Heat shock cognate 70 kDa protein

Overview
NameHeat shock cognate 70 kDa protein
Smed IDSMED30005131
Length (bp)1059
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Heat shock cognate 70 kDa protein (SMED30005131) t-SNE clustered cells

Violin plots show distribution of expression levels for Heat shock cognate 70 kDa protein (SMED30005131) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Heat shock cognate 70 kDa protein (SMED30005131) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Heat shock cognate 70 kDa protein (SMED30005131) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005131

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30005131SMESG000081110.1 Contig4015_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 620.928 bits (1600), Expect = 0.000e+0
Identity = 298/351 (84.90%), Postives = 326/351 (92.88%), Query Frame = 1
Query:   13 MSK-KAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKK-GKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            MSK  A+GIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+NTVFDAKRLIGR+FDD VVQ DMK WPF V+N   +PK+QVEYKGETKSF+PEE+SSMVLTKMKE AE+YLG  VT+AVVTVPAYFND QRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK G E+N+LIFDLGGGTFDVS+L+IE+GIFEVK+TAGDTHLGGEDFDNRMV HFI EFKRK+KKDI++NK+AVRRLRTACERAKRTLSSS Q +IEIDSL EG+DFYT+ITRARFEELNADLFR TLDPVEKAL+DAK DKS+I++IVLVGGS RIPKIQKLLQ
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQ 351          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 620.928 bits (1600), Expect = 0.000e+0
Identity = 298/351 (84.90%), Postives = 326/351 (92.88%), Query Frame = 1
Query:   13 MSK-KAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKK-GKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            MSK  A+GIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+NTVFDAKRLIGR+FDD VVQ DMK WPF V+N   +PK+QVEYKGETKSF+PEE+SSMVLTKMKE AE+YLG  VT+AVVTVPAYFND QRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK G E+N+LIFDLGGGTFDVS+L+IE+GIFEVK+TAGDTHLGGEDFDNRMV HFI EFKRK+KKDI++NK+AVRRLRTACERAKRTLSSS Q +IEIDSL EG+DFYT+ITRARFEELNADLFR TLDPVEKAL+DAK DKS+I++IVLVGGS RIPKIQKLLQ
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQ 351          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 620.928 bits (1600), Expect = 0.000e+0
Identity = 298/351 (84.90%), Postives = 326/351 (92.88%), Query Frame = 1
Query:   13 MSK-KAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKK-GKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            MSK  A+GIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+NTVFDAKRLIGR+FDD VVQ DMK WPF V+N   +PK+QVEYKGETKSF+PEE+SSMVLTKMKE AE+YLG  VT+AVVTVPAYFND QRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK G E+N+LIFDLGGGTFDVS+L+IE+GIFEVK+TAGDTHLGGEDFDNRMV HFI EFKRK+KKDI++NK+AVRRLRTACERAKRTLSSS Q +IEIDSL EG+DFYT+ITRARFEELNADLFR TLDPVEKAL+DAK DKS+I++IVLVGGS RIPKIQKLLQ
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQ 351          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 620.542 bits (1599), Expect = 0.000e+0
Identity = 298/351 (84.90%), Postives = 326/351 (92.88%), Query Frame = 1
Query:   13 MSK-KAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKK-GKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            MSK  A+GIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+NTVFDAKRLIGR+FDD VVQ DMK WPF V+N   +PK+QVEYKGETKSF+PEE+SSMVLTKMKE AE+YLG  VT+AVVTVPAYFND QRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK G E+N+LIFDLGGGTFDVS+L+IE+GIFEVK+TAGDTHLGGEDFDNRMV HFI EFKRK+KKDI++NK+AVRRLRTACERAKRTLSSS Q +IEIDSL EG+DFYT+ITRARFEELNADLFR TLDPVEKAL+DAK DKS+I++IVLVGGS RIPKIQKLLQ
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQ 351          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Human
Match: HSPA2 (heat shock protein family A (Hsp70) member 2 [Source:HGNC Symbol;Acc:HGNC:5235])

HSP 1 Score: 611.298 bits (1575), Expect = 0.000e+0
Identity = 294/348 (84.48%), Postives = 318/348 (91.38%), Query Frame = 1
Query:   25 AIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKK---GKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            AIGIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+NT+FDAKRLIGRKF+D  VQ DMK WPF+V++ G KPK+QVEYKGETK+FFPEEISSMVLTKMKE AE+YLGGKV  AV+TVPAYFND QRQATKDAG I GLNVLRIINEPTAAAIAYGLDKK   G EKN+LIFDLGGGTFDVS+L+IE+GIFEVK+TAGDTHLGGEDFDNRMV H  +EFKRK+KKDI  NK+AVRRLRTACERAKRTLSSS Q +IEIDSL EGVDFYT+ITRARFEELNADLFR TL+PVEKAL+DAK DK +I EIVLVGGS RIPKIQKLLQ
Sbjct:    7 AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEISSMVLTKMKEIAEAYLGGKVHSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQ 354          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Celegans
Match: hsp-1 (Heat shock 70 kDa protein A [Source:UniProtKB/Swiss-Prot;Acc:P09446])

HSP 1 Score: 600.897 bits (1548), Expect = 0.000e+0
Identity = 291/351 (82.91%), Postives = 319/351 (90.88%), Query Frame = 1
Query:   13 MSKK-AIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINA-GSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKKGK-EKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLL 1056
            MSK  A+GIDLGTTYSCV VF +GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGRKFDDP VQ DMK WPFKVI+A G+KPK+QVEYKGE K F PEEISSMVL KMKETAE++LG  V DAVVTVPAYFND QRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKKG  E+N+LIFDLGGGTFDVS+L+IE+GIFEVK+TAGDTHLGGEDFDNRMV HF  EFKRK+KKD+  N +A+RRLRTACERAKRTLSSS+Q +IEIDSL EG+DFYT ITRARFEEL ADLFRST+DPVEK+L+DAK DKS++++IVLVGGS RIPK+QKLL
Sbjct:    1 MSKHNAVGIDLGTTYSCVGVFMHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPHNTVFDAKRLIGRKFDDPAVQSDMKHWPFKVISAEGAKPKVQVEYKGENKIFTPEEISSMVLLKMKETAEAFLGTTVKDAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGHGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFCAEFKRKHKKDLASNPRALRRLRTACERAKRTLSSSSQASIEIDSLFEGIDFYTNITRARFEELCADLFRSTMDPVEKSLRDAKMDKSQVHDIVLVGGSTRIPKVQKLL 351          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Celegans
Match: hsp-1 (Heat shock 70 kDa protein A [Source:UniProtKB/Swiss-Prot;Acc:P09446])

HSP 1 Score: 600.897 bits (1548), Expect = 0.000e+0
Identity = 291/351 (82.91%), Postives = 319/351 (90.88%), Query Frame = 1
Query:   13 MSKK-AIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINA-GSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKKGK-EKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLL 1056
            MSK  A+GIDLGTTYSCV VF +GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGRKFDDP VQ DMK WPFKVI+A G+KPK+QVEYKGE K F PEEISSMVL KMKETAE++LG  V DAVVTVPAYFND QRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKKG  E+N+LIFDLGGGTFDVS+L+IE+GIFEVK+TAGDTHLGGEDFDNRMV HF  EFKRK+KKD+  N +A+RRLRTACERAKRTLSSS+Q +IEIDSL EG+DFYT ITRARFEEL ADLFRST+DPVEK+L+DAK DKS++++IVLVGGS RIPK+QKLL
Sbjct:    1 MSKHNAVGIDLGTTYSCVGVFMHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPHNTVFDAKRLIGRKFDDPAVQSDMKHWPFKVISAEGAKPKVQVEYKGENKIFTPEEISSMVLLKMKETAEAFLGTTVKDAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGHGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFCAEFKRKHKKDLASNPRALRRLRTACERAKRTLSSSSQASIEIDSLFEGIDFYTNITRARFEELCADLFRSTMDPVEKSLRDAKMDKSQVHDIVLVGGSTRIPKVQKLL 351          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Celegans
Match: F44E5.5 (pep chromosome:WBcel235:II:11759681:11761808:1 gene:WBGene00009692.1 transcript:F44E5.5.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F44E5.5)

HSP 1 Score: 544.658 bits (1402), Expect = 0.000e+0
Identity = 263/350 (75.14%), Postives = 299/350 (85.43%), Query Frame = 1
Query:   16 SKKAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKKGK-EKNILIFDLGGGTFDVSVLSIEEG-IFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            S KAIGIDLGTTYSCV ++QNGKVEI+AN +GN+TTPSYVAFTDTERL+GDAAK+Q A NP NTVFDAKRLIGR+FD+  VQ D K WPF V     KP I+VE KGE + F PEEIS+MVL KMKETAE+YLG  V DAV+TVPAYFND QRQATKDA  IAGLN +RIINEPTAAA+AYGLDK  + EKN+LIFDLGGGTFDVS+LSI EG IFEVK+TAGDTHLGGEDFD RM+QHF+ EFKRK  KDI+ N +A+RRLRTACERAKRTLSSS++  +E+DSL EG+D  T ITRARFEEL ADLFR TL+PVEKAL+DAK DKSKI+E+VLVGGS R+PKIQKLL+
Sbjct:    3 SCKAIGIDLGTTYSCVGIYQNGKVEILANSEGNKTTPSYVAFTDTERLVGDAAKDQAARNPENTVFDAKRLIGRRFDESTVQSDCKHWPFGVKGKQGKPVIEVEVKGEKRQFNPEEISAMVLQKMKETAETYLGHTVKDAVITVPAYFNDSQRQATKDAATIAGLNAIRIINEPTAAALAYGLDKGIQDEKNVLIFDLGGGTFDVSILSIAEGSIFEVKSTAGDTHLGGEDFDQRMLQHFMNEFKRKTGKDISPNPRAIRRLRTACERAKRTLSSSSEACVEVDSLFEGIDLCTKITRARFEELCADLFRKTLEPVEKALRDAKLDKSKIDEVVLVGGSTRVPKIQKLLK 352          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Celegans
Match: F44E5.5 (pep chromosome:WBcel235:II:11759640:11761853:1 gene:WBGene00009692.1 transcript:F44E5.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F44E5.5)

HSP 1 Score: 544.658 bits (1402), Expect = 0.000e+0
Identity = 263/350 (75.14%), Postives = 299/350 (85.43%), Query Frame = 1
Query:   16 SKKAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKKGK-EKNILIFDLGGGTFDVSVLSIEEG-IFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            S KAIGIDLGTTYSCV ++QNGKVEI+AN +GN+TTPSYVAFTDTERL+GDAAK+Q A NP NTVFDAKRLIGR+FD+  VQ D K WPF V     KP I+VE KGE + F PEEIS+MVL KMKETAE+YLG  V DAV+TVPAYFND QRQATKDA  IAGLN +RIINEPTAAA+AYGLDK  + EKN+LIFDLGGGTFDVS+LSI EG IFEVK+TAGDTHLGGEDFD RM+QHF+ EFKRK  KDI+ N +A+RRLRTACERAKRTLSSS++  +E+DSL EG+D  T ITRARFEEL ADLFR TL+PVEKAL+DAK DKSKI+E+VLVGGS R+PKIQKLL+
Sbjct:    3 SCKAIGIDLGTTYSCVGIYQNGKVEILANSEGNKTTPSYVAFTDTERLVGDAAKDQAARNPENTVFDAKRLIGRRFDESTVQSDCKHWPFGVKGKQGKPVIEVEVKGEKRQFNPEEISAMVLQKMKETAETYLGHTVKDAVITVPAYFNDSQRQATKDAATIAGLNAIRIINEPTAAALAYGLDKGIQDEKNVLIFDLGGGTFDVSILSIAEGSIFEVKSTAGDTHLGGEDFDQRMLQHFMNEFKRKTGKDISPNPRAIRRLRTACERAKRTLSSSSEACVEVDSLFEGIDLCTKITRARFEELCADLFRKTLEPVEKALRDAKLDKSKIDEVVLVGGSTRVPKIQKLLK 352          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Celegans
Match: F44E5.4 (pep chromosome:WBcel235:II:11757106:11759323:-1 gene:WBGene00009691.1 transcript:F44E5.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F44E5.4)

