGSCIINESVSYTVFSNLGAFYLPMAFMSVIYLRIYIFARSRIRYKRKKMKQN--HCLSNTDHKS 240          

HSP 2 Score: 123.25 bits (308), Expect = 6.042e-26
Identity = 59/97 (60.82%), Postives = 68/97 (70.10%), Query Frame = 2
Query: 1712 RIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKILFGRYYHR 2002
            R K+EQ+RERKAARTLAIITGCF+ICWLPF   N+ +         N     + L DS  LWLGY NS LNP+IYTVFSPDFR +FRKIL G Y+ R
Sbjct:  418 RNKVEQKRERKAARTLAIITGCFIICWLPFGINNVAHAF------CNTEPCGSALFDSLCLWLGYVNSGLNPVIYTVFSPDFRTAFRKILLGHYHTR 508          
BLAST of 5-hydroxytryptamine receptor vs. TrEMBL
Match: A0A183AJS0 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS7205 PE=3 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 3.152e-53
Identity = 125/256 (48.83%), Postives = 166/256 (64.84%), Query Frame = 2
Query:  107 NITVPIFSPRFSWLHVWTCGPILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQINFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHR------NQFLTSEDGV-------CRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRSTKFRPPDIH------TLSNLNPKSTRTGKEN 817
            N+T  +F  RF W H W    +L+ LIL TI+GNVFVVAAI+LEK+LQ VSNYLILSLAVADLMVA L MPIS INE+S  WW+G +LCD WI  DVLCCTAS+LHLV IA+DRYWAVT   +IRK++  R   +I +F  W +S+ IS+P+RF+  R      +  L + + +       C +N  + Y I + +GAF++PM+ M+ IY RIY+ AK +IR+ + + R    H      T +N   KS  + K N
Sbjct:    5 NVTAVVFQTRFGWAHFWVTLALLIPLILCTIVGNVFVVAAILLEKHLQGVSNYLILSLAVADLMVATLPMPISAINEVSEDWWLGNALCDFWICSDVLCCTASILHLVGIALDRYWAVTNAEYIRKRTAKRIGFMITVF--WLLSVAISLPARFNITRLKSWIQHSNLAANESIEQWSVPDCGINKEYGYTIFSTVGAFYMPMIFMMGIYARIYLVAKARIRRSTFRKRTNSPHEQLTTITETNQGQKSCHSTKSN 258          

HSP 2 Score: 112.849 bits (281), Expect = 4.913e-22
Identity = 54/97 (55.67%), Postives = 67/97 (69.07%), Query Frame = 2
Query: 1712 RIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKILFGRYYHR 2002
            R ++E +RERKA  TLAIITGCF++CWLPF    +I   +D    +        +    +LWLGY+NS LNPIIYT+FSPDFR +FRKILFGRYY R
Sbjct:  611 RERLENQRERKAVITLAIITGCFMLCWLPFFIVAVIAPFNDRMRISK-------VGHGIVLWLGYSNSLLNPIIYTIFSPDFRNAFRKILFGRYYLR 700          
BLAST of 5-hydroxytryptamine receptor vs. TrEMBL
Match: A0A4S2LW70 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005918 PE=3 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 1.906e-52
Identity = 123/222 (55.41%), Postives = 152/222 (68.47%), Query Frame = 2
Query:  110 ITVPIFSPRFSWLHVWTCGPILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQINFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHR-----NQFLTSEDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRSTKFRPP 760
            I  PIF  R  W H W    IL  LIL TI+GNVFVVAAI+LEK+LQ VSNYLILSLAVADLMVA L MPIS ++E+S  WW+G S+CD WI  DVLCCTAS+LHLV IA+DRYWAVT   + R+++  R  I IMI   W +S+VIS+P+RF   R     N   T+   VC +N  + Y I + +GAF++PML M+ IY RIY  A+ +IRK  + FR P
Sbjct:    8 IDQPIFQTRLGWTHFWLTLVILGTLILCTIVGNVFVVAAILLEKHLQGVSNYLILSLAVADLMVATLPMPISAVSEVSLDWWLGESVCDFWICSDVLCCTASILHLVGIALDRYWAVTNAEYFRRRTAQR--IGIMIAAFWFLSLVISLPARFDYARITNWINGVSTNMTEVCSINKEYGYTIFSTVGAFYVPMLFMIGIYARIYTVARSRIRK--SAFRKP 225          

HSP 2 Score: 115.931 bits (289), Expect = 4.599e-23
Identity = 53/96 (55.21%), Postives = 66/96 (68.75%), Query Frame = 2
Query: 1712 RIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKILFGRYYH 1999
            R +IE +RERKA  TLAIITGCF++CWLPF    +++   +    +  T          ILWLGY+NS LNP+IYT+FSPDFR +FRKILFGRYY 
Sbjct:  585 RERIENKRERKAVMTLAIITGCFMLCWLPFFINALVSPFYEKWQPSRATG-------DIILWLGYSNSLLNPVIYTIFSPDFREAFRKILFGRYYR 673          
BLAST of 5-hydroxytryptamine receptor vs. TrEMBL
Match: G7YNE6 (5-hydroxytryptamine receptor 1 OS=Clonorchis sinensis OX=79923 GN=CLF_103340 PE=3 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 2.083e-52
Identity = 123/222 (55.41%), Postives = 152/222 (68.47%), Query Frame = 2
Query:  110 ITVPIFSPRFSWLHVWTCGPILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQINFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHR-----NQFLTSEDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRSTKFRPP 760
            I  PIF  R  W H W    IL  LIL TI+GNVFVVAAI+LEK+LQ VSNYLILSLAVADLMVA L MPIS ++E+S  WW+G S+CD WI  DVLCCTAS+LHLV IA+DRYWAVT   + R+++  R  I IMI   W +S+VIS+P+RF   R     N   T+   VC +N  + Y I + +GAF++PML M+ IY RIY  A+ +IRK  + FR P
Sbjct:    8 IDQPIFQTRLGWTHFWLTLVILGSLILCTIVGNVFVVAAILLEKHLQGVSNYLILSLAVADLMVATLPMPISAVSEVSLDWWLGESICDFWICSDVLCCTASILHLVGIALDRYWAVTNAEYFRRRTAQR--IGIMIAAFWFLSLVISLPARFDYARITNWINGVSTNMTEVCSINKEYGYTIFSTVGAFYVPMLFMIGIYARIYTVARSRIRK--SAFRKP 225          

HSP 2 Score: 114.775 bits (286), Expect = 9.012e-23
Identity = 53/95 (55.79%), Postives = 66/95 (69.47%), Query Frame = 2
Query: 1712 RIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKILFGRYY 1996
            R +IE +RERKA  TLAIITGCF++CWLPF    +++   +    +  T          ILWLGY+NS LNP+IYT+FSPDFR +FRKILFGRYY
Sbjct:  585 RERIENKRERKAVMTLAIITGCFMLCWLPFFINALVSPFYEKWQPSRATG-------DIILWLGYSNSLLNPVIYTIFSPDFRGAFRKILFGRYY 672          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Cavefish
Match: adra2c (alpha-2C adrenergic receptor-like [Source:NCBI gene;Acc:103033245])

HSP 1 Score: 123.635 bits (309), Expect = 7.936e-30
Identity = 82/199 (41.21%), Postives = 127/199 (63.82%), Query Frame = 2
Query:  170 ILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQ-INFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRSTKFRPPD 763
            ++  LIL+TI+GNV VV A++  + L+   N  ++SLA AD++VA L+MP S+ NE+   W+ G   CDI++  DVL CT+S++HL AI++DRYW+VTQ + +  K++  R + +I++  VW +S VIS P      R     +    C +N +  YI+ ++IG+FF P +IM+ +YIRIY  AK + R  S K + PD
Sbjct:   39 LVSFLILFTIVGNVLVVIAVLTSRALKPPQNLFLVSLATADILVATLIMPFSLANELMGYWFFGKVWCDIYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKGMIVV--VWLISAVISFPPLISMDRKDQEINVKPQCEINDHTWYILYSSIGSFFAPCVIMILVYIRIYQVAKTRTRSMSEKRKDPD 235          

HSP 2 Score: 83.1889 bits (204), Expect = 1.816e-16
Identity = 39/91 (42.86%), Postives = 53/91 (58.24%), Query Frame = 2
Query: 1709 SRIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKIL 1981
            SR KI Q RE++    LA++ G F++CW PF     +  I   P       +K      F  W+GY NS LNP+IYT+F+ DFRR+F+KIL
Sbjct:  340 SRKKISQAREKRFTFVLAVVMGVFVVCWFPFFFSYSLYGICREPCEIPEPLFK------FFFWIGYCNSSLNPVIYTIFNQDFRRAFQKIL 424          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Cavefish
Match: htr1ab (5-hydroxytryptamine (serotonin) receptor 1A b [Source:ZFIN;Acc:ZDB-GENE-090409-2])

