Voltage-dependent L-type calcium channel subunit alpha

NameVoltage-dependent L-type calcium channel subunit alpha
Smed IDSMED30005127
Length (bp)9129
Neoblast Clusters

Zeng et. al., 2018

▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population





Single cell RNA-seq of pluripotent neoblasts and its early progenies

We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)

Explore this single cell expression dataset with our NB Cluster Shiny App


Neoblast Population


t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.

Expression of Voltage-dependent L-type calcium channel subunit alpha (SMED30005127) t-SNE clustered cells

Violin plots show distribution of expression levels for Voltage-dependent L-type calcium channel subunit alpha (SMED30005127) in cells (dots) of each of the 12 neoblast clusters.


back to top


Sub-lethal Irradiated Surviving X1 and X2 Cell Population


t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Voltage-dependent L-type calcium channel subunit alpha (SMED30005127) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Voltage-dependent L-type calcium channel subunit alpha (SMED30005127) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.


back to top


Embryonic Expression

Davies et. al., 2017

Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods


back to top
Anatomical Expression

PAGE et. al., 2020


has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE

PAGE Curations: 17

Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30005127h1SMcG0000076 SmedASXL_032259SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30005127h1SMcG0000076 Contig45524uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005127h1SMcG0000076 Contig45524newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005127h1SMcG0000076 Contig43570newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005127h1SMcG0000076 Contig43570uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30005127h1SMcG0000076 dd_Smed_v4_8899_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005127h1SMcG0000076 dd_Smed_v4_8899_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30005127h1SMcG0000076 dd_Smed_v4_8899_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30005127h1SMcG0000076 dd_Smed_v4_8899_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30005127h1SMcG0000076 dd_Smed_v4_8899_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30005127h1SMcG0000076 dd_Smed_v4_8899_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30005127h1SMcG0000076 dd_Smed_v4_8899_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30005127h1SMcG0000076 dd_Smed_v4_8899_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005127h1SMcG0000076 dd_Smed_v4_8899_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005127h1SMcG0000076 Contig35674uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005127h1SMcG0000076 Contig35674newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
zeta neoblastSMED30005127h1SMcG0000076 dd_Smed_v4_8899_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Human
Match: CACNA1S (calcium voltage-gated channel subunit alpha1 S [Source:HGNC Symbol;Acc:HGNC:1397])

HSP 1 Score: 1634 bits (4230), Expect = 0.000e+0
Identity = 930/1751 (53.11%), Postives = 1172/1751 (66.93%), Query Frame = 1
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Human
Match: CACNA1S (calcium voltage-gated channel subunit alpha1 S [Source:HGNC Symbol;Acc:HGNC:1397])

HSP 1 Score: 1624.37 bits (4205), Expect = 0.000e+0
Identity = 930/1766 (52.66%), Postives = 1171/1766 (66.31%), Query Frame = 1
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Human
Match: CACNA1D (calcium voltage-gated channel subunit alpha1 D [Source:HGNC Symbol;Acc:HGNC:1391])

HSP 1 Score: 975.696 bits (2521), Expect = 0.000e+0
Identity = 542/902 (60.09%), Postives = 658/902 (72.95%), Query Frame = 1

HSP 2 Score: 713.375 bits (1840), Expect = 0.000e+0
Identity = 400/693 (57.72%), Postives = 496/693 (71.57%), Query Frame = 1

HSP 3 Score: 122.865 bits (307), Expect = 8.423e-27
Identity = 112/372 (30.11%), Postives = 168/372 (45.16%), Query Frame = 1
            RP  ++ L +  +IA               P P+  A F L+  NP R  C K++    F  LIL  I  +  ALAA  P   R  +  N+ L   +  F  IFT E +LK+  FG  +H GA+ RN +NLLD L+V + L+S      S     VK LR  RVLRPLR ++    L+ V+  +  A+  + +I ++   +  ++A IG++LF GK     Y   D    +P  C                G   + KD   ++       W   +    +FDN   AM+ +F   T EGW  ++Y   DS G +   IY         F+  III +FF+MN+ +G +   F ++ EK  K  +  K + Q

HSP 4 Score: 91.2781 bits (225), Expect = 3.776e-17
Identity = 57/203 (28.08%), Postives = 106/203 (52.22%), Query Frame = 1
            + S  F +++ VL+ LNT++++ +   QP    Q+ D  N V   +FT E L+K+ + G + YF   +N FD  +V G   + I   +   +        + I+ FR  R++R+ K+      +  L+ + + S +++  + LL+ +   I++++GMQ+FG     +E + K     + F  FPQA+L +F+  TGE W  +M

HSP 5 Score: 87.8113 bits (216), Expect = 3.468e-16
Identity = 55/178 (30.90%), Postives = 92/178 (51.69%), Query Frame = 1
            +NP++     +V   PFEY++   I  N   LA         S   N A++ + +VF  +FT E VLK++AF     P  Y  + WN  D LIVI  +I   LS+           +   R FRV+R ++L+S    ++ ++ + +++   L ++ALL   +  IYA+IG+++F GK+

HSP 6 Score: 85.8853 bits (211), Expect = 1.573e-15
Identity = 79/286 (27.62%), Postives = 128/286 (44.76%), Query Frame = 1
            A + F    NN  R+ C  I     F   +L+ I  +   LA   P   D  +S N  L   +Y F  +FTVE  LK+I YGL+ H  A+ R+  N+LD ++V+  + S  +           ++   S    ++ LR  R LR +    G+  +   +   +K++  ++ +  L+ F   ++A+IG++LF GK      F   + V++     C     G+    N  +    +V     I    NFDN   AMLT+F   T EGW  VLY   D+   ++  +Y

HSP 7 Score: 85.5001 bits (210), Expect = 1.769e-15
Identity = 59/249 (23.69%), Postives = 112/249 (44.98%), Query Frame = 1
            ++  +PF+  I + I  N ++LA+     +         ++ +   F  +FTVE  LK+ A+G       Y  + WN+ DF+IV+     +I + +     G N++        +   R FRV+R ++L+S    ++ +L + +K+   L ++ALL++ +  IYA+IG+++F                             G+  T N  E +   +  N    NF  F  A+L +F+  T E W +++

HSP 8 Score: 85.1149 bits (209), Expect = 2.393e-15
Identity = 67/252 (26.59%), Postives = 138/252 (54.76%), Query Frame = 1
            +V S  F +++ VL+ LNT  L  +HY QS   +   +  N++F  +FT+EM++K+ +   + YF   +N FD  +VI SI+++ + + D       + ++  R  R++R+ K+      +R L+ + + S +++  + +L+ +   I++++GMQ+FG     D  +    +NF +F Q++L +F+  TGE W E+M   +        S  N G+     S  + +Y++  ++   ++++N+F+A+ +DN 
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Human
Match: CACNA1D (calcium voltage-gated channel subunit alpha1 D [Source:HGNC Symbol;Acc:HGNC:1391])

HSP 1 Score: 975.696 bits (2521), Expect = 0.000e+0
Identity = 542/902 (60.09%), Postives = 658/902 (72.95%), Query Frame = 1

HSP 2 Score: 713.375 bits (1840), Expect = 0.000e+0
Identity = 400/693 (57.72%), Postives = 496/693 (71.57%), Query Frame = 1

HSP 3 Score: 122.865 bits (307), Expect = 8.892e-27
Identity = 112/372 (30.11%), Postives = 168/372 (45.16%), Query Frame = 1
            RP  ++ L +  +IA               P P+  A F L+  NP R  C K++    F  LIL  I  +  ALAA  P   R  +  N+ L   +  F  IFT E +LK+  FG  +H GA+ RN +NLLD L+V + L+S      S     VK LR  RVLRPLR ++    L+ V+  +  A+  + +I ++   +  ++A IG++LF GK     Y   D    +P  C                G   + KD   ++       W   +    +FDN   AM+ +F   T EGW  ++Y   DS G +   IY         F+  III +FF+MN+ +G +   F ++ EK  K  +  K + Q

HSP 4 Score: 90.8929 bits (224), Expect = 4.222e-17
Identity = 57/203 (28.08%), Postives = 106/203 (52.22%), Query Frame = 1
            + S  F +++ VL+ LNT++++ +   QP    Q+ D  N V   +FT E L+K+ + G + YF   +N FD  +V G   + I   +   +        + I+ FR  R++R+ K+      +  L+ + + S +++  + LL+ +   I++++GMQ+FG     +E + K     + F  FPQA+L +F+  TGE W  +M

HSP 5 Score: 87.8113 bits (216), Expect = 3.418e-16
Identity = 55/178 (30.90%), Postives = 92/178 (51.69%), Query Frame = 1
            +NP++     +V   PFEY++   I  N   LA         S   N A++ + +VF  +FT E VLK++AF     P  Y  + WN  D LIVI  +I   LS+           +   R FRV+R ++L+S    ++ ++ + +++   L ++ALL   +  IYA+IG+++F GK+

HSP 6 Score: 85.8853 bits (211), Expect = 1.563e-15
Identity = 79/286 (27.62%), Postives = 128/286 (44.76%), Query Frame = 1
            A + F    NN  R+ C  I     F   +L+ I  +   LA   P   D  +S N  L   +Y F  +FTVE  LK+I YGL+ H  A+ R+  N+LD ++V+  + S  +           ++   S    ++ LR  R LR +    G+  +   +   +K++  ++ +  L+ F   ++A+IG++LF GK      F   + V++     C     G+    N  +    +V     I    NFDN   AMLT+F   T EGW  VLY   D+   ++  +Y

HSP 7 Score: 85.5001 bits (210), Expect = 1.773e-15
Identity = 59/249 (23.69%), Postives = 112/249 (44.98%), Query Frame = 1
            ++  +PF+  I + I  N ++LA+     +         ++ +   F  +FTVE  LK+ A+G       Y  + WN+ DF+IV+     +I + +     G N++        +   R FRV+R ++L+S    ++ +L + +K+   L ++ALL++ +  IYA+IG+++F                             G+  T N  E +   +  N    NF  F  A+L +F+  T E W +++

HSP 8 Score: 85.1149 bits (209), Expect = 2.419e-15
Identity = 67/252 (26.59%), Postives = 138/252 (54.76%), Query Frame = 1
            +V S  F +++ VL+ LNT  L  +HY QS   +   +  N++F  +FT+EM++K+ +   + YF   +N FD  +VI SI+++ + + D       + ++  R  R++R+ K+      +R L+ + + S +++  + +L+ +   I++++GMQ+FG     D  +    +NF +F Q++L +F+  TGE W E+M   +        S  N G+     S  + +Y++  ++   ++++N+F+A+ +DN 
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Human
Match: CACNA1D (calcium voltage-gated channel subunit alpha1 D [Source:HGNC Symbol;Acc:HGNC:1391])

HSP 1 Score: 974.926 bits (2519), Expect = 0.000e+0
Identity = 542/902 (60.09%), Postives = 658/902 (72.95%), Query Frame = 1

HSP 2 Score: 706.057 bits (1821), Expect = 0.000e+0
Identity = 398/693 (57.43%), Postives = 494/693 (71.28%), Query Frame = 1

HSP 3 Score: 122.865 bits (307), Expect = 9.382e-27
Identity = 112/372 (30.11%), Postives = 168/372 (45.16%), Query Frame = 1
            RP  ++ L +  +IA               P P+  A F L+  NP R  C K++    F  LIL  I  +  ALAA  P   R  +  N+ L   +  F  IFT E +LK+  FG  +H GA+ RN +NLLD L+V + L+S      S     VK LR  RVLRPLR ++    L+ V+  +  A+  + +I ++   +  ++A IG++LF GK     Y   D    +P  C                G   + KD   ++       W   +    +FDN   AM+ +F   T EGW  ++Y   DS G +   IY         F+  III +FF+MN+ +G +   F ++ EK  K  +  K + Q

HSP 4 Score: 90.8929 bits (224), Expect = 4.351e-17
Identity = 57/203 (28.08%), Postives = 106/203 (52.22%), Query Frame = 1
            + S  F +++ VL+ LNT++++ +   QP    Q+ D  N V   +FT E L+K+ + G + YF   +N FD  +V G   + I   +   +        + I+ FR  R++R+ K+      +  L+ + + S +++  + LL+ +   I++++GMQ+FG     +E + K     + F  FPQA+L +F+  TGE W  +M

HSP 5 Score: 87.8113 bits (216), Expect = 4.168e-16
Identity = 55/178 (30.90%), Postives = 92/178 (51.69%), Query Frame = 1
            +NP++     +V   PFEY++   I  N   LA         S   N A++ + +VF  +FT E VLK++AF     P  Y  + WN  D LIVI  +I   LS+           +   R FRV+R ++L+S    ++ ++ + +++   L ++ALL   +  IYA+IG+++F GK+

HSP 6 Score: 87.0409 bits (214), Expect = 5.881e-16
Identity = 63/257 (24.51%), Postives = 117/257 (45.53%), Query Frame = 1
            ++  +PF+  I + I  N ++LA+     +         ++ +   F  +FTVE  LK+ A+G       Y  + WN+ DF+IV+     +I + +     G N++        +   R FRV+R ++L+S    ++ +L + +K+   L ++ALL++ +  IYA+IG+++F                             G+  T N  E +   +  N    NF  F  A+L +F+  T E W ++ L+ + DAM

HSP 7 Score: 85.1149 bits (209), Expect = 2.536e-15
Identity = 67/252 (26.59%), Postives = 138/252 (54.76%), Query Frame = 1
            +V S  F +++ VL+ LNT  L  +HY QS   +   +  N++F  +FT+EM++K+ +   + YF   +N FD  +VI SI+++ + + D       + ++  R  R++R+ K+      +R L+ + + S +++  + +L+ +   I++++GMQ+FG     D  +    +NF +F Q++L +F+  TGE W E+M   +        S  N G+     S  + +Y++  ++   ++++N+F+A+ +DN 

HSP 8 Score: 83.9593 bits (206), Expect = 5.492e-15
Identity = 79/286 (27.62%), Postives = 127/286 (44.41%), Query Frame = 1
            A + F    NN  R+ C  I     F   +L+ I  +   LA   P   D  +S N  L   +Y F  +FTVE  LK+I YGL+ H  A+ R+  N+LD ++V+  + S  +           ++   S    ++ LR  R LR +    G+  +   +   +K++  ++ +  L+ F   ++A+IG++LF GK      F   + V++     C     G+    N  +    +V     I    NFDN   AMLT+F   T EGW  VLY   D+   +   +Y
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Celegans
Match: egl-19 (Voltage-dependent L-type calcium channel subunit alpha [Source:UniProtKB/TrEMBL;Acc:W6RY76])

HSP 1 Score: 1032.32 bits (2668), Expect = 0.000e+0
Identity = 589/1014 (58.09%), Postives = 707/1014 (69.72%), Query Frame = 1

HSP 2 Score: 502.286 bits (1292), Expect = 5.728e-145
Identity = 243/393 (61.83%), Postives = 297/393 (75.57%), Query Frame = 1

HSP 3 Score: 276.174 bits (705), Expect = 7.591e-74
Identity = 174/243 (71.60%), Postives = 205/243 (84.36%), Query Frame = 1

HSP 4 Score: 142.51 bits (358), Expect = 3.605e-33
Identity = 106/349 (30.37%), Postives = 169/349 (48.42%), Query Frame = 1
             PA S +  P P+  +LF L+  N FR FC  +V    F   +LF I  +   LAA  P   + ++T N  L   +  F  +FT E  LK++ FG + H G++ RN +NLLD L+V + L S VL   ++    VK LR  RVLRPLR ++    L+ V+  ++ A+  + +I L+   +  ++AIIG++LF G    T +  ND+   +   C                   Y   D     S+   WS  +    +FDN G AM+++F   T EGW Q++Y   DS                ++F++ II+ +FF+MN+ +G +   F  E E+  +  +  K + +

HSP 5 Score: 95.1301 bits (235), Expect = 7.336e-19
Identity = 90/355 (25.35%), Postives = 156/355 (43.94%), Query Frame = 1
            V  + FEY+I   I  N  +LA    YP   S      L+   L+F  +F  E VLKI+A    ++P  Y+ + WN+ D L+V+   I     K++ GG ++ ++   R FRV+R ++L+S    ++ ++ + M++   L ++ALL + +  IYA+IG++ F GK+     + +D         STS+++    ++FHS                             F  A+L +F+  T E W  IM   +D                       G ++ + YF+S  ++ SF V+NL + V+   F          G +   +  R   ++D D +G   +LD +     IS

HSP 6 Score: 90.1225 bits (222), Expect = 2.547e-17
Identity = 78/320 (24.38%), Postives = 144/320 (45.00%), Query Frame = 1
            ++  +PFE++I  +I  N I+LA+   +  Q   Y+  +++ +  VF  VFT+E +LK+ A GF      Y  +AWN+ DFIIV+   +  I   ++             +   R FRV+R ++L+S    ++ +L   +++   L ++ALL++ +  IYA+IG+++F GK+ +                            ATG+  Q     C  D    A   Q      N+ V R   + N    G N+ +  +       + + + +S   + DV        G  + + YF++  ++ SF ++NL + V+   F

