Slc18a-1

Overview
NameSlc18a-1
Smed IDSMED30005143
Length (bp)498
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005143

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30005143SMESG000041535.1 dd_Smed_v4_20921_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30005143SMESG000041535.1 dd_Smed_v4_20921_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Slc18a-1 vs. TrEMBL
Match: A0A0H3YJ27 (Slc18a-1 OS=Schmidtea mediterranea OX=79327 GN=slc18a-1 PE=2 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 3.276e-27
Identity = 64/151 (42.38%), Postives = 88/151 (58.28%), Query Frame = 3
Query:   54 MRVNCNIILAILMVSFSFFMMSIPESSLYTILPKYLVDQLXXXXXXXXXXXXXXXXXXXXXXXXLNDRINLRINISKL---CHIQKPPYFIVSMVFLSKNLAQVVSNLIIGCIIEKINHYFILIAAQCFGIGVALIYAFGNSVVAYMCGRV 497
            M   C+  LA +++  +F+M+ I ESSLYTILPKYLVD+                           +    + N S+    CH+QKPPYFIVSM+FLSK+LAQ   N IIGC ++K+N++ IL+  Q  GI +ALIYA  NS+  Y+ GR+
Sbjct:    1 MSFKCDDCLAAIVICLNFYMLGIQESSLYTILPKYLVDE----------------------PFNATNNETFKPNTSRTIFQCHLQKPPYFIVSMIFLSKSLAQFFFNSIIGCFVDKVNNFIILLIGQGLGIIIALIYALNNSITMYIVGRL 129          
BLAST of Slc18a-1 vs. TrEMBL
Match: A0A0H3YK88 (Slc18a-8 OS=Schmidtea mediterranea OX=79327 GN=slc18a-8 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 1.833e-19
Identity = 54/141 (38.30%), Postives = 83/141 (58.87%), Query Frame = 3
Query:   75 ILAILMVSFSFFMMSIPESSLYTILPKYLVDQLXXXXXXXXXXXXXXXXXXXXXXXXLNDRINLRINISKLCHIQKPPYFIVSMVFLSKNLAQVVSNLIIGCIIEKINHYFILIAAQCFGIGVALIYAFGNSVVAYMCGRV 497
            +LA ++VS +FF+M + E+SLY ILPKY  +Q + +                      N+ + +   + + C  QKPPY +VS +FLSKN+A +  N+ IG II K+N Y ILI +   GIGV+ IYA+ ++++ Y+ GRV
Sbjct:    8 LLAGVVVSLNFFLMVLQENSLYAILPKYFSNQTSISAR--------------------NETVLINSTVPQNCSFQKPPYVVVSQIFLSKNVAMIFLNIFIGIIIYKLNIYIILILSHFVGIGVSFIYAYTDTLLLYIIGRV 128          
BLAST of Slc18a-1 vs. Planmine SMEST
Match: SMESG000041535.1 (SMESG000041535.1)

HSP 1 Score: 199.519 bits (506), Expect = 1.877e-62
Identity = 127/129 (98.45%), Postives = 127/129 (98.45%), Query Frame = 3
Query:  111 MMSIPESSLYTILPKYLVDQLXXXXXXXXXXXXXXXXXXXXXXXXLNDRINLRINISKLCHIQKPPYFIVSMVFLSKNLAQVVSNLIIGCIIEKINHYFILIAAQCFGIGVALIYAFGNSVVAYMCGRV 497
            MMSIPESSLYTILPKYLVDQLNN TANTTANTTVNATINITFNVTLNDRINLRINISKLCHIQKPPYFIVSMVFLSKNLAQVVSNLIIGCIIEKINHYFILIAAQCFGI VALIYAFGNSVVAYMCGRV
Sbjct:    1 MMSIPESSLYTILPKYLVDQLNNVTANTTANTTVNATINITFNVTLNDRINLRINISKLCHIQKPPYFIVSMVFLSKNLAQVVSNLIIGCIIEKINHYFILIAAQCFGIVVALIYAFGNSVVAYMCGRV 129          
BLAST of Slc18a-1 vs. Planmine SMEST
Match: SMESG000041534.1 (SMESG000041534.1)