HSP 1 Score: 544.658 bits (1402), Expect = 0.000e+0
Identity = 263/350 (75.14%), Postives = 299/350 (85.43%), Query Frame = 1
Query:   16 SKKAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKKGK-EKNILIFDLGGGTFDVSVLSIEEG-IFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            S KAIGIDLGTTYSCV ++QNGKVEI+AN +GN+TTPSYVAFTDTERL+GDAAK+Q A NP NTVFDAKRLIGR+FD+  VQ D K WPF V     KP I+VE KGE + F PEEIS+MVL KMKETAE+YLG  V DAV+TVPAYFND QRQATKDA  IAGLN +RIINEPTAAA+AYGLDK  + EKN+LIFDLGGGTFDVS+LSI EG IFEVK+TAGDTHLGGEDFD RM+QHF+ EFKRK  KDI+ N +A+RRLRTACERAKRTLSSS++  +E+DSL EG+D  T ITRARFEEL ADLFR TL+PVEKAL+DAK DKSKI+E+VLVGGS R+PKIQKLL+
Sbjct:    3 SCKAIGIDLGTTYSCVGIYQNGKVEILANSEGNKTTPSYVAFTDTERLVGDAAKDQAARNPENTVFDAKRLIGRRFDESTVQSDCKHWPFGVKGKQGKPVIEVEVKGEKRQFNPEEISAMVLQKMKETAETYLGHTVKDAVITVPAYFNDSQRQATKDAATIAGLNAIRIINEPTAAALAYGLDKGIQDEKNVLIFDLGGGTFDVSILSIAEGSIFEVKSTAGDTHLGGEDFDQRMLQHFMNEFKRKTGKDISPNPRAIRRLRTACERAKRTLSSSSEACVEVDSLFEGIDLCTKITRARFEELCADLFRKTLEPVEKALRDAKLDKSKIDEVVLVGGSTRVPKIQKLLK 352          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0083059)

HSP 1 Score: 604.749 bits (1558), Expect = 0.000e+0
Identity = 290/351 (82.62%), Postives = 322/351 (91.74%), Query Frame = 1
Query:   13 MSK-KAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKKG-KEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            MSK  A+GIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+ T+FDAKRLIGRKFDD  VQ DMK WPF+V++A  KPKI+V YK E K+FFPEEISSMVLTKMKETAE+YLG  VT+AV+TVPAYFND QRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK   E+N+LIFDLGGGTFDVS+LSI++GIFEVK+TAGDTHLGGEDFDNR+V HF+QEFKRK+KKD+T NK+A+RRLRTACERAKRTLSSS Q +IEIDSL EG DFYT+ITRARFEELNADLFRST+DPVEKAL+DAK DKS I++IVLVGGS RIPK+Q+LLQ
Sbjct:    1 MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAKLDKSVIHDIVLVGGSTRIPKVQRLLQ 351          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0337053)

HSP 1 Score: 604.749 bits (1558), Expect = 0.000e+0
Identity = 290/351 (82.62%), Postives = 322/351 (91.74%), Query Frame = 1
Query:   13 MSK-KAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKKG-KEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            MSK  A+GIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+ T+FDAKRLIGRKFDD  VQ DMK WPF+V++A  KPKI+V YK E K+FFPEEISSMVLTKMKETAE+YLG  VT+AV+TVPAYFND QRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK   E+N+LIFDLGGGTFDVS+LSI++GIFEVK+TAGDTHLGGEDFDNR+V HF+QEFKRK+KKD+T NK+A+RRLRTACERAKRTLSSS Q +IEIDSL EG DFYT+ITRARFEELNADLFRST+DPVEKAL+DAK DKS I++IVLVGGS RIPK+Q+LLQ
Sbjct:    1 MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAKLDKSVIHDIVLVGGSTRIPKVQRLLQ 351          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0083058)

HSP 1 Score: 604.749 bits (1558), Expect = 0.000e+0
Identity = 290/351 (82.62%), Postives = 322/351 (91.74%), Query Frame = 1
Query:   13 MSK-KAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKKG-KEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            MSK  A+GIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+ T+FDAKRLIGRKFDD  VQ DMK WPF+V++A  KPKI+V YK E K+FFPEEISSMVLTKMKETAE+YLG  VT+AV+TVPAYFND QRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK   E+N+LIFDLGGGTFDVS+LSI++GIFEVK+TAGDTHLGGEDFDNR+V HF+QEFKRK+KKD+T NK+A+RRLRTACERAKRTLSSS Q +IEIDSL EG DFYT+ITRARFEELNADLFRST+DPVEKAL+DAK DKS I++IVLVGGS RIPK+Q+LLQ
Sbjct:    1 MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAKLDKSVIHDIVLVGGSTRIPKVQRLLQ 351          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0083060)

HSP 1 Score: 604.749 bits (1558), Expect = 0.000e+0
Identity = 290/351 (82.62%), Postives = 322/351 (91.74%), Query Frame = 1
Query:   13 MSK-KAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKKG-KEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            MSK  A+GIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+ T+FDAKRLIGRKFDD  VQ DMK WPF+V++A  KPKI+V YK E K+FFPEEISSMVLTKMKETAE+YLG  VT+AV+TVPAYFND QRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK   E+N+LIFDLGGGTFDVS+LSI++GIFEVK+TAGDTHLGGEDFDNR+V HF+QEFKRK+KKD+T NK+A+RRLRTACERAKRTLSSS Q +IEIDSL EG DFYT+ITRARFEELNADLFRST+DPVEKAL+DAK DKS I++IVLVGGS RIPK+Q+LLQ
Sbjct:    1 MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAKLDKSVIHDIVLVGGSTRIPKVQRLLQ 351          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0083057)

HSP 1 Score: 604.749 bits (1558), Expect = 0.000e+0
Identity = 290/351 (82.62%), Postives = 322/351 (91.74%), Query Frame = 1
Query:   13 MSK-KAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKKG-KEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            MSK  A+GIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+ T+FDAKRLIGRKFDD  VQ DMK WPF+V++A  KPKI+V YK E K+FFPEEISSMVLTKMKETAE+YLG  VT+AV+TVPAYFND QRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK   E+N+LIFDLGGGTFDVS+LSI++GIFEVK+TAGDTHLGGEDFDNR+V HF+QEFKRK+KKD+T NK+A+RRLRTACERAKRTLSSS Q +IEIDSL EG DFYT+ITRARFEELNADLFRST+DPVEKAL+DAK DKS I++IVLVGGS RIPK+Q+LLQ
Sbjct:    1 MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAKLDKSVIHDIVLVGGSTRIPKVQRLLQ 351          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Zebrafish
Match: hspa8 (heat shock protein 8 [Source:NCBI gene;Acc:573376])

HSP 1 Score: 621.698 bits (1602), Expect = 0.000e+0
Identity = 298/352 (84.66%), Postives = 328/352 (93.18%), Query Frame = 1
Query:   10 TMSK-KAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKK-GKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            TMSK  A+GIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+NTVFDAKRLIGR+FDD VVQ DMK WPF VIN  S+PK+QVEYKGE+KSF+PEEISSMVLTKMKE AE+YLG  V++AV+TVPAYFND QRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK G E+N+LIFDLGGGTFDVS+L+IE+GIFEVK+TAGDTHLGGEDFDNRMV HFI EFKRK+KKDI+DNK+AVRRLRTACERAKRTLSSS Q +IEIDSL EG+DFYT+ITRARFEELNADLFR TLDPVEKAL+DAK DK++I++IVLVGGS RIPKIQKLLQ
Sbjct:    5 TMSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDGVVQSDMKHWPFNVINDNSRPKVQVEYKGESKSFYPEEISSMVLTKMKEIAEAYLGKTVSNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQ 356          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Zebrafish
Match: hspa8 (heat shock protein 8 [Source:NCBI gene;Acc:573376])

HSP 1 Score: 620.157 bits (1598), Expect = 0.000e+0
Identity = 297/351 (84.62%), Postives = 327/351 (93.16%), Query Frame = 1
Query:   13 MSK-KAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKK-GKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            MSK  A+GIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+NTVFDAKRLIGR+FDD VVQ DMK WPF VIN  S+PK+QVEYKGE+KSF+PEEISSMVLTKMKE AE+YLG  V++AV+TVPAYFND QRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK G E+N+LIFDLGGGTFDVS+L+IE+GIFEVK+TAGDTHLGGEDFDNRMV HFI EFKRK+KKDI+DNK+AVRRLRTACERAKRTLSSS Q +IEIDSL EG+DFYT+ITRARFEELNADLFR TLDPVEKAL+DAK DK++I++IVLVGGS RIPKIQKLLQ
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDGVVQSDMKHWPFNVINDNSRPKVQVEYKGESKSFYPEEISSMVLTKMKEIAEAYLGKTVSNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQ 351          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Zebrafish
Match: hspa8 (heat shock protein 8 [Source:NCBI gene;Acc:573376])

HSP 1 Score: 619.772 bits (1597), Expect = 0.000e+0
Identity = 297/351 (84.62%), Postives = 327/351 (93.16%), Query Frame = 1
Query:   13 MSK-KAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKK-GKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            MSK  A+GIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+NTVFDAKRLIGR+FDD VVQ DMK WPF VIN  S+PK+QVEYKGE+KSF+PEEISSMVLTKMKE AE+YLG  V++AV+TVPAYFND QRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK G E+N+LIFDLGGGTFDVS+L+IE+GIFEVK+TAGDTHLGGEDFDNRMV HFI EFKRK+KKDI+DNK+AVRRLRTACERAKRTLSSS Q +IEIDSL EG+DFYT+ITRARFEELNADLFR TLDPVEKAL+DAK DK++I++IVLVGGS RIPKIQKLLQ
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDGVVQSDMKHWPFNVINDNSRPKVQVEYKGESKSFYPEEISSMVLTKMKEIAEAYLGKTVSNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQ 351          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Zebrafish
Match: hspa8 (heat shock protein 8 [Source:NCBI gene;Acc:573376])

HSP 1 Score: 619.772 bits (1597), Expect = 0.000e+0
Identity = 297/351 (84.62%), Postives = 327/351 (93.16%), Query Frame = 1
Query:   13 MSK-KAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKK-GKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            MSK  A+GIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+NTVFDAKRLIGR+FDD VVQ DMK WPF VIN  S+PK+QVEYKGE+KSF+PEEISSMVLTKMKE AE+YLG  V++AV+TVPAYFND QRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK G E+N+LIFDLGGGTFDVS+L+IE+GIFEVK+TAGDTHLGGEDFDNRMV HFI EFKRK+KKDI+DNK+AVRRLRTACERAKRTLSSS Q +IEIDSL EG+DFYT+ITRARFEELNADLFR TLDPVEKAL+DAK DK++I++IVLVGGS RIPKIQKLLQ
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDGVVQSDMKHWPFNVINDNSRPKVQVEYKGESKSFYPEEISSMVLTKMKEIAEAYLGKTVSNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQ 351          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Zebrafish
Match: hspa8 (heat shock protein 8 [Source:NCBI gene;Acc:573376])

HSP 1 Score: 619.772 bits (1597), Expect = 0.000e+0
Identity = 297/351 (84.62%), Postives = 327/351 (93.16%), Query Frame = 1
Query:   13 MSK-KAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKK-GKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            MSK  A+GIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+NTVFDAKRLIGR+FDD VVQ DMK WPF VIN  S+PK+QVEYKGE+KSF+PEEISSMVLTKMKE AE+YLG  V++AV+TVPAYFND QRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK G E+N+LIFDLGGGTFDVS+L+IE+GIFEVK+TAGDTHLGGEDFDNRMV HFI EFKRK+KKDI+DNK+AVRRLRTACERAKRTLSSS Q +IEIDSL EG+DFYT+ITRARFEELNADLFR TLDPVEKAL+DAK DK++I++IVLVGGS RIPKIQKLLQ
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDGVVQSDMKHWPFNVINDNSRPKVQVEYKGESKSFYPEEISSMVLTKMKEIAEAYLGKTVSNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQ 351          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Xenopus
Match: wdr26 (WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-993726])

HSP 1 Score: 615.15 bits (1585), Expect = 0.000e+0
Identity = 295/352 (83.81%), Postives = 324/352 (92.05%), Query Frame = 1
Query:   10 TMSK-KAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKK-GKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            TMSK  A+GIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+NTVFDAKRLIGR+F+D VVQ DMK WPF VI+   +PK+QVEYK ETKSF+PEEISSMVL KMKE AE+YLG  VT+AV+TVPAYFND QRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK G E+N+LIFDLGGGTFDVS+L+IE+GIFEVK+TAGDTHLGGEDFDNRMV HF+ EFKRK+KKDI DNK+AVRRLRTACERAKRTLSSS Q +IEIDSL EG+DFYT+ITRARFEELNADLFR TLDPVEKAL+DAK DKS+I++IVLVGGS RIPKIQKLLQ
Sbjct:    5 TMSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFEDAVVQSDMKHWPFNVISDSGRPKVQVEYKAETKSFYPEEISSMVLVKMKEIAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVAEFKRKHKKDIIDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQ 356          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Xenopus
Match: wdr26 (WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-993726])

HSP 1 Score: 615.15 bits (1585), Expect = 0.000e+0
Identity = 295/352 (83.81%), Postives = 324/352 (92.05%), Query Frame = 1
Query:   10 TMSK-KAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKK-GKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            TMSK  A+GIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+NTVFDAKRLIGR+F+D VVQ DMK WPF VI+   +PK+QVEYK ETKSF+PEEISSMVL KMKE AE+YLG  VT+AV+TVPAYFND QRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK G E+N+LIFDLGGGTFDVS+L+IE+GIFEVK+TAGDTHLGGEDFDNRMV HF+ EFKRK+KKDI DNK+AVRRLRTACERAKRTLSSS Q +IEIDSL EG+DFYT+ITRARFEELNADLFR TLDPVEKAL+DAK DKS+I++IVLVGGS RIPKIQKLLQ
Sbjct:    8 TMSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFEDAVVQSDMKHWPFNVISDSGRPKVQVEYKAETKSFYPEEISSMVLVKMKEIAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVAEFKRKHKKDIIDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQ 359          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Xenopus
Match: ENSXETT00000025573.1 (heat shock protein family A (Hsp70) member 1B [Source:NCBI gene;Acc:100485441])