HSP 1 Score: 122.865 bits (307), Expect = 1.245e-29
Identity = 92/227 (40.53%), Postives = 140/227 (61.67%), Query Frame = 2
Query:  182 LILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVT-QINFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSED----GVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRK---RSTKFR----PPDIHTLSNLNPKSTRTGKENKIV 826
            LIL ++ GN  VVAAI LE++LQ+V+NYLI SLAV DLMV+VLV+P++ + ++   W +G   CDI+I  D+LCCT+S+LHL AIA+DRYWA+T  I++++K++  R  +LI +   W V   ISIP            +ED      C ++ +  Y I +   AF++P+++M+ +Y RI+  A+ +IRK   +S K +     P +   SN   KS R+  E K +
Sbjct:   47 LILCSVFGNSCVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMACLYQVLDRWTLGQVTCDIFISLDILCCTSSILHLCAIALDRYWAITDPIDYMKKRTLKRAAVLIGV--TWLVGFSISIPPMLIMKSQPKSKAEDIANPEACMISHDPWYTIYSTFCAFYIPLILMLVLYGRIFKAARFRIRKTVRKSEKVKCLTVSPALFKKSNGELKSWRSSVEPKPI 271          

HSP 2 Score: 76.2554 bits (186), Expect = 2.879e-14
Identity = 39/97 (40.21%), Postives = 56/97 (57.73%), Query Frame = 2
Query: 1691 HQLKIRSRIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKIL 1981
            H+    ++ K+   RERK  +TL II G F++CWLPF  + ++     S            L+D  I WLGY+NS LNPIIY  F+ DF+ +F+KI+
Sbjct:  319 HEKNTEAKRKLALARERKTVKTLGIIMGTFILCWLPFFIKALVMPFCPS------CQMPVWLMD-VINWLGYSNSLLNPIIYAYFNKDFQSAFKKII 408          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Cavefish
Match: htr1b (5-hydroxytryptamine (serotonin) receptor 1B [Source:ZFIN;Acc:ZDB-GENE-081022-141])

HSP 1 Score: 120.553 bits (301), Expect = 3.466e-29
Identity = 80/188 (42.55%), Postives = 119/188 (63.30%), Query Frame = 2
Query:  206 NVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVT-QINFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNHT-YIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRSTKFRPPD 763
            N FV+A I   + L + +N+LI SLAV DL+V+VLVMPIS +  ++ SW +G   CD+W+  D+ CCTAS+LHL  IA+DRYWA+T  + + ++++  R     M+   W +++ IS+P  F     Q    E   C +N++H  Y I +  GAF+LP L++VA+Y RIYV A+R+I K+S K   P 
Sbjct:   55 NAFVIATISRSRKLHTPANFLIGSLAVTDLLVSVLVMPISALYTVTHSWSLGQVACDVWLSSDITCCTASILHLCVIALDRYWAITDAVGYAKRRTIRRAA--GMVATAWVIAVSISVPPFFW---RQVKAGEVTSCAVNSDHIFYTIYSTFGAFYLPTLLLVALYGRIYVEARRRILKQSPKKVAPG 237          

HSP 2 Score: 73.559 bits (179), Expect = 1.321e-13
Identity = 38/88 (43.18%), Postives = 55/88 (62.50%), Query Frame = 2
Query: 1718 KIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKIL 1981
            +I   RERKA +TL II G ++ICWLPF    +  L+   P+  +       L D F  WLGY NS +NPIIYT+ + DF+++F+K++
Sbjct:  282 RISAARERKATKTLGIILGAYIICWLPFFIYTL--LVPLCPSCLHPE-----LFD-FFTWLGYLNSLINPIIYTMSNDDFKKAFQKLV 361          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Cavefish
Match: HTR1B (5-hydroxytryptamine receptor 1B [Source:NCBI gene;Acc:103031645])

HSP 1 Score: 120.168 bits (300), Expect = 6.005e-29
Identity = 93/295 (31.53%), Postives = 147/295 (49.83%), Query Frame = 2
Query:  158 TCGPILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQINFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNHT-YIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRSTKF-------------RPPDIHTLSNLNPKSTRTGKENKIVYFSSILFRCISVKTNTKNNQDQLVFKDANHDNNVIKDSELDKVKGGKDIEHI-GDYIM 997
            T   +L +L   T + N FVVA I   + L + +N LI SLA  DL+V+VLVMP+S++  +   W +G  +CD+W+  DV CCTAS+LHL  IA+DRYWA+T      K+   ++   ++         +   P  +   R +    E   C +NT+H  Y I +  GAF++P L+++A+Y RIY  A+++I K+S K               P  + + ++LN  +  T   +  V  S++            N+Q ++   DA  +   I  S   + K  K +  I G YIM
Sbjct:   44 TVATLLSLLTCATALSNAFVVATIARSRKLHTPANVLIGSLAFTDLLVSVLVMPVSIVYTVRRVWTLGRVICDLWLSSDVTCCTASILHLCVIALDRYWAITDAVGYSKRRTTQRAAAMIAAAWVIAVSISLPPFFWQQVRTE---DEMTSCTVNTDHVFYTIYSTFGAFYIPTLLLIALYGRIYAEARKRILKQSPKRVGKRLTSARLISDSPGSVASTTSLNYGTHETSTSDATVATSAV-----------ANHQVKVTVSDALLEKKRI--SAARERKATKTLGVILGAYIM 322          

HSP 2 Score: 75.485 bits (184), Expect = 3.552e-14
Identity = 41/103 (39.81%), Postives = 60/103 (58.25%), Query Frame = 2
Query: 1691 HQLKIR------SRIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKIL 1981
            HQ+K+        + +I   RERKA +TL +I G +++CWLPF    ++      P  T  T Y  L  D F  WLGY NS +NPIIYT+ + DF+++F K++
Sbjct:  285 HQVKVTVSDALLEKKRISAARERKATKTLGVILGAYIMCWLPFFIYTLL-----VPICTTCTFYPELF-DVFT-WLGYLNSLINPIIYTMSNEDFKQAFHKLI 380          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Cavefish
Match: ENSAMXT00000026144.2 (pep primary_assembly:Astyanax_mexicanus-2.0:9:14357937:14360657:1 gene:ENSAMXG00000025418.2 transcript:ENSAMXT00000026144.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.39 bits (285), Expect = 3.561e-27
Identity = 81/190 (42.63%), Postives = 122/190 (64.21%), Query Frame = 2
Query:  170 ILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQINFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNH-TYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRK 736
            +L ++ L T++ N FV+A I L + L + +N+LI SLA+ DL+V++LVMPIS++  +S +W +G  +CDIW+  D+  CTAS+LHL  IA+DRYWA+T      K+   R+  L MI  VW +SI ISIP  F   R      E   C +NT+  +Y + +  GAF++P +++V +Y RIYV A+ +I K
Sbjct:   31 LLAVVTLATMLSNAFVIATIFLTRKLHTPANFLIGSLALTDLLVSILVMPISIVYTVSKTWTLGQIMCDIWLSSDITFCTASILHLCVIALDRYWAITDALEYSKRRTTRRAAL-MIGVVWVISISISIPPLF--WRQAKAHEELTECLVNTDQISYTLYSTFGAFYVPTILLVILYGRIYVAARSRIFK 217          