HSP 7 Score: 89.3521 bits (220), Expect = 4.705e-17
Identity = 84/282 (29.79%), Postives = 134/282 (47.52%), Query Frame = 1
            S      NN  RK C  I     F  ++L  I  +   LA   P  A+ S  +N +L   +Y+F  VFT+E  LK++  G +FH  A+ R++ NILD ++V+  ++S  ++  +I    VK LR  RVLRPLR ++    L+ V+  ++ A+  + +I L+   +  ++A+IG++LF GK  S                 C   ++ +   C+      N     +   N   W    N   NFDN   AMLT+F   + EGW  V+Y   D+   ++  IY

HSP 8 Score: 75.8702 bits (185), Expect = 5.080e-13
Identity = 66/256 (25.78%), Postives = 133/256 (51.95%), Query Frame = 1
             V S+AF +V+ +++ +NT  L  +HY  S   + F +  N+IF  +F  E ++K+ +L  + Y    +N FD  VV+ S ++I    +       + ++  R  R++R+ K+      +R L+ + + S +++  + +L+ L   I++++GMQ FG     D  +  R +NF SF  ++L +F+  TGE W ++M      + +R          G L +S      +  Y++  F+  +++++N+F+A+ +DN 

HSP 9 Score: 67.3958 bits (163), Expect = 1.981e-10
Identity = 56/206 (27.18%), Postives = 111/206 (53.88%), Query Frame = 1
            L+ S+ F +++ +L++LNT+ L  +   Q +  +      N+ F  +F++E LLK+ + GF  Y +  +N FD  +V+ S ++ +  + +         + + ++  R  R++R+ K+      +R L+ + + S +++  + LL+ +   I+A++GMQ+FG     N ++ K      NF TF QA+L +F+  TGE W  +M H

HSP 10 Score: 56.9954 bits (136), Expect = 3.329e-7
Identity = 59/243 (24.28%), Postives = 108/243 (44.44%), Query Frame = 1
            L F+++F+ E +LK+ + GF      Y  + +N  D  +VI  ++  VL       P  V  LR+ R+LR  ++     SL+ +++S++ ++  +  + LL    I+I+A++G+++F GK +           + P P +                                       +FD F  A+LTVFQ +T E W  +MY   +S G          IY++ L I G++ ++N+ L +
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Celegans
Match: egl-19 (Voltage-dependent L-type calcium channel subunit alpha [Source:UniProtKB/TrEMBL;Acc:W6RY76])

HSP 1 Score: 1031.94 bits (2667), Expect = 0.000e+0
Identity = 567/910 (62.31%), Postives = 671/910 (73.74%), Query Frame = 1

HSP 2 Score: 502.671 bits (1293), Expect = 1.438e-145
Identity = 243/393 (61.83%), Postives = 297/393 (75.57%), Query Frame = 1

HSP 3 Score: 276.174 bits (705), Expect = 6.758e-74
Identity = 174/243 (71.60%), Postives = 205/243 (84.36%), Query Frame = 1

HSP 4 Score: 142.51 bits (358), Expect = 3.534e-33
Identity = 106/349 (30.37%), Postives = 169/349 (48.42%), Query Frame = 1
             PA S +  P P+  +LF L+  N FR FC  +V    F   +LF I  +   LAA  P   + ++T N  L   +  F  +FT E  LK++ FG + H G++ RN +NLLD L+V + L S VL   ++    VK LR  RVLRPLR ++    L+ V+  ++ A+  + +I L+   +  ++AIIG++LF G    T +  ND+   +   C                   Y   D     S+   WS  +    +FDN G AM+++F   T EGW Q++Y   DS                ++F++ II+ +FF+MN+ +G +   F  E E+  +  +  K + +

HSP 5 Score: 95.1301 bits (235), Expect = 8.336e-19
Identity = 89/352 (25.28%), Postives = 155/352 (44.03%), Query Frame = 1
            + FEY+I   I  N  +LA    YP   S      L+   L+F  +F  E VLKI+A    ++P  Y+ + WN+ D L+V+   I     K++ GG ++ ++   R FRV+R ++L+S    ++ ++ + M++   L ++ALL + +  IYA+IG++ F GK+     + +D         STS+++    ++FHS                             F  A+L +F+  T E W  IM   +D                       G ++ + YF+S  ++ SF V+NL + V+   F          G +   +  R   ++D D +G   +LD +     IS

HSP 6 Score: 89.3521 bits (220), Expect = 5.048e-17
Identity = 78/320 (24.38%), Postives = 144/320 (45.00%), Query Frame = 1
            ++  +PFE++I  +I  N I+LA+   +  Q   Y+  +++ +  VF  VFT+E +LK+ A GF      Y  +AWN+ DFIIV+   +  I   ++             +   R FRV+R ++L+S    ++ +L   +++   L ++ALL++ +  IYA+IG+++F GK+ +                            ATG+  Q     C  D    A   Q      N+ V R   + N    G N+ +  +       + + + +S   + DV        G  + + YF++  ++ SF ++NL + V+   F

HSP 7 Score: 88.9669 bits (219), Expect = 5.972e-17
Identity = 75/282 (26.60%), Postives = 127/282 (45.04%), Query Frame = 1
            S      NN  RK C  I     F  ++L  I  +   LA   P  A+ S  +N +L   +Y+F  VFT+E  LK++  G +FH  A+ R++ NILD ++V+  ++S  ++  +I    +  +        LR ++    L+ V+  ++ A+  + +I L+   +  ++A+IG++LF GK  S                 C   ++ +   C+      N     +   N   W    N   NFDN   AMLT+F   + EGW  V+Y   D+   ++  IY

HSP 8 Score: 75.8702 bits (185), Expect = 6.252e-13
Identity = 66/256 (25.78%), Postives = 133/256 (51.95%), Query Frame = 1
             V S+AF +V+ +++ +NT  L  +HY  S   + F +  N+IF  +F  E ++K+ +L  + Y    +N FD  VV+ S ++I    +       + ++  R  R++R+ K+      +R L+ + + S +++  + +L+ L   I++++GMQ FG     D  +  R +NF SF  ++L +F+  TGE W ++M      + +R          G L +S      +  Y++  F+  +++++N+F+A+ +DN 

HSP 9 Score: 67.0106 bits (162), Expect = 2.442e-10
Identity = 56/206 (27.18%), Postives = 111/206 (53.88%), Query Frame = 1
            L+ S+ F +++ +L++LNT+ L  +   Q +  +      N+ F  +F++E LLK+ + GF  Y +  +N FD  +V+ S ++ +  + +         + + ++  R  R++R+ K+      +R L+ + + S +++  + LL+ +   I+A++GMQ+FG     N ++ K      NF TF QA+L +F+  TGE W  +M H

HSP 10 Score: 56.6102 bits (135), Expect = 4.216e-7
Identity = 59/243 (24.28%), Postives = 108/243 (44.44%), Query Frame = 1
            L F+++F+ E +LK+ + GF      Y  + +N  D  +VI  ++  VL       P  V  LR+ R+LR  ++     SL+ +++S++ ++  +  + LL    I+I+A++G+++F GK +           + P P +                                       +FD F  A+LTVFQ +T E W  +MY   +S G          IY++ L I G++ ++N+ L +
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Celegans
Match: unc-2 (High voltage activated calcium channel alpha-1 subunit [Source:UniProtKB/TrEMBL;Acc:Q86G45])

HSP 1 Score: 647.506 bits (1669), Expect = 0.000e+0
Identity = 367/813 (45.14%), Postives = 497/813 (61.13%), Query Frame = 1
            KP+   SS F   P N FR   H I    +F  +V+  I +SS  LAAEDP+D E+ RN++L Y DY FT VF  E+ LK+I  G++ H G++CR   NILD +VV  ++ ++       S  K L  ++ LR LR +   K +KR+ +   V      ++K++ NI++V FL +F+FAVI VQLFNGKF  C D ++    +C GQ+ +Y N+ D  +V   +REW   P N+DN  NAMLTLF V+T EGWPG+   S+D+  ED       R  V++FY+ + IV  FF +NIFV  +I+TFQ++GE E    +LDKNQ++CI+FAL A+P   ++P  K S +YR+W L+TS PFEY I  +I  NT+ L +K+   P  YE+++   N   T VFTVE +LK+ AFG +NYF D WN FDF+ V+GS  D +     G          +S+ F RLFR  RL++LL +G  IR LLWTFV+SF+ALPYV LLI MLFFIYA++GMQ+FG I         EINR+NNFQ+F  A+++LFR ATGE WQ+IM+  +    C                    +AG+   N                      ++    CGSN +Y YF SF  + SFL++NLFVAVIMDNFDYLTRD SILGPHHLDEF+R+W++YDP A GRI + ++  +LR + PP+GFGK CP+R A   L+RMNMP+  DGTV F  TLFAL+R +L IK      +D+ +EELR+ +KKIW   ++K M+D VVPP        +TVGK YA  LI E +R  K

HSP 2 Score: 505.368 bits (1300), Expect = 9.128e-145
Identity = 315/705 (44.68%), Postives = 442/705 (62.70%), Query Frame = 1
            RK T + +     +   +LF     N  R+    I+EW PFEY IL TI  NC  L+     P+ D   ++  LE+ E  F+ IF  ECVLK++AFGF +H G+YLR+GWN++DF++V+ G+++       T  +       D++ LRA RVLRPL+LVSG+PSLQVV+ SI+ AM PL  I LL LF III+AIIGLE +SG  HS CY++    + + E P+PC+  TS    Y CD   ++  +           +W GPN GITSFDN G AM+TVFQCITMEGWT +MY+ NDS+G ++ W YF+ LI++GSFF++NLVLGVLSGEF+KERE+ + R ++ K R Q Q + ++ GYL+WI  AE++      + +EE     + +      + K     +S+E  +D ++   +  +   + G       +++++   C  +       + ++ R   R +VK+Q FYW VI LVFLNT  + SEHY Q  W   F   A  +F+ +F +EML+K++++G R YF   FNRFD  V++ S  E++  +       G+SV+R  RLLR+FK+T YW SLRNLV SL+ SM+SI+SLL LLFLFI+IF+LLGMQLFGG+FNF     P ++FD+F  +L+TVFQILTGEDWNEVMY  I S G +        +Y+++L + GNY LLNVFLAIAVDNLA+ 

HSP 3 Score: 122.865 bits (307), Expect = 3.139e-27
Identity = 87/280 (31.07%), Postives = 138/280 (49.29%), Query Frame = 1
            G P+P     ++F L+  NPFR     IV  K FE +++  I  +  +LAA  P  E   N  N  L+ ++  F  +F  E +LK++  G ++HPG+Y R+ WN+LD ++V   L +   +  +EG        +K+LR  RVLRPL+ +  +P L+ V + ++ ++  +F+I ++      I+A+I ++LF+GK    C  KN     +   C             H   F Y   DN+N+  R       +  F  DN   AMLT+F   T EGW  I

HSP 4 Score: 102.449 bits (254), Expect = 5.933e-21
Identity = 62/213 (29.11%), Postives = 114/213 (53.52%), Query Frame = 1
            +  R ++  ++ ++ F + +  L+ LNT  +A +   QPQ +   + Y   VF G+F VE LLKL A G + YF+  +N FD ++++GS  ++I+  V G +          I+  R  R++R+ KL S    +R L+ + + S +++  +  L+ +   I+A++GMQ+FG            ++   +F TFP A++ +F+  TGE W  +M

HSP 5 Score: 87.4261 bits (215), Expect = 2.066e-16
Identity = 85/367 (23.16%), Postives = 152/367 (41.42%), Query Frame = 1
            N RP R+LF    +N  +    ++V   PFEY I+  I  N   L     N P + E      N+AL         +FT E +LKILAFG       Y R+GWN  DF+ V+  +   ++++       +  LR FR  R +RL+    ++++++ + +++   L ++ LL   +  IYAI+G+++F            ++ + +    +T +N+                                  +F +F  A++ +F+C T EGW  IM                  +    + G +  + YF S + + SF ++NL + V+   F      +   G +         DE ++ + D+  AA

HSP 6 Score: 80.4925 bits (197), Expect = 2.520e-14
Identity = 73/309 (23.62%), Postives = 138/309 (44.66%), Query Frame = 1
            +V+ + F + ++  +F N CC  + +   P+  ++ +  A    E VF+ IF  E +LK+ A G       Y  + +N  D ++++      + +++  G   +  +RA R+LR  +L S   SL+ ++ S+M +M  +  +  L    I+I+A++G++LF G                                                  R++ P M   T FD F +A++TVFQ +T E W ++MY   +S G      WP+ IYF+ L++ G++ ++N+ L +     +  +E        +KA

HSP 7 Score: 72.4034 bits (176), Expect = 7.295e-12
Identity = 76/281 (27.05%), Postives = 129/281 (45.91%), Query Frame = 1
            SS FIF  +N  R+    I     F   +L+ I+ +  +L+ E   P + + + +  L   +  F  +F +E  LKVI +G   H G++ RS  NI+D +VV++ +++    + A            LR LRA+   + LK    +  + V +KSI   M       L+      +FA+IG++ ++G F S   N+  +  ++S R        + +       K     ++WI       +FDN+  AM+T+F   T EGW  V+Y + DS    Y+  Y

HSP 8 Score: 68.1662 bits (165), Expect = 1.438e-10
Identity = 62/251 (24.70%), Postives = 130/251 (51.79%), Query Frame = 1
            LV S  F + ++ ++  NT +L  ++Y   ++ +      N     +FT+E ++K+ + G+R YF   +NRFDF  V+ SI + ++ +      + +  LR  R  R+ ++ +   ++R L+ + + S K++  + +L+ +   I++++GMQ+FG  + N   +    +NF SF  +++ +F+  TGE W ++M   ++            N  K     S +S  Y+       ++++LN+F+A+ +DN 

HSP 9 Score: 63.5438 bits (153), Expect = 3.674e-9
Identity = 55/246 (22.36%), Postives = 107/246 (43.50%), Query Frame = 1
            PFEY I + I+ N + L+++        + + ++L      F G+F +E +LK+ AFGF     +Y    WN+ DFI+V+   + ++         N   D  + +   R  RV+R +KL+S    ++ +L + + +   L  + LL++    I+A+IG++ +            G+I   +E+ M   N+ +                          +F     A++ +F+  T E W  +M +
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Celegans
Match: unc-2 (High voltage activated calcium channel alpha-1 subunit [Source:UniProtKB/TrEMBL;Acc:Q86G45])

HSP 1 Score: 647.506 bits (1669), Expect = 0.000e+0
Identity = 375/813 (46.13%), Postives = 503/813 (61.87%), Query Frame = 1
            KP+   SS F   P N FR   H I    +F  +V+  I +SS  LAAEDP+D E+ RN++L Y DY FT VF  E+ LK+I  G++ H G++CR   NILD +VV  ++ ++            ++ +K LRVLRVLRPL+ I R   LK V  CVV ++K++ NI++V FL +F+FAVI VQLFNGKF  C D ++    +C GQ+ +Y N+ D  +V   +REW   P N+DN  NAMLTLF V+T EGWPG+   S+D+  ED       R  V++FY+ + IV  FF +NIFV  +I+TFQ++GE E    +LDKNQ++CI+FAL A+P   ++P  K S +YR+W L+TS PFEY I  +I  NT+ L +K+   P  YE+++   N   T VFTVE +LK+ AFG +NYF D WN FDF+ V+GS  D +     G          +S+ F RLFR  RL++LL +G  IR LLWTFV+SF+ALPYV LLI MLFFIYA++GMQ+FG I         EINR+NNFQ+F  A+++LFR ATGE WQ+IM+  +    C                    +AG+   N                      ++    CGSN +Y YF SF  + SFL++NLFVAVIMDNFDYLTRD SILGPHHLDEF+R+W++YDP A GRI + ++  +LR + PP+GFGK CP+R A   L+RMNMP+  DGTV F  TLFAL+R +L IK      +D+ +EELR+ +KKIW   ++K M+D VVPP        +TVGK YA  LI E +R  K

HSP 2 Score: 505.368 bits (1300), Expect = 6.506e-145
Identity = 315/705 (44.68%), Postives = 442/705 (62.70%), Query Frame = 1
            RK T + +     +   +LF     N  R+    I+EW PFEY IL TI  NC  L+     P+ D   ++  LE+ E  F+ IF  ECVLK++AFGF +H G+YLR+GWN++DF++V+ G+++       T  +       D++ LRA RVLRPL+LVSG+PSLQVV+ SI+ AM PL  I LL LF III+AIIGLE +SG  HS CY++    + + E P+PC+  TS    Y CD   ++  +           +W GPN GITSFDN G AM+TVFQCITMEGWT +MY+ NDS+G ++ W YF+ LI++GSFF++NLVLGVLSGEF+KERE+ + R ++ K R Q Q + ++ GYL+WI  AE++      + +EE     + +      + K     +S+E  +D ++   +  +   + G       +++++   C  +       + ++ R   R +VK+Q FYW VI LVFLNT  + SEHY Q  W   F   A  +F+ +F +EML+K++++G R YF   FNRFD  V++ S  E++  +       G+SV+R  RLLR+FK+T YW SLRNLV SL+ SM+SI+SLL LLFLFI+IF+LLGMQLFGG+FNF     P ++FD+F  +L+TVFQILTGEDWNEVMY  I S G +        +Y+++L + GNY LLNVFLAIAVDNLA+ 