HSP 1 Score: 145.591 bits (366), Expect = 5.215e-45
Identity = 82/148 (55.41%), Postives = 100/148 (67.57%), Query Frame = 3
Query:   54 MRVNCNIILAILMVSFSFFMMSIPESSLYTILPKYLVDQLXXXXXXXXXXXXXXXXXXXXXXXXLNDRINLRINISKLCHIQKPPYFIVSMVFLSKNLAQVVSNLIIGCIIEKINHYFILIAAQCFGIGVALIYAFGNSVVAYMCGRV 497
            M+ NC  +L ILMVS + FM++IPES+LYTILPKY VD+          + +     N   +VT+ND  NLRINISKLC ++KPPYF+VSMVFL+KNLAQV+SN I+               AQCFGI V LIY FGNSV+AYMCGRV
Sbjct:    1 MQFNCGSVLVILMVSLNSFMITIPESTLYTILPKYFVDK----------HRSSTTNNNTIVDVTVNDTTNLRINISKLCPLKKPPYFMVSMVFLAKNLAQVISNSIV---------------AQCFGIVVTLIYGFGNSVIAYMCGRV 123          
BLAST of Slc18a-1 vs. Planmine SMEST
Match: SMESG000041534.1 (SMESG000041534.1)

HSP 1 Score: 135.191 bits (339), Expect = 4.921e-41
Identity = 76/136 (55.88%), Postives = 92/136 (67.65%), Query Frame = 3
Query:   90 MVSFSFFMMSIPESSLYTILPKYLVDQLXXXXXXXXXXXXXXXXXXXXXXXXLNDRINLRINISKLCHIQKPPYFIVSMVFLSKNLAQVVSNLIIGCIIEKINHYFILIAAQCFGIGVALIYAFGNSVVAYMCGRV 497
            MVS + FM++IPES+LYTILPKY VD+          + +     N   +VT+ND  NLRINISKLC ++KPPYF+VSMVFL+KNLAQV+SN I+               AQCFGI V LIY FGNSV+AYMCGRV
Sbjct:    1 MVSLNSFMITIPESTLYTILPKYFVDK----------HRSSTTNNNTIVDVTVNDTTNLRINISKLCPLKKPPYFMVSMVFLAKNLAQVISNSIV---------------AQCFGIVVTLIYGFGNSVIAYMCGRV 111          
BLAST of Slc18a-1 vs. Planmine SMEST
Match: SMESG000041534.1 (SMESG000041534.1)

HSP 1 Score: 120.553 bits (301), Expect = 2.392e-35
Identity = 69/124 (55.65%), Postives = 82/124 (66.13%), Query Frame = 3
Query:  126 ESSLYTILPKYLVDQLXXXXXXXXXXXXXXXXXXXXXXXXLNDRINLRINISKLCHIQKPPYFIVSMVFLSKNLAQVVSNLIIGCIIEKINHYFILIAAQCFGIGVALIYAFGNSVVAYMCGRV 497
            ES+LYTILPKY VD+          + +     N   +VT+ND  NLRINISKLC ++KPPYF+VSMVFL+KNLAQV+SN I+               AQCFGI V LIY FGNSV+AYMCGRV
Sbjct:    6 ESTLYTILPKYFVDK----------HRSSTTNNNTIVDVTVNDTTNLRINISKLCPLKKPPYFMVSMVFLAKNLAQVISNSIV---------------AQCFGIVVTLIYGFGNSVIAYMCGRV 104          
BLAST of Slc18a-1 vs. Planmine SMEST
Match: SMESG000041557.1 (SMESG000041557.1)