HSP 2 Score: 75.0998 bits (183), Expect = 4.039e-14
Identity = 37/99 (37.37%), Postives = 59/99 (59.60%), Query Frame = 2
Query: 1703 IRSRIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKIL-FGRYY 1996
            +  R ++   RE+KA +TL II G F++CWLPF    ++  I           +  +L D F  WLGY NS +NP+IYT F+ +F+++F+K++ F + Y
Sbjct:  279 VLERKRLCAAREKKATKTLGIILGAFIVCWLPFFVVTLVMAIC------KDCWFHPVLFD-FFTWLGYLNSLINPVIYTAFNDEFKQAFQKLIKFKKCY 370          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009127.1 (pep scaffold:Pmarinus_7.0:GL478629:43196:44446:-1 gene:ENSPMAG00000008256.1 transcript:ENSPMAT00000009127.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 135.191 bits (339), Expect = 7.816e-35
Identity = 85/193 (44.04%), Postives = 128/193 (66.32%), Query Frame = 2
Query:  173 LVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVT-QINFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRSTK 748
            L  LIL  I GN  V+AAI LE+ LQ+V+NYLI SLAV DL+V++LV+P++ + ++   W +G  +CDI+I  DVLCCT+S+LHL  IA+DRYWA+T  I+++ K++  R   +IMI   W V   ISIP    G R     ++   C+++ +H Y I +  GAF++P+++M+ +Y RI+  A+ +IRK   K
Sbjct:   43 LTALILCAIFGNSCVIAAIALERTLQNVANYLIGSLAVTDLLVSILVLPMAALYQVLDRWTLGQVVCDIFIALDVLCCTSSILHLCVIALDRYWAITNPIDYVNKRTPRRA--VIMISLTWLVGFSISIPPML-GWRTPEDRADPNACKISQDHGYTIYSTFGAFYIPLILMLVLYSRIFRAARFRIRKNVKK 232          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001357.1 (pep scaffold:Pmarinus_7.0:GL478256:17157:19157:1 gene:ENSPMAG00000001226.1 transcript:ENSPMAT00000001357.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 122.865 bits (307), Expect = 1.042e-30
Identity = 81/189 (42.86%), Postives = 128/189 (67.72%), Query Frame = 2
Query:  173 LVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQ-INFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRK 736
            L  LI  +I GN FV+AAI LE++LQ+V+NYLI SLAV DL+V+VLV+P++ + ++   W +G ++CD +I  DVLCCT+S+LHL AIA+DRYWA+T  ++++ K++  R  ++I I   W V   ISIP    G R     ++   C ++ +  Y I +  GAF++P+++M+ +Y +I+  A+ +IRK
Sbjct:    9 LGALIACSIAGNAFVLAAIYLERSLQTVANYLIGSLAVTDLLVSVLVLPVAALYQVLGRWTLGQAVCDAFIALDVLCCTSSILHLCAIALDRYWAITDPVDYVNKRTPRRAALMIAI--TWVVGFSISIPPML-GWRQAEDRADPDACNISQHLGYTIYSTFGAFYIPLVLMLVLYGKIFSAARFRIRK 194          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Sea Lamprey
Match: HTR1F (5-hydroxytryptamine receptor 1F [Source:HGNC Symbol;Acc:HGNC:5292])

HSP 1 Score: 116.316 bits (290), Expect = 3.919e-28
Identity = 76/185 (41.08%), Postives = 113/185 (61.08%), Query Frame = 2
Query:  206 NVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVT-QINFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNHT-YIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRSTKFR 754
            N  V+AAI   + L+  +NYLI SLAVADL+VA LVMP++    ++  W +G +LCD+W+  DV CCTAS+LHL AIA+DR+WA+T    +  K++  R    +MI   W ++  IS+P  F   R+         C +  +H  Y I +  GAF++P+ +++A+Y RI+  AKR   KR +K R
Sbjct:   65 NALVIAAISATRKLRQPANYLIGSLAVADLLVAALVMPVAAAYVVTGEWALGGALCDLWLSLDVTCCTASILHLCAIALDRFWAITDAAEYAHKRTPGRAA--LMIAASWLLAACISVPPLFWRRRD----PAKPRCIIEHDHVLYTIYSTFGAFYVPLALLLALYCRIFRAAKRLYEKRESKQR 243          

HSP 2 Score: 77.411 bits (189), Expect = 2.733e-15
Identity = 35/89 (39.33%), Postives = 55/89 (61.80%), Query Frame = 2
Query: 1718 KIEQRRERKAARTLAIITGCFLICWLPFATQNMI-NLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKIL 1981
            +I   RER+AA+TL +I G F++CWLPF  + ++ NL      +          +   + WLGY NS +NP+IYT+F+ DF+ +FRK++
Sbjct:  341 RISGSRERRAAKTLGLILGAFVVCWLPFFIKELVVNLCKSCAVSPE--------VADLLTWLGYMNSLINPLIYTMFNEDFKSAFRKLV 421          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Sea Lamprey
Match: adra2c (adrenoceptor alpha 2C [Source:NCBI gene;Acc:266752])

HSP 1 Score: 111.694 bits (278), Expect = 2.204e-26
Identity = 72/199 (36.18%), Postives = 122/199 (61.31%), Query Frame = 2
Query:  170 ILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQ-INFIRKKSGAR-KQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAK-RQIRKRSTKFRP 757
            ++++L+  T+ GN  V+ A++   +L++  N  ++SLA AD++VA LV+P S+ NE+   W+ G   C+I++  DVL CT+S++HL AI++DRYW+V+Q + +  K++  R K+I+++++ +     +  + S    +R Q        C +NTN  YI+ + IG+FF P LIMV +Y RIY   K R  + R  K  P
Sbjct:   57 LVLILVFATVFGNCLVIIAVLTRPSLKAPQNLFLVSLATADILVATLVIPFSLFNELMGYWYFGRVWCEIYLALDVLFCTSSIVHLCAISLDRYWSVSQAVEYNIKRTPRRIKRIIVIVWFIAIAISLPPLISMNQKNRQQQEEVGRPNCELNTNTWYILGSCIGSFFAPCLIMVLVYARIYHLVKWRAAKLRRDKEAP 255          

HSP 2 Score: 88.9669 bits (219), Expect = 5.003e-19
Identity = 46/98 (46.94%), Postives = 58/98 (59.18%), Query Frame = 2
Query: 1691 HQLKIRSRIKIEQRRERKAARTLAIITGCFLICWLPFA-TQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKIL 1981
             Q K R R KI Q RER+    L+++ G F+ICW PF  T ++  L S        T +K      F  W GY NSCLNP+IYTVF+ DFRR+F+KIL
Sbjct:  363 RQNKARERRKIAQARERRFTFVLSVMIGVFVICWFPFFFTYSLSALCSPESCAIPETLFK------FFFWFGYCNSCLNPVIYTVFNRDFRRAFKKIL 454          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006953.1 (pep scaffold:Pmarinus_7.0:GL477632:7596:14007:1 gene:ENSPMAG00000006283.1 transcript:ENSPMAT00000006953.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.457 bits (267), Expect = 2.649e-25
Identity = 74/170 (43.53%), Postives = 114/170 (67.06%), Query Frame = 2
Query:  194 TIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISS-SWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQINFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYI 700
            TI GNV V+ A+ LEK LQ+ +NY ++SLAVAD++V +LVMPIS++N +    W + +SLC +WI+ DVL  TAS++HL AI++DRY A+ +      +  +R + L+ I  VW +S+ IS+P    G ++      DG C+MN +  +II  ++ +FFLP++IMVA Y+
Sbjct:   38 TIAGNVLVILAVSLEKKLQTATNYFLMSLAVADMLVGILVMPISLLNILYGFKWPLPLSLCPVWIYLDVLFSTASIMHLCAISLDRYIAIKK-PIEHSRFNSRTKALLKILAVWVISVGISMPVPVLGLQDLAYVYTDGSCQMNISD-FIIYGSLSSFFLPLIIMVASYV 205          

HSP 2 Score: 54.299 bits (129), Expect = 4.945e-8
Identity = 25/80 (31.25%), Postives = 49/80 (61.25%), Query Frame = 2
Query: 1736 ERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRK 1975
            E++A++ L I+   F+  W PF   N+++ +  +     H    A L+D F+ W+GY +S +NP++YT+F+  +R++F +
Sbjct:  312 EQRASKVLGIVFLLFVGMWCPFFITNVLSALCPADACNRHA--MAALLDVFV-WVGYVSSGVNPLVYTLFNRTYRQAFAR 388          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Nematostella
Match: EDO47619 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLK3])

HSP 1 Score: 80.4925 bits (197), Expect = 7.089e-17
Identity = 60/188 (31.91%), Postives = 112/188 (59.57%), Query Frame = 2
Query:  179 MLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWM-GMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQINFIRK-KSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRK 736
            MLI++T+IGNV V A+  L + L+++ NY ++SL+ AD++VA+L MP     +++S+ WM G+ L   W   D+LC TAS+++L+A++IDR+ A+T   +     S  + ++ IM   +++++I      ++ G + +                Y+ +A   +F  P+ +MV +Y+RIY+ A+ Q+R+
Sbjct:    8 MLIVFTLIGNVLVCASFALFRELRTICNYFVVSLSAADILVALLAMPFWCALQVTSNMWMFGLELQLFWSCMDILCGTASIMNLMAVSIDRHIAITMPFYYETVMSPIKAKLTIMFVWLYAITISCLRLVQWPGKQGK---------------VYMNIAAFASFLCPLTVMVVMYLRIYLVARYQVRR 180          