HSP 3 Score: 122.865 bits (307), Expect = 3.531e-27
Identity = 87/280 (31.07%), Postives = 138/280 (49.29%), Query Frame = 1
            G P+P     ++F L+  NPFR     IV  K FE +++  I  +  +LAA  P  E   N  N  L+ ++  F  +F  E +LK++  G ++HPG+Y R+ WN+LD ++V   L +   +  +EG        +K+LR  RVLRPL+ +  +P L+ V + ++ ++  +F+I ++      I+A+I ++LF+GK    C  KN     +   C             H   F Y   DN+N+  R       +  F  DN   AMLT+F   T EGW  I

HSP 4 Score: 102.064 bits (253), Expect = 6.358e-21
Identity = 68/233 (29.18%), Postives = 123/233 (52.79%), Query Frame = 1
            EFA + K      V ++I +   + R+  ++ ++ F + +  L+ LNT  +A +   QPQ +   + Y   VF G+F VE LLKL A G + YF+  +N FD ++++GS  ++I+  V G +          I+  R  R++R+ KL S    +R L+ + + S +++  +  L+ +   I+A++GMQ+FG            ++   +F TFP A++ +F+  TGE W  +M

HSP 5 Score: 87.0409 bits (214), Expect = 2.370e-16
Identity = 85/367 (23.16%), Postives = 152/367 (41.42%), Query Frame = 1
            N RP R+LF    +N  +    ++V   PFEY I+  I  N   L     N P + E      N+AL         +FT E +LKILAFG       Y R+GWN  DF+ V+  +   ++++       +  LR FR  R +RL+    ++++++ + +++   L ++ LL   +  IYAI+G+++F            ++ + +    +T +N+                                  +F +F  A++ +F+C T EGW  IM                  +    + G +  + YF S + + SF ++NL + V+   F      +   G +         DE ++ + D+  AA

HSP 6 Score: 80.1073 bits (196), Expect = 2.728e-14
Identity = 73/309 (23.62%), Postives = 138/309 (44.66%), Query Frame = 1
            +V+ + F + ++  +F N CC  + +   P+  ++ +  A    E VF+ IF  E +LK+ A G       Y  + +N  D ++++      + +++  G   +  +RA R+LR  +L S   SL+ ++ S+M +M  +  +  L    I+I+A++G++LF G                                                  R++ P M   T FD F +A++TVFQ +T E W ++MY   +S G      WP+ IYF+ L++ G++ ++N+ L +     +  +E        +KA

HSP 7 Score: 72.4034 bits (176), Expect = 7.026e-12
Identity = 76/281 (27.05%), Postives = 129/281 (45.91%), Query Frame = 1
            SS FIF  +N  R+    I     F   +L+ I+ +  +L+ E   P + + + +  L   +  F  +F +E  LKVI +G   H G++ RS  NI+D +VV++ +++    + A            LR LRA+   + LK    +  + V +KSI   M       L+      +FA+IG++ ++G F S   N+  +  ++S R        + +       K     ++WI       +FDN+  AM+T+F   T EGW  V+Y + DS    Y+  Y

HSP 8 Score: 68.1662 bits (165), Expect = 1.242e-10
Identity = 62/251 (24.70%), Postives = 130/251 (51.79%), Query Frame = 1
            LV S  F + ++ ++  NT +L  ++Y   ++ +      N     +FT+E ++K+ + G+R YF   +NRFDF  V+ SI + ++ +      + +  LR  R  R+ ++ +   ++R L+ + + S K++  + +L+ +   I++++GMQ+FG  + N   +    +NF SF  +++ +F+  TGE W ++M   ++            N  K     S +S  Y+       ++++LN+F+A+ +DN 

HSP 9 Score: 63.1586 bits (152), Expect = 4.259e-9
Identity = 55/246 (22.36%), Postives = 107/246 (43.50%), Query Frame = 1
            PFEY I + I+ N + L+++        + + ++L      F G+F +E +LK+ AFGF     +Y    WN+ DFI+V+   + ++         N   D  + +   R  RV+R +KL+S    ++ +L + + +   L  + LL++    I+A+IG++ +            G+I   +E+ M   N+ +                          +F     A++ +F+  T E W  +M +
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Celegans
Match: unc-2 (High voltage activated calcium channel alpha-1 subunit [Source:UniProtKB/TrEMBL;Acc:Q86G45])

HSP 1 Score: 647.506 bits (1669), Expect = 0.000e+0
Identity = 375/813 (46.13%), Postives = 503/813 (61.87%), Query Frame = 1
            KP+   SS F   P N FR   H I    +F  +V+  I +SS  LAAEDP+D E+ RN++L Y DY FT VF  E+ LK+I  G++ H G++CR   NILD +VV  ++ ++            ++ +K LRVLRVLRPL+ I R   LK V  CVV ++K++ NI++V FL +F+FAVI VQLFNGKF  C D ++    +C GQ+ +Y N+ D  +V   +REW   P N+DN  NAMLTLF V+T EGWPG+   S+D+  ED       R  V++FY+ + IV  FF +NIFV  +I+TFQ++GE E    +LDKNQ++CI+FAL A+P   ++P  K S +YR+W L+TS PFEY I  +I  NT+ L +K+   P  YE+++   N   T VFTVE +LK+ AFG +NYF D WN FDF+ V+GS  D +     G          +S+ F RLFR  RL++LL +G  IR LLWTFV+SF+ALPYV LLI MLFFIYA++GMQ+FG I         EINR+NNFQ+F  A+++LFR ATGE WQ+IM+  +    C                    +AG+   N                      ++    CGSN +Y YF SF  + SFL++NLFVAVIMDNFDYLTRD SILGPHHLDEF+R+W++YDP A GRI + ++  +LR + PP+GFGK CP+R A   L+RMNMP+  DGTV F  TLFAL+R +L IK      +D+ +EELR+ +KKIW   ++K M+D VVPP        +TVGK YA  LI E +R  K

HSP 2 Score: 504.982 bits (1299), Expect = 9.059e-145
Identity = 315/705 (44.68%), Postives = 442/705 (62.70%), Query Frame = 1
            RK T + +     +   +LF     N  R+    I+EW PFEY IL TI  NC  L+     P+ D   ++  LE+ E  F+ IF  ECVLK++AFGF +H G+YLR+GWN++DF++V+ G+++       T  +       D++ LRA RVLRPL+LVSG+PSLQVV+ SI+ AM PL  I LL LF III+AIIGLE +SG  HS CY++    + + E P+PC+  TS    Y CD   ++  +           +W GPN GITSFDN G AM+TVFQCITMEGWT +MY+ NDS+G ++ W YF+ LI++GSFF++NLVLGVLSGEF+KERE+ + R ++ K R Q Q + ++ GYL+WI  AE++      + +EE     + +      + K     +S+E  +D ++   +  +   + G       +++++   C  +       + ++ R   R +VK+Q FYW VI LVFLNT  + SEHY Q  W   F   A  +F+ +F +EML+K++++G R YF   FNRFD  V++ S  E++  +       G+SV+R  RLLR+FK+T YW SLRNLV SL+ SM+SI+SLL LLFLFI+IF+LLGMQLFGG+FNF     P ++FD+F  +L+TVFQILTGEDWNEVMY  I S G +        +Y+++L + GNY LLNVFLAIAVDNLA+ 

HSP 3 Score: 122.865 bits (307), Expect = 3.506e-27
Identity = 87/280 (31.07%), Postives = 138/280 (49.29%), Query Frame = 1
            G P+P     ++F L+  NPFR     IV  K FE +++  I  +  +LAA  P  E   N  N  L+ ++  F  +F  E +LK++  G ++HPG+Y R+ WN+LD ++V   L +   +  +EG        +K+LR  RVLRPL+ +  +P L+ V + ++ ++  +F+I ++      I+A+I ++LF+GK    C  KN     +   C             H   F Y   DN+N+  R       +  F  DN   AMLT+F   T EGW  I

HSP 4 Score: 102.064 bits (253), Expect = 7.280e-21
Identity = 68/233 (29.18%), Postives = 123/233 (52.79%), Query Frame = 1
            EFA + K      V ++I +   + R+  ++ ++ F + +  L+ LNT  +A +   QPQ +   + Y   VF G+F VE LLKL A G + YF+  +N FD ++++GS  ++I+  V G +          I+  R  R++R+ KL S    +R L+ + + S +++  +  L+ +   I+A++GMQ+FG            ++   +F TFP A++ +F+  TGE W  +M

HSP 5 Score: 87.0409 bits (214), Expect = 2.624e-16
Identity = 85/367 (23.16%), Postives = 152/367 (41.42%), Query Frame = 1
            N RP R+LF    +N  +    ++V   PFEY I+  I  N   L     N P + E      N+AL         +FT E +LKILAFG       Y R+GWN  DF+ V+  +   ++++       +  LR FR  R +RL+    ++++++ + +++   L ++ LL   +  IYAI+G+++F            ++ + +    +T +N+                                  +F +F  A++ +F+C T EGW  IM                  +    + G +  + YF S + + SF ++NL + V+   F      +   G +         DE ++ + D+  AA

HSP 6 Score: 80.1073 bits (196), Expect = 2.994e-14
Identity = 73/309 (23.62%), Postives = 138/309 (44.66%), Query Frame = 1
            +V+ + F + ++  +F N CC  + +   P+  ++ +  A    E VF+ IF  E +LK+ A G       Y  + +N  D ++++      + +++  G   +  +RA R+LR  +L S   SL+ ++ S+M +M  +  +  L    I+I+A++G++LF G                                                  R++ P M   T FD F +A++TVFQ +T E W ++MY   +S G      WP+ IYF+ L++ G++ ++N+ L +     +  +E        +KA

HSP 7 Score: 72.4034 bits (176), Expect = 6.914e-12
Identity = 76/281 (27.05%), Postives = 129/281 (45.91%), Query Frame = 1
            SS FIF  +N  R+    I     F   +L+ I+ +  +L+ E   P + + + +  L   +  F  +F +E  LKVI +G   H G++ RS  NI+D +VV++ +++    + A            LR LRA+   + LK    +  + V +KSI   M       L+      +FA+IG++ ++G F S   N+  +  ++S R        + +       K     ++WI       +FDN+  AM+T+F   T EGW  V+Y + DS    Y+  Y

HSP 8 Score: 67.781 bits (164), Expect = 1.470e-10
Identity = 62/251 (24.70%), Postives = 130/251 (51.79%), Query Frame = 1
            LV S  F + ++ ++  NT +L  ++Y   ++ +      N     +FT+E ++K+ + G+R YF   +NRFDF  V+ SI + ++ +      + +  LR  R  R+ ++ +   ++R L+ + + S K++  + +L+ +   I++++GMQ+FG  + N   +    +NF SF  +++ +F+  TGE W ++M   ++            N  K     S +S  Y+       ++++LN+F+A+ +DN 

HSP 9 Score: 63.1586 bits (152), Expect = 4.370e-9
Identity = 55/246 (22.36%), Postives = 107/246 (43.50%), Query Frame = 1
            PFEY I + I+ N + L+++        + + ++L      F G+F +E +LK+ AFGF     +Y    WN+ DFI+V+   + ++         N   D  + +   R  RV+R +KL+S    ++ +L + + +   L  + LL++    I+A+IG++ +            G+I   +E+ M   N+ +                          +F     A++ +F+  T E W  +M +
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Fly
Match: Ca-alpha1D (gene:FBgn0001991 transcript:FBtr0332020)

HSP 1 Score: 1739.93 bits (4505), Expect = 0.000e+0
Identity = 996/1701 (58.55%), Postives = 1194/1701 (70.19%), Query Frame = 1

HSP 2 Score: 118.242 bits (295), Expect = 1.026e-25
Identity = 97/349 (27.79%), Postives = 163/349 (46.70%), Query Frame = 1
            +SA++ +  R+ +  +  ++  P P+  A F  +  N FR FC  +     F  +IL  I  +   LAA  P   R ++ +N  L K +  F  +FT E +LK++++GF++H GA+ R+ +NLLD L+V   +    L   S     VK LR  RVLRPLR ++    L+ V+  ++ A+  + +I L+   +  ++A+IG++LF GK    C   + +  +         + G    D H    +            WS        FD+    MLT+F   T EGW  ++Y   DS   +   I+    I+         I +FF++N+ +G +   F  E E+  K
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Fly
Match: Ca-alpha1D (gene:FBgn0001991 transcript:FBtr0090005)

HSP 1 Score: 1736.85 bits (4497), Expect = 0.000e+0
Identity = 998/1702 (58.64%), Postives = 1197/1702 (70.33%), Query Frame = 1

HSP 2 Score: 118.242 bits (295), Expect = 1.220e-25
Identity = 98/355 (27.61%), Postives = 164/355 (46.20%), Query Frame = 1
            +SA++ +  R+ +  +  ++  P P+  A F  +  N FR FC  +     F  +IL  I  +   LAA  P   R ++ +N  L K +  F  +FT E +LK++++GF++H GA+ R+ +NLLD L+V   +    L   S     VK LR  RVLRPLR ++    L+ V+  ++ A+  + +I L+   +  ++A+IG++LF GK    C   + +  +         + G    D H    +            WS        FD+    MLT+F   T EGW  ++Y   DS   +   I+    I+         I +FF++N+ +G +   F  E E+  K     K
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Fly
Match: Ca-alpha1D (gene:FBgn0001991 transcript:FBtr0332024)

HSP 1 Score: 1733 bits (4487), Expect = 0.000e+0
Identity = 998/1702 (58.64%), Postives = 1197/1702 (70.33%), Query Frame = 1

HSP 2 Score: 117.472 bits (293), Expect = 1.874e-25
Identity = 98/355 (27.61%), Postives = 164/355 (46.20%), Query Frame = 1
            +SA++ +  R+ +  +  ++  P P+  A F  +  N FR FC  +     F  +IL  I  +   LAA  P   R ++ +N  L K +  F  +FT E +LK++++GF++H GA+ R+ +NLLD L+V   +    L   S     VK LR  RVLRPLR ++    L+ V+  ++ A+  + +I L+   +  ++A+IG++LF GK    C   + +  +         + G    D H    +            WS        FD+    MLT+F   T EGW  ++Y   DS   +   I+    I+         I +FF++N+ +G +   F  E E+  K     K
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Fly
Match: Ca-alpha1D (gene:FBgn0001991 transcript:FBtr0090006)

HSP 1 Score: 1732.61 bits (4486), Expect = 0.000e+0
Identity = 999/1701 (58.73%), Postives = 1200/1701 (70.55%), Query Frame = 1
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Fly
Match: Ca-alpha1D (gene:FBgn0001991 transcript:FBtr0332023)

HSP 1 Score: 1730.69 bits (4481), Expect = 0.000e+0
Identity = 999/1701 (58.73%), Postives = 1201/1701 (70.61%), Query Frame = 1
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Zebrafish
Match: cacna1sb (calcium channel, voltage-dependent, L type, alpha 1S subunit, b [Source:ZFIN;Acc:ZDB-GENE-051227-1])

HSP 1 Score: 1520.37 bits (3935), Expect = 0.000e+0
Identity = 875/1693 (51.68%), Postives = 1129/1693 (66.69%), Query Frame = 1

HSP 2 Score: 83.1889 bits (204), Expect = 6.353e-15
Identity = 100/445 (22.47%), Postives = 175/445 (39.33%), Query Frame = 1
            EEE K  + +K  +K +      +P R    +  +  FR     ++  +PFE II + I  N ++LA+ F   P+         ++ L  +F  +FT+E  LK+ A+G       Y  + WN+ DF+IV      ++ D ++   G      G     +   R FRV+R ++L+S    ++ ++ + +KS   L ++ LL+  +  IYA++G+++F                                G+  T N  E ++     N     F  F  A+L +F+  T E+W ++ L+ + DAM                            ND    WP                           + YF+S  M+ SF I+NL + V+   F           +W +L     +DE ++ + E+   A+      D + LLRK
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Zebrafish
Match: cacna1da (calcium channel, voltage-dependent, L type, alpha 1D subunit, a [Source:ZFIN;Acc:ZDB-GENE-030616-135])

HSP 1 Score: 989.949 bits (2558), Expect = 0.000e+0
Identity = 550/916 (60.04%), Postives = 666/916 (72.71%), Query Frame = 1

HSP 2 Score: 719.924 bits (1857), Expect = 0.000e+0
Identity = 403/729 (55.28%), Postives = 501/729 (68.72%), Query Frame = 1