HSP 1 Score: 613.994 bits (1582), Expect = 0.000e+0
Identity = 294/346 (84.97%), Postives = 324/346 (93.64%), Query Frame = 1
Query:   25 AIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKKGK-EKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            AIGIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA+NP NTVFDAKRLIGRK+D+PVVQ DMK WPFKVI+ G KPK+ VEYKGE KSF PEEISSMVLTKMKETAE+YLG KVT+AV+TVPAYFND QRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDK G+ E+NILIFDLGGGTFDVS+L+I++GIFEVKATAGDTHLGGEDFDNRMV HF++EFKRK+KKDI+ NK+A+RRLRTACERAKRTLSSS Q +IEIDSL EG+DFYT+ITRARFEEL ADLFR TL+PVEKA++DAK DKS+I+EIVLVGGS RIPK+QKLLQ
Sbjct:    7 AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPHNTVFDAKRLIGRKYDEPVVQSDMKHWPFKVISDGGKPKVTVEYKGEGKSFSPEEISSMVLTKMKETAEAYLGYKVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKSGRGERNILIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRMVNHFVEEFKRKHKKDISPNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGIDFYTSITRARFEELCADLFRGTLEPVEKAMRDAKLDKSQIHEIVLVGGSTRIPKVQKLLQ 352          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Xenopus
Match: wdr26 (WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-993726])

HSP 1 Score: 613.224 bits (1580), Expect = 0.000e+0
Identity = 294/351 (83.76%), Postives = 323/351 (92.02%), Query Frame = 1
Query:   13 MSK-KAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKK-GKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            MSK  A+GIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+NTVFDAKRLIGR+F+D VVQ DMK WPF VI+   +PK+QVEYK ETKSF+PEEISSMVL KMKE AE+YLG  VT+AV+TVPAYFND QRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK G E+N+LIFDLGGGTFDVS+L+IE+GIFEVK+TAGDTHLGGEDFDNRMV HF+ EFKRK+KKDI DNK+AVRRLRTACERAKRTLSSS Q +IEIDSL EG+DFYT+ITRARFEELNADLFR TLDPVEKAL+DAK DKS+I++IVLVGGS RIPKIQKLLQ
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFEDAVVQSDMKHWPFNVISDSGRPKVQVEYKAETKSFYPEEISSMVLVKMKEIAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVAEFKRKHKKDIIDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQ 351          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Xenopus
Match: wdr26 (WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-993726])

HSP 1 Score: 612.453 bits (1578), Expect = 0.000e+0
Identity = 292/349 (83.67%), Postives = 321/349 (91.98%), Query Frame = 1
Query:   16 SKKAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKK-GKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            S  A+GIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+NTVFDAKRLIGR+F+D VVQ DMK WPF VI+   +PK+QVEYK ETKSF+PEEISSMVL KMKE AE+YLG  VT+AV+TVPAYFND QRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK G E+N+LIFDLGGGTFDVS+L+IE+GIFEVK+TAGDTHLGGEDFDNRMV HF+ EFKRK+KKDI DNK+AVRRLRTACERAKRTLSSS Q +IEIDSL EG+DFYT+ITRARFEELNADLFR TLDPVEKAL+DAK DKS+I++IVLVGGS RIPKIQKLLQ
Sbjct:    4 SGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFEDAVVQSDMKHWPFNVISDSGRPKVQVEYKAETKSFYPEEISSMVLVKMKEIAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVAEFKRKHKKDIIDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQ 352          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Mouse
Match: Hspa8 (heat shock protein 8 [Source:MGI Symbol;Acc:MGI:105384])

HSP 1 Score: 620.928 bits (1600), Expect = 0.000e+0
Identity = 298/351 (84.90%), Postives = 326/351 (92.88%), Query Frame = 1
Query:   13 MSK-KAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKK-GKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            MSK  A+GIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+NTVFDAKRLIGR+FDD VVQ DMK WPF V+N   +PK+QVEYKGETKSF+PEE+SSMVLTKMKE AE+YLG  VT+AVVTVPAYFND QRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK G E+N+LIFDLGGGTFDVS+L+IE+GIFEVK+TAGDTHLGGEDFDNRMV HFI EFKRK+KKDI++NK+AVRRLRTACERAKRTLSSS Q +IEIDSL EG+DFYT+ITRARFEELNADLFR TLDPVEKAL+DAK DKS+I++IVLVGGS RIPKIQKLLQ
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQ 351          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Mouse
Match: Hspa2 (heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96243])

HSP 1 Score: 609.757 bits (1571), Expect = 0.000e+0
Identity = 293/348 (84.20%), Postives = 317/348 (91.09%), Query Frame = 1
Query:   25 AIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKK---GKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            AIGIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+NT+FDAKRLIGRKF+D  VQ DMK WPF+V++ G KPK+QVEYKGE K+FFPEEISSMVLTKMKE AE+YLGGKV  AV+TVPAYFND QRQATKDAG I GLNVLRIINEPTAAAIAYGLDKK   G EKN+LIFDLGGGTFDVS+L+IE+GIFEVK+TAGDTHLGGEDFDNRMV H  +EFKRK+KKDI  NK+AVRRLRTACERAKRTLSSS Q +IEIDSL EGVDFYT+ITRARFEELNADLFR TL+PVEKAL+DAK DK +I EIVLVGGS RIPKIQKLLQ
Sbjct:    7 AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGEMKTFFPEEISSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQ 354          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Mouse
Match: Hspa2 (heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96243])

HSP 1 Score: 609.757 bits (1571), Expect = 0.000e+0
Identity = 293/348 (84.20%), Postives = 317/348 (91.09%), Query Frame = 1
Query:   25 AIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKK---GKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            AIGIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+NT+FDAKRLIGRKF+D  VQ DMK WPF+V++ G KPK+QVEYKGE K+FFPEEISSMVLTKMKE AE+YLGGKV  AV+TVPAYFND QRQATKDAG I GLNVLRIINEPTAAAIAYGLDKK   G EKN+LIFDLGGGTFDVS+L+IE+GIFEVK+TAGDTHLGGEDFDNRMV H  +EFKRK+KKDI  NK+AVRRLRTACERAKRTLSSS Q +IEIDSL EGVDFYT+ITRARFEELNADLFR TL+PVEKAL+DAK DK +I EIVLVGGS RIPKIQKLLQ
Sbjct:    7 AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGEMKTFFPEEISSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQ 354          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Mouse
Match: Hspa1l (heat shock protein 1-like [Source:MGI Symbol;Acc:MGI:96231])

HSP 1 Score: 607.06 bits (1564), Expect = 0.000e+0
Identity = 288/346 (83.24%), Postives = 321/346 (92.77%), Query Frame = 1
Query:   25 AIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKKGK-EKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            AIGIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGRKF+DPVVQ DMKLWPF+VIN   KPK+ V YKGE K+F+PEEISSMVLTKMKETAE++LG  VT+AV+TVPAYFND QRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDK    E+++LIFDLGGGTFDVS+L+I++GIFEVKATAGDTHLGGEDFDNR+V HF++EFKRK+KKDI+ NK+AVRRLRTACERAKRTLSSS Q N+EIDSL EG+DFYT+ITRARFEEL ADLFR TL+PVEK+L+DAK DK+KI++IVLVGGS RIPK+QKLLQ
Sbjct:    8 AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPQNTVFDAKRLIGRKFNDPVVQSDMKLWPFQVINEAGKPKVMVSYKGEKKAFYPEEISSMVLTKMKETAEAFLGHNVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGSHGERHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQANLEIDSLYEGIDFYTSITRARFEELCADLFRGTLEPVEKSLRDAKMDKAKIHDIVLVGGSTRIPKVQKLLQ 353          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Mouse
Match: Hspa1a (heat shock protein 1A [Source:MGI Symbol;Acc:MGI:96244])

HSP 1 Score: 605.134 bits (1559), Expect = 0.000e+0
Identity = 286/346 (82.66%), Postives = 322/346 (93.06%), Query Frame = 1
Query:   25 AIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKKGK-EKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            AIGIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA+NP NTVFDAKRLIGRKF D VVQ DMK WPF+V+N G KPK+QV YKGE++SFFPEEISSMVLTKMKE AE+YLG  VT+AV+TVPAYFND QRQATKDAGVIAGLNVLRIINEPTAAAIAYGLD+ GK E+N+LIFDLGGGTFDVS+L+I++GIFEVKATAGDTHLGGEDFDNR+V HF++EFKRK+KKDI+ NK+AVRRLRTACERAKRTLSSS Q ++EIDSL EG+DFYT+ITRARFEEL +DLFR TL+PVEKAL+DAK DK++I+++VLVGGS RIPK+QKLLQ
Sbjct:    6 AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDAVVQSDMKHWPFQVVNDGDKPKVQVNYKGESRSFFPEEISSMVLTKMKEIAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRGTLEPVEKALRDAKMDKAQIHDLVLVGGSTRIPKVQKLLQ 351          
BLAST of Heat shock cognate 70 kDa protein vs. UniProt/SwissProt
Match: sp|Q71U34|HSP7C_SAGOE (Heat shock cognate 71 kDa protein OS=Saguinus oedipus OX=9490 GN=HSPA8 PE=2 SV=1)

HSP 1 Score: 620.928 bits (1600), Expect = 0.000e+0
Identity = 298/351 (84.90%), Postives = 326/351 (92.88%), Query Frame = 1
Query:   13 MSK-KAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKK-GKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            MSK  A+GIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+NTVFDAKRLIGR+FDD VVQ DMK WPF V+N   +PK+QVEYKGETKSF+PEE+SSMVLTKMKE AE+YLG  VT+AVVTVPAYFND QRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK G E+N+LIFDLGGGTFDVS+L+IE+GIFEVK+TAGDTHLGGEDFDNRMV HFI EFKRK+KKDI++NK+AVRRLRTACERAKRTLSSS Q +IEIDSL EG+DFYT+ITRARFEELNADLFR TLDPVEKAL+DAK DKS+I++IVLVGGS RIPKIQKLLQ
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQ 351          
BLAST of Heat shock cognate 70 kDa protein vs. UniProt/SwissProt
Match: sp|P63018|HSP7C_RAT (Heat shock cognate 71 kDa protein OS=Rattus norvegicus OX=10116 GN=Hspa8 PE=1 SV=1)

HSP 1 Score: 620.928 bits (1600), Expect = 0.000e+0
Identity = 298/351 (84.90%), Postives = 326/351 (92.88%), Query Frame = 1
Query:   13 MSK-KAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKK-GKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            MSK  A+GIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+NTVFDAKRLIGR+FDD VVQ DMK WPF V+N   +PK+QVEYKGETKSF+PEE+SSMVLTKMKE AE+YLG  VT+AVVTVPAYFND QRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK G E+N+LIFDLGGGTFDVS+L+IE+GIFEVK+TAGDTHLGGEDFDNRMV HFI EFKRK+KKDI++NK+AVRRLRTACERAKRTLSSS Q +IEIDSL EG+DFYT+ITRARFEELNADLFR TLDPVEKAL+DAK DKS+I++IVLVGGS RIPKIQKLLQ
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQ 351          
BLAST of Heat shock cognate 70 kDa protein vs. UniProt/SwissProt
Match: sp|P63017|HSP7C_MOUSE (Heat shock cognate 71 kDa protein OS=Mus musculus OX=10090 GN=Hspa8 PE=1 SV=1)

HSP 1 Score: 620.928 bits (1600), Expect = 0.000e+0
Identity = 298/351 (84.90%), Postives = 326/351 (92.88%), Query Frame = 1
Query:   13 MSK-KAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKK-GKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            MSK  A+GIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+NTVFDAKRLIGR+FDD VVQ DMK WPF V+N   +PK+QVEYKGETKSF+PEE+SSMVLTKMKE AE+YLG  VT+AVVTVPAYFND QRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK G E+N+LIFDLGGGTFDVS+L+IE+GIFEVK+TAGDTHLGGEDFDNRMV HFI EFKRK+KKDI++NK+AVRRLRTACERAKRTLSSS Q +IEIDSL EG+DFYT+ITRARFEELNADLFR TLDPVEKAL+DAK DKS+I++IVLVGGS RIPKIQKLLQ
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQ 351          
BLAST of Heat shock cognate 70 kDa protein vs. UniProt/SwissProt
Match: sp|P11142|HSP7C_HUMAN (Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1)