HSP 2 Score: 58.9214 bits (141), Expect = 1.408e-9
Identity = 32/88 (36.36%), Postives = 48/88 (54.55%), Query Frame = 2
Query: 1712 RIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPN-NTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFR 1972
            RI      + KAA+T+A++ G F+ CW PF    +I   +  P  N   T+         + W+ Y NSCLNP+IYT  + ++RR+FR
Sbjct:  180 RIGRNYMTDVKAAKTIAVVIGVFVACWTPFFV--IIICYAHHPGFNVTKTTLNV------VKWMEYLNSCLNPVIYTCLNRNYRRAFR 259          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Nematostella
Match: EDO35450 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLG6])

HSP 1 Score: 76.2554 bits (186), Expect = 3.751e-15
Identity = 66/220 (30.00%), Postives = 120/220 (54.55%), Query Frame = 2
Query:  173 LVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWW-MGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWA----VTQINFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRK----RSTKFRPPDIHTLSNLNPKSTRT 805
            ++ +++  + GN+ V  AI+  + L++V+NY I+SLAV+DL+VA L MP  + + + S  W +G+S+C+ WIF D++C +AS+ +L  I++DR+ A    +T  + + K+ G     ++  + +   ++  ++P    G     L  +   C +   + Y  V  +G FFLP++++V  Y  ++  A  Q RK     S  F P  I  L     K+T+T
Sbjct:   16 VIFILILDVCGNLLVCGAILSYRRLRTVTNYFIISLAVSDLLVAGLSMPFRIHHTLHSMCWDLGISVCEFWIFVDLVCSSASICNLSMISVDRFLALSYPLTYPSIMTKRRGLLAIAMVWGYSLLISALSFTLPWSPDG-----LMQDIPACSLKDKYYYTFVITVG-FFLPLVVLVIAYSLVFKVALHQARKLQLLSSGGFDPSIIREL-----KATKT 224          

HSP 2 Score: 60.8474 bits (146), Expect = 4.657e-10
Identity = 34/86 (39.53%), Postives = 48/86 (55.81%), Query Frame = 2
Query: 1733 RERKAARTLAIITGCFLICWLP-FATQNMINLISDSPNNTNHTSYKALLI--DSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKIL 1981
            RE KA +TLAI+ G F++CWLP F     +    +   +      KA L     F+  L   NS +NPIIY+ F+ +FRR+F+ IL
Sbjct:  217 RELKATKTLAIVVGSFIVCWLPFFVIMFTVQFCPECFQDHRSLPVKAQLAIGTVFVYVLPLLNSAVNPIIYSSFNANFRRAFKDIL 302          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Nematostella
Match: EDO28603 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T607])

HSP 1 Score: 73.1738 bits (178), Expect = 6.892e-14
Identity = 65/201 (32.34%), Postives = 103/201 (51.24%), Query Frame = 2
Query:  143 WLHVWTCGPILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWW-MGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQINF-----IRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQ 727
            W  +   G ++V+L L  + GN+ V  AI   + L+SV+NYLI SLAV+DL+VA L MP  + + +    W +G+S+C  WIF D LC  AS+ +L  IAIDRY  V    F     +RK  G    + + ++     S+ ++ P    G    F            +  Y   A   +FFLP+++++  Y  ++  A++Q
Sbjct:   17 WSLIAQAGFVVVILFL-DLFGNLLVCVAIYRYRRLRSVTNYLIGSLAVSDLLVACLSMPFRIYHTLHLMCWDLGLSVCKFWIFVDALCSGASICNLSLIAIDRY-LVLSCPFSYREKMRKPRGFIAILAVWLYAFVIASLSLTEPWSPDGFNASFPACA------KMDKYYYAFAITMSFFLPLVVLIIAYSMVFKVARKQ 209          

HSP 2 Score: 57.3806 bits (137), Expect = 7.858e-9
Identity = 35/93 (37.63%), Postives = 50/93 (53.76%), Query Frame = 2
Query: 1733 RERKAARTLAIITGCFLICWLPF-ATQNMINLISDSPNNTNHTSYKALLIDS-FILWLGYTNSCLNPIIYTVFSPDFRRSFRKILFGRY-YHR 2002
            RE KA +TL+I+ G F+ CW PF     ++    D   N+  T    + I + F+  L   NS  NPIIY+ F+ DFR +F+ IL   +  HR
Sbjct:  256 RELKATKTLSIVIGTFIACWAPFFIIMFIVQFCHDCVYNSWLTKEAQMTIGTVFVYVLPLLNSAANPIIYSKFNADFRLAFKDILMSMFRLHR 348          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Nematostella
Match: EDO40999 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5M0])

HSP 1 Score: 71.633 bits (174), Expect = 2.390e-13
Identity = 64/194 (32.99%), Postives = 101/194 (52.06%), Query Frame = 2
Query:  164 GPILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWW-MGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQINF-----IRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQ 727
            G ++V+L L  + GN+ V  AI   + L+SV+NYLI SLAV+DL+VA L MP  + + +    W +G+S+C  WIF D LC  AS+ +L  IAIDRY  V    F     +RK  G    + + ++     S+ ++ P    G    F            +  Y   A   +FFLP+++++  Y  ++  A++Q
Sbjct:   35 GFVVVILFL-DLFGNLLVCVAIYRYRRLRSVTNYLIGSLAVSDLLVACLSMPFRIYHTLHLMCWDLGLSVCKFWIFVDALCSGASICNLSLIAIDRY-LVLSCPFSYREKMRKPRGFIAILAVWLYAFVIASLSLTEPWSPDGFNASFPACA------KMDKYYYAFAITMSFFLPLVVLIIAYSMVFKVARKQ 220          

HSP 2 Score: 57.3806 bits (137), Expect = 8.479e-9
Identity = 35/93 (37.63%), Postives = 50/93 (53.76%), Query Frame = 2
Query: 1733 RERKAARTLAIITGCFLICWLPF-ATQNMINLISDSPNNTNHTSYKALLIDS-FILWLGYTNSCLNPIIYTVFSPDFRRSFRKILFGRY-YHR 2002
            RE KA +TL+I+ G F+ CW PF     ++    D   N+  T    + I + F+  L   NS  NPIIY+ F+ DFR +F+ IL   +  HR
Sbjct:  267 RELKATKTLSIVIGTFIACWAPFFIIMFIVQFCHDCVYNSWLTKEAQMTIGTVFVYVLPLLNSAANPIIYSKFNADFRLAFKDILMSMFRLHR 359          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Nematostella
Match: EDO36610 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI87])

HSP 1 Score: 70.4774 bits (171), Expect = 2.727e-13
Identity = 42/114 (36.84%), Postives = 64/114 (56.14%), Query Frame = 2
Query: 1652 LAKNKNRLSNAMWHQLKIRSR-IKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLI---SDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKIL 1981
            +A N+ R   A+    K R R   I   +E KAA+ LAI+ GCF++CW PF    +++L    + S    +  + + + + +F+  L   NS LNPIIY +F+ DFRR+F KI 
Sbjct:  185 VAMNQARAVAALQTDSKRRGRRSSINLVKEVKAAKILAIVVGCFVVCWFPFFVLTLVSLWEPHALSKETISKDTARGITL-TFVYVLPVLNSTLNPIIYALFNRDFRRAFGKIF 297          

HSP 2 Score: 62.003 bits (149), Expect = 1.673e-10
Identity = 62/225 (27.56%), Postives = 110/225 (48.89%), Query Frame = 2
Query:  176 VMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEI-SSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQINFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGV--------CRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRSTKFRPPDIHTLSNLNPKSTRTGKENKI 823
            + ++L T  GN  VV A++L   +++++NY ++SLAV+DL+VA L +P  +     +++W +G+  C  WI  D++CC AS+ +L  I++DR+ A+            R   L+       +   + I S   G  +    +E G         CR      Y +V+ +G FFLP+ I++ +Y +++V A  Q R             ++ L   S R G+ + I
Sbjct:    6 IFILLVTFYGNFMVVLAVVLFHRMRTITNYFVVSLAVSDLLVATLSLPFRIHQTTHNTAWCLGLEACVAWIVVDIICCGASIWNLAMISVDRFIAIVM--------PFRYHALMTPMTGVCLIGAVWILSMGMGMLSLINWTELGSPHFHIEVQCRKFDPVYYTVVSVVG-FFLPLFIVLLMYGQVFVVAMNQARA------------VAALQTDSKRRGRRSSI 209          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Medaka
Match: ENSORLT00000005282.2 (pep primary_assembly:ASM223467v1:9:8571029:8576106:1 gene:ENSORLG00000004220.2 transcript:ENSORLT00000005282.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.88 bits (333), Expect = 4.178e-33
Identity = 81/194 (41.75%), Postives = 126/194 (64.95%), Query Frame = 2
Query:  170 ILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQ-INFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRSTK 748
            +L  LIL +I GN  VVAAI LE++LQ+V+NYLI SLAV DLMV+VLV+P++ + ++ + W +G  +CD++I  DVLCCT+S+LHL AIA+DRYWA+T  I+++ K++  R  +LI   C   +           G R+    +    C ++ +  Y I +  GAF++P+++M+ +Y RI+  A+ +IRK   K
Sbjct:   48 LLGALILCSIFGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQEICDLFISLDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPMRAVLLI---CATWLIGFSISIPPMLGWRSAEDRANPDACMISQDPGYTIYSTFGAFYIPLILMLVLYGRIFRAARFRIRKTVKK 238          