HSP 3 Score: 120.553 bits (301), Expect = 2.596e-26
Identity = 105/337 (31.16%), Postives = 159/337 (47.18%), Query Frame = 1
            P P+  A F  +  NP R  C K++    F  LIL  I  +  +LAA  P   R+ +  N  L   +  F  IFT E VLK+  +G  +H GA+ RN +NLLD L+V + L+S      S     VK LR  RVLRPLR ++    L+ V+  +  A+  + +I ++   +  ++A IG++LF GK     Y  ND    SP  C  +    Y+  D +             +   W   +    +FDN  +AM+ +F   T EGW  ++Y   DS   +   IY         F+  III +FF+MN+ +G +   F ++ EK  K  +  K + Q

HSP 4 Score: 95.9005 bits (237), Expect = 9.472e-19
Identity = 72/256 (28.12%), Postives = 124/256 (48.44%), Query Frame = 1
            E E  N E +K +    E A    P  + I K  F  R+R W           + S PF +++ +L+ LNT++++ +   QP    QV D  N V   +FT E L+K+ + G + YF   +N FD  +V G   + I       +        + I+ FR  R++R+ K+      +  L+ + + S +++  + LL+ +   I++++GMQ+FG     +E + K     + F  FPQA+L +F+  TGE W  +M

HSP 5 Score: 93.5893 bits (231), Expect = 3.757e-18
Identity = 68/252 (26.98%), Postives = 139/252 (55.16%), Query Frame = 1
            +V S  F +++ VL+ LNT  L  +HY QS   +   +  N++F  +FT+EM++K+ +   R YF   +N FD  +V+ S+++I + +   T+    + ++  R  R++R+ K+      +R L+ + + S +++  + +L+ +   I++++GMQ+FG     D     R +NF +F Q++L +F+  TGE W E+M   +        S  N G+     S  + +Y++  ++   ++++N+F+A+ +DN 

HSP 6 Score: 88.9669 bits (219), Expect = 1.167e-16
Identity = 75/316 (23.73%), Postives = 137/316 (43.35%), Query Frame = 1
            +NP++     +V    FEY++   I  N   LA         S   N  ++ + +VF  +FT E VLK++AF     P  Y  + WN  D LIV+  ++   +++++      +      R FRV+R ++L+S    ++ ++ + +++   L ++ALL   +  IYA+IG+++F GK+          M++      T +N+                  N N              F  F  A+L +F+C T E W +IM                     + G S+  IYF++  ++ +F ++NL + V+   F

HSP 7 Score: 78.1814 bits (191), Expect = 2.222e-13
Identity = 62/265 (23.40%), Postives = 116/265 (43.77%), Query Frame = 1
            L+  +PF+  I + I  N ++LA+     +         ++ +   F  +FT+E  LK+ A+G       Y  + WN+ DF+IV+     ++ +              N + + H G      +   R FRV+R ++L+S    ++ +L + +K+   L ++ALL++ +  IYA+IG+++F           G    E+E     +N +                       NF  F  A+L +F+  T E W ++ L+ + DAM

HSP 8 Score: 77.0258 bits (188), Expect = 4.207e-13
Identity = 79/299 (26.42%), Postives = 123/299 (41.14%), Query Frame = 1
            + F    NN  R+ C  +     F   +L+ I  +   LA   P   D  +S N  L   +Y F  +FT+E  LK+I YGLV H  A+ R+  N+LD ++V+  + S  +                     +        ++ LR  R LR +    G+  +   +   +K++  ++ +  L+ F   ++A+IG++LF GK           H SC  Q     E + A   VN             +E    P     NFDN   AMLT+F   T EGW  VLY   D+   +   +Y
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Zebrafish
Match: cacna1da (calcium channel, voltage-dependent, L type, alpha 1D subunit, a [Source:ZFIN;Acc:ZDB-GENE-030616-135])

HSP 1 Score: 980.704 bits (2534), Expect = 0.000e+0
Identity = 548/923 (59.37%), Postives = 664/923 (71.94%), Query Frame = 1

HSP 2 Score: 708.368 bits (1827), Expect = 0.000e+0
Identity = 396/718 (55.15%), Postives = 496/718 (69.08%), Query Frame = 1

HSP 3 Score: 119.398 bits (298), Expect = 6.420e-26
Identity = 105/337 (31.16%), Postives = 160/337 (47.48%), Query Frame = 1
            P P+  A F  +  NP R  C K++    F  LIL  I  +  +LAA  P   R+ +  N  L   + VF  +FT E VLK+  +G  +H GA+ RN +NLLD L+V + L+S      S     VK LR  RVLRPLR ++    L+ V+  +  A+  + +I ++   +  ++A IG++LF GK     Y  ND    SP  C  +    Y+  D +             +   W   +    +FDN  +AM+ +F   T EGW  ++Y   DS   +   IY         F+  III +FF+MN+ +G +   F ++ EK  K  +  K + Q

HSP 4 Score: 95.5153 bits (236), Expect = 9.861e-19
Identity = 72/256 (28.12%), Postives = 124/256 (48.44%), Query Frame = 1
            E E  N E +K +    E A    P  + I K  F  R+R W           + S PF +++ +L+ LNT++++ +   QP    QV D  N V   +FT E L+K+ + G + YF   +N FD  +V G   + I       +        + I+ FR  R++R+ K+      +  L+ + + S +++  + LL+ +   I++++GMQ+FG     +E + K     + F  FPQA+L +F+  TGE W  +M

HSP 5 Score: 89.3521 bits (220), Expect = 7.219e-17
Identity = 68/263 (25.86%), Postives = 139/263 (52.85%), Query Frame = 1
            +V S  F +++ VL+ LNT  L  +HY QS   +   +  N++F  +FT+EM++K+ +   R YF   +N FD  +V+ S+++I + +              T+    + ++  R  R++R+ K+      +R L+ + + S +++  + +L+ +   I++++GMQ+FG     D     R +NF +F Q++L +F+  TGE W E+M   +        S  N G+     S  + +Y++  ++   ++++N+F+A+ +DN 

HSP 6 Score: 85.1149 bits (209), Expect = 1.424e-15
Identity = 77/327 (23.55%), Postives = 138/327 (42.20%), Query Frame = 1
            +NP++     +V    FEY++   I  N   LA         S   N  ++ + +VF  +FT E VLK++AF     P  Y  + WN  D LIV+  ++   +++++    P V                 R FRV+R ++L+S    ++ ++ + +++   L ++ALL   +  IYA+IG+++F GK+          M++      T +N+                  N N              F  F  A+L +F+C T E W +IM                     + G S+  IYF++  ++ +F ++NL + V+   F

HSP 7 Score: 77.7962 bits (190), Expect = 2.276e-13
Identity = 62/265 (23.40%), Postives = 116/265 (43.77%), Query Frame = 1
            L+  +PF+  I + I  N ++LA+     +         ++ +   F  +FT+E  LK+ A+G       Y  + WN+ DF+IV+     ++ +              N + + H G      +   R FRV+R ++L+S    ++ +L + +K+   L ++ALL++ +  IYA+IG+++F           G    E+E     +N +                       NF  F  A+L +F+  T E W ++ L+ + DAM

HSP 8 Score: 77.0258 bits (188), Expect = 4.456e-13
Identity = 79/299 (26.42%), Postives = 123/299 (41.14%), Query Frame = 1
            + F    NN  R+ C  +     F   +L+ I  +   LA   P   D  +S N  L   +Y F  +FT+E  LK+I YGLV H  A+ R+  N+LD ++V+  + S  +                     +        ++ LR  R LR +    G+  +   +   +K++  ++ +  L+ F   ++A+IG++LF GK           H SC  Q     E + A   VN             +E    P     NFDN   AMLT+F   T EGW  VLY   D+   +   +Y
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Zebrafish
Match: cacna1c (calcium channel, voltage-dependent, L type, alpha 1C subunit [Source:ZFIN;Acc:ZDB-GENE-020129-1])

HSP 1 Score: 957.977 bits (2475), Expect = 0.000e+0
Identity = 542/948 (57.17%), Postives = 665/948 (70.15%), Query Frame = 1

HSP 2 Score: 720.309 bits (1858), Expect = 0.000e+0
Identity = 405/691 (58.61%), Postives = 500/691 (72.36%), Query Frame = 1

HSP 3 Score: 105.145 bits (261), Expect = 1.411e-21
Identity = 99/345 (28.70%), Postives = 160/345 (46.38%), Query Frame = 1
            P PQ +A F  +  N FR  C KIV    F  LILF I  +  +LAA  P   ++ +  N  L   + VF  IFT E +LK+ A+G  +H G++ RN +N+LD       ++  G+ S+ ++        VK LR  RVLRPLR ++    L+ V+  +  A+  + +I ++   +  ++A IG++LF GK     +   D   ++   C                G   + KD    K E ++ S  N    +FD+    M+ +F   T EGW  ++Y   DS       IY   ++         II +FF+MN+ +G +   F ++ E+  K  +  K + Q

HSP 4 Score: 87.8113 bits (216), Expect = 2.508e-16
Identity = 56/203 (27.59%), Postives = 105/203 (51.72%), Query Frame = 1
            + S  F +++  L+ LNT+++A +  +QP+    V D  N V   +FT E LLK+ + G + YF   +N FD  +V G  ++ I       +        + I+  R  R++R+ K+      +  L+ + + S +++  + LL+ +   I++++GMQ+FG     +E       R + F  FPQ++L +F+  TGE W ++M

HSP 5 Score: 86.6557 bits (213), Expect = 5.476e-16
Identity = 66/261 (25.29%), Postives = 115/261 (44.06%), Query Frame = 1
            ++  +PFE II + I  N ++LA+     +         ++ +  +F  +FTVE  LK+ A+G       Y  + WN+ DFIIV+ G F  I+     G      G +     +   R FRV+R ++L+S    ++ +L + +K+   L ++ALL++ +  IYA+IG+++F                G I  E        + +                        NF  F  A+L +F+  T E W ++ L+ + DAM

HSP 6 Score: 82.0333 bits (201), Expect = 1.378e-14
Identity = 76/334 (22.75%), Postives = 137/334 (41.02%), Query Frame = 1
            +NP++     +V    FEYL+   I  N   LA         S + N A+  + ++F  +FT E +LK++AF     P  Y  + WN  D LIV+  ++   +++++   P                        +   R FRV+R ++L+S    ++ ++ + +++   L ++ALL + +  IYA+IG+++F GK+                                    +   + N+N             +F  F  A+L +F+C T E W +IM              IN S    G  +   YFVS  ++ +F ++NL + V+   F

HSP 7 Score: 81.6481 bits (200), Expect = 1.864e-14
Identity = 77/280 (27.50%), Postives = 124/280 (44.29%), Query Frame = 1
            N  R+ C  I     F  I+L+ I  +   LA   P   D  ++ N  L   +YLF  +FTVE  LKVI YGL+ H  A+ R+  N+LD ++V+    ++I+      D  + +        ++ LRA      +    G+  +   +   +K++  ++ +  L+ F   ++A+IG++LF GK        K+ H   +G       A  A    + R              E  N+ + NFDN   AMLT+F   T EGW  VLY   D+   +   +Y

HSP 8 Score: 80.4925 bits (197), Expect = 3.649e-14
Identity = 67/270 (24.81%), Postives = 137/270 (50.74%), Query Frame = 1
            +V S  F +++  L+ LNT  L  +H+ QS   +   N  N++F  LFT+EM++K+ +   R YF   +N FD  +V+ S+++I + + +            + P+G           ++  R  R++R+ K+      +R L+ + + S +++  + +L+ +   I++++GMQ+FG     D     R +NF +F Q++L +F+  TGE W E+M               ++ +    S  +  Y+V  ++   ++++N+F+A+ +DN 
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Zebrafish
Match: cacna1c (calcium channel, voltage-dependent, L type, alpha 1C subunit [Source:ZFIN;Acc:ZDB-GENE-020129-1])

HSP 1 Score: 952.584 bits (2461), Expect = 0.000e+0
Identity = 546/977 (55.89%), Postives = 667/977 (68.27%), Query Frame = 1

HSP 2 Score: 719.153 bits (1855), Expect = 0.000e+0
Identity = 405/691 (58.61%), Postives = 500/691 (72.36%), Query Frame = 1

HSP 3 Score: 104.76 bits (260), Expect = 1.620e-21
Identity = 99/345 (28.70%), Postives = 160/345 (46.38%), Query Frame = 1
            P PQ +A F  +  N FR  C KIV    F  LILF I  +  +LAA  P   ++ +  N  L   + VF  IFT E +LK+ A+G  +H G++ RN +N+LD       ++  G+ S+ ++        VK LR  RVLRPLR ++    L+ V+  +  A+  + +I ++   +  ++A IG++LF GK     +   D   ++   C                G   + KD    K E ++ S  N    +FD+    M+ +F   T EGW  ++Y   DS       IY   ++         II +FF+MN+ +G +   F ++ E+  K  +  K + Q

HSP 4 Score: 87.4261 bits (215), Expect = 2.876e-16
Identity = 56/203 (27.59%), Postives = 105/203 (51.72%), Query Frame = 1
            + S  F +++  L+ LNT+++A +  +QP+    V D  N V   +FT E LLK+ + G + YF   +N FD  +V G  ++ I       +        + I+  R  R++R+ K+      +  L+ + + S +++  + LL+ +   I++++GMQ+FG     +E       R + F  FPQ++L +F+  TGE W ++M

HSP 5 Score: 86.2705 bits (212), Expect = 6.495e-16
Identity = 66/261 (25.29%), Postives = 115/261 (44.06%), Query Frame = 1
            ++  +PFE II + I  N ++LA+     +         ++ +  +F  +FTVE  LK+ A+G       Y  + WN+ DFIIV+ G F  I+     G      G +     +   R FRV+R ++L+S    ++ +L + +K+   L ++ALL++ +  IYA+IG+++F                G I  E        + +                        NF  F  A+L +F+  T E W ++ L+ + DAM

HSP 6 Score: 81.2629 bits (199), Expect = 2.210e-14
Identity = 77/280 (27.50%), Postives = 124/280 (44.29%), Query Frame = 1
            N  R+ C  I     F  I+L+ I  +   LA   P   D  ++ N  L   +YLF  +FTVE  LKVI YGL+ H  A+ R+  N+LD ++V+    ++I+      D  + +        ++ LRA      +    G+  +   +   +K++  ++ +  L+ F   ++A+IG++LF GK        K+ H   +G       A  A    + R              E  N+ + NFDN   AMLT+F   T EGW  VLY   D+   +   +Y

HSP 7 Score: 80.8777 bits (198), Expect = 2.726e-14
Identity = 82/362 (22.65%), Postives = 141/362 (38.95%), Query Frame = 1
            +NP++     +V    FEYL+   I  N   LA         S + N A+  + ++F  +FT E +LK++AF     P  Y  + WN+ DFLIVI  +I  +LS++                         +E  P                           +   R FRV+R ++L+S    ++ ++ + +++   L ++ALL + +  IYA+IG+++F GK+                                    +   + N+N             +F  F  A+L +F+C T E W +IM              IN S    G  +   YFVS  ++ +F ++NL + V+   F

HSP 8 Score: 70.4774 bits (171), Expect = 4.680e-11
Identity = 71/298 (23.83%), Postives = 140/298 (46.98%), Query Frame = 1
            +V S  F +++  L+ LNT  L  +H+ QS   +   N  N++F  LFT+EM++K+ +   R YF   +N FDF +VI SI+++++ +                          T+  P             P+G           ++  R  R++R+ K+      +R L+ + + S +++  + +L+ +   I++++GMQ+FG     D     R+N F +F Q++L +F+  TGE W E+M               ++ +    S  +  Y+V  ++   ++++N+F+A+ +DN 
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Xenopus
Match: CACNA1C (calcium channel, voltage-dependent, L type, alpha 1C subunit [Source:NCBI gene;Acc:100488055])

HSP 1 Score: 1663.66 bits (4307), Expect = 0.000e+0
Identity = 979/1778 (55.06%), Postives = 1208/1778 (67.94%), Query Frame = 1
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Xenopus
Match: CACNA1C (calcium channel, voltage-dependent, L type, alpha 1C subunit [Source:NCBI gene;Acc:100488055])

HSP 1 Score: 1654.03 bits (4282), Expect = 0.000e+0
Identity = 978/1792 (54.58%), Postives = 1209/1792 (67.47%), Query Frame = 1
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Xenopus
Match: CACNA1C (calcium channel, voltage-dependent, L type, alpha 1C subunit [Source:NCBI gene;Acc:100488055])

HSP 1 Score: 1653.65 bits (4281), Expect = 0.000e+0
Identity = 976/1790 (54.53%), Postives = 1209/1790 (67.54%), Query Frame = 1
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Xenopus
Match: CACNA1C (calcium channel, voltage-dependent, L type, alpha 1C subunit [Source:NCBI gene;Acc:100488055])

HSP 1 Score: 1652.88 bits (4279), Expect = 0.000e+0
Identity = 982/1807 (54.34%), Postives = 1209/1807 (66.91%), Query Frame = 1
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Xenopus
Match: CACNA1C (calcium channel, voltage-dependent, L type, alpha 1C subunit [Source:NCBI gene;Acc:100488055])