HSP 1 Score: 620.928 bits (1600), Expect = 0.000e+0
Identity = 298/351 (84.90%), Postives = 326/351 (92.88%), Query Frame = 1
Query:   13 MSK-KAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKK-GKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            MSK  A+GIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+NTVFDAKRLIGR+FDD VVQ DMK WPF V+N   +PK+QVEYKGETKSF+PEE+SSMVLTKMKE AE+YLG  VT+AVVTVPAYFND QRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK G E+N+LIFDLGGGTFDVS+L+IE+GIFEVK+TAGDTHLGGEDFDNRMV HFI EFKRK+KKDI++NK+AVRRLRTACERAKRTLSSS Q +IEIDSL EG+DFYT+ITRARFEELNADLFR TLDPVEKAL+DAK DKS+I++IVLVGGS RIPKIQKLLQ
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQ 351          
BLAST of Heat shock cognate 70 kDa protein vs. UniProt/SwissProt
Match: sp|A2Q0Z1|HSP7C_HORSE (Heat shock cognate 71 kDa protein OS=Equus caballus OX=9796 GN=HSPA8 PE=2 SV=1)

HSP 1 Score: 620.928 bits (1600), Expect = 0.000e+0
Identity = 298/351 (84.90%), Postives = 326/351 (92.88%), Query Frame = 1
Query:   13 MSK-KAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKK-GKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            MSK  A+GIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+NTVFDAKRLIGR+FDD VVQ DMK WPF V+N   +PK+QVEYKGETKSF+PEE+SSMVLTKMKE AE+YLG  VT+AVVTVPAYFND QRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK G E+N+LIFDLGGGTFDVS+L+IE+GIFEVK+TAGDTHLGGEDFDNRMV HFI EFKRK+KKDI++NK+AVRRLRTACERAKRTLSSS Q +IEIDSL EG+DFYT+ITRARFEELNADLFR TLDPVEKAL+DAK DKS+I++IVLVGGS RIPKIQKLLQ
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQ 351          
BLAST of Heat shock cognate 70 kDa protein vs. TrEMBL
Match: A0A1I8I9V9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010745g1 PE=3 SV=1)

HSP 1 Score: 632.869 bits (1631), Expect = 0.000e+0
Identity = 306/351 (87.18%), Postives = 329/351 (93.73%), Query Frame = 1
Query:   13 MSK-KAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKK-GKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            MSK  AIGIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGD+AKNQVA+NPSNTVFDAKRLIGRKFDD VVQ+DMK WPF V+N GS+PKIQVE+KGETKSFF EEISSMVLTKMKETAE+YLG  VTDAVVTVPAYFND QRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK G E+N+LIFDLGGGTFDVS+L+IEEGIFEVK+TAGDTHLGGEDFDNRMV HFIQEFKRK KKD++DNK+AVRRLRTACERAKRTLSS+AQ NIEIDSL EG+DFYT+ITRARFEELNADLFR TL+PVEK+L+DAK DK+ INEIVLVGGS RIPKIQKLLQ
Sbjct:    1 MSKTPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDSAKNQVALNPSNTVFDAKRLIGRKFDDSVVQQDMKHWPFTVVNDGSRPKIQVEFKGETKSFFAEEISSMVLTKMKETAEAYLGKTVTDAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSGHERNVLIFDLGGGTFDVSILTIEEGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKYKKDMSDNKRAVRRLRTACERAKRTLSSAAQANIEIDSLYEGIDFYTSITRARFEELNADLFRGTLEPVEKSLRDAKLDKASINEIVLVGGSTRIPKIQKLLQ 351          
BLAST of Heat shock cognate 70 kDa protein vs. TrEMBL
Match: W0RZE3 (Heat shock 70 kDa protein 2 OS=Brachionus plicatilis OX=10195 GN=hsp70-2 PE=2 SV=1)

HSP 1 Score: 632.484 bits (1630), Expect = 0.000e+0
Identity = 306/351 (87.18%), Postives = 327/351 (93.16%), Query Frame = 1
Query:   13 MSK-KAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKK-GKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            MSK  A+GIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+NTVFDAKRLIGRKFDDP VQ DMK WPF VI+   +PKIQVE+KGETKSF+PEE+SSMVLTKMKETAE+YLG KVTDAVVTVPAYFND QRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK G EKNILIFDLGGGTFDVS+L+IEEGIFEVK+TAGDTHLGGEDFDNR+V HF++EFKRKNKKDIT NK+A+RRLRTACERAKRTLSSSAQ NIEIDSL EGVDFYT+ITRARFEEL ADLFR TLDPVEKAL+DAK DKS +NEIVLVGGS RIPK+QKLLQ
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDDPTVQADMKHWPFTVISDSGRPKIQVEFKGETKSFYPEEVSSMVLTKMKETAEAYLGKKVTDAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGGEKNILIFDLGGGTFDVSILTIEEGIFEVKSTAGDTHLGGEDFDNRLVNHFVEEFKRKNKKDITSNKRALRRLRTACERAKRTLSSSAQANIEIDSLHEGVDFYTSITRARFEELCADLFRGTLDPVEKALRDAKMDKSSVNEIVLVGGSTRIPKVQKLLQ 351          
BLAST of Heat shock cognate 70 kDa protein vs. TrEMBL
Match: A0A267H1F3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010745g2 PE=4 SV=1)

HSP 1 Score: 631.328 bits (1627), Expect = 0.000e+0
Identity = 305/351 (86.89%), Postives = 329/351 (93.73%), Query Frame = 1
Query:   13 MSKK-AIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKK-GKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            MSK  AIGIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGD+AKNQVA+NPSNTVFDAKRLIGRKFDD VVQ+DMK WPF V+N G++PKIQVE+KGETKSFF EEISSMVLTKMKETAE+YLG  VTDAVVTVPAYFND QRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK G E+N+LIFDLGGGTFDVS+L+IEEGIFEVK+TAGDTHLGGEDFDNRMV HFIQEFKRK KKD++DNK+AVRRLRTACERAKRTLSS+AQ NIEIDSL EG+DFYT+ITRARFEELNADLFR TL+PVEK+L+DAK DK+ INEIVLVGGS RIPKIQKLLQ
Sbjct:    1 MSKTPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDSAKNQVALNPSNTVFDAKRLIGRKFDDSVVQQDMKHWPFTVVNDGTRPKIQVEFKGETKSFFAEEISSMVLTKMKETAEAYLGKTVTDAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSGHERNVLIFDLGGGTFDVSILTIEEGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKYKKDMSDNKRAVRRLRTACERAKRTLSSAAQANIEIDSLYEGIDFYTSITRARFEELNADLFRGTLEPVEKSLRDAKLDKASINEIVLVGGSTRIPKIQKLLQ 351          
BLAST of Heat shock cognate 70 kDa protein vs. TrEMBL
Match: A0A1I8I882 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 631.328 bits (1627), Expect = 0.000e+0
Identity = 305/351 (86.89%), Postives = 329/351 (93.73%), Query Frame = 1
Query:   13 MSK-KAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKK-GKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            MSK  AIGIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGD+AKNQVA+NPSNTVFDAKRLIGRKFDD VVQ+DMK WPF V+N G++PKIQVE+KGETKSFF EEISSMVLTKMKETAE+YLG  VTDAVVTVPAYFND QRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK G E+N+LIFDLGGGTFDVS+L+IEEGIFEVK+TAGDTHLGGEDFDNRMV HFIQEFKRK KKD++DNK+AVRRLRTACERAKRTLSS+AQ NIEIDSL EG+DFYT+ITRARFEELNADLFR TL+PVEK+L+DAK DK+ INEIVLVGGS RIPKIQKLLQ
Sbjct:    1 MSKTPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDSAKNQVALNPSNTVFDAKRLIGRKFDDSVVQQDMKHWPFTVVNDGTRPKIQVEFKGETKSFFAEEISSMVLTKMKETAEAYLGKTVTDAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSGHERNVLIFDLGGGTFDVSILTIEEGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKYKKDMSDNKRAVRRLRTACERAKRTLSSAAQANIEIDSLYEGIDFYTSITRARFEELNADLFRGTLEPVEKSLRDAKLDKASINEIVLVGGSTRIPKIQKLLQ 351          
BLAST of Heat shock cognate 70 kDa protein vs. TrEMBL
Match: A0A267H178 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022022g3 PE=3 SV=1)

HSP 1 Score: 629.787 bits (1623), Expect = 0.000e+0
Identity = 303/346 (87.57%), Postives = 325/346 (93.93%), Query Frame = 1
Query:   25 AIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKK-GKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            AIGIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGD+AKNQVA+NPSNTVFDAKRLIGRKFDD VVQ+DMK WPF VIN  S+PKIQVEYKGETKSFF EEISSMVLTKMKETAE+YLG  VTDAVVTVPAYFND QRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK G E+N+LIFDLGGGTFDVS+L+IEEGIFEVK+TAGDTHLGGEDFDNRMV HFIQEFKRK KKD++DNK+AVRRLRTACERAKRTLSS+AQ NIEIDSL EG+DFYT+ITRARFEELNADLFR TL+PVEK+L+DAK DK+ I+EIVLVGGS RIPKIQKLLQ
Sbjct:    6 AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDSAKNQVALNPSNTVFDAKRLIGRKFDDSVVQQDMKHWPFTVINDASRPKIQVEYKGETKSFFAEEISSMVLTKMKETAEAYLGKTVTDAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKSGHERNVLIFDLGGGTFDVSILTIEEGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKYKKDMSDNKRAVRRLRTACERAKRTLSSAAQANIEIDSLYEGIDFYTSITRARFEELNADLFRGTLEPVEKSLRDAKLDKASISEIVLVGGSTRIPKIQKLLQ 351          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Cavefish
Match: hspa8b (heat shock cognate 70 kDa protein-like [Source:NCBI gene;Acc:103047344])

HSP 1 Score: 618.231 bits (1593), Expect = 0.000e+0
Identity = 298/351 (84.90%), Postives = 325/351 (92.59%), Query Frame = 1
Query:   13 MSK-KAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKK-GKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            MSK  A+GIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+NTVFDAKRLIGR+FDD VVQ DMK WPF VIN  ++PK+QVEYKGETK+F+PEEISSMVL KMKE AE+YLG  VT+AVVTVPAYFND QRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK G E+N+LIFDLGGGTFDVS+L+IE+GIFEVK+TAGDTHLGGEDFDNRMV HFI EFKRK KKDI+DNK+AVRRLRTACERAKRTLSSS Q +IEIDSL EGVDFYT+ITRARFEELNADLFR TLDPVEK+L+DAK DKS+I++IVLVGGS RIPKIQKLLQ
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFTVINDSTRPKVQVEYKGETKAFYPEEISSMVLVKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGSERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFISEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKSLRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQ 351          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Cavefish
Match: hspa8 (heat shock cognate 71 kDa protein [Source:NCBI gene;Acc:103043364])

HSP 1 Score: 614.764 bits (1584), Expect = 0.000e+0
Identity = 294/351 (83.76%), Postives = 325/351 (92.59%), Query Frame = 1
Query:   13 MSK-KAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKK-GKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            MSK  A+GIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+NT+FDAKRLIGR+FDD VVQ DMK WPF VIN  ++PK+QV+YKGE KSF+PEEISSMVL KMKE AE+YLG  VT+AV+TVPAYFND QRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK G E+N+LIFDLGGGTFDVS+L+IE+GIFEVK+TAGDTHLGGEDFDNRMV HFI EFKRK+KKDI+DNK+AVRRLRTACERAKRTLSSS Q +IEIDSL EGVDFYT+ITRARFEELNADLFR TLDPVEK+L+DAK DK++I++IVLVGGS RIPKIQKLLQ
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRRFDDGVVQSDMKHWPFTVINDSTRPKVQVDYKGEAKSFYPEEISSMVLVKMKEIAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGSERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFITEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKSLRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQ 351          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Cavefish
Match: hspa1b (heat shock protein family A (Hsp70) member 1B [Source:ZFIN;Acc:ZDB-GENE-060503-867])