HSP 2 Score: 73.9442 bits (180), Expect = 1.503e-13
Identity = 38/98 (38.78%), Postives = 58/98 (59.18%), Query Frame = 2
Query: 1709 SRIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKILFGRYYHR 2002
            ++ K+   RERK  +TL II G F+ CWLPF    ++  +   P +     +   +I+    WLGY+NS LNPIIY  F+ DF+ +F+KI+  + +HR
Sbjct:  331 AKRKLALSRERKTVKTLGIIMGTFIFCWLPFFIVALV--LPFCPESCFMPDWLGAVIN----WLGYSNSLLNPIIYAYFNKDFQNAFKKIIKCK-FHR 421          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Medaka
Match: htr1ab (5-hydroxytryptamine (serotonin) receptor 1A b [Source:ZFIN;Acc:ZDB-GENE-090409-2])

HSP 1 Score: 131.339 bits (329), Expect = 1.236e-32
Identity = 86/198 (43.43%), Postives = 131/198 (66.16%), Query Frame = 2
Query:  170 ILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQ-INFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGV----CRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRSTK 748
            +L  LIL  I GN  VVAAI+LE++LQ+V+NYLI SLAV DLMV+VLV+P++ + ++ +SW +G   CDI+I  DVLCCT+S+LHL AIA+DRYWA+T+ I++++K++  R  +LI +   W V   IS+P            +ED      C++  +  Y I +  GAF++P+ +M+ +Y RI+  A+ +IR+   K
Sbjct:   24 LLGALILCAIFGNACVVAAIVLERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNSWTLGQVPCDIFISLDVLCCTSSILHLCAIALDRYWAITEPIDYMKKRTPRRAAVLISV--TWLVGFSISVPPMLVMRSQPGSMAEDRANPKQCKIRQDPWYTIYSTFGAFYIPLTLMLVLYGRIFKAARFRIRRTVRK 219          

HSP 2 Score: 77.0258 bits (188), Expect = 1.410e-14
Identity = 38/97 (39.18%), Postives = 54/97 (55.67%), Query Frame = 2
Query: 1691 HQLKIRSRIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKIL 1981
            H     ++ KI   RERK  +TL II G F++CWLPF    ++            + Y    ++  I WLGY+NS LNPIIY  F+ DF+ +F+KI+
Sbjct:  306 HDKATEAKRKIALARERKTVKTLGIIMGTFILCWLPFFIVALVMPF------CQESCYMPRWLEDVINWLGYSNSLLNPIIYAYFNKDFQSAFKKII 396          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Medaka
Match: HTR1B (5-hydroxytryptamine receptor 1B [Source:HGNC Symbol;Acc:HGNC:5287])

HSP 1 Score: 125.946 bits (315), Expect = 1.204e-30
Identity = 85/209 (40.67%), Postives = 131/209 (62.68%), Query Frame = 2
Query:  128 SPRFSWLHVWTCGPILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVT-QINFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNHT-YIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRSTK 748
            S  FS  +  +   IL ++ L T + N FV+A I   K LQ+ +N+LI SLA+ DL+V++LVMPI V+  +  +W +G  +CDIW+  D+ CCTAS+LHL  IA+DRYWA+T  + + +K++ AR     M+   W ++I IS+P  F     Q    E   C +NT+H  Y I +  GAF++P L+++ +Y RIYV A+++I K+S +
Sbjct:   85 SENFSLWYQISLAVILSLITLATTLSNAFVIATISQSKKLQTPANFLIASLAITDLLVSILVMPICVLYTVIHTWTLGQIVCDIWLSSDITCCTASILHLCVIALDRYWAITDAVEYSKKRTPARAA--GMVATAWVIAISISLPPLFW---RQVKAEELTSCSVNTDHIFYTIYSTFGAFYIPTLLLIVLYGRIYVEARKRILKQSPR 288          

HSP 2 Score: 73.559 bits (179), Expect = 1.943e-13
Identity = 36/88 (40.91%), Postives = 53/88 (60.23%), Query Frame = 2
Query: 1718 KIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKIL 1981
            +I   RERKA +TL II G +++CWLPF    ++         T    +   L D F  WLGY NS +NPIIYT+ + DF+++F+K++
Sbjct:  347 RISAARERKATKTLGIILGAYIVCWLPFFIYTLLV-------ATCVACFNQELFD-FFTWLGYLNSLINPIIYTMSNEDFKKAFQKLV 426          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Medaka
Match: HTR1B (5-hydroxytryptamine receptor 1B [Source:HGNC Symbol;Acc:HGNC:5287])

HSP 1 Score: 124.405 bits (311), Expect = 1.299e-30
Identity = 81/192 (42.19%), Postives = 123/192 (64.06%), Query Frame = 2
Query:  173 LVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVT-QINFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNHT-YIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRS 742
            L ++   T + N FV+A I   + L + +N+LI SLAV DL+V++LVMPIS +  +  +W +G  +CDIW+  D+ CCTAS+LHL  IA+DRYWA+T  + + +K++ AR     MI   W ++I IS+P  F     Q    E   C +NT+H  Y I +  GAF++P L+++A+Y RIYV A+++I K+S
Sbjct:   21 LALITFATTLSNAFVIATIYQSRKLHTPANFLIASLAVTDLLVSILVMPISALYTVCQTWTLGQVVCDIWLSSDITCCTASILHLCVIALDRYWAITDAVEYSKKRTPARAA--GMIATAWVIAISISLPPFFW---RQVKAEEVTSCNVNTDHIFYTIYSTFGAFYIPTLLLIALYGRIYVEARKRILKQS 207          

HSP 2 Score: 74.3294 bits (181), Expect = 7.150e-14
Identity = 38/91 (41.76%), Postives = 55/91 (60.44%), Query Frame = 2
Query: 1718 KIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKILFGR 1990
            +I   RE+KA +TL II G ++ICWLPF    ++  + DS        +   L D F  WLGY NS +NPIIYT+ + DF+++F K++  R
Sbjct:  268 RISAAREKKATKTLGIILGAYIICWLPFFIYTLLVPLCDS-------CFHPELFDIFT-WLGYLNSLINPIIYTMSNEDFKQAFHKLIRFR 350          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Medaka
Match: adra2c (alpha-2C adrenergic receptor [Source:NCBI gene;Acc:101169521])

HSP 1 Score: 125.561 bits (314), Expect = 1.863e-30
Identity = 87/210 (41.43%), Postives = 136/210 (64.76%), Query Frame = 2
Query:  137 FSWLHVWTCGPILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQ-INFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRSTKFRPPD 763
            +S L +W+   ++  LIL+TI+GNV VV A++  + L+   N  ++SLA AD++VA LVMP S+ NE+   W+ G   CDI++  DVL CT+S++HL AI++DRYW+VTQ + +  K++  R + +I++  VW +S VIS P      R+    S++  C++N +  YI+ ++IG+FF P +IM+ +YIRIY  AK + R  S K R  D
Sbjct:   28 YSQLTIWSLIGLVSFLILFTIVGNVLVVIAVLTSRALKPPQNLFLVSLATADILVATLVMPFSLSNELGY-WFFGTVWCDIYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPQRVKRMIVV--VWLISAVISFPPLISMDRSSSKASQE--CKLNDDTWYILYSSIGSFFAPCVIMILVYIRIYQVAKTRTRTMSEKKRDMD 232          

HSP 2 Score: 79.7221 bits (195), Expect = 2.131e-15
Identity = 37/90 (41.11%), Postives = 52/90 (57.78%), Query Frame = 2
Query: 1712 RIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKIL 1981
            R K+   RE++    LA++ G F++CW PF     +  I   P     T +K      F  W+GY NS LNP+IYT+F+ DFRR+F+KIL
Sbjct:  358 RKKVSAAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYSICRDPCKIPPTLFK------FFFWIGYCNSSLNPVIYTIFNQDFRRAFQKIL 441          
BLAST of 5-hydroxytryptamine receptor vs. Planmine SMEST
Match: SMESG000010648.1 (SMESG000010648.1)