HSP 1 Score: 1644.02 bits (4256), Expect = 0.000e+0
Identity = 983/1827 (53.80%), Postives = 1210/1827 (66.23%), Query Frame = 1
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Mouse
Match: Cacna1s (calcium channel, voltage-dependent, L type, alpha 1S subunit [Source:MGI Symbol;Acc:MGI:88294])

HSP 1 Score: 1649.03 bits (4269), Expect = 0.000e+0
Identity = 929/1702 (54.58%), Postives = 1169/1702 (68.68%), Query Frame = 1
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Mouse
Match: Cacna1s (calcium channel, voltage-dependent, L type, alpha 1S subunit [Source:MGI Symbol;Acc:MGI:88294])

HSP 1 Score: 1640.17 bits (4246), Expect = 0.000e+0
Identity = 929/1717 (54.11%), Postives = 1168/1717 (68.03%), Query Frame = 1
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Mouse
Match: Cacna1s (calcium channel, voltage-dependent, L type, alpha 1S subunit [Source:MGI Symbol;Acc:MGI:88294])

HSP 1 Score: 1640.17 bits (4246), Expect = 0.000e+0
Identity = 929/1717 (54.11%), Postives = 1168/1717 (68.03%), Query Frame = 1
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Mouse
Match: Cacna1s (calcium channel, voltage-dependent, L type, alpha 1S subunit [Source:MGI Symbol;Acc:MGI:88294])

HSP 1 Score: 1382.08 bits (3576), Expect = 0.000e+0
Identity = 789/1444 (54.64%), Postives = 993/1444 (68.77%), Query Frame = 1

HSP 2 Score: 124.405 bits (311), Expect = 1.919e-27
Identity = 93/279 (33.33%), Postives = 135/279 (48.39%), Query Frame = 1
            P P+  + F  +  N  R  C +IV    F   IL  I  +  ALAA  P   R  +  N  LE  + VF  +FT E VLK+  +G  +H G++ RN +N+LD L+V + LIS  L   S     VK LR  RVLRPLR ++    L+ V+  +  A+  + +I L+   +  ++A IG++LF GK     YS ND+   +   C                G+ Y+ KD  + T     P   I +   FDN   AM+++F   T EGW Q++Y   DS

HSP 3 Score: 99.3673 bits (246), Expect = 7.835e-20
Identity = 83/326 (25.46%), Postives = 146/326 (44.79%), Query Frame = 1
            R L C   +NP++     +V    FEYL+   I  N   L          S  +N   + + + F +IFT E VLK++AF     P  Y  + WN+ DFLIVI  +I  +LS++ +  PD  A       R FRV+R ++L++    ++ ++ + +++   L ++ALL + +  IYA+IG+++F GK+          M++      T +N+                  N N              F  F  A+L +F+C T E W +I+   +                 + G ++ + YF+S  ++ +F ++NL + V+   F

HSP 4 Score: 58.5362 bits (140), Expect = 1.670e-7
Identity = 73/324 (22.53%), Postives = 138/324 (42.59%), Query Frame = 1
            FR  C  +V+ K F +L++  +  N  ++A+   N P        +    +    V + +FT E ++K+   G       Y  + +N  D  +V  G++  +L +     P  +  LR  R+LR  ++     SL  ++ S++ ++  +  + LL    III+A++G++LF G+                              DF  +           E  R        ++FDNF  A+++VFQ +T E W  +MY  I    G ++P     IYF+ L + G++ ++N+ L +     ++      A+K    ++ R +M
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Mouse
Match: Cacna1f (calcium channel, voltage-dependent, alpha 1F subunit [Source:MGI Symbol;Acc:MGI:1859639])

HSP 1 Score: 1179.08 bits (3049), Expect = 0.000e+0
Identity = 677/1160 (58.36%), Postives = 834/1160 (71.90%), Query Frame = 1

HSP 2 Score: 456.447 bits (1173), Expect = 1.387e-129
Identity = 226/369 (61.25%), Postives = 269/369 (72.90%), Query Frame = 1

HSP 3 Score: 112.849 bits (281), Expect = 5.873e-24
Identity = 87/279 (31.18%), Postives = 128/279 (45.88%), Query Frame = 1
            P P+  A FCL+  NP RK C  ++    F  LIL  I  +  +LAA  P   R  +  N  L   +  F  IFT E +LK+  FG  +H G++ R+ +NLLD L+V + LIS      S     VK LR  RVLRPLR ++    L+ V+  +  A+  + +I ++   +  ++A IG++LF GK +S        + E    C  S                Y   D      R   W   +    +FDN   AM+ +F   T EGW  ++Y   D+

HSP 4 Score: 90.1225 bits (222), Expect = 4.979e-17
Identity = 77/316 (24.37%), Postives = 136/316 (43.04%), Query Frame = 1
            +NP +      V    FEYL+   I  N  ALA         +   N A++ + +VF  +FT E VLKI+AF     P  Y  + WN  D LIV+  ++   +++++         +   R FRV+R ++L+S    ++ ++ + +++   L ++ALL   +  IYA+IG+++F GK+                    ++  G Q               N+N             +F  F  A+L +F+C T E W +IM                     + G S+  +YF+S  ++ +F ++NL + V+   F

HSP 5 Score: 88.9669 bits (219), Expect = 1.154e-16
Identity = 65/247 (26.32%), Postives = 118/247 (47.77%), Query Frame = 1
            G+E+ +   +    R C+   +K +  R +    +  R R    + S    + + +L+ LNT+++A +   QP    Q  +Y N V   +FTVE LLKL   G   Y +  +N FD  +V G  ++     V            + I+  R  R++R+ K+      +  L+ + + S +++  + LL+ +   I++++GMQ+FG     ++   K     + F TFPQA+L +F+  TGE W  +M

HSP 6 Score: 82.8037 bits (203), Expect = 8.308e-15
Identity = 63/257 (24.51%), Postives = 116/257 (45.14%), Query Frame = 1
            ++  +PF+ +I + I  N ++L +     +         ++ +  VF  +FTVE +LK+ A+G       Y  + WN+ DFIIV+     ++ +   G   +  H G +     +   R FRV+R ++L+S    +  +L + +K+   L ++ALL++ +  IYA+IG+++F                             G+  T N  E +           NF  F  A+L +F+  T E W ++ L+ + DAM

HSP 7 Score: 75.0998 bits (183), Expect = 1.972e-12
Identity = 73/284 (25.70%), Postives = 124/284 (43.66%), Query Frame = 1
            + F     N  R+ C  I     F  ++L+ I  +   L    P   D  ++ N  L   +Y+F  +FTVE  LK++ YGLV H  A+ R+  N+LD ++V+  + S  +        DA           ++ LR  R LR +    G+  +   +   +K++  ++ +  L+ F   ++A+IG++LF G+  ++C  +  +            S  G+    N  +    +      I    NFDN   AMLT+F   T EGW  VLY   D+   +   +Y

HSP 8 Score: 63.929 bits (154), Expect = 4.223e-9
Identity = 73/314 (23.25%), Postives = 133/314 (42.36%), Query Frame = 1
             R  C + V+     + +L  +F N   +A+           +    E    V + +FT E +LK+   G    P  Y+ + +N  D  +V  G++ T L ++    P  +  LR  R+LR  ++     SL  ++ S++ +M  +  + LL    III++++G++LF GK                                    F +    ++  T R        ++FD F  A+LTVFQ +T E W  +MY  I    G  +P     +YF+ L I G++ ++N+ L +      SG+    ++K +++
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. UniProt/SwissProt
Match: sp|Q25452|CAC1M_MUSDO (Muscle calcium channel subunit alpha-1 OS=Musca domestica OX=7370 PE=2 SV=1)

HSP 1 Score: 1766.51 bits (4574), Expect = 0.000e+0
Identity = 1004/1737 (57.80%), Postives = 1207/1737 (69.49%), Query Frame = 1
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. UniProt/SwissProt
Match: sp|Q24270|CAC1D_DROME (Voltage-dependent calcium channel type D subunit alpha-1 OS=Drosophila melanogaster OX=7227 GN=Ca-alpha1D PE=1 SV=2)

HSP 1 Score: 1732.61 bits (4486), Expect = 0.000e+0
Identity = 999/1701 (58.73%), Postives = 1200/1701 (70.55%), Query Frame = 1
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. UniProt/SwissProt
Match: sp|Q02485|CAC1S_RAT (Voltage-dependent L-type calcium channel subunit alpha-1S OS=Rattus norvegicus OX=10116 GN=Cacna1s PE=1 SV=2)

HSP 1 Score: 1642.09 bits (4251), Expect = 0.000e+0
Identity = 929/1716 (54.14%), Postives = 1167/1716 (68.01%), Query Frame = 1
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. UniProt/SwissProt
Match: sp|Q02789|CAC1S_MOUSE (Voltage-dependent L-type calcium channel subunit alpha-1S OS=Mus musculus OX=10090 GN=Cacna1s PE=1 SV=2)

HSP 1 Score: 1637.47 bits (4239), Expect = 0.000e+0
Identity = 929/1716 (54.14%), Postives = 1167/1716 (68.01%), Query Frame = 1
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. UniProt/SwissProt
Match: sp|P07293|CAC1S_RABIT (Voltage-dependent L-type calcium channel subunit alpha-1S OS=Oryctolagus cuniculus OX=9986 GN=CACNA1S PE=1 SV=1)

HSP 1 Score: 1627.45 bits (4213), Expect = 0.000e+0
Identity = 924/1716 (53.85%), Postives = 1161/1716 (67.66%), Query Frame = 1
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. TrEMBL
Match: G0YP32 (Voltage-dependent L-type calcium channel subunit alpha OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 4135.49 bits (10724), Expect = 0.000e+0
Identity = 2321/2654 (87.45%), Postives = 2460/2654 (92.69%), Query Frame = 1
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. TrEMBL
Match: A0A068WA30 (Voltage-dependent L-type calcium channel subunit alpha OS=Echinococcus granulosus OX=6210 GN=EgrG_000960800 PE=3 SV=1)

HSP 1 Score: 2033.84 bits (5268), Expect = 0.000e+0
Identity = 1139/1723 (66.11%), Postives = 1297/1723 (75.28%), Query Frame = 1
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. TrEMBL
Match: W6UN84 (Voltage-dependent L-type calcium channel subunit alpha OS=Echinococcus granulosus OX=6210 GN=EGR_02129 PE=3 SV=1)

HSP 1 Score: 1963.73 bits (5086), Expect = 0.000e+0
Identity = 1126/1804 (62.42%), Postives = 1294/1804 (71.73%), Query Frame = 1
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. TrEMBL
Match: A0A068YHX8 (Voltage-dependent L-type calcium channel subunit alpha OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000961000 PE=3 SV=2)

HSP 1 Score: 1948.71 bits (5047), Expect = 0.000e+0
Identity = 1096/1757 (62.38%), Postives = 1267/1757 (72.11%), Query Frame = 1
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. TrEMBL
Match: A0A182J4Y3 (Voltage-dependent L-type calcium channel subunit alpha OS=Anopheles atroparvus OX=41427 PE=3 SV=1)

HSP 1 Score: 1820.05 bits (4713), Expect = 0.000e+0
Identity = 1020/1687 (60.46%), Postives = 1225/1687 (72.61%), Query Frame = 1
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Cavefish
Match: cacna1db (calcium channel, voltage-dependent, L type, alpha 1D subunit, b [Source:ZFIN;Acc:ZDB-GENE-040525-3])

HSP 1 Score: 1612.43 bits (4174), Expect = 0.000e+0
Identity = 923/1608 (57.40%), Postives = 1107/1608 (68.84%), Query Frame = 1

HSP 2 Score: 119.783 bits (299), Expect = 3.282e-26
Identity = 115/370 (31.08%), Postives = 172/370 (46.49%), Query Frame = 1
            RP  L+ LT+        +++TP       P P+  A F  +  NP R  C +++  + F  LIL  I  +  +LAA  P   R  +  N  L   +  F  IFT E +LK+ AFG  +H GA+ RN +NLLD L+V + L+S      S     VK LR  RVLRPLR ++    L+ V+  +  A+  + +I ++   +  ++A IG++LF GK     Y   D    SP  C     KG        +   Y   DN     R   W   +    +FDN  +AM+ +F   T EGW  ++Y   DS   +   IY         F+  III +FF+MN+ +G +   F ++ EK  K  +  K + Q
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Cavefish
Match: cacna1sb (calcium channel, voltage-dependent, L type, alpha 1S subunit, b [Source:ZFIN;Acc:ZDB-GENE-051227-1])

HSP 1 Score: 1457.2 bits (3771), Expect = 0.000e+0
Identity = 843/1728 (48.78%), Postives = 1101/1728 (63.72%), Query Frame = 1
            ++  GNPRP R+LF  TL+NPFRK C KIVEWKPFE +IL TIFANC ALA   P PE D+N  N+ LE +E +F+VIFT EC LKI+A+G + H GAYLRN WN+LDF+IV +GL +  +  ++          GG D+KALRAFRVLRPLRLVSG+PSLQVVMNSI++AM+PLF + LL  F++ ++AI+GLEL+  K+H TCY +  D++     E P PC+ + N G +C    +      C+        W GPN GIT FDNFG AMLTVFQCITME WT ++YW+ND+VG  W WIYFV++I++GSFFV+NLVLGVLSGEFSKEREK + RG+YQK RE+ Q DED++GY++WI  AE +  D+E  G    K++  ES   F + GL + +                      ++   +++   F LK                  VKS+ FYW+VI++VFLNT V+  EH+ QS     FQ+ AN I +  F  EM  KMY+ G+R YF  +FNRFDFFVV   ILEI+++  D M PLG+SV+RC RLLR                                                    F K  K R  F+ F     L  +F Q++TGE+W+ +MY+GI ++G      +L  +Y++IL++ GN+ILLNVFLAIAVDNL +  S +  +K++ E +  + T    EE KA    +       KT        +K +E   ++ +         +       +   + +EE+ E   +   R ++++  KE + P+P ASSFFIFGP NKFRK CH   N   F N +L+ I++SS  LAAED +D +S RN+IL Y D +FT+VFT+EI LK+  YG + H G+FCR++ NILDL+VV+ S++S  + + AISV+KILRVLRVLRPLRA+NRAKGLK VVQCV VA+++IGNI+LVT LL FMFA IGVQL+ GKF SC D  K T   C+G ++ +    +    + +R+W+N+  NFDNVPNAML LF VSTFEGWP +LYK+IDS  ED   ++NNR   S+F++ Y+I+IAFFM+NIFVGFVIVTF+++GE+E+KNCELDKNQR+C+++ALKA+P+R YIPK  ++YRVW+L+TS  FEY++F+LI+LNT SL L+   Q     ++ D LN++FT +FT E ++KL AF  K YF D WNVFDF+IV+GS +D++   V+    +  G           +  +SI FFRLFRV+RL+KLL+R EGIR LLWTF+KSFQA P+VALLIVMLFFIYAVIGMQ+FGKI   +     EINRN NFQTFPQAIL+L+R+ TGE WQ +ML C+   +CD  SD    E Y                                            CG+NFA  YF+SF MIC FLIINLFVAVIMDNFDYLTRDWSILGPHHLDEF ++W+EYDPEA GRIKHLDVVTLLR+I PPLGFGK+CPHR+AC  L+ MNMPLNSDGTV FNATLFALVRT+L IKT+G+  +Q NEELR++IK IWKRTS K+LDQV+PP G D+VTVGKFYATFLIQE FR++  KR EE  G   ++     +    RT    + P L   IS  L+     DE D+       G  RRT  +FG         G      ++ P++ +   ++  P   S SRP
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Cavefish
Match: cacna1da (calcium channel, voltage-dependent, L type, alpha 1D subunit, a [Source:ZFIN;Acc:ZDB-GENE-030616-135])

HSP 1 Score: 988.408 bits (2554), Expect = 0.000e+0
Identity = 546/900 (60.67%), Postives = 658/900 (73.11%), Query Frame = 1

HSP 2 Score: 710.679 bits (1833), Expect = 0.000e+0
Identity = 403/720 (55.97%), Postives = 496/720 (68.89%), Query Frame = 1

HSP 3 Score: 124.79 bits (312), Expect = 1.244e-27
Identity = 111/366 (30.33%), Postives = 170/366 (46.45%), Query Frame = 1
            NLA      ++ SG R       + +   P P+  A F  +  NP R  C K++    F  LIL  I  +  +LAA  P   R+ +  N  L   +  F  IFT E VLK+  +G  +H GA+ RN +NLLD L+V + L+S      S     VK LR  RVLRPLR ++    L+ V+  +  A+  + +I ++   +  ++A IG++LF GK     Y  ND    SP  C  +    Y+  D +             +   W   +    +FDN  +AM+ +F   T EGW  ++Y   DS   ++  IY         F+  III +FF+MN+ +G +   F ++ EK  K  +  K + Q