HSP 1 Score: 612.838 bits (1579), Expect = 0.000e+0
Identity = 290/346 (83.82%), Postives = 326/346 (94.22%), Query Frame = 1
Query:   25 AIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDK-KGKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            +IGIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+NT+FDAKRLIGR+FDD VVQ DMKLWPFKVI+ G KPK++VEYKGE K+F+PEEISSMVL KM+E +E+YLG +VT+AV+TVPAYFND QRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDK K  E+N+LIFDLGGGTFDVS+L+IE+GIFEVKATAGDTHLGGEDFDNRMVQHF++EFKRK+KKDIT NK+AVRRLRTACERAKRTLSSS Q +IEIDSL +G+DFYT+ITRARFEELN++LFR TL+PVEKAL+DAK DKS+I++IVLVGGS RIPKIQKLLQ
Sbjct:    6 SIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTIFDAKRLIGRRFDDAVVQSDMKLWPFKVISDGGKPKVEVEYKGEVKTFYPEEISSMVLVKMREISEAYLGQRVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGKRGERNVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRMVQHFVEEFKRKHKKDITQNKRAVRRLRTACERAKRTLSSSTQASIEIDSLFDGIDFYTSITRARFEELNSELFRGTLEPVEKALRDAKMDKSQIHDIVLVGGSTRIPKIQKLLQ 351          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Cavefish
Match: ENSAMXT00000055474.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001455.1:150188:156169:-1 gene:ENSAMXG00000043809.1 transcript:ENSAMXT00000055474.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 612.068 bits (1577), Expect = 0.000e+0
Identity = 291/346 (84.10%), Postives = 325/346 (93.93%), Query Frame = 1
Query:   25 AIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDK-KGKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            AIGIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+NTVFDAKRLIGRKFDDPVVQ DMK WPF+V++ G KPK+QVE+KGE K+F+PEEISSMVL KMKE AE+YLG KVT+AV+TVPAYFND QRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDK K  E+++LIFDLGGGTFDVS+L+IE+GIFEVKATAGDTHLGGEDFDNR+V HF++EFKRK+KKDI+ NK+A+RRLRTACERAKRTLSSS+Q +IEIDSL EGVDFYT+ITRARFEE+ +DLFR TL+PVEKAL+DAK DKS+I+EIVLVGGS RIPKIQKLLQ
Sbjct:    8 AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDDPVVQSDMKHWPFQVVSDGGKPKVQVEHKGEQKTFYPEEISSMVLVKMKEIAEAYLGQKVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGKTGERHVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRALRRLRTACERAKRTLSSSSQASIEIDSLYEGVDFYTSITRARFEEMCSDLFRGTLEPVEKALRDAKMDKSQIHEIVLVGGSTRIPKIQKLLQ 353          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Cavefish
Match: ENSAMXT00000031477.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001455.1:148482:152871:-1 gene:ENSAMXG00000043809.1 transcript:ENSAMXT00000031477.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 612.068 bits (1577), Expect = 0.000e+0
Identity = 291/346 (84.10%), Postives = 325/346 (93.93%), Query Frame = 1
Query:   25 AIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDK-KGKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            AIGIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+NTVFDAKRLIGRKFDDPVVQ DMK WPF+V++ G KPK+QVE+KGE K+F+PEEISSMVL KMKE AE+YLG KVT+AV+TVPAYFND QRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDK K  E+++LIFDLGGGTFDVS+L+IE+GIFEVKATAGDTHLGGEDFDNR+V HF++EFKRK+KKDI+ NK+A+RRLRTACERAKRTLSSS+Q +IEIDSL EGVDFYT+ITRARFEE+ +DLFR TL+PVEKAL+DAK DKS+I+EIVLVGGS RIPKIQKLLQ
Sbjct:    8 AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDDPVVQSDMKHWPFQVVSDGGKPKVQVEHKGEQKTFYPEEISSMVLVKMKEIAEAYLGQKVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGKTGERHVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRALRRLRTACERAKRTLSSSSQASIEIDSLYEGVDFYTSITRARFEEMCSDLFRGTLEPVEKALRDAKMDKSQIHEIVLVGGSTRIPKIQKLLQ 353          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Sea Lamprey
Match: hspa5 (heat shock protein 5 [Source:NCBI gene;Acc:378848])

HSP 1 Score: 502.286 bits (1292), Expect = 9.054e-176
Identity = 244/346 (70.52%), Postives = 288/346 (83.24%), Query Frame = 1
Query:   28 IGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEY-KGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKKGKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            IGIDLGTTYSCV VF+NG+VEIIANDQGNR TPSYVAFT + ERLIGDAAKNQ+  NP NTVFDAKRLIGR + DP VQ D+K WPF V+    KP IQVE   GE+K+F PEEIS+MVLTKMKETAE+YLG KVT AVVTVPAYFND QRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK  EKNIL+FDLGGGTFDVS+L+I+ G+FEV AT GDTHLGGEDFD R+++HFI+ +K+K  KD+  + +AV++LR   E+AKRTLS+  Q  I+I+S  +G DF  T+TRA+FEELN DLFRST+ PV+K ++D+   K+ I+EIVLVGGS RIPKIQ+L++
Sbjct:   36 IGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTSNPENTVFDAKRLIGRSWTDPTVQHDIKFWPFTVLEKKGKPHIQVEVIAGESKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKEGEKNILVFDLGGGTFDVSLLTIDHGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDHRAVQKLRREVEKAKRTLSTQHQARIDIESFYDGDDFSETLTRAKFEELNMDLFRSTMKPVQKVMEDSDLKKTDIDEIVLVGGSTRIPKIQQLVK 381          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Sea Lamprey
Match: hspa9 (heat shock protein 9 [Source:ZFIN;Acc:ZDB-GENE-030828-12])

HSP 1 Score: 363.999 bits (933), Expect = 1.624e-121
Identity = 188/349 (53.87%), Postives = 252/349 (72.21%), Query Frame = 1
Query:   28 IGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKKGKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSL---SEGVDFYTT-ITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            IGIDLGTT SCVAV +  + +++ N +G RTTPS VAFT D ERL+G  AK Q   NP+NT +  KRLIGR+FDD  VQKDM    +K++ A S     VE  G  K + P +I + VL KMKETAE+++G  V +AV+TVPAYFND QRQATKDAG I+GLNVLR+INEPTAAA+AYGLD K  +K I ++DLGGGTFD+S+L I++G+FEVK+T GDT LGGEDFDN ++++ ++EFKR++  D+T +  A++R+R A E+AK  LSSS QT+I +  L   S G       +TR++FE +  DL R T+ P +KAL+D +  KS I +++LVGG  R+PK+Q+ +Q
Sbjct:   56 IGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGERLVGMPAKRQAVTNPNNTFYATKRLIGRRFDDSDVQKDMNNLSYKIVRA-SNGDAWVEAHG--KMYSPSQIGAFVLLKMKETAENFMGTSVKNAVITVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLD-KADDKVIAVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDNALLKYIVKEFKRESGVDLTKDSMALQRVREAAEKAKCELSSSLQTDINLPYLTMDSSGPKHLNMKLTRSQFENIVGDLIRKTIAPCQKALQDGEVAKSDIGDVILVGGMTRMPKVQQTVQ 400          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Sea Lamprey
Match: hspa14 (heat shock protein 14 [Source:NCBI gene;Acc:565232])

HSP 1 Score: 259.996 bits (663), Expect = 5.108e-83
Identity = 129/347 (37.18%), Postives = 205/347 (59.08%), Query Frame = 1
Query:   25 AIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKKGKEK--NILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            A+G+ LG+T +CVA++++G+ ++IAND G+R TP+ VAF D+E+++G AAK     N + TV   KR++G +F+D VVQK +      VI     P   +      K     E+++++L KMKETA   +G    DAV+T P  F   Q    + A   AG NVLRI++EP AA +A+G+ ++       +L++ LGG     + + +  G++ V  +  D  +GGE+F   + ++   EF++ +++D+  N +A+ +L T  E AK  LS+ A +N  +DSL +G+DF   ITRARF+ L + LF+ +L P+   L       S   ++VL GGS RIPK+Q+LLQ
Sbjct:    3 AVGVHLGSTCACVAIYKDGRADVIANDAGDRVTPAMVAFRDSEKIVGLAAKQGRIRNATTTVVGVKRILGHRFEDDVVQKYISSSSCPVIEKDGCPVFSINNGTVKKHITRHEVATLILQKMKETALFAVGADAKDAVITTPLNFTTQQVDELRQAAESAGFNVLRILSEPAAALLAFGIGQESSHSKCKVLVYKLGGTCAYATAIEVNSGLYRVLGSVSDDTVGGEEFTEALAEYLATEFQKFHRQDLRGNSRAMMKLHTNAEMAKHVLSTMAISNCFVDSLHDGLDFECNITRARFDSLCSVLFQQSLQPIHDLLAQINLTTSDFQKVVLCGGSARIPKLQQLLQ 349          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Sea Lamprey
Match: hspa13 (heat shock protein 70 family, member 13 [Source:ZFIN;Acc:ZDB-GENE-070410-58])

HSP 1 Score: 226.483 bits (576), Expect = 1.577e-70
Identity = 133/391 (34.02%), Postives = 212/391 (54.22%), Query Frame = 1
Query:   22 KAIGIDLGTTYSCVAVFQNG--KVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVIN-AGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKKGKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHF---------------------IQEFKRKNKKDITDNKKAVRRLRTA----------CERA------KRTLSSSAQTNI-----EIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLL 1056
            + +GIDLGTTY  + V+  G  +VE++A+  G R  PS VA  +D   L G  A  Q A NP  T++DAKR IGR F    ++++   + F V   +G    +   + G  ++  PE + + +L +++  AE  LG  V  AV+ VPA F++ QR +T  A  +AGL VLR++NEPTAAA+AYGL ++    ++L+ DLGGGT DVS+L+ + G+F  +A AG+ HLGG+DF  R+V+H                      ++E     K ++T N +A   LR +          C         +R L +    ++     ++      V+   T+TR  FE LN DLF+  ++P+ + L+  +    +++ +VLVGGS RIP+++++L
Sbjct:   32 RIVGIDLGTTYCSIGVYHAGVGEVEVLADADGRRAFPSVVAAGSDGRVLAGFPALQQAADNPHATLYDAKRFIGRAFSPGELEREAGRYQFTVRQVSGEVVFVLRGHGGAEQTVTPEWVGAQMLDQLRLLAEERLGLPVRYAVLAVPAEFDERQRNSTIKAATMAGLEVLRVVNEPTAAALAYGLHEEESVSSVLVVDLGGGTTDVSLLTKQGGMFFTRAMAGNNHLGGQDFTQRLVEHLTGRLADRHGGGRPWGRADTQLLREAAEMAKLELTHNDRARVSLRLSLVFMPDNRPCCVHQETTVYIRRPLCTGGNAHVLFFGLKLKGTHNTVEMDETVTRQEFESLNEDLFQKVMEPIVEVLRSGRLVAKQVDRVVLVGGSTRIPRVRRML 422          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003663.1 (pep scaffold:Pmarinus_7.0:GL498042:47:1690:1 gene:ENSPMAG00000003351.1 transcript:ENSPMAT00000003663.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.521 bits (114), Expect = 1.295e-6
Identity = 23/52 (44.23%), Postives = 34/52 (65.38%), Query Frame = 1
Query:  901 RARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLL 1056
            R  FE+ +A LF   + PV + LK A     ++++I L+GG IRIPKIQ++L
Sbjct:    1 REEFEDASAHLFDRAITPVYEVLKRANLSIDEVDQIELLGGGIRIPKIQEML 52          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Yeast
Match: SSA1 (ATPase involved in protein folding and NLS-directed nuclear transport; member of HSP70 family; required for ubiquitin-dependent degradation of short-lived proteins; forms chaperone complex with Ydj1p; localized to nucleus, cytoplasm, cell wall; 98% identical to paralog Ssa2p with different functional specificity in propagation of yeast [URE3] prions, vacuolar-mediated degradations of gluconeogenesis enzymes; general targeting factor of Hsp104p to prion fibrils [Source:SGD;Acc:S000000004])

HSP 1 Score: 604.749 bits (1558), Expect = 0.000e+0
Identity = 288/345 (83.48%), Postives = 321/345 (93.04%), Query Frame = 1
Query:   22 KAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKKGKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLL 1056
            KA+GIDLGTTYSCVA F N +V+IIANDQGNRTTPS+VAFTDTERLIGDAAKNQ AMNPSNTVFDAKRLIGR F+DP VQ DMK +PFK+I+   KP+IQVE+KGETK+F PE+ISSMVL KMKETAESYLG KV DAVVTVPAYFND QRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKKGKE+++LIFDLGGGTFDVS+LSIE+GIFEVKATAGDTHLGGEDFDNR+V HFIQEFKRKNKKD++ N++A+RRLRTACERAKRTLSSSAQT++EIDSL EG+DFYT+ITRARFEEL ADLFRSTLDPVEK L+DAK DKS+++EIVLVGGS RIPK+QKL+
Sbjct:    3 KAVGIDLGTTYSCVAHFANDRVDIIANDQGNRTTPSFVAFTDTERLIGDAAKNQAAMNPSNTVFDAKRLIGRNFNDPEVQADMKHFPFKLIDVDGKPQIQVEFKGETKNFTPEQISSMVLGKMKETAESYLGAKVNDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKGKEEHVLIFDLGGGTFDVSLLSIEDGIFEVKATAGDTHLGGEDFDNRLVNHFIQEFKRKNKKDLSTNQRALRRLRTACERAKRTLSSSAQTSVEIDSLFEGIDFYTSITRARFEELCADLFRSTLDPVEKVLRDAKLDKSQVDEIVLVGGSTRIPKVQKLV 347          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Yeast
Match: SSA2 (HSP70 family ATP-binding protein; involved in protein folding, vacuolar import of proteins; required for ubiquitin-dependent degradation of short-lived proteins; associated with chaperonin-containing T-complex; 98% identical to paralog Ssa1p with distinct functional specificity in propagation of yeast [URE3] prions and vacuolar-mediated degradation of gluconeogenesis enzymes; binds tRNA, has role in tRNA nuclear import during starvation [Source:SGD;Acc:S000003947])