HSP 1 Score: 1161.75 bits (3004), Expect = 0.000e+0
Identity = 635/640 (99.22%), Postives = 638/640 (99.69%), Query Frame = 2
Query:   98 MDWNITVPIFSPRFSWLHVWTCGPILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQINFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSEDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRSTKFRPPDIHTLSNLNPKSTRTGKENKIVYFSSILFRCISVKTNTKNNQDQLVFKDANHDNNVIKDSELDKVKGGKDIEHIGDYIMNPNNISKRQISLMSFGSQLSDIPYVDEDEVIKHDXXXXXXXXXXXXXXXXXXXXXXVTAIEKQAXXXXXXXXVTISGESSTQTMIASQFHRYSSDDTNEIRXXXXXXXXXXXGTDFQVDSESVFESNNSTKHGSQELFCENCINALDSELESSGFPISSTELEEHLACANEISSDHVISYGHQDDIVARSISSREEKISLRVNANAHMCTKEPACRQSLAKNKNRLSNAMWHQLKIRSRIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKILFGRYYHRGKRSQ 2017
            MDWNITVPIFSPRFSWLHVWTCGPILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADLMVAVLVMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQINFIRKKSGARKQILIMIFCVWSVSIVISIPSRFHGHRNQFLTSEDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRSTKFRPPDIHTLSNLNPKSTRTGKENKIVYFSSILFRCISVKTNTKNNQDQLV+KD+NHDNNVIKD ELDKVKGGKDIEHIGDYI+NPNNISKRQISLMSFGSQLSDIPYVDEDEVIKHDSSLSKKNSPQPSKLSSPSCSSLVTAIEKQANNNINNNIVTISGESSTQTMIASQFHRYSSDDTNEIRSPSVSCRSSNSGTDFQVDSESVFESNNSTKHGSQELFCENCINALDSELESSGFPISSTELEEHLACANEISSDHVIS GHQDDIVARSISSREEKISLRVNANAHMCTKEPACRQSLAKNKNRLSNAMWHQLKIRSRIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKILFGRYYHRGKRSQ
Sbjct:    1 MDWNITVPIFSPRFSWLHVWTCGPILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADLMVAVLVMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQINFIRKKSGARKQILIMIFCVWSVSIVISIPSRFHGHRNQFLTSEDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRSTKFRPPDIHTLSNLNPKSTRTGKENKIVYFSSILFRCISVKTNTKNNQDQLVYKDSNHDNNVIKDFELDKVKGGKDIEHIGDYIINPNNISKRQISLMSFGSQLSDIPYVDEDEVIKHDSSLSKKNSPQPSKLSSPSCSSLVTAIEKQANNNINNNIVTISGESSTQTMIASQFHRYSSDDTNEIRSPSVSCRSSNSGTDFQVDSESVFESNNSTKHGSQELFCENCINALDSELESSGFPISSTELEEHLACANEISSDHVISCGHQDDIVARSISSREEKISLRVNANAHMCTKEPACRQSLAKNKNRLSNAMWHQLKIRSRIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKILFGRYYHRGKRSQ 640          
BLAST of 5-hydroxytryptamine receptor vs. Planmine SMEST
Match: SMESG000019254.1 (SMESG000019254.1)

HSP 1 Score: 220.32 bits (560), Expect = 9.946e-64
Identity = 128/227 (56.39%), Postives = 169/227 (74.45%), Query Frame = 2
Query:  125 FSPRFSWLHVWTCGPILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQINFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQ---FLTSEDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRSTKFRPPDIHTLSNLNPKS 796
            FSPR SW+  +     L  +ILWTIIGNVFVVAAI+LE+ L++VSNYLILSLAVADLMVA+LVMPIS I E+SS+WW+G+ LCD+W  FDVL CTAS+LHLV IAIDRYWAVT IN++ +++ +R  I++MI  VW +S++IS+PSRFH HRN         +G C +N + +Y + +N+GAF+LPM  M  IY+RIY+FA+ +IR +  K +    H LSN + KS
Sbjct:   18 FSPRLSWIQFYITALFLGAIILWTIIGNVFVVAAIVLERTLKNVSNYLILSLAVADLMVAILVMPISAIKEVSSTWWLGIELCDLWTCFDVLSCTASILHLVVIAIDRYWAVTDINYLHRRTSSR--IILMIIGVWLISVIISVPSRFHTHRNNAEWLRVIVNGSCIINESVSYTVFSNLGAFYLPMAFMSVIYLRIYIFARSRIRYKRKKMKQN--HCLSNTDHKS 240          

HSP 2 Score: 123.635 bits (309), Expect = 1.547e-29
Identity = 59/97 (60.82%), Postives = 68/97 (70.10%), Query Frame = 2
Query: 1712 RIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKILFGRYYHR 2002
            R K+EQ+RERKAARTLAIITGCF+ICWLPF   N+ +         N     + L DS  LWLGY NS LNP+IYTVFSPDFR +FRKIL G Y+ R
Sbjct:  418 RNKVEQKRERKAARTLAIITGCFIICWLPFGINNVAHAF------CNTEPCGSALFDSLCLWLGYVNSGLNPVIYTVFSPDFRTAFRKILLGHYHTR 508          
BLAST of 5-hydroxytryptamine receptor vs. Planmine SMEST
Match: SMESG000008878.1 (SMESG000008878.1)

HSP 1 Score: 195.282 bits (495), Expect = 1.113e-54
Identity = 118/238 (49.58%), Postives = 170/238 (71.43%), Query Frame = 2
Query:  116 VPIFSPRFSWLHVWTCGPILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQINFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSE------DGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRSTKFRPPDIHTLSNLN-PKSTRTG 808
            V  F P++ W H++    +LV+LIL T+IGN FV+AAI+LEKNL +VSNYLI+SLAVADLMVA LVM +SV +EIS +W++G+ +CD+W+ FDVLCC+AS+LHLVAIAIDRY AVT+ +++R ++   K+I IMI  +W +SI+IS+P+RFH +RN   T E      DG C +N    + + +  GAF+LPM  ++ IY RIY  A+ +IR+++ + R    H +S  + P + +TG
Sbjct:   18 VSTFRPKYGWTHIYITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKPDYVRTRTA--KRIYIMIAIIWLLSIMISVPTRFHLNRNY--TKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQVARARIRRQAFRKRLRSQHHVSKRSQPCTCKTG 251          

HSP 2 Score: 116.701 bits (291), Expect = 2.629e-27
Identity = 57/94 (60.64%), Postives = 65/94 (69.15%), Query Frame = 2
Query: 1712 RIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKILFGRY 1993
            R K+EQ+RERKA RTLAIITGCF++CW PF  Q  I      P          LL  SF+LWLGY NS LNP+IYT+FSPDFR +F KILFGRY
Sbjct:  406 RQKLEQKRERKAVRTLAIITGCFIVCWQPFFIQATI-----VPFCGKKCQLPPLL-SSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKILFGRY 493          
BLAST of 5-hydroxytryptamine receptor vs. Planmine SMEST
Match: SMESG000008878.1 (SMESG000008878.1)

HSP 1 Score: 194.897 bits (494), Expect = 1.779e-54
Identity = 118/238 (49.58%), Postives = 170/238 (71.43%), Query Frame = 2
Query:  116 VPIFSPRFSWLHVWTCGPILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQINFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHRNQFLTSE------DGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRKRSTKFRPPDIHTLSNLN-PKSTRTG 808
            V  F P++ W H++    +LV+LIL T+IGN FV+AAI+LEKNL +VSNYLI+SLAVADLMVA LVM +SV +EIS +W++G+ +CD+W+ FDVLCC+AS+LHLVAIAIDRY AVT+ +++R ++   K+I IMI  +W +SI+IS+P+RFH +RN   T E      DG C +N    + + +  GAF+LPM  ++ IY RIY  A+ +IR+++ + R    H +S  + P + +TG
Sbjct:   32 VSTFRPKYGWTHIYITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKPDYVRTRTA--KRIYIMIAIIWLLSIMISVPTRFHLNRNY--TKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQVARARIRRQAFRKRLRSQHHVSKRSQPCTCKTG 265          

HSP 2 Score: 116.316 bits (290), Expect = 3.261e-27
Identity = 57/94 (60.64%), Postives = 65/94 (69.15%), Query Frame = 2
Query: 1712 RIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKILFGRY 1993
            R K+EQ+RERKA RTLAIITGCF++CW PF  Q  I      P          LL  SF+LWLGY NS LNP+IYT+FSPDFR +F KILFGRY
Sbjct:  420 RQKLEQKRERKAVRTLAIITGCFIVCWQPFFIQATI-----VPFCGKKCQLPPLL-SSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKILFGRY 507          
BLAST of 5-hydroxytryptamine receptor vs. Planmine SMEST
Match: SMESG000004643.1 (SMESG000004643.1)