HSP 4 Score: 95.9005 bits (237), Expect = 7.409e-19
Identity = 72/256 (28.12%), Postives = 126/256 (49.22%), Query Frame = 1
            E E  N E +K +    E A    P+ + I K  F  R+R W           + S PF +++ +L+ LNT++++ +   QP    QV D  N V   +FT E L+K+ + G + YF   +N FD  +V G   + I   +   +        + I+ FR  R++R+ K+      +  L+ + + S +++  + LL+ +   I++++GMQ+FG     +E + K     + F  FPQA+L +F+  TGE W  +M

HSP 5 Score: 91.6633 bits (226), Expect = 1.258e-17
Identity = 68/252 (26.98%), Postives = 138/252 (54.76%), Query Frame = 1
            +V S  F +++ VL+ LNT  L  +HY QS   +   +  N+ F  +FT+EM++K+ +   R YF   +N FD  +V+ S+++I + +   T+    + ++  R  R++R+ K+      +R L+ + + S +++  + +L+ +   I++++GMQ+FG     D     R +NF +F Q++L +F+  TGE W E+M   +        S  N G+     S  + +Y++  ++   ++++N+F+A+ +DN 

HSP 6 Score: 89.3521 bits (220), Expect = 6.582e-17
Identity = 74/316 (23.42%), Postives = 137/316 (43.35%), Query Frame = 1
            +NP++     +V    FEY++   I  N   LA         S T N  ++ + + F  +FT E VLK++AF     P  Y  + WN  D LIV+  ++   +++++      +      R FRV+R ++L+S    ++ ++ + +++   L ++ALL   +  IYA+IG+++F GK+          M++      T +N+                  N N              F  F  A+L +F+C T E W +IM                     + G S+  +YF++  ++ +F ++NL + V+   F

HSP 7 Score: 78.1814 bits (191), Expect = 1.534e-13
Identity = 63/269 (23.42%), Postives = 117/269 (43.49%), Query Frame = 1
            L+  +PF+  I + I  N ++LA+     +         ++ +   F  +FT+E  LK+ A+G       Y  + WN+ DF+IV+     ++ + +  T +  + D  + I                     R FRV+R ++L+S    ++ +L + +K+   L ++ALL++ +  IYA+IG+++F                           G+  T N  E +E          NF  F  A+L +F+  T E W ++ L+ + DAM

HSP 8 Score: 78.1814 bits (191), Expect = 1.755e-13
Identity = 86/370 (23.24%), Postives = 157/370 (42.43%), Query Frame = 1
            FDN P A+LT+F + T E W  V+Y  I +    Y G  ++  IV I++I   I   + ++N+F+   +     E +E     E+    R  I   +K + +   IP+ S           R     LI    F  +I V IML++ SLA    + P R       ++ Y +  FT +FTVE +LK+  +G         +NYF    N+ D ++V  S +              +   +  +   R+ RV+R ++ ++R +G++ ++     + + +  + ++  +L F++A IG+Q+F                           G +     ++    N + NF     A++ LF  +T E W  ++

HSP 9 Score: 77.7962 bits (190), Expect = 2.129e-13
Identity = 78/300 (26.00%), Postives = 125/300 (41.67%), Query Frame = 1
            + F    NN  R+ C  +     F   +L+ I  +   LA   P   D  +S N  L   +Y F  +FT+E  LK+I YGLV H  A+ R+  N+LD ++V+  + S  +  + ++         V  PL A   A G                            L+ V+  ++ A+  + +I L+   +  ++A+IG++LF GK  +       +S++    C     G+    N  +        RE  + P     NFDN   AMLT+F   T EGW  VLY   D+   +   +Y
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Cavefish
Match: cacna1da (calcium channel, voltage-dependent, L type, alpha 1D subunit, a [Source:ZFIN;Acc:ZDB-GENE-030616-135])

HSP 1 Score: 987.252 bits (2551), Expect = 0.000e+0
Identity = 544/899 (60.51%), Postives = 658/899 (73.19%), Query Frame = 1

HSP 2 Score: 701.049 bits (1808), Expect = 0.000e+0
Identity = 393/703 (55.90%), Postives = 478/703 (67.99%), Query Frame = 1

HSP 3 Score: 124.405 bits (311), Expect = 1.573e-27
Identity = 111/366 (30.33%), Postives = 170/366 (46.45%), Query Frame = 1
            NLA      ++ SG R       + +   P P+  A F  +  NP R  C K++    F  LIL  I  +  +LAA  P   R+ +  N  L   +  F  IFT E VLK+  +G  +H GA+ RN +NLLD L+V + L+S      S     VK LR  RVLRPLR ++    L+ V+  +  A+  + +I ++   +  ++A IG++LF GK     Y  ND    SP  C  +    Y+  D +             +   W   +    +FDN  +AM+ +F   T EGW  ++Y   DS   ++  IY         F+  III +FF+MN+ +G +   F ++ EK  K  +  K + Q

HSP 4 Score: 96.2857 bits (238), Expect = 5.173e-19
Identity = 72/256 (28.12%), Postives = 126/256 (49.22%), Query Frame = 1
            E E  N E +K +    E A    P+ + I K  F  R+R W           + S PF +++ +L+ LNT++++ +   QP    QV D  N V   +FT E L+K+ + G + YF   +N FD  +V G   + I   +   +        + I+ FR  R++R+ K+      +  L+ + + S +++  + LL+ +   I++++GMQ+FG     +E + K     + F  FPQA+L +F+  TGE W  +M

HSP 5 Score: 93.9745 bits (232), Expect = 2.597e-18
Identity = 77/316 (24.37%), Postives = 138/316 (43.67%), Query Frame = 1
            +NP++     +V    FEY++   I  N   LA         S T N  ++ + + F  +FT E VLK++AF     P  Y  + WN+ D L+VI  ++  VLS++       +      R FRV+R ++L+S    ++ ++ + +++   L ++ALL   +  IYA+IG+++F GK+          M++      T +N+                  N N              F  F  A+L +F+C T E W +IM                     + G S+  +YF++  ++ +F ++NL + V+   F

HSP 6 Score: 93.2041 bits (230), Expect = 4.193e-18
Identity = 72/252 (28.57%), Postives = 139/252 (55.16%), Query Frame = 1
            +V S  F +++ VL+ LNT  L  +HY QS   +   +  N+ F  +FT+EM++K+ +   R YF   +N FD  VVI SI++IV+ +   T+    + ++  R  R++R+ K+      +R L+ + + S +++  + +L+ +   I++++GMQ+FG     D     R +NF +F Q++L +F+  TGE W E+M   +        S  N G+     S  + +Y++  ++   ++++N+F+A+ +DN 

HSP 7 Score: 80.4925 bits (197), Expect = 3.042e-14
Identity = 77/279 (27.60%), Postives = 124/279 (44.44%), Query Frame = 1
            + F    NN  R+ C  +     F   +L+ I  +   LA   P   D  +S N  L   +Y F  +FT+E  LK+I YGLV H  A+ R+  N+LD ++V+  + +    +        ++ LR  R LR +    G+  +   +   +K++  ++ +  L+ F   ++A+IG++LF GK  +   +  +  IS         E + A   VN             RE  + P     NFDN   AMLT+F   T EGW  VLY   D+   +   +Y

HSP 8 Score: 79.337 bits (194), Expect = 8.338e-14
Identity = 62/254 (24.41%), Postives = 112/254 (44.09%), Query Frame = 1
            L+  +PF+  I + I  N ++LA+     +         ++ +   F  +FT+E  LK+ A+G       Y  + WN+ DF+IV+          +    + H G      +   R FRV+R ++L+S    ++ +L + +K+   L ++ALL++ +  IYA+IG+++F                             G+  T N  E +E          NF  F  A+L +F+  T E W ++ L+ + DAM

HSP 9 Score: 78.5666 bits (192), Expect = 1.269e-13
Identity = 86/370 (23.24%), Postives = 157/370 (42.43%), Query Frame = 1
            FDN P A+LT+F + T E W  V+Y  I +    Y G  ++  IV I++I   I   + ++N+F+   +     E +E     E+    R  I   +K + +   IP+ S           R     LI    F  +I V IML++ SLA    + P R       ++ Y +  FT +FTVE +LK+  +G         +NYF    N+ D ++V  S +              +   +  +   R+ RV+R ++ ++R +G++ ++     + + +  + ++  +L F++A IG+Q+F                           G +     ++    N + NF     A++ LF  +T E W  ++
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Cavefish
Match: cacna1da (calcium channel, voltage-dependent, L type, alpha 1D subunit, a [Source:ZFIN;Acc:ZDB-GENE-030616-135])

HSP 1 Score: 983.786 bits (2542), Expect = 0.000e+0
Identity = 544/899 (60.51%), Postives = 657/899 (73.08%), Query Frame = 1

HSP 2 Score: 696.812 bits (1797), Expect = 0.000e+0
Identity = 405/712 (56.88%), Postives = 498/712 (69.94%), Query Frame = 1

HSP 3 Score: 123.635 bits (309), Expect = 2.566e-27
Identity = 111/366 (30.33%), Postives = 171/366 (46.72%), Query Frame = 1
            NLA      ++ SG R       + +   P P+  A F  +  NP R  C K++    F  LIL  I  +  +LAA  P   R+ +  N  L   + VF  +FT E VLK+  +G  +H GA+ RN +NLLD L+V + L+S      S     VK LR  RVLRPLR ++    L+ V+  +  A+  + +I ++   +  ++A IG++LF GK     Y  ND    SP  C  +    Y+  D +             +   W   +    +FDN  +AM+ +F   T EGW  ++Y   DS   ++  IY         F+  III +FF+MN+ +G +   F ++ EK  K  +  K + Q

HSP 4 Score: 92.8189 bits (229), Expect = 6.161e-18
Identity = 66/251 (26.29%), Postives = 122/251 (48.61%), Query Frame = 1
            T  ++GE+E   C        C     + +   R+      R +    + S PF +++ +L+ LNT++++ +   QP    QV D  N V   +FT E L+K+ + G + YF   +N FD  +V G   + I   +   +        + I+ FR  R++R+ K+      +  L+ + + S +++  + LL+ +   I++++GMQ+FG     +E + K     + F  FPQA+L +F+  TGE W  +M

HSP 5 Score: 92.0485 bits (227), Expect = 1.157e-17
Identity = 68/252 (26.98%), Postives = 138/252 (54.76%), Query Frame = 1
            +V S  F +++ VL+ LNT  L  +HY QS   +   +  N+ F  +FT+EM++K+ +   R YF   +N FD  +V+ S+++I + +   T+    + ++  R  R++R+ K+      +R L+ + + S +++  + +L+ +   I++++GMQ+FG     D     R +NF +F Q++L +F+  TGE W E+M   +        S  N G+     S  + +Y++  ++   ++++N+F+A+ +DN 

HSP 6 Score: 89.3521 bits (220), Expect = 6.642e-17
Identity = 74/316 (23.42%), Postives = 137/316 (43.35%), Query Frame = 1
            +NP++     +V    FEY++   I  N   LA         S T N  ++ + + F  +FT E VLK++AF     P  Y  + WN  D LIV+  ++   +++++      +      R FRV+R ++L+S    ++ ++ + +++   L ++ALL   +  IYA+IG+++F GK+          M++      T +N+                  N N              F  F  A+L +F+C T E W +IM                     + G S+  +YF++  ++ +F ++NL + V+   F

HSP 7 Score: 77.0258 bits (188), Expect = 3.966e-13
Identity = 87/370 (23.51%), Postives = 157/370 (42.43%), Query Frame = 1
            FDN P A+LT+F + T E W  V+Y  I +    Y G  ++  IV I++I   I   + ++N+F+   +     E +E     E+    R  I   +K + +   IP+ S           R     LI    F  +I V IML++ SLA    + P R       V+ Y + VFT +FT E +LK+  +G         +NYF    N+ D ++V  S +              +   +  +   R+ RV+R ++ ++R +G++ ++     + + +  + ++  +L F++A IG+Q+F                           G +     ++    N + NF     A++ LF  +T E W  ++

HSP 8 Score: 76.6406 bits (187), Expect = 4.975e-13
Identity = 64/280 (22.86%), Postives = 119/280 (42.50%), Query Frame = 1
            L+  +PF+  I + I  N ++LA+              D      + +++ +   F  +FT+E  LK+ A+G       Y  + WN+ DF+IV+     ++ + +  T +  + D  + I                     R FRV+R ++L+S    ++ +L + +K+   L ++ALL++ +  IYA+IG+++F                             G+  T N  E +E          NF  F  A+L +F+  T E W ++ L+ + DAM

HSP 9 Score: 72.0182 bits (175), Expect = 1.339e-11
Identity = 81/313 (25.88%), Postives = 126/313 (40.26%), Query Frame = 1
            + F    NN  R+ C  +     F   +L+ I  +   LA   P   D  +S N  LN           +Y F  +FT+E  LK+I YGLV H  A+ R+  N+LD ++V+  + S  +  + ++         V  PL A   A G                            L+ V+  ++ A+  + +I L+   +  ++A+IG++LF GK  +   +  +  IS         E + A   VN             RE  + P     NFDN   AMLT+F   T EGW  VLY   D+   +   +Y
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005302.1 (pep scaffold:Pmarinus_7.0:GL483978:134:5921:-1 gene:ENSPMAG00000004828.1 transcript:ENSPMAT00000005302.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 463.766 bits (1192), Expect = 6.590e-149
Identity = 233/346 (67.34%), Postives = 262/346 (75.72%), Query Frame = 1

HSP 2 Score: 52.7582 bits (125), Expect = 6.145e-7
Identity = 39/154 (25.32%), Postives = 81/154 (52.60%), Query Frame = 1
            + ++  R  R+LR+ K+      +R L+ + + S +++  + +L+ +   I++++GMQ+FG     D     R+N F +F Q++L +F+  TGE W ++M           D   S G      S  +  Y+V  ++   ++++N+F+A+ +DN
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007697.1 (pep scaffold:Pmarinus_7.0:GL478030:18311:55165:1 gene:ENSPMAG00000006953.1 transcript:ENSPMAT00000007697.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 301.597 bits (771), Expect = 9.738e-89
Identity = 201/358 (56.15%), Postives = 246/358 (68.72%), Query Frame = 1

HSP 2 Score: 154.451 bits (389), Expect = 8.304e-39
Identity = 94/157 (59.87%), Postives = 116/157 (73.89%), Query Frame = 1

HSP 3 Score: 90.8929 bits (224), Expect = 1.764e-18
Identity = 62/230 (26.96%), Postives = 114/230 (49.57%), Query Frame = 1
            C+  A + +   R+      R +    + S  F +++ +L+ LNT+++A +   QP    QV D  N V   +FTVE L K+ + G + YF   +N FD  +V G  I+ I       +        + I+  R  R++R+ K+      +  L+ + + S +++  + LL+ +   I++++GMQ+FG     +E + K     + F  FPQ++L +F+  TGE W  +M

HSP 4 Score: 83.1889 bits (204), Expect = 4.540e-16
Identity = 54/149 (36.24%), Postives = 79/149 (53.02%), Query Frame = 1
            P P+  A F  +  NP R  C +++    F  LIL  I  +  +LAA  P   R+ +  N+ L   +  F  IFT E +LK+ ++G  +H G++ RN +NLLD L+V + L+S      S     VK LR  RVLRPLR ++    L+V

HSP 5 Score: 55.0694 bits (131), Expect = 2.589e-7
Identity = 73/309 (23.62%), Postives = 133/309 (43.04%), Query Frame = 1
            C+ L   +R+   FC +     V+   F ++++  +F N   +A+   Y + D   +    +    V + +FT E + K+ + G      AY  + +N  D  +V  G+I T+L +     P  +  LR  R+LR  ++     +L  ++ S++ +M  +  + LL    III++++G++LF GK +                                         ++ +T R        ++FDNF  ++LTVFQ +T E W  +M      Y    S GM    IYF+ L I G+  ++N+ L +
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010500.1 (pep scaffold:Pmarinus_7.0:GL477503:21958:35427:1 gene:ENSPMAG00000009511.1 transcript:ENSPMAT00000010500.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 283.108 bits (723), Expect = 1.479e-86
Identity = 153/308 (49.68%), Postives = 186/308 (60.39%), Query Frame = 1
            S QALPYV LLI MLFFIYA++GMQ+FG +  ++E  + E   +NNFQTF QA+++LFRSATGEAWQ IML CL    C+  S                       N   V                        CGS+FAY YF+SF  +CSFL++NLFVAVIMDNF+YLTRD SILGPHHLDEFVR+W +YDP A GRI +  +  LLR ++PPLG GK CP R A   LVRM+MP+  D TV F  TL AL+RT L IK   +  D  + + ELR  +  IW   SQK LD +VPP    D+TVG
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007700.1 (pep scaffold:Pmarinus_7.0:GL478030:35286:55231:1 gene:ENSPMAG00000006953.1 transcript:ENSPMAT00000007700.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 277.33 bits (708), Expect = 1.515e-81
Identity = 162/241 (67.22%), Postives = 192/241 (79.67%), Query Frame = 1

HSP 2 Score: 154.836 bits (390), Expect = 1.358e-39
Identity = 94/157 (59.87%), Postives = 116/157 (73.89%), Query Frame = 1