HSP 1 Score: 601.668 bits (1550), Expect = 0.000e+0
Identity = 286/345 (82.90%), Postives = 320/345 (92.75%), Query Frame = 1
Query:   22 KAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKKGKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLL 1056
            KA+GIDLGTTYSCVA F N +V+IIANDQGNRTTPS+V FTDTERLIGDAAKNQ AMNP+NTVFDAKRLIGR F+DP VQ DMK +PFK+I+   KP+IQVE+KGETK+F PE+ISSMVL KMKETAESYLG KV DAVVTVPAYFND QRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKKGKE+++LIFDLGGGTFDVS+LSIE+GIFEVKATAGDTHLGGEDFDNR+V HFIQEFKRKNKKD++ N++A+RRLRTACERAKRTLSSSAQT++EIDSL EG+DFYT+ITRARFEEL ADLFRSTLDPVEK L+DAK DKS+++EIVLVGGS RIPK+QKL+
Sbjct:    3 KAVGIDLGTTYSCVAHFSNDRVDIIANDQGNRTTPSFVGFTDTERLIGDAAKNQAAMNPANTVFDAKRLIGRNFNDPEVQGDMKHFPFKLIDVDGKPQIQVEFKGETKNFTPEQISSMVLGKMKETAESYLGAKVNDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKGKEEHVLIFDLGGGTFDVSLLSIEDGIFEVKATAGDTHLGGEDFDNRLVNHFIQEFKRKNKKDLSTNQRALRRLRTACERAKRTLSSSAQTSVEIDSLFEGIDFYTSITRARFEELCADLFRSTLDPVEKVLRDAKLDKSQVDEIVLVGGSTRIPKVQKLV 347          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Yeast
Match: SSA4 (Heat shock protein that is highly induced upon stress; plays a role in SRP-dependent cotranslational protein-membrane targeting and translocation; member of the HSP70 family; cytoplasmic protein that concentrates in nuclei upon starvation; SSA4 has a paralog, SSA3, that arose from the whole genome duplication [Source:SGD;Acc:S000000905])

HSP 1 Score: 581.637 bits (1498), Expect = 0.000e+0
Identity = 282/346 (81.50%), Postives = 313/346 (90.46%), Query Frame = 1
Query:   22 KAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKKG-KEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLL 1056
            KA+GIDLGTTYSCVA F N +VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ AMNP NTVFDAKRLIGRKFDDP V  D K +PFKVI+ G KP +QVEYKGETK+F PEEISSM+LTKMKETAE++LG +V DAVVTVPAYFND QRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK  KE N+LIFDLGGGTFDVS+LSI+EG+FEVKATAGDTHLGGEDFD+R+V    +EFKRKNKKD+T N++++RRLRTA ERAKRTLSSSAQT+IEIDSL EG+DFYT+ITRARFEEL ADLFRSTL+PVEK L D+K DKS+I+EIVLVGGS RIPK+QKL+
Sbjct:    3 KAVGIDLGTTYSCVAHFANDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQAAMNPHNTVFDAKRLIGRKFDDPEVTNDAKHYPFKVIDKGGKPVVQVEYKGETKTFTPEEISSMILTKMKETAENFLGTEVKDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKSQKEHNVLIFDLGGGTFDVSLLSIDEGVFEVKATAGDTHLGGEDFDSRLVNFLAEEFKRKNKKDLTTNQRSLRRLRTAAERAKRTLSSSAQTSIEIDSLFEGIDFYTSITRARFEELCADLFRSTLEPVEKVLADSKLDKSQIDEIVLVGGSTRIPKVQKLV 348          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Yeast
Match: SSA3 (ATPase involved in protein folding and the response to stress; plays a role in SRP-dependent cotranslational protein-membrane targeting and translocation; member of the heat shock protein 70 (HSP70) family; localized to the cytoplasm; SSA3 has a paralog, SSA4, that arose from the whole genome duplication [Source:SGD;Acc:S000000171])

HSP 1 Score: 577.785 bits (1488), Expect = 0.000e+0
Identity = 279/346 (80.64%), Postives = 312/346 (90.17%), Query Frame = 1
Query:   22 KAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKKGK-EKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLL 1056
            +A+GIDLGTTYSCVA F N +VEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ A+NP NTVFDAKRLIGRKFDDP V  D K +PFKVI+   KP +QVEYKGETK+F PEEISSMVL+KMKETAE+YLG  V DAVVTVPAYFND QRQATKDAG IAG+NVLRIINEPTAAAIAYGLDKKG+ E N+LIFDLGGGTFDVS+LSI+EG+FEVKATAGDTHLGGEDFDNR+V H   EFKRK KKDI++N++++RRLRTA ERAKR LSSS+QT+IEIDSL EG+DFYT++TRARFEEL ADLFRSTL+PVEK LKD+K DKS+I+EIVLVGGS RIPKIQKL+
Sbjct:    3 RAVGIDLGTTYSCVAHFSNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQAAINPHNTVFDAKRLIGRKFDDPEVTTDAKHFPFKVISRDGKPVVQVEYKGETKTFTPEEISSMVLSKMKETAENYLGTTVNDAVVTVPAYFNDSQRQATKDAGTIAGMNVLRIINEPTAAAIAYGLDKKGRAEHNVLIFDLGGGTFDVSLLSIDEGVFEVKATAGDTHLGGEDFDNRLVNHLATEFKRKTKKDISNNQRSLRRLRTAAERAKRALSSSSQTSIEIDSLFEGMDFYTSLTRARFEELCADLFRSTLEPVEKVLKDSKLDKSQIDEIVLVGGSTRIPKIQKLV 348          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Yeast
Match: SSB2 (Cytoplasmic ATPase that is a ribosome-associated molecular chaperone; functions with J-protein partner Zuo1p; may be involved in the folding of newly-synthesized polypeptide chains; member of the HSP70 family; SSB2 has a paralog, SSB1, that arose from the whole genome duplication [Source:SGD;Acc:S000005153])

HSP 1 Score: 501.516 bits (1290), Expect = 2.611e-176
Identity = 242/346 (69.94%), Postives = 291/346 (84.10%), Query Frame = 1
Query:   25 AIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGL--DKKGKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLL 1056
            AIGIDLGTTYSCVA +++  VEIIAN+QGNR TPS+VAFT  ERLIGDAAKNQ A+NP NTVFDAKRLIGR+FDD  VQKDMK WPFKVI+    P I+V+Y  ETK+F P+EIS+MVLTKMKE AE+ +G KV  AV+TVPAYFND QRQATKDAG I+GLNVLRIINEPTAAAIAYGL   K  KE+++LIFDLGGGTFDVS+L I  G++ VK+T+G+THLGG+DFD  +++HF  EFK+K   DI+D+ +A+RRLRTA ERAKRTLSS  QT +E+DSL +G DF +++TRARFE+LNA LF+STL+PVE+ LKDAK  KS+I+E+VLVGGS RIPK+QKLL
Sbjct:    9 AIGIDLGTTYSCVATYESS-VEIIANEQGNRVTPSFVAFTPQERLIGDAAKNQAALNPRNTVFDAKRLIGRRFDDESVQKDMKTWPFKVIDVDGNPVIEVQYLEETKTFSPQEISAMVLTKMKEIAEAKIGKKVEKAVITVPAYFNDAQRQATKDAGAISGLNVLRIINEPTAAAIAYGLGAGKSEKERHVLIFDLGGGTFDVSLLHIAGGVYTVKSTSGNTHLGGQDFDTNLLEHFKAEFKKKTGLDISDDARALRRLRTAAERAKRTLSSVTQTTVEVDSLFDGEDFESSLTRARFEDLNAALFKSTLEPVEQVLKDAKISKSQIDEVVLVGGSTRIPKVQKLL 353          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Nematostella
Match: EDO37280 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG65])

HSP 1 Score: 593.578 bits (1529), Expect = 0.000e+0
Identity = 285/348 (81.90%), Postives = 317/348 (91.09%), Query Frame = 1
Query:   25 AIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKK-GKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFD--KSKINEIVLVGGSIRIPKIQKLLQ 1059
            A+GIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAF+DTERLIGDAAKNQVAMNP NTVFDAKRLIGRKFDDPVV +DM  WPF VI  G +PKIQVE+KGE KSFFPEEISSMVLTKMKETAE+YLG KVTDAVVTVPAYFND QRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK G E+N+LI+DLGGGTFDVSVL+IE+GIFEVK+TAGDTHLGGEDFDN+MV HF+++FK+K KKDIT NK+A+RRLRTACERAKRTLSSS Q +IEIDSL EG+DFYT+ITRARFEELN DLF+ T +PVE+A++D+K    K  I++IVLVGGS RIPKIQK+LQ
Sbjct:    6 AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFSDTERLIGDAAKNQVAMNPENTVFDAKRLIGRKFDDPVVARDMTHWPFHVIREGERPKIQVEFKGEKKSFFPEEISSMVLTKMKETAEAYLGAKVTDAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGVERNVLIYDLGGGTFDVSVLTIEDGIFEVKSTAGDTHLGGEDFDNKMVDHFVKQFKQKYKKDITPNKRAMRRLRTACERAKRTLSSSTQASIEIDSLFEGIDFYTSITRARFEELNQDLFKKTTEPVEQAIRDSKIPGGKESIHDIVLVGGSTRIPKIQKMLQ 353          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Nematostella
Match: EDO30323 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T144])

HSP 1 Score: 585.104 bits (1507), Expect = 0.000e+0
Identity = 280/347 (80.69%), Postives = 317/347 (91.35%), Query Frame = 1
Query:   25 AIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKK-GKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFD-KSKINEIVLVGGSIRIPKIQKLLQ 1059
            AIGIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTD ERL+GDAAKNQVAMNP+NT+FDAKRLIGR+FDDP V+ DMK W F+V+N   +PK++VEYKGETK+FF EEISSMVL KMKETAE+YLG KVTDAVVTVPAYFND QRQATKDAGVI+GLNVLRIINEPTAAAIAYGLDKK G+E+N+LIFDLGGGTFDVSVLSIE+GIFEVK+T GDTHLGGEDFDN MV  F+++FK+K KKDIT NK+A+RRLRTACERAKRTLSSS Q +IEIDSL +G+DFYT+ITRARFEE+NA LF+ TL+PVEKA+KD+K + K KI+EIV+VGGS RIPKIQ LLQ
Sbjct:    6 AIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDEERLVGDAAKNQVAMNPTNTIFDAKRLIGRRFDDPGVKDDMKHWSFEVVNEAGRPKVKVEYKGETKTFFAEEISSMVLNKMKETAEAYLGCKVTDAVVTVPAYFNDSQRQATKDAGVISGLNVLRIINEPTAAAIAYGLDKKVGQERNVLIFDLGGGTFDVSVLSIEDGIFEVKSTHGDTHLGGEDFDNNMVDFFVKQFKQKYKKDITPNKRALRRLRTACERAKRTLSSSTQASIEIDSLYDGIDFYTSITRARFEEMNAHLFKKTLEPVEKAIKDSKLESKEKIDEIVMVGGSTRIPKIQSLLQ 352          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Nematostella
Match: EDO44530 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV88])

HSP 1 Score: 570.852 bits (1470), Expect = 0.000e+0
Identity = 271/347 (78.10%), Postives = 309/347 (89.05%), Query Frame = 1
Query:   25 AIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKK-GKEKNILIFDLGGGTFDVSVLSIEEG-IFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            AIGIDLGTTYSCV VFQNGKVEIIANDQGNRTTPSYV FTDTERL+GDAAKNQVA+NP NT+FDAKRLIGR++DD  VQ DMKLWPFK+I+  +KPKIQVEYKGE K+F  EEISSMVL KMKETAE+YLG KVT AV+TVPAYFND QRQATKDAG IAGLNVLR+INEPTAAA+AYGLDK    EKN+LIFDLGGGTFDVS+L+I++G +FEVK+TAGDTHLGGEDFDNR+V HF+ EFKRK KKD++ N +A+RRLRTACERAKRTLSSS + +IE+DSL EG+DFYT I+RARFE+L +DLF S LDPV KAL DAKF KS I+E+VLVGGS R+PKIQK+L+
Sbjct:    6 AIGIDLGTTYSCVGVFQNGKVEIIANDQGNRTTPSYVGFTDTERLVGDAAKNQVALNPENTIFDAKRLIGRRYDDATVQSDMKLWPFKIISDNNKPKIQVEYKGERKTFAAEEISSMVLGKMKETAEAYLGQKVTSAVITVPAYFNDSQRQATKDAGTIAGLNVLRVINEPTAAALAYGLDKSLSGEKNVLIFDLGGGTFDVSILTIDDGSLFEVKSTAGDTHLGGEDFDNRLVNHFVAEFKRKYKKDMSKNSRAMRRLRTACERAKRTLSSSTEASIEVDSLFEGIDFYTKISRARFEDLCSDLFLSCLDPVNKALSDAKFSKSDIHEVVLVGGSTRVPKIQKMLE 352          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Nematostella
Match: EDO33296 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSL5])