HSP 1 Score: 115.931 bits (289), Expect = 9.585e-31
Identity = 64/151 (42.38%), Postives = 88/151 (58.28%), Query Frame = 3
Query:   54 MRVNCNIILAILMVSFSFFMMSIPESSLYTILPKYLVDQLXXXXXXXXXXXXXXXXXXXXXXXXLNDRINLRINISKL---CHIQKPPYFIVSMVFLSKNLAQVVSNLIIGCIIEKINHYFILIAAQCFGIGVALIYAFGNSVVAYMCGRV 497
            M   C+  LA +++  +F+M+ I ESSLYTILPKYLVD+                           +    + N S+    CH+QKPPYFIVSM+FLSK+LAQ   N IIGC ++K+N++ IL+  Q  GI +ALIYA  NS+  Y+ GR+
Sbjct:    1 MSFKCDDCLAAIVICLNFYMLGIQESSLYTILPKYLVDE----------------------PFNATNNETFKPNTSRTIFQCHLQKPPYFIVSMIFLSKSLAQFFFNSIIGCFVDKVNNFIILLIGQGLGIIIALIYALNNSITMYIVGRL 129          
The following BLAST results are available for this feature:
BLAST of Slc18a-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc18a-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc18a-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc18a-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc18a-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc18a-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc18a-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc18a-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 2
Match NameE-valueIdentityDescription
A0A0H3YJ273.276e-2742.38Slc18a-1 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YK881.833e-1938.30Slc18a-8 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
back to top
BLAST of Slc18a-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc18a-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc18a-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc18a-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc18a-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc18a-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000041535.11.877e-6298.45SMESG000041535.1[more]
SMESG000041534.15.215e-4555.41SMESG000041534.1[more]
SMESG000041534.14.921e-4155.88SMESG000041534.1[more]
SMESG000041534.12.392e-3555.65SMESG000041534.1[more]
SMESG000041557.19.585e-3142.38SMESG000041557.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005143 ID=SMED30005143|Name=Slc18a-1|organism=Schmidtea mediterranea sexual|type=transcript|length=498bp
TACAAACTGATTTTATTAGGTCTACGGTTATTATTTGACGTTTCTTACAT
TTAATGAGGGTTAATTGTAATATCATCTTAGCGATTCTCATGGTGAGTTT
TAGTTTTTTTATGATGAGTATTCCCGAAAGCAGTCTATATACGATTCTCC
CAAAGTATCTCGTCGATCAACTCAACAATGCCACGGCCAATACCACTGCC
AATACCACTGTCAATGCTACTATCAACATAACTTTCAATGTCACTCTTAA
TGACAGAATAAATCTAAGGATTAATATTTCAAAACTTTGTCATATTCAAA
AACCTCCATACTTCATCGTTAGCATGGTGTTTCTGTCAAAAAATCTGGCT
CAGGTGGTCTCAAACTTAATAATTGGATGTATAATAGAGAAAATAAATCA
TTATTTCATTTTAATAGCAGCGCAATGTTTTGGTATTGGTGTTGCGTTGA
TTTACGCTTTTGGGAATTCGGTGGTAGCTTATATGTGTGGAAGGGTTC
back to top

protein sequence of SMED30005143-orf-1

>SMED30005143-orf-1 ID=SMED30005143-orf-1|Name=SMED30005143-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=148bp
MRVNCNIILAILMVSFSFFMMSIPESSLYTILPKYLVDQLNNATANTTAN
TTVNATINITFNVTLNDRINLRINISKLCHIQKPPYFIVSMVFLSKNLAQ
VVSNLIIGCIIEKINHYFILIAAQCFGIGVALIYAFGNSVVAYMCGRV
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR020846MFS_dom
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..24
score: 0.629
NoneNo IPR availableTMHMMTMhelixcoord: 86..108
NoneNo IPR availableTMHMMTMhelixcoord: 43..65
NoneNo IPR availableTMHMMTMhelixcoord: 118..140
NoneNo IPR availableTMHMMTMhelixcoord: 5..23
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 11..148