HSP 3 Score: 88.1965 bits (217), Expect = 1.000e-17
Identity = 59/210 (28.10%), Postives = 107/210 (50.95%), Query Frame = 1
            R +    + S  F +++ +L+ LNT+++A +   QP    QV D  N V   +FTVE L K+ + G + YF   +N FD  +V G  I+ I       +        + I+  R  R++R+ K+      +  L+ + + S +++  + LL+ +   I++++GMQ+FG     +E + K     + F  FPQ++L +F+  TGE W  +M

HSP 4 Score: 82.4185 bits (202), Expect = 5.556e-16
Identity = 54/149 (36.24%), Postives = 79/149 (53.02%), Query Frame = 1
            P P+  A F  +  NP R  C +++    F  LIL  I  +  +LAA  P   R+ +  N+ L   +  F  IFT E +LK+ ++G  +H G++ RN +NLLD L+V + L+S      S     VK LR  RVLRPLR ++    L+V

HSP 5 Score: 54.299 bits (129), Expect = 3.238e-7
Identity = 70/297 (23.57%), Postives = 129/297 (43.43%), Query Frame = 1
            +FC +     V+   F ++++  +F N   +A+   Y + D   +    +    V + +FT E + K+ + G      AY  + +N  D  +V  G+I T+L +     P  +  LR  R+LR  ++     +L  ++ S++ +M  +  + LL    III++++G++LF GK +                                         ++ +T R        ++FDNF  ++LTVFQ +T E W  +M      Y    S GM    IYF+ L I G++ ++N+ L +
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008632.1 (pep scaffold:Pmarinus_7.0:GL481395:151307:166184:-1 gene:ENSPMAG00000007818.1 transcript:ENSPMAT00000008632.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 274.633 bits (701), Expect = 6.382e-80
Identity = 165/242 (68.18%), Postives = 194/242 (80.17%), Query Frame = 1

HSP 2 Score: 160.229 bits (404), Expect = 5.477e-41
Identity = 98/158 (62.03%), Postives = 119/158 (75.32%), Query Frame = 1

HSP 3 Score: 84.3445 bits (207), Expect = 1.973e-16
Identity = 60/169 (35.50%), Postives = 86/169 (50.89%), Query Frame = 1
            ++  G R R  +  Q      P P+  A F  +  NPFR  C  I+    F  LIL  I  +  +LAA  P   R ++  N  L   +  F  IFT E +LK+ A+G  +H G++ R+ +NLLD L+V + LIS  + + S     VK LR  RVLRPLR ++    L+

HSP 4 Score: 81.2629 bits (199), Expect = 1.595e-15
Identity = 56/204 (27.45%), Postives = 107/204 (52.45%), Query Frame = 1
            + S  F +++ VL+ LNT+++A +   Q Q    V D  N V   +FT+E L+K+ + G + YF   +N FD  +V G  ++ I   +   +        + I+  R  R++R+ K       +  L+ + + S +++  + LL+ +   I++++GMQ+FG     +E ++    R ++F  FP A+L +F+   TGE W ++M

HSP 5 Score: 58.9214 bits (141), Expect = 1.374e-8
Identity = 74/291 (25.43%), Postives = 126/291 (43.30%), Query Frame = 1
            C   V+   F ++++  +F N   +A+      +    +     K   V + +FT E ++KI + G      AY  + +N  D  +V  G++ T+L ++    P  +  LR  R+LR  +      SL  ++ S++ +M  +  + LL    III++++G++LF GK                                           N +ET       +  +SFDNF  A+LTVFQ I T E W  +MY  I    G S+P     IYF+ L I G++ ++N+ L +

HSP 6 Score: 51.2174 bits (121), Expect = 3.435e-6
Identity = 43/184 (23.37%), Postives = 83/184 (45.11%), Query Frame = 1
            + +E      +    R+  E  +K K V   +P+ S          FR     +I    F  +I V IML+++SLA +   +   +  +++ Y +  FT +FT+E +LK+ A+G    K  F  ++ N+ D ++V  S I                  +  +   R+ RV+R ++ ++R +G++
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Yeast
Match: CCH1 (Voltage-gated high-affinity calcium channel; involved in calcium influx in response to some environmental stresses as well as exposure to mating pheromones; interacts and partially co-localizes with Mid1p; however, evidence suggests CCH1 is not required for Mid1p function [Source:SGD;Acc:S000003449])

HSP 1 Score: 105.531 bits (262), Expect = 1.016e-22
Identity = 161/764 (21.07%), Postives = 305/764 (39.92%), Query Frame = 1
            S++ F P ++FR+FC  +                          +F +I   V V I   + +L         PL     +    N+    D  F   F++E  +K +  G ++   A+ R+  N +D  V+++   ++I+Y  NN  +S +              I+     +     +   +  I    L++  L F F V G+ +F G+  +CND S      C  +Y   + +      ++ R +    L+ D+  +A  +L+ + + EGW  +L   ++S               ++F + +  +   F++N+FV F++    +     Y   E +K   +  +   +AKP  + IP        + F Y++   +  + F Y  F+ ++L   I + L     P           M  T VF ++  L +   G + YF   WN     I++ +FI + +  HV  ++   +N +G  L+ I  F          ++ + + +  LL T + S   +  +     +LF +YA+   Q+FG       +       N NF+T  ++++VLFR + GE W  IM                     +LTV     + +                        S Y D   CGS  +AY   +S+ +I  ++ +N+FV++I+ NF Y+ R     S +    + +++  WS++D +  G ++   +  ++   + PL F K    R    +LV   M +N D

HSP 2 Score: 74.7146 bits (182), Expect = 2.570e-13
Identity = 55/218 (25.23%), Postives = 108/218 (49.54%), Query Frame = 1
            ++  FI  F+ E ++K +A GFI  P AYLRN WN +DF  V+I +   +++ +   G   +  +    LR LR ++   + +   N +M   +  +F   L++L ++  + + GL +F G+L  TC   ND           S+ +    +++ +S F++     +     +  P + +   D+F  A  +++Q I++EGW  ++  + +S G+  P

HSP 3 Score: 70.0922 bits (170), Expect = 6.689e-12
Identity = 65/280 (23.21%), Postives = 122/280 (43.57%), Query Frame = 1
            P A+ R+ WN +D +  +   +G+  ++ S  ++ G  + K L   R+LR + + +G+PS   ++  +   +  L +++ + ++  I + I+G+++F G     C   N    E P                P +              SV+KG+ C  +        C  N N       P  G  SFDN   +M  VF  ++   +T +MY+  DS  M+   ++F+  I + + +++NL++ VL   F    E+ KK+     +R+       V GY
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Nematostella
Match: EDO46991 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNU9])

HSP 1 Score: 1522.29 bits (3940), Expect = 0.000e+0
Identity = 920/1787 (51.48%), Postives = 1173/1787 (65.64%), Query Frame = 1
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Nematostella
Match: EDO36844 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHI0])

HSP 1 Score: 226.868 bits (577), Expect = 3.485e-59
Identity = 180/573 (31.41%), Postives = 296/573 (51.66%), Query Frame = 1
            S ++F P+N+FR     +  +  F   VL+ I+++  ++A E P +   S   R+++   Y+F  +FT+E+ +KVI  GL     A+ RS  N++D  +V+ S    I++   N  N  + V+++ R LR LRPLR I+RA GLK VV+ ++ ++K IGNI+L+      +F ++GVQLF GKF  C D  V   T   C                 N   W+N   NFDN+  A+LTLF  ST +GW  ++Y  ID+   D   I N+     I+++ ++++  F ++N+ VG V+  FQ+        +  +E K  + ++  R+  E A        Y   + F + V    T   F+  I  +I LN + +AL+  +QP      +   N VFT VF +E +LK+ A G K Y  D WN  D +IV+ S + I  +       +N T           I   R+ R+ R++KLL   EGIR LL T  ++   +  + +L +++FFI++ +G+++FGKI  E      + ++ + NF++F  A+L LFR +TG+ W  I+   +   +C

HSP 2 Score: 144.05 bits (362), Expect = 6.034e-34
Identity = 102/352 (28.98%), Postives = 171/352 (48.58%), Query Frame = 1
            TP  S + NP             R   +L+     N FR    ++ + K F+  +L  I  NC  +A   P      + +  +LE+  I++   VF+ IFT E ++K++A G  + P AYLR+GWN++D  +V+I  +  +++  + G   +    +  RA R LRPLR++S  P L++V+ +++ ++ P+ +I L+A    II+ I+G++LF GK H           ++ VP +T                K  C +N      W        +FDN   A+LT+F   T +GW  IMY   D+VG+          +  IYFV  +++  F V+N+++GV+   F K R

HSP 3 Score: 128.257 bits (321), Expect = 3.973e-29
Identity = 92/241 (38.17%), Postives = 141/241 (58.51%), Query Frame = 1
            V S+ F +V++  +F+NT  +  E+Y Q   +       N IF  +F +EM++K+  LG   Y    FN FD  +VI S++E+           G+SVLR  RLLRVFK+ R+  +LR  +  ++ +M ++++ L LL +F+   S+LGM LFGGK+ F          R+NFD    +++TVFQ+LT EDWN VMYDG+R+      +S  + LY+++L   GNYIL N+ +AI V+  A

HSP 4 Score: 105.916 bits (263), Expect = 2.137e-22
Identity = 75/249 (30.12%), Postives = 126/249 (50.60%), Query Frame = 1
            + A+RA RVLRPLR ++ +PS+++++  ++  +  L ++  +   +  I+ I+G++++ G L S C ++                     +D++   P            +P ST+   G +C      G  Y    N+    N  + W+       +MGI       SFDN  +A + +FQ IT+EGWT IMY+I D+ G  W +IYFV LI+IGS+F+ NL L V++ +F  +K+RE    R   +K

HSP 5 Score: 103.605 bits (257), Expect = 1.111e-21
Identity = 60/204 (29.41%), Postives = 108/204 (52.94%), Query Frame = 1
            + S+ F Y+I   I +NT+++ +++  QPQ+   V++  N +FT +F +E ++KL   GF  Y  DA+N+FD  IV+ S +++  D  +G            I+  R FR++R+ KL+     +R  L   + +   +     L+V+  F  +++GM +F GK    N++ + E +R  NF     AI+ +F+  T E W  +M

HSP 6 Score: 94.7449 bits (234), Expect = 5.024e-19
Identity = 82/316 (25.95%), Postives = 139/316 (43.99%), Query Frame = 1
            FR  C   V+ K F Y+I+  IF N   +       P++    +   LE    +F  IF  E ++K++  GF      Y+++ +N+ D  IVII    +V+    +    +  LR+FR+LR  +LV  LP+L+       R ++ + H     +  LAL VI ++  +I+G+ LF GK                                    +++   +   ETSR         +FD+   A++TVFQ +T E W  +MY   D +  +  W  +YF+ L+ IG++ + NL++ +L   F+         G Y

HSP 7 Score: 76.6406 bits (187), Expect = 1.652e-13
Identity = 63/196 (32.14%), Postives = 112/196 (57.14%), Query Frame = 1
            +  ++ LN   +  EHY+Q   L +F   AN +F  +F LE ++K+++LG++ Y    +N+ D  +VI SI+ I + + T  +P  P  + V+R  R+ RV K+ +    +R L+ ++  ++  + +L +L  L   IFS LG++LFG K + +K           +NF SF  ++LT+F+I TG++WN ++ D I

HSP 8 Score: 70.8626 bits (172), Expect = 1.123e-11
Identity = 64/259 (24.71%), Postives = 114/259 (44.02%), Query Frame = 1
            RKF   +     F+  I   I  N   +A    Y + D   + + L+    VF  +F  E +LKI A G       Y+++ WN LD LIVI+ ++   L +M+   P     ++ +R  R+ R L+L+     ++ +++++ +A+  + ++ +L L +  I++ +G+ELF GK+            E P         G  C   D H+                         +F +FG+AMLT+F+  T + W  I+

HSP 9 Score: 66.2402 bits (160), Expect = 2.238e-10
Identity = 73/269 (27.14%), Postives = 138/269 (51.30%), Query Frame = 1
            L +++ F   V++ + LN  V+  E    S+   S +    +    +F+ +FT+EM++K+ +LG+      Y    +N  D F+V+ S +++++  T       LGV  V R  R LR  +V      L+ +V +L++S+K I +++++   F +IF +LG+QLF GKF++   A  P +                 NFD+  ++LLT+F   T + W  +MYDGI + G     +   +  + +Y+V   +   +++LN+ + + V+N
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Nematostella
Match: EDO35497 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLD1])

HSP 1 Score: 213.772 bits (543), Expect = 6.964e-59
Identity = 169/538 (31.41%), Postives = 294/538 (54.65%), Query Frame = 1
            +FR+    +C+H  F  ++LV I+ S A+LA E P  AE    R I++    +FT +FT+E+ +K++  GLV   G + R   ++LD  +V+ S    I++Y   ++ + +  +++ R LR LRPLR I RA GLK VVQ ++ ++K IGN +L+  +   MF ++GVQLF GKF  C     ++H+  + +                 +W+N   NFD++  A+++LF VST +GW  +++  ID+   D   I N      +++I ++++  F ++N+ VG V+  FQ+   E     E  +  RK  +   + +    Y      R ++ ++ T R ++  I  +I +N I ++L+  K PQ + +  +Y    FT VF +E ++K+ A GF  Y  D WN+ D  IVL S   I+ + +   ++      + ++   R+ RV++LVKL    +G+R+LL T  ++   +P + LL  +LFFIY+ +G+Q+FG +   ++   +  NR+ +F+ F  A+L LFR ATG+ W  I+

HSP 2 Score: 139.428 bits (350), Expect = 5.567e-34
Identity = 94/338 (27.81%), Postives = 170/338 (50.30%), Query Frame = 1
            FR+    +   + F+Y+IL  I  +C  LA   P    +       ++   LVF +IFT E ++K++A G ++ PG YLR+GW++LD  +V++  I  +++  S   P+V    +  RA R LRPLR++   P L++V+ +++ ++ P+ +  L+A    +++ I+G++LF GK +   Y + D  + S   C+ S     VN+ Y                                +FD+   A++++F   T +GW +IM+   D+V +          W  +YF+  +++G F V+N+++GV+   F +      E E+A+   K +KAR QMQ

HSP 3 Score: 103.99 bits (258), Expect = 2.196e-22
Identity = 64/233 (27.47%), Postives = 116/233 (49.79%), Query Frame = 1
            FR R+  + + R F+Y+I V I+ +   LA++     ++    Q++D   +VFT +FT+E L+KL A G       Y  D W+V D  +V+ S+IDII  + +  +    G    ++  FR  R +R ++++ R  G++ ++ T + S + +    L+  + F ++ ++G+Q+F               K    N    + +NR  NF    QA++ LF  +T + W  IM H

HSP 4 Score: 67.0106 bits (162), Expect = 9.382e-11
Identity = 67/226 (29.65%), Postives = 118/226 (52.21%), Query Frame = 1
            +AF +V++V +  +  VL  E          RQ I      + + ++F ++FT+EMLIK+ ++G+      Y    ++  D F+V+ S ++I++  T  + P  LG + V R  R LR  +V R    L+ +V +LL S+K I + +++  +F V+F +LG+QLF GKF +                   +    R NFD  +Q+L+++F + T + W E+M+ GI
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Nematostella
Match: EDO46797 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP56])

HSP 1 Score: 220.32 bits (560), Expect = 2.556e-57
Identity = 197/652 (30.21%), Postives = 318/652 (48.77%), Query Frame = 1
            KFR        H +F   +L  +MVSS  L  ED  L  +    R LN+ ++LF ++F++E  LKVI +G V    ++  S  N LD L+V   + ++    N  +SV +  R +R LRPLRAI+R  G+K V+  +  A+  IG++++V+ L   MF++ GVQLF GKF  C +                +E     V  NK          W+N  +NFDNV N  L L  V+T+EGW  V+  ++DS K D    Y    I   +++ +IIV +FF++N+FVG +I  F   ++  EE  +    L ++QRK ++  + A     P  R  P   FR +++ L++S  FE  I  +IM N   + ++   QP     + +Y   V  G+F +E ++K+ A    +YF  AW++FDF++V+ S + +       +     G     +   R+FRV RL++++   + IR LL   + S  AL  +  L+ ++ FIYA+IGM  FG I     K+   +N   NF+TF  +I+++FR  TG  W +I+                                     D++V+ PPH   NF  +              CG      +++  Y++  FLII N+++AV++DN +

HSP 2 Score: 146.747 bits (369), Expect = 8.335e-35
Identity = 98/312 (31.41%), Postives = 158/312 (50.64%), Query Frame = 1
            +L CL   +P R FCI ++    FE ++   I  NC  L  N P PE           + E +F  I+T E + KI++ GF+    AYLR+ WN LD L+V +  +S          PD+ +L   R  RVLR  R +S L  L+ ++NS++R++  L  + +L LF + + A+IGL+LF+G+L + C   + N   + +P        +   C    ++G    C  N    +     P+ G T+FD+ G +++  FQ +TM+ W  +   +  S+G  W  +YFV  I   SF+++NLVL V+   +  E