HSP 1 Score: 481.485 bits (1238), Expect = 3.594e-167
Identity = 238/345 (68.99%), Postives = 284/345 (82.32%), Query Frame = 1
Query:   28 IGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKKGKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            IGIDLGTTYSCV VF+NG+VEIIANDQGNR TPSYVAFT+  ERLIGD AKNQ+  NP NTVFDAKRLIGR +DD  VQ D+K +PFKV++   KP +QV+ K E K+F  EEIS+MVLTKMKETAE+YLG KVT AVVTVPAYFND QRQATKDAG IAGL V+RIINEPTAAAIAYG+DKK  EKNIL+FDLGGGTFDVS+L+I+ G+FEV AT GDTHLGGEDFD  +++HFI+ +K+K  K+I  + +AV++LR   E+AKR LS+  Q  +EI+S  EG DF   +TRARFEELNA LF+STL PV+K L+DA   KS+I+EIVLVGGS RIPK+Q+L++
Sbjct:   36 IGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTEEGERLIGDGAKNQLTTNPENTVFDAKRLIGRSWDDTSVQNDLKFFPFKVVDKNKKPHVQVKVKDEIKTFAAEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGAIAGLTVMRIINEPTAAAIAYGMDKKEGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQNVMEHFIKLYKKKKGKNIRKDNRAVQKLRREVEKAKRALSTQHQARVEIESFFEGEDFSEMLTRARFEELNAKLFKSTLKPVQKVLEDADLKKSEIHEIVLVGGSTRIPKVQQLVK 380          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Nematostella
Match: EDO47723 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLN7])

HSP 1 Score: 356.295 bits (913), Expect = 1.556e-118
Identity = 184/350 (52.57%), Postives = 251/350 (71.71%), Query Frame = 1
Query:   31 GIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKKGKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVD------FYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            GIDLGTT SCVAV      ++I N +G+RTTPS VAFT + ERL+G  A+ Q   NP NT++  KR IGR+FD P ++KD+K   +K++ A S      E  G  K + P ++ + VL KMKETAESYLG  V +AVVTVPAYFND QRQATKDAG IAGLNVLR+INEPTAAA+AYG+DK  ++K I ++DLGGGTFD+S+L I++G+FEVKAT GDT+LGGEDFDN +++  I EFK+++  D++ +  A++RLR A E+AK  LSSS QT+I +  ++  VD          ++R++FE L ADL   T+ P +K L+DA+ +K +I +++LVGG  R+PK+Q+ +Q
Sbjct:   16 GIDLGTTNSCVAVMDGKTPKVIENAEGSRTTPSVVAFTPEGERLVGAPARRQAITNPQNTLYATKRYIGRRFDAPEIKKDLKNVSYKIVRA-SNGDAWFEVAG--KVYSPSQVGAFVLMKMKETAESYLGTNVNNAVVTVPAYFNDSQRQATKDAGQIAGLNVLRVINEPTAAALAYGMDKT-EDKIIAVYDLGGGTFDISILEIQKGVFEVKATNGDTYLGGEDFDNTLLKFLIAEFKKESGVDLSKDSMALQRLREAAEKAKIELSSSVQTDINLPYIT--VDASGPKHLNMKLSRSKFESLVADLINRTVGPCKKCLQDAEINKGEIGDVLLVGGMTRMPKVQQTVQ 359          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Medaka
Match: hsc70 (heat shock protein 70 cognate [Source:NCBI gene;Acc:100049425])

HSP 1 Score: 615.535 bits (1586), Expect = 0.000e+0
Identity = 297/352 (84.38%), Postives = 325/352 (92.33%), Query Frame = 1
Query:   10 TMSK-KAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKK-GKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            +MSK  A+GIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+NTVFDAKRLIGR+FDD VVQ DMK WPF VIN  ++PK+QVEYKGETKSF+PEEISSMVLTKMKE AE+YLG  V +AV+TVPAYFND QRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK G E+N+LIFDLGGGTFDVS+L+IE+GIFEVK+TAGDTHLGGEDFDNRMV HFI EFKRK KKDI+DNK+AVRRLRTACERAKRTLSSS Q +IEIDSL EGVDFYT+ITRARFEELNADLFR TLDPVEK+L+DAK DK +I++IVLVGGS RIPKIQKLLQ
Sbjct:   50 SMSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDHVVQSDMKHWPFNVINDNTRPKVQVEYKGETKSFYPEEISSMVLTKMKEIAEAYLGKTVNNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGSERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKSLRDAKMDKGQIHDIVLVGGSTRIPKIQKLLQ 401          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Medaka
Match: hsp70-3 (heat shock protein 70 [Source:NCBI gene;Acc:100125493])

HSP 1 Score: 615.15 bits (1585), Expect = 0.000e+0
Identity = 295/351 (84.05%), Postives = 325/351 (92.59%), Query Frame = 1
Query:   13 MSK-KAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKK-GKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            MSK  A+GIDLGTTYSCV +FQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+NTVFDAKRLIGRKFDD VVQ DMK WPFKV+N  SKPK++VEYKGE K+F+PEEISSMVLTKMKE +E+YLG  VT+AV+TVPAYFND QRQATKDAG IAGLNVLRIINEPTAAAIAYGLDKK G E+N+LIFDLGGGTFDVS+L+IE+GIFEVKATAGDTHLGGEDFDNRMV HFI EFKRK KK+IT+NK+AVRRLRTACERAKRTLSSS Q +IEIDSL EG DFYT+ITRARFEELNADLFR T++PVEKAL+DAK DKS+I+++VLVGGS RIPKIQKLLQ
Sbjct:    1 MSKGPAVGIDLGTTYSCVGIFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPANTVFDAKRLIGRKFDDAVVQSDMKHWPFKVVNDSSKPKVEVEYKGEIKTFYPEEISSMVLTKMKEISEAYLGKSVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGGERNVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRMVNHFITEFKRKFKKEITNNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGTDFYTSITRARFEELNADLFRGTIEPVEKALRDAKMDKSQIHDVVLVGGSTRIPKIQKLLQ 351          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Medaka
Match: hsc70 (heat shock protein 70 cognate [Source:NCBI gene;Acc:100049425])

HSP 1 Score: 614.764 bits (1584), Expect = 0.000e+0
Identity = 294/345 (85.22%), Postives = 320/345 (92.75%), Query Frame = 1
Query:   28 IGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKK-GKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            IGIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+NTVFDAKRLIGR+FDD VVQ DMK WPF VIN  ++PK+QVEYKGETKSF+PEEISSMVLTKMKE AE+YLG  V +AV+TVPAYFND QRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK G E+N+LIFDLGGGTFDVS+L+IE+GIFEVK+TAGDTHLGGEDFDNRMV HFI EFKRK KKDI+DNK+AVRRLRTACERAKRTLSSS Q +IEIDSL EGVDFYT+ITRARFEELNADLFR TLDPVEK+L+DAK DK +I++IVLVGGS RIPKIQKLLQ
Sbjct:    4 IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDHVVQSDMKHWPFNVINDNTRPKVQVEYKGETKSFYPEEISSMVLTKMKEIAEAYLGKTVNNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGSERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKSLRDAKMDKGQIHDIVLVGGSTRIPKIQKLLQ 348          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Medaka
Match: hsp70-5 (Oryzias latipes heat shock protein 70 (hsp70-5), mRNA. [Source:RefSeq mRNA;Acc:NM_001104914])

HSP 1 Score: 613.994 bits (1582), Expect = 0.000e+0
Identity = 291/346 (84.10%), Postives = 324/346 (93.64%), Query Frame = 1
Query:   25 AIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDK-KGKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            +IGIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTD ERLIGDAAKNQVAMNPSNTVFDAKRLIGR F+DP+VQ DMKLWPFKVIN   KPKIQV+YKGETK+F+PEEISSMVL KMKE AE+YLG +V++ V+TVPAYFND QRQATKDAGVIAGLNV+RIINEPTAAAIAYGLDK K  E+N+LIFDLGGGTFDVS+L+IE+GIFEVKAT+GDTHLGGEDFDNRMV HF++EFKRK+KKDI+ NK+AVRRLRTACERAKRTLSSS+Q +IEIDSL +G+DFYT+ITRARFEELN+DLFR TL+PVEKAL+DAK DKSKI+EIVLVGGS RIPKIQKLLQ
Sbjct:    6 SIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDAERLIGDAAKNQVAMNPSNTVFDAKRLIGRNFNDPIVQSDMKLWPFKVINDNGKPKIQVDYKGETKAFYPEEISSMVLVKMKEIAEAYLGQRVSNVVITVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKGKRGEQNVLIFDLGGGTFDVSILTIEDGIFEVKATSGDTHLGGEDFDNRMVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSSQASIEIDSLFDGIDFYTSITRARFEELNSDLFRGTLEPVEKALRDAKLDKSKIHEIVLVGGSTRIPKIQKLLQ 351          
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Medaka
Match: hspa8b (heat shock cognate 70 kDa protein [Source:NCBI gene;Acc:100125490])

HSP 1 Score: 613.994 bits (1582), Expect = 0.000e+0
Identity = 296/351 (84.33%), Postives = 325/351 (92.59%), Query Frame = 1
Query:   13 MSK-KAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKK-GKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            MSK  A+GIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA+NP+NTVFDAKRLIGR+FDD VVQ DMK WPF VIN  ++PK++VEYKGETK+F+PEEISSMVL KMKE AE+YLG  VT+AVVTVPAYFND QRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK G E+N+LIFDLGGGTFDVS+L+IE+GIFEVK+TAGDTHLGGEDFDNRMV HFI EFKRK KKDI+DNK+AVRRLRTACERAKRTLSSS Q +IEIDSL EGVDFYT+ITRARFEELNADLFR TLDPVEKAL+DAK DK++I++IVLVGGS RIPKIQKLLQ
Sbjct:    1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPNNTVFDAKRLIGRRFDDSVVQSDMKHWPFTVINDNTRPKVKVEYKGETKTFYPEEISSMVLVKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFISEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLDPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQ 351          
BLAST of Heat shock cognate 70 kDa protein vs. Planmine SMEST
Match: SMESG000081110.1 (SMESG000081110.1)

HSP 1 Score: 710.679 bits (1833), Expect = 0.000e+0
Identity = 349/349 (100.00%), Postives = 349/349 (100.00%), Query Frame = 1
Query:   13 MSKKAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKKGKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            MSKKAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKKGKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ
Sbjct:    1 MSKKAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKKGKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 349          
BLAST of Heat shock cognate 70 kDa protein vs. Planmine SMEST
Match: SMESG000051570.1 (SMESG000051570.1)

HSP 1 Score: 615.92 bits (1587), Expect = 0.000e+0
Identity = 297/350 (84.86%), Postives = 323/350 (92.29%), Query Frame = 1
Query:   13 MSKKAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKK-GKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            MS  AIGIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+NTVFDAKRLIGRKFD+  VQ DMK W F VIN   +PKI+VE+KGETK+FFPEEISSMVL KMKE AE+YLG  V DAVVTVPAYFND QRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK G E+N+LIFDLGGGTFDVS+L+IE+GIFEVK+TAGDTHLGGEDFDNRMV HFIQEFKRK+KKDI+DNK+AVRRLRTACERAKRTLSSSAQ N+EIDSL EG+DFYT+ITRARFEELNADLFRSTL+PVEKAL+DAK DK+ I++IVLVGGS RIPKIQKLLQ
Sbjct:    1 MSGNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQ 350          
BLAST of Heat shock cognate 70 kDa protein vs. Planmine SMEST
Match: SMESG000051567.1 (SMESG000051567.1)

HSP 1 Score: 615.92 bits (1587), Expect = 0.000e+0
Identity = 297/350 (84.86%), Postives = 323/350 (92.29%), Query Frame = 1
Query:   13 MSKKAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKK-GKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            MS  AIGIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+NTVFDAKRLIGRKFD+  VQ DMK W F VIN   +PKI+VE+KGETK+FFPEEISSMVL KMKE AE+YLG  V DAVVTVPAYFND QRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK G E+N+LIFDLGGGTFDVS+L+IE+GIFEVK+TAGDTHLGGEDFDNRMV HFIQEFKRK+KKDI+DNK+AVRRLRTACERAKRTLSSSAQ N+EIDSL EG+DFYT+ITRARFEELNADLFRSTL+PVEKAL+DAK DK+ I++IVLVGGS RIPKIQKLLQ
Sbjct:    1 MSGNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQ 350          
BLAST of Heat shock cognate 70 kDa protein vs. Planmine SMEST
Match: SMESG000051541.1 (SMESG000051541.1)

HSP 1 Score: 615.92 bits (1587), Expect = 0.000e+0
Identity = 297/350 (84.86%), Postives = 323/350 (92.29%), Query Frame = 1
Query:   13 MSKKAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKK-GKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            MS  AIGIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+NTVFDAKRLIGRKFD+  VQ DMK W F VIN   +PKI+VE+KGETK+FFPEEISSMVL KMKE AE+YLG  V DAVVTVPAYFND QRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK G E+N+LIFDLGGGTFDVS+L+IE+GIFEVK+TAGDTHLGGEDFDNRMV HFIQEFKRK+KKDI+DNK+AVRRLRTACERAKRTLSSSAQ N+EIDSL EG+DFYT+ITRARFEELNADLFRSTL+PVEKAL+DAK DK+ I++IVLVGGS RIPKIQKLLQ
Sbjct:    1 MSGNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQ 350          
BLAST of Heat shock cognate 70 kDa protein vs. Planmine SMEST
Match: SMESG000051540.1 (SMESG000051540.1)