HSP 1 Score: 196.052 bits (497), Expect = 5.159e-54
Identity = 122/213 (57.28%), Postives = 162/213 (76.06%), Query Frame = 2
Query:  110 ITVPIFSPRFSWLHVWTCGPILVMLILWTIIGNVFVVAAIILEKNLQSVSNYLIXXXXXXXXXXXXXXMPISVINEISSSWWMGMSLCDIWIFFDVLCCTASVLHLVAIAIDRYWAVTQINFIRKKSGARKQILIMIFCXXXXXXXXXXPSRFHGHR---NQFLTSE-DGVCRMNTNHTYIIVANIGAFFLPMLIMVAIYIRIYVFAKRQIRK 736
            + V  FSP+  W+HV+    +L  LIL TIIGNVFVVAAIILEKNLQSVSNYLILSLAVADLMVA LVM +S+++EIS  W++G+ LCD W+ FDVLCC+AS+LHLVAIA DRYWAVT I++IR ++  R  I+I+I  VW +SI+ISIPSRF+  R   N + +   DG+C +N  + Y I + +GAF++PM +++ IY++IY  A+ +IRK
Sbjct:   17 LEVARFSPKHGWIHVYLTSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADLMVASLVMSVSLLSEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTNIDYIRMRTAKRIIIMIII--VWFLSIIISIPSRFYSSRTWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQTARARIRK 227          

HSP 2 Score: 115.546 bits (288), Expect = 1.302e-26
Identity = 58/106 (54.72%), Postives = 71/106 (66.98%), Query Frame = 2
Query: 1706 RSRIKIEQRRERKAARTLAIITGCFLICWLPFATQNMINLISDS---PNNTNHTSYKALLIDSFILWLGYTNSCLNPIIYTVFSPDFRRSFRKILFGRYYHRGKRS 2014
            + + K+E +RERKAARTLAIITGCF++CWLPF  Q +          PN+         +  SF LWLGY NS LNPIIYT+FSP+FR +F KILFGR Y + KRS
Sbjct:  520 QQKQKLEHKRERKAARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPND---------IFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKILFGR-YQKTKRS 615          
The following BLAST results are available for this feature:
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HTR1A2.222e-3342.315-hydroxytryptamine receptor 1A [Source:HGNC Symbo... [more]
HTR1B4.556e-2940.935-hydroxytryptamine receptor 1B [Source:HGNC Symbo... [more]
ADRA2A7.032e-2737.56adrenoceptor alpha 2A [Source:HGNC Symbol;Acc:HGNC... [more]
HTR1D3.120e-2639.605-hydroxytryptamine receptor 1D [Source:HGNC Symbo... [more]
ADRA2B5.383e-2635.48adrenoceptor alpha 2B [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ser-46.788e-2834.91SERotonin/octopamine receptor family; Serotonin re... [more]
ser-46.788e-2834.91SERotonin/octopamine receptor family; Serotonin re... [more]
ser-24.830e-2337.23Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-P... [more]
ser-25.299e-2337.23Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-P... [more]
ser-25.556e-2337.23Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
5-HT1A1.289e-4050.54gene:FBgn0004168 transcript:FBtr0086577[more]
5-HT1A1.444e-4050.54gene:FBgn0004168 transcript:FBtr0474126[more]
5-HT1B1.996e-4047.94gene:FBgn0263116 transcript:FBtr0330056[more]
5-HT1B2.073e-4047.94gene:FBgn0263116 transcript:FBtr0086599[more]
5-HT1B2.091e-4047.94gene:FBgn0263116 transcript:FBtr0330055[more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
htr1aa3.779e-3545.085-hydroxytryptamine (serotonin) receptor 1A a [Sou... [more]
htr1b2.926e-3343.225-hydroxytryptamine (serotonin) receptor 1B [Sourc... [more]
htr1ab3.128e-3043.685-hydroxytryptamine (serotonin) receptor 1A b [Sou... [more]
htr1ab3.128e-3043.685-hydroxytryptamine (serotonin) receptor 1A b [Sou... [more]
adra2c3.882e-3041.21adrenoceptor alpha 2C [Source:NCBI gene;Acc:266752... [more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000046867.16.016e-3245.745-hydroxytryptamine (serotonin) receptor 1A, G pro... [more]
adra2c5.213e-3141.63adrenoceptor alpha 2C [Source:NCBI gene;Acc:100145... [more]
HTR1B1.387e-2941.305-hydroxytryptamine receptor 1B [Source:HGNC Symbo... [more]
HTR1D1.507e-2936.365-hydroxytryptamine receptor 1D [Source:HGNC Symbo... [more]
ADRA2B1.719e-2936.65adrenoceptor alpha 2B [Source:NCBI gene;Acc:100485... [more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Htr1a6.191e-3344.335-hydroxytryptamine (serotonin) receptor 1A [Sourc... [more]
Htr1b8.750e-2842.545-hydroxytryptamine (serotonin) receptor 1B [Sourc... [more]
Htr1b8.750e-2842.545-hydroxytryptamine (serotonin) receptor 1B [Sourc... [more]
Adra2a1.147e-2737.06adrenergic receptor, alpha 2a [Source:MGI Symbol;A... [more]
Adra2a1.147e-2737.06adrenergic receptor, alpha 2a [Source:MGI Symbol;A... [more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q25414|5HTR_LYMST1.499e-4552.135-hydroxytryptamine receptor OS=Lymnaea stagnalis ... [more]
sp|P28285|5HT2A_DROME1.292e-3950.545-hydroxytryptamine receptor 2A OS=Drosophila mela... [more]
sp|P28286|5HT2B_DROME2.078e-3947.945-hydroxytryptamine receptor 2B OS=Drosophila mela... [more]
sp|Q0EAB6|5HT1A_HORSE5.800e-3341.475-hydroxytryptamine receptor 1A OS=Equus caballus ... [more]
sp|Q6XXY0|5HT1A_VULVU8.387e-3342.315-hydroxytryptamine receptor 1A OS=Vulpes vulpes O... [more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUE30.000e+099.84GCR012 OS=Schmidtea mediterranea OX=79327 GN=gcr01... [more]
A0A193KU564.258e-6056.39GCR006 OS=Schmidtea mediterranea OX=79327 GN=gcr00... [more]
A0A183AJS03.152e-5348.83G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A4S2LW701.906e-5255.41G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
G7YNE62.083e-5255.415-hydroxytryptamine receptor 1 OS=Clonorchis sinen... [more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adra2c7.936e-3041.21alpha-2C adrenergic receptor-like [Source:NCBI gen... [more]
htr1ab1.245e-2940.535-hydroxytryptamine (serotonin) receptor 1A b [Sou... [more]
htr1b3.466e-2942.555-hydroxytryptamine (serotonin) receptor 1B [Sourc... [more]
HTR1B6.005e-2931.535-hydroxytryptamine receptor 1B [Source:NCBI gene;... [more]
ENSAMXT00000026144.23.561e-2742.63pep primary_assembly:Astyanax_mexicanus-2.0:9:1435... [more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009127.17.816e-3544.04pep scaffold:Pmarinus_7.0:GL478629:43196:44446:-1 ... [more]
ENSPMAT00000001357.11.042e-3042.86pep scaffold:Pmarinus_7.0:GL478256:17157:19157:1 g... [more]
HTR1F3.919e-2841.085-hydroxytryptamine receptor 1F [Source:HGNC Symbo... [more]
adra2c2.204e-2636.18adrenoceptor alpha 2C [Source:NCBI gene;Acc:266752... [more]
ENSPMAT00000006953.12.649e-2543.53pep scaffold:Pmarinus_7.0:GL477632:7596:14007:1 ge... [more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO476197.089e-1731.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354503.751e-1530.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO286036.892e-1432.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409992.390e-1332.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO366102.727e-1336.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000005282.24.178e-3341.75pep primary_assembly:ASM223467v1:9:8571029:8576106... [more]
htr1ab1.236e-3243.435-hydroxytryptamine (serotonin) receptor 1A b [Sou... [more]
HTR1B1.204e-3040.675-hydroxytryptamine receptor 1B [Source:HGNC Symbo... [more]
HTR1B1.299e-3042.195-hydroxytryptamine receptor 1B [Source:HGNC Symbo... [more]
adra2c1.863e-3041.43alpha-2C adrenergic receptor [Source:NCBI gene;Acc... [more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000010648.10.000e+099.22SMESG000010648.1[more]
SMESG000019254.19.946e-6456.39SMESG000019254.1[more]
SMESG000008878.11.113e-5449.58SMESG000008878.1[more]
SMESG000008878.11.779e-5449.58SMESG000008878.1[more]
SMESG000004643.15.159e-5457.28SMESG000004643.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005147 ID=SMED30005147|Name=5-hydroxytryptamine receptor|organism=Schmidtea mediterranea sexual|type=transcript|length=2028bp
AACAAATTTTACATTAATTTTGTCTTGGTACACCAATAAATAATATTCAG
CTTCACGCGAATGTACACCGAGAGAAATTGAGTAAATTATTTGGCAGATG
GACTGGAATATAACTGTGCCAATATTTAGTCCTCGGTTTTCATGGCTTCA
CGTTTGGACTTGTGGACCTATTCTTGTTATGCTGATTTTATGGACAATCA
TAGGAAATGTATTTGTTGTCGCCGCAATTATACTTGAAAAGAATCTTCAG
AGTGTCTCCAACTATCTCATTCTGAGTCTGGCAGTAGCAGATTTGATGGT
GGCGGTACTCGTAATGCCGATCAGCGTCATTAATGAAATCTCCAGTAGTT
GGTGGATGGGGATGAGTCTCTGTGATATTTGGATTTTCTTTGATGTATTA
TGCTGCACAGCATCCGTTTTGCATCTTGTAGCAATCGCAATAGACAGATA
CTGGGCCGTTACGCAAATAAATTTTATTCGAAAAAAATCTGGTGCTCGTA
AACAAATTCTAATAATGATATTTTGTGTTTGGAGTGTTTCAATTGTCATA
TCAATTCCATCAAGATTTCACGGTCACAGAAATCAGTTTCTAACCTCAGA
AGACGGAGTCTGCCGAATGAACACGAATCATACTTACATCATCGTTGCTA
ATATCGGCGCATTCTTTCTTCCTATGTTAATTATGGTGGCTATCTATATT
CGGATTTATGTATTTGCAAAAAGACAAATCAGAAAACGTTCCACCAAGTT
TCGACCCCCTGACATCCACACCCTTTCCAATCTCAACCCCAAATCCACTA
GAACTGGAAAGGAAAATAAAATAGTTTATTTTTCATCAATTTTATTTCGA
TGCATTTCAGTGAAAACTAATACAAAAAACAATCAAGACCAGCTAGTTTT
CAAAGATGCAAATCATGACAATAATGTCATTAAAGATTCTGAATTGGATA
AAGTAAAAGGAGGTAAAGATATAGAACATATTGGAGATTATATTATGAAT
CCTAATAATATATCAAAAAGACAAATTTCCTTAATGAGTTTTGGGTCACA
ACTTTCAGATATACCTTACGTGGATGAGGATGAAGTCATCAAACATGATT
CTTCGTTGTCTAAAAAAAATTCACCGCAACCTTCAAAGCTTTCTAGCCCT
TCGTGTTCTTCTCTTGTAACTGCAATTGAAAAGCAGGCAAATAATAATAT
AAACAACAATATTGTGACAATTTCCGGGGAATCATCTACACAAACCATGA
TTGCTTCTCAATTTCATCGATACTCATCTGACGACACAAATGAAATAAGG
TCTCCGTCAGTTTCTTGTCGGTCCAGTAACAGCGGAACAGACTTCCAAGT
AGATAGTGAATCAGTATTTGAATCTAATAATAGTACCAAACACGGATCAC
AAGAGCTTTTCTGCGAAAACTGTATAAATGCTTTGGATTCAGAATTAGAG
TCATCAGGATTCCCAATAAGTAGTACTGAATTAGAAGAACATTTAGCTTG
TGCTAATGAAATCAGTTCAGACCATGTCATATCTTATGGTCATCAAGATG
ATATTGTAGCGAGAAGTATTTCAAGTAGAGAAGAGAAAATAAGTCTGAGA
GTGAATGCCAACGCTCATATGTGTACAAAAGAGCCAGCTTGTAGACAGTC
TCTTGCGAAAAATAAAAATCGTCTTTCGAATGCAATGTGGCATCAACTAA
AAATCCGATCTCGCATAAAAATTGAACAGCGACGTGAGAGAAAAGCCGCC
AGAACTTTAGCAATTATTACCGGTTGTTTTCTCATTTGTTGGCTGCCGTT
TGCTACTCAGAACATGATAAATCTGATTTCAGACTCACCAAATAATACAA
ATCATACCAGTTATAAAGCTCTTTTAATCGACAGTTTTATATTATGGTTA
GGTTATACTAATTCGTGCCTAAATCCCATAATCTATACTGTATTTTCTCC
CGATTTTCGACGCTCGTTTAGGAAGATCCTATTTGGTCGGTATTACCACC
GTGGTAAAAGGTCGCAATAATTTACCTC
back to top