HSP 3 Score: 118.242 bits (295), Expect = 3.501e-26
Identity = 92/323 (28.48%), Postives = 161/323 (49.85%), Query Frame = 1
            FC L  R   R F    VE + FE+ ILFT+  +   L     +  +  + +  AL  +  +F  IF+ E +LK++ FGF+    +Y  + WN LD LIV + +    L +     P++   R+FR    LRPLR +S L  ++VV+N++  A+  +  + ++++   ++++I G++LF+GK +    ++++ +  S +P  T+                  C D+ +   RW   N+   +FDN     L + Q  T EGW ++M    DS  +            + YFV  II+GSFFV+NL +GV+   F+  ++K ++

HSP 4 Score: 92.8189 bits (229), Expect = 2.001e-18
Identity = 59/205 (28.78%), Postives = 107/205 (52.20%), Query Frame = 1
            RP F+ II  LI+LNT+ L + +   P     V+D LN +FTG+F +E ++K+ AFG   Y  + WN+FD +I++ S +     +  GT+          ++ FR+ R++R++ L    E +  L+     S   +  +  ++ ++ +++AV+GM++FG   T      + I R  NF  F  + +++FR    E W   +  C+

HSP 5 Score: 87.4261 bits (215), Expect = 1.004e-16
Identity = 70/245 (28.57%), Postives = 130/245 (53.06%), Query Frame = 1
            ++   F  ++  L+ LNT VLT  ++     L    +  N IF  LF LEM++K+++ G+  Y              +++ + V+I T A+        GVS+ R  RLLRV  + + W ++  L+ ++  S+  I ++  +L + I +F+++GM++FG  +    F  +  PR NF  F  S + VF+IL  E W E ++D +R       ++  + L+++   I GN+I+LN+F+A+ +++ A

HSP 6 Score: 73.559 bits (179), Expect = 1.553e-12
Identity = 71/276 (25.72%), Postives = 132/276 (47.83%), Query Frame = 1
             +S    GP +  R FC  +  HP+F  IV + I+V+  +L   DP +            +Y+FT+++T+E+  K+I+ G V  + A+ R + N LD LVV  S +S   +  ++S ++ LRVLR  R + A+   KGL+ +V  ++ ++K + +++++      + A+IG+QLF G+ ++ C   + N          Y+ E +                   +A V  N         NFD++  +++  F + T + W  +  + + S  E Y

HSP 7 Score: 71.633 bits (174), Expect = 5.002e-12
Identity = 72/306 (23.53%), Postives = 131/306 (42.81%), Query Frame = 1
            C  +VE+  +P F+ +I   I  N   L   T Y     + +   L+ +  +F  +F  E ++KI AFG +     Y+ N WNL D +I+I   ++  L   S G   V   R  R+LR L L     ++  ++ +I  ++ P+F+I  +   +I ++A++G+ +F                             Y  + F S G             RW        +F +F  + + VF+ +  E W + + W    V  +   ++F+  +I+G+F V+NL + +L   F+K+ E   +    Q

HSP 8 Score: 66.2402 bits (160), Expect = 2.723e-10
Identity = 76/327 (23.24%), Postives = 140/327 (42.81%), Query Frame = 1
            P    R     LIT   FE I+ ++I++N I L L  +  P+  E +       FT ++T+E + K+ + GF      Y  D WN  D ++V  S++ +  D             + S++  R  RV+R  + +S  +G+R ++ + ++S + L  V +L +    + A+IG+Q+F G++  +   E       NN    +    + +L  F S  G         C  +  C A             V      G   F+D   S+V+     F  + ++ + + Y  V +    +   YF+     CSF ++NL +AV+  ++ +

HSP 9 Score: 65.0846 bits (157), Expect = 4.907e-10
Identity = 72/267 (26.97%), Postives = 125/267 (46.82%), Query Frame = 1
            V+ + F W ++  V +++  L  E  H  Q   L+   N  N +F  +F+LE ++K+   G   YF  ++N  D  +V   +    + +    P L V    R  R LR  +       ++ ++ +L A++  I S+LV+  LF ++FS+ G+QLF GKF       D+K  P                      NFD+ +   L + Q+ T E W EVM D + S     + S    +++  Y+V+  I G++ +LN+F+ + +DN

HSP 10 Score: 62.3882 bits (150), Expect = 3.954e-9
Identity = 57/205 (27.80%), Postives = 90/205 (43.90%), Query Frame = 1
             QI     KR P    S   RP          + FR     +V    FE  IL  I  N   +         D   + + +     V + IF  E ++KI+A    +H   Y +  W++ DF++V+  ++   L   +E     P + + LR FRV R LR+V     ++ ++ +I+ +M  LF+I  L   V+ IYAIIG+  F

HSP 11 Score: 60.4622 bits (145), Expect = 1.231e-8
Identity = 67/256 (26.17%), Postives = 139/256 (54.30%), Query Frame = 1
            LV S  F   ++ ++  N G++  +HY Q           N + V +F LE +IK+ ++ +  YF   ++ FDF VV+ SI+ + +    ++  + P  + VLR  R+ R+ +V ++   +R L+ +++ SM ++ ++  LLFL + I++++GM  FG   N  K+       NF++F  S++ +F++ TG  WN+++             + G+ + GN G    +  ++Y++ +I   + I++N+++A+ +DN+
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Nematostella
Match: EDO35661 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKR1])

HSP 1 Score: 219.935 bits (559), Expect = 3.853e-57
Identity = 218/761 (28.65%), Postives = 370/761 (48.62%), Query Frame = 1
            +  H  F  I+L  I  SS  LA ED  LD++ +  ++L   + LF  +FTVE+ LK I  G       +  +  NILD ++V+ SI   ++    ND I+ ++ LR LR  RPLRAI+R +G+K V+  ++ A+  IGN++LV  +   +F+++GVQ+F GKF  C D        C    +      ++    N   W N+ +NFD V    L L  V+TFEGW  ++  ++D+ K D   I  N     +F++ +II+  FF +N+F+G +I  F Q  ++      +D       +N    ++ A   KP +R   P+  F+  ++ ++ SR FE  I + I +N + + ++ +D      +Q+   LN++FT VF +E +L++ A   K YF + WNVFDF+IV+ S I II +++  +     +              R F   R         GIR LL++ V S  AL  +  L+ ++ FIYA+IGM +FG +     K+ + +N   NF+TF  + ++LFR  T   W +I   ++   PD  CD         Y      R   +GN                                CG+ +  P ++  +++  FLI IN+++AVI++N++ +     I +    ++ F ++W  +DP A   I + D+   + ++   L   K  P++ AC  L   N+PL     +     L ALV+   +I +    VD  +E  ++V++++ +R

HSP 2 Score: 161.384 bits (407), Expect = 3.206e-39
Identity = 115/371 (31.00%), Postives = 184/371 (49.60%), Query Frame = 1
            ++L+     NP R+F +K++  + P +       +L TI  NC  LA   P PE+            E VF  I+T E   KI+A GF +H  AYLR+ WN LDF++VI+G ++          PDV  L     FRV R LR +S +  L+ ++N+++ +M  L+ + +L LF I I+A+IG++LF G+L + C       +  P     S +  +  +D       +++G +  C  N        G PN G TSFD+FG A+LT FQ IT++ W  +    N+ +    PW  +YF  +I  G FF++NLVL V++  +  E + +K   +  + ++ R    +       L  +    D+  DE N 

HSP 3 Score: 127.102 bits (318), Expect = 8.069e-29
Identity = 92/312 (29.49%), Postives = 155/312 (49.68%), Query Frame = 1
            ++VE K FE +ILF I A+  +LA    Y +    T+   L+ + ++F VIFT E +LK +  GF      Y  N WN+LDF+IVI+   S ++S  +  G D    +++LR  R  RPLR +S    ++VV+ S++ A+  + ++ L+ L   +I++I+G+++F GK         +    S VP  T  ++ GY                      RW   N+   +FD      L + Q  T EGW +IM    D+  +            +++FV  II+G+FF +NL +GV+   F++ +++ +  G

HSP 4 Score: 117.472 bits (293), Expect = 6.721e-26
Identity = 95/342 (27.78%), Postives = 154/342 (45.03%), Query Frame = 1
            RY+V  L+  + FE II  LI  ++ISLA +    D +P   +QV+  LN++F  +FTVE LLK    GFK YF++ WN+ DF+IV+ S I +    + G       D++  I   R  R  R ++ +SR EG++ ++ + + +   +  V L+ +M + I++++G+Q+FG      +    EK    +               N N NF T  Q  L L + AT E W  IM     DA+     D+   E  N++                                              AY +F+ F ++ +F  +NLF+ VI+DNF+ L +    +G

HSP 5 Score: 102.064 bits (253), Expect = 3.549e-21
Identity = 72/209 (34.45%), Postives = 114/209 (54.55%), Query Frame = 1
            E  I V I+LNT+ ++++  +       V++  N VFT +F +E +LKL A GF  Y   AWN+FD I+V+ S +D I   VN    +  G     I+  R FR++R++KL      + +LL T  KS  AL  + +++ ++ +I+AV+GMQ+ G   T  +K    I R  NF+ FP + +++FR   GE W   +  C+    P AM

HSP 6 Score: 99.7525 bits (247), Expect = 1.758e-20
Identity = 81/221 (36.65%), Postives = 132/221 (59.73%), Query Frame = 1
            +IV + LNT V++ EH R    L +  N +N +F  +F LEM++K+ +LG   Y    +N FD  VVI SI++ ++     DA    G+SVLR  RLLRV K+ + WS++ +L+ ++  S+ ++ +L V+L + + IF+++GMQL G  +  DK   + PR NF  F  S + +F++L GE W E ++D + + G       ++ L +V  FI GN+I+LN

HSP 7 Score: 73.559 bits (179), Expect = 1.303e-12
Identity = 44/165 (26.67%), Postives = 86/165 (52.12%), Query Frame = 1
            +K    K  E  I+  I  N   ++   P  E    T+ +   +   VF  IF  E +LK++A GF+     Y+R  WN+ D ++VII ++  +++K     GG  +  LR FR+LR L+L     ++  ++ +I +++  L ++ ++   ++ I+A++G++L  

HSP 8 Score: 69.707 bits (169), Expect = 2.058e-11
Identity = 75/280 (26.79%), Postives = 137/280 (48.93%), Query Frame = 1
            LV+ + F  +++ L+  ++  L  E     ++LDS           NI+F V+FT+EML+K   LG + Y          F   ++IL+ V++    M  L        ++ +R  R LR F+  R  S    ++ ++ SLL ++  I ++L++  +F +IFS++G+Q+FGGKF    D+  +  P S                    NFD+  Q  L + Q+ T E W E+M D + +       + ++++ + L++V+  I G +  LN+F+ + +DN

HSP 9 Score: 66.2402 bits (160), Expect = 2.282e-10
Identity = 89/341 (26.10%), Postives = 167/341 (48.97%), Query Frame = 1
             K ++     + S ++FGP N  R+F    I N +P    N    VL+ I+V+   LA  +P +            +Y+F +++T+E+  K+I  G   H  A+ R   N LD +VV+   ++  I+ D ++ +  +   RV R LR I+  KGLK +V  ++V++K + ++M++T     +FA+IG+QLF G+ ++ C   V +N  +  R       I+Y E +   +  N       P N+  +P+A     F  ++F+  GW    G    ++D ++  Y+  IY   P   +++   I    FF++N+ +  V  +++ E +      E ++ ++K

HSP 10 Score: 58.151 bits (139), Expect = 7.072e-8
Identity = 45/155 (29.03%), Postives = 74/155 (47.74%), Query Frame = 1
            + + I++N + LA+    +   Y         VF  ++T+E   K+ A GF      Y  D WN  DFI+V+   + I  D  N          L  I  FR+FR +R +   S  +G++ ++ T + S + L  V +L +    I+A+IGMQ+F
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Medaka
Match: cacna1c (voltage-dependent L-type calcium channel subunit alpha-1C [Source:NCBI gene;Acc:101173517])

HSP 1 Score: 1638.62 bits (4242), Expect = 0.000e+0
Identity = 954/1748 (54.58%), Postives = 1181/1748 (67.56%), Query Frame = 1

HSP 2 Score: 104.375 bits (259), Expect = 2.149e-21
Identity = 96/342 (28.07%), Postives = 158/342 (46.20%), Query Frame = 1
            P P+ RA F  +  N FR  C KIV    F  LILF I  +  +LAA  P   ++ +  N  L   + VF  +FT E +LK+ A+G  +H G++ RN +N+LD       ++  G+ S+ ++        VK LR  RVLRPLR ++    L+ V+  +  A+  + +I ++   +  ++A IG++LF GK     +   D   ++   C  S    Y+  D    G      +N +             +FD+    M+ +F   T EGW  ++Y   DS       IY   ++         II +FF+MN+ +G +   F ++ E+  K  +  K + Q
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Medaka
Match: cacna1c (voltage-dependent L-type calcium channel subunit alpha-1C [Source:NCBI gene;Acc:101173517])

HSP 1 Score: 1624.76 bits (4206), Expect = 0.000e+0
Identity = 959/1742 (55.05%), Postives = 1188/1742 (68.20%), Query Frame = 1

HSP 2 Score: 103.99 bits (258), Expect = 2.897e-21
Identity = 96/342 (28.07%), Postives = 158/342 (46.20%), Query Frame = 1
            P P+ RA F  +  N FR  C KIV    F  LILF I  +  +LAA  P   ++ +  N  L   + VF  +FT E +LK+ A+G  +H G++ RN +N+LD       ++  G+ S+ ++        VK LR  RVLRPLR ++    L+ V+  +  A+  + +I ++   +  ++A IG++LF GK     +   D   ++   C  S    Y+  D    G      +N +             +FD+    M+ +F   T EGW  ++Y   DS       IY   ++         II +FF+MN+ +G +   F ++ E+  K  +  K + Q
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Medaka
Match: CACNA1D (calcium voltage-gated channel subunit alpha1 D [Source:NCBI gene;Acc:101171831])

HSP 1 Score: 1226.85 bits (3173), Expect = 0.000e+0
Identity = 706/1168 (60.45%), Postives = 843/1168 (72.17%), Query Frame = 1

HSP 2 Score: 453.751 bits (1166), Expect = 5.318e-131
Identity = 222/371 (59.84%), Postives = 271/371 (73.05%), Query Frame = 1

HSP 3 Score: 146.362 bits (368), Expect = 2.713e-34
Identity = 147/597 (24.62%), Postives = 278/597 (46.57%), Query Frame = 1
            + F    NN  R+ C  +     F   +L+ I  +   LA   P   D  +S N+ L   +Y F  +FT+E  +K+I YGLV H  ++ R+  N+LD ++V   L S++   I  DA              ++ LR  R LR +    G+  +   +   +K++  ++ +  L+ F   ++A+IG++LF GK  +   V +             +S  G++  +N        + +  W    N   NFDN   AMLT+F   T EGW  VLY   D+   +   +Y         +++ +I  +FF++N+ +G +   F +E E+           +  +L+++ +  +++  +A+ +            K++ ++R W  W           + S  F +++ +L+ LNT+++A +   QP    +V D  N V   +FT+E L+K+ + G + YF   +N FD  +V G  ++ I   +   +        + I+ FR  R++R+ K+      +  L+ + + S +++  + LL+ +   I++++GMQ+FG     +E     + + + F  FPQA+L +F+  TGE W  +M

HSP 4 Score: 122.479 bits (306), Expect = 5.531e-27
Identity = 116/367 (31.61%), Postives = 173/367 (47.14%), Query Frame = 1
            RP  L+ LT+        +++TP       P PQ  A F  +  NPFR  C K++  + F  LIL  I  +  +LAA  P   R+ +  N  L   +  F  IFT E +LK+ AFG  +H GA+ RN +NLLD L+V + L+S      S     VK LR  RVLRPLR ++    L+ V+  +  A+  + +I ++   +  ++A IG++LF GK     Y   D    SP  C     KG      +      M K+       W   +    +FDN  +AM+ +F   T EGW  ++Y   DS   +   IY         F+  III +FF+MN+ +G +   F ++ EK  K  +  K + Q

HSP 5 Score: 89.7373 bits (221), Expect = 5.490e-17
Identity = 71/255 (27.84%), Postives = 138/255 (54.12%), Query Frame = 1
            +V S  F +V+ VL+ LNT  L  +HY QS   +   +  N++F  +FT+EM++K+ +   R Y    +N FD  VVI S+++I++ Q    P        + ++  R  R++R+ K+      +R L+ + + S +++  + +L+ +   I++++GMQ+FG     D     R +NF +F Q++L +F+  TGE W E+M   +        S  N G+     S  + +Y++  ++   ++++N+F+A+ +DN

HSP 6 Score: 86.6557 bits (213), Expect = 4.354e-16
Identity = 78/320 (24.38%), Postives = 142/320 (44.38%), Query Frame = 1
            +NP++     +V    FEY++   I  N   LA    