HSP 1 Score: 615.92 bits (1587), Expect = 0.000e+0
Identity = 297/350 (84.86%), Postives = 323/350 (92.29%), Query Frame = 1
Query:   13 MSKKAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKPKIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFNDGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKK-GKEKNILIFDLGGGTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKDITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARFEELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ 1059
            MS  AIGIDLGTTYSCV VFQ+GKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP+NTVFDAKRLIGRKFD+  VQ DMK W F VIN   +PKI+VE+KGETK+FFPEEISSMVL KMKE AE+YLG  V DAVVTVPAYFND QRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK G E+N+LIFDLGGGTFDVS+L+IE+GIFEVK+TAGDTHLGGEDFDNRMV HFIQEFKRK+KKDI+DNK+AVRRLRTACERAKRTLSSSAQ N+EIDSL EG+DFYT+ITRARFEELNADLFRSTL+PVEKAL+DAK DK+ I++IVLVGGS RIPKIQKLLQ
Sbjct:    1 MSGNAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLIGRKFDESSVQSDMKHWSFDVINETGRPKIRVEFKGETKTFFPEEISSMVLIKMKEIAEAYLGKTVKDAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIQEFKRKHKKDISDNKRAVRRLRTACERAKRTLSSSAQANLEIDSLYEGIDFYTSITRARFEELNADLFRSTLEPVEKALRDAKLDKNTIHDIVLVGGSTRIPKIQKLLQ 350          
The following BLAST results are available for this feature:
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HSPA80.000e+084.90heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA80.000e+084.90heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA80.000e+084.90heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA80.000e+084.90heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA20.000e+084.48heat shock protein family A (Hsp70) member 2 [Sour... [more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hsp-10.000e+082.91Heat shock 70 kDa protein A [Source:UniProtKB/Swi... [more]
hsp-10.000e+082.91Heat shock 70 kDa protein A [Source:UniProtKB/Swi... [more]
F44E5.50.000e+075.14pep chromosome:WBcel235:II:11759681:11761808:1 gen... [more]
F44E5.50.000e+075.14pep chromosome:WBcel235:II:11759640:11761853:1 gen... [more]
F44E5.40.000e+075.14pep chromosome:WBcel235:II:11757106:11759323:-1 ge... [more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hsc70-40.000e+082.62gene:FBgn0266599 transcript:FBtr0083059[more]
Hsc70-40.000e+082.62gene:FBgn0266599 transcript:FBtr0337053[more]
Hsc70-40.000e+082.62gene:FBgn0266599 transcript:FBtr0083058[more]
Hsc70-40.000e+082.62gene:FBgn0266599 transcript:FBtr0083060[more]
Hsc70-40.000e+082.62gene:FBgn0266599 transcript:FBtr0083057[more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspa80.000e+084.66heat shock protein 8 [Source:NCBI gene;Acc:573376][more]
hspa80.000e+084.62heat shock protein 8 [Source:NCBI gene;Acc:573376][more]
hspa80.000e+084.62heat shock protein 8 [Source:NCBI gene;Acc:573376][more]
hspa80.000e+084.62heat shock protein 8 [Source:NCBI gene;Acc:573376][more]
hspa80.000e+084.62heat shock protein 8 [Source:NCBI gene;Acc:573376][more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr260.000e+083.81WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-99... [more]
wdr260.000e+083.81WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-99... [more]
ENSXETT00000025573.10.000e+084.97heat shock protein family A (Hsp70) member 1B [Sou... [more]
wdr260.000e+083.76WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-99... [more]
wdr260.000e+083.67WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-99... [more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hspa80.000e+084.90heat shock protein 8 [Source:MGI Symbol;Acc:MGI:10... [more]
Hspa20.000e+084.20heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96... [more]
Hspa20.000e+084.20heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96... [more]
Hspa1l0.000e+083.24heat shock protein 1-like [Source:MGI Symbol;Acc:M... [more]
Hspa1a0.000e+082.66heat shock protein 1A [Source:MGI Symbol;Acc:MGI:9... [more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q71U34|HSP7C_SAGOE0.000e+084.90Heat shock cognate 71 kDa protein OS=Saguinus oedi... [more]
sp|P63018|HSP7C_RAT0.000e+084.90Heat shock cognate 71 kDa protein OS=Rattus norveg... [more]
sp|P63017|HSP7C_MOUSE0.000e+084.90Heat shock cognate 71 kDa protein OS=Mus musculus ... [more]
sp|P11142|HSP7C_HUMAN0.000e+084.90Heat shock cognate 71 kDa protein OS=Homo sapiens ... [more]
sp|A2Q0Z1|HSP7C_HORSE0.000e+084.90Heat shock cognate 71 kDa protein OS=Equus caballu... [more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8I9V90.000e+087.18Uncharacterized protein OS=Macrostomum lignano OX=... [more]
W0RZE30.000e+087.18Heat shock 70 kDa protein 2 OS=Brachionus plicatil... [more]
A0A267H1F30.000e+086.89Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8I8820.000e+086.89Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267H1780.000e+087.57Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspa8b0.000e+084.90heat shock cognate 70 kDa protein-like [Source:NCB... [more]
hspa80.000e+083.76heat shock cognate 71 kDa protein [Source:NCBI gen... [more]
hspa1b0.000e+083.82heat shock protein family A (Hsp70) member 1B [Sou... [more]
ENSAMXT00000055474.10.000e+084.10pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000031477.10.000e+084.10pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspa59.054e-17670.52heat shock protein 5 [Source:NCBI gene;Acc:378848][more]
hspa91.624e-12153.87heat shock protein 9 [Source:ZFIN;Acc:ZDB-GENE-030... [more]
hspa145.108e-8337.18heat shock protein 14 [Source:NCBI gene;Acc:565232... [more]
hspa131.577e-7034.02heat shock protein 70 family, member 13 [Source:ZF... [more]
ENSPMAT00000003663.11.295e-644.23pep scaffold:Pmarinus_7.0:GL498042:47:1690:1 gene:... [more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SSA10.000e+083.48ATPase involved in protein folding and NLS-directe... [more]
SSA20.000e+082.90HSP70 family ATP-binding protein; involved in prot... [more]
SSA40.000e+081.50Heat shock protein that is highly induced upon str... [more]
SSA30.000e+080.64ATPase involved in protein folding and the respons... [more]
SSB22.611e-17669.94Cytoplasmic ATPase that is a ribosome-associated m... [more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO372800.000e+081.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303230.000e+080.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO445300.000e+078.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332963.594e-16768.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477231.556e-11852.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hsc700.000e+084.38heat shock protein 70 cognate [Source:NCBI gene;Ac... [more]
hsp70-30.000e+084.05heat shock protein 70 [Source:NCBI gene;Acc:100125... [more]
hsc700.000e+085.22heat shock protein 70 cognate [Source:NCBI gene;Ac... [more]
hsp70-50.000e+084.10Oryzias latipes heat shock protein 70 (hsp70-5), m... [more]
hspa8b0.000e+084.33heat shock cognate 70 kDa protein [Source:NCBI gen... [more]
back to top
BLAST of Heat shock cognate 70 kDa protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081110.10.000e+0100.00SMESG000081110.1[more]
SMESG000051570.10.000e+084.86SMESG000051570.1[more]
SMESG000051567.10.000e+084.86SMESG000051567.1[more]
SMESG000051541.10.000e+084.86SMESG000051541.1[more]
SMESG000051540.10.000e+084.86SMESG000051540.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005131 ID=SMED30005131|Name=Heat shock cognate 70 kDa protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1059bp
GCTTGATTTACGATGTCCAAGAAAGCAATAGGAATAGATCTCGGCACAAC
TTATTCTTGCGTCGCAGTATTTCAAAACGGAAAAGTGGAGATCATTGCCA
ACGATCAAGGAAATCGGACGACTCCCAGTTATGTAGCTTTCACAGACACC
GAAAGATTGATTGGCGATGCTGCTAAAAATCAAGTGGCAATGAATCCGTC
TAACACCGTATTTGATGCTAAAAGATTGATCGGCAGAAAATTTGATGATC
CCGTGGTGCAAAAAGATATGAAATTGTGGCCATTCAAAGTTATTAATGCT
GGATCTAAACCAAAAATTCAAGTAGAATATAAAGGGGAAACAAAATCATT
TTTTCCTGAAGAAATTTCGTCAATGGTTTTAACAAAAATGAAAGAGACGG
CTGAATCATATTTAGGAGGTAAAGTGACCGATGCTGTTGTAACCGTTCCT
GCTTATTTCAATGATGGTCAAAGACAAGCAACAAAAGATGCCGGTGTAAT
TGCTGGATTAAATGTATTGCGGATCATAAATGAACCAACAGCTGCCGCTA
TTGCTTATGGATTAGATAAAAAAGGCAAAGAAAAAAATATTTTAATTTTT
GATCTTGGAGGAGGAACATTTGATGTCTCAGTTCTATCTATTGAGGAAGG
CATATTTGAAGTGAAAGCTACAGCTGGGGATACACATTTAGGTGGAGAAG
ATTTTGATAACAGAATGGTTCAACATTTTATTCAAGAATTCAAAAGAAAA
AACAAAAAGGATATCACTGACAACAAAAAGGCCGTACGTCGTTTAAGAAC
TGCATGTGAAAGAGCTAAAAGAACTCTAAGCTCAAGTGCTCAAACAAATA
TTGAAATTGACTCTTTAAGTGAAGGGGTCGATTTTTATACAACAATAACC
AGAGCAAGATTCGAAGAATTAAATGCTGATCTATTTCGATCGACGTTGGA
TCCAGTGGAAAAAGCTCTAAAAGATGCAAAATTTGACAAATCAAAAATAA
ACGAAATCGTTTTAGTTGGAGGCTCAATAAGAATTCCTAAAATTCAGAAA
TTATTACAA
back to top

protein sequence of SMED30005131-orf-1

>SMED30005131-orf-1 ID=SMED30005131-orf-1|Name=SMED30005131-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=349bp
MSKKAIGIDLGTTYSCVAVFQNGKVEIIANDQGNRTTPSYVAFTDTERLI
GDAAKNQVAMNPSNTVFDAKRLIGRKFDDPVVQKDMKLWPFKVINAGSKP
KIQVEYKGETKSFFPEEISSMVLTKMKETAESYLGGKVTDAVVTVPAYFN
DGQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKKGKEKNILIFDLGG
GTFDVSVLSIEEGIFEVKATAGDTHLGGEDFDNRMVQHFIQEFKRKNKKD
ITDNKKAVRRLRTACERAKRTLSSSAQTNIEIDSLSEGVDFYTTITRARF
EELNADLFRSTLDPVEKALKDAKFDKSKINEIVLVGGSIRIPKIQKLLQ
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0003304testis primordium
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0016020membrane
GO:0002199zona pellucida receptor complex
GO:0005829cytosol
GO:0008180COP9 signalosome
GO:0044297cell body
GO:0072562blood microparticle
Vocabulary: biological process
TermDefinition
GO:0009408response to heat
GO:0046686response to cadmium ion
GO:0046688response to copper ion
GO:1903842response to arsenite ion
GO:0007339binding of sperm to zona pellucida
GO:0042026protein refolding
GO:1903955positive regulation of protein targeting to mitochondrion
Vocabulary: INTERPRO
TermDefinition
IPR043129ATPase_NBD
IPR013126Hsp_70_fam
IPR018181Heat_shock_70_CS
IPR019651Glutamate_DH_NAD-spec
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0005524ATP binding
GO:0031072heat shock protein binding
GO:0031625ubiquitin protein ligase binding
GO:0051082unfolded protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00301HEATSHOCK70coord: 54..62
score: 76.1
coord: 32..44
score: 85.18
coord: 4..17
score: 84.89
coord: 141..161
score: 90.24
coord: 329..345
score: 69.82
coord: 201..211
score: 73.52
NoneNo IPR availableGENE3DG3DSA:3.30.30.30coord: 67..113
e-value: 1.6E-165
score: 552.2
NoneNo IPR availableGENE3DG3DSA:3.90.640.10coord: 227..304
e-value: 1.6E-165
score: 552.2
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 6..186
e-value: 1.6E-165
score: 552.2
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 187..349
e-value: 1.6E-165
score: 552.2
NoneNo IPR availablePANTHERPTHR19375:SF310coord: 4..349
NoneNo IPR availableCDDcd10233HSPA1-2_6-8-like_NBDcoord: 5..349
e-value: 0.0
score: 774.208
IPR013126Heat shock protein 70 familyPFAMPF00012HSP70coord: 5..348
e-value: 1.5E-166
score: 555.2
IPR013126Heat shock protein 70 familyPANTHERPTHR19375HEAT SHOCK PROTEIN 70KDAcoord: 4..349
IPR018181Heat shock protein 70, conserved sitePROSITEPS00329HSP70_2coord: 195..208
IPR018181Heat shock protein 70, conserved sitePROSITEPS00297HSP70_1coord: 8..15
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 4..186
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 189..349