protein sequence of SMED30005147-orf-1

>SMED30005147-orf-1 ID=SMED30005147-orf-1|Name=SMED30005147-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=641bp
MDWNITVPIFSPRFSWLHVWTCGPILVMLILWTIIGNVFVVAAIILEKNL
QSVSNYLILSLAVADLMVAVLVMPISVINEISSSWWMGMSLCDIWIFFDV
LCCTASVLHLVAIAIDRYWAVTQINFIRKKSGARKQILIMIFCVWSVSIV
ISIPSRFHGHRNQFLTSEDGVCRMNTNHTYIIVANIGAFFLPMLIMVAIY
IRIYVFAKRQIRKRSTKFRPPDIHTLSNLNPKSTRTGKENKIVYFSSILF
RCISVKTNTKNNQDQLVFKDANHDNNVIKDSELDKVKGGKDIEHIGDYIM
NPNNISKRQISLMSFGSQLSDIPYVDEDEVIKHDSSLSKKNSPQPSKLSS
PSCSSLVTAIEKQANNNINNNIVTISGESSTQTMIASQFHRYSSDDTNEI
RSPSVSCRSSNSGTDFQVDSESVFESNNSTKHGSQELFCENCINALDSEL
ESSGFPISSTELEEHLACANEISSDHVISYGHQDDIVARSISSREEKISL
RVNANAHMCTKEPACRQSLAKNKNRLSNAMWHQLKIRSRIKIEQRRERKA
ARTLAIITGCFLICWLPFATQNMINLISDSPNNTNHTSYKALLIDSFILW
LGYTNSCLNPIIYTVFSPDFRRSFRKILFGRYYHRGKRSQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 21..45
score: 23.75
coord: 54..75
score: 38.24
coord: 181..204
score: 27.5
coord: 550..574
score: 32.12
coord: 99..121
score: 38.87
coord: 136..157
score: 22.73
coord: 595..621
score: 37.46
IPR000276G protein-coupled receptor, rhodopsin-likeSMARTSM013817TM_GPCR_Srsx_2coord: 30..628
e-value: 0.0031
score: -62.0
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 36..613
e-value: 3.1E-69
score: 233.2
IPR000276G protein-coupled receptor, rhodopsin-likePROSITEPS00237G_PROTEIN_RECEP_F1_1coord: 105..121
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 539..627
e-value: 8.0E-30
score: 106.2
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 26..211
e-value: 2.6E-67
score: 229.5
NoneNo IPR availableGENE3DG3DSA:1.20.120.10coord: 495..538
e-value: 8.0E-30
score: 106.2
NoneNo IPR availableGENE3DG3DSA:1.20.120.10coord: 212..275
e-value: 2.6E-67
score: 229.5
NoneNo IPR availablePANTHERPTHR242475-HYDROXYTRYPTAMINE RECEPTORcoord: 21..631
NoneNo IPR availablePANTHERPTHR24247:SF1985-HYDROXYTRYPTAMINE RECEPTOR 2A-RELATEDcoord: 21..631
NoneNo IPR availableCDDcd153317tmA_5-HT1A_invertebratescoord: 25..213
e-value: 4.19044E-86
score: 268.068
NoneNo IPR availableCDDcd153317tmA_5-HT1A_invertebratescoord: 540..624
e-value: 7.81775E-25
score: 102.047
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 10..636
NoneNo IPR availableTMHMMTMhelixcoord: 57..79
NoneNo IPR availableTMHMMTMhelixcoord: 94..116
NoneNo IPR availableTMHMMTMhelixcoord: 179..201
NoneNo IPR availableTMHMMTMhelixcoord: 597..616
NoneNo IPR availableTMHMMTMhelixcoord: 23..45
NoneNo IPR availableTMHMMTMhelixcoord: 555..577
NoneNo IPR availableTMHMMTMhelixcoord: 137..159
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 36..613
score: 39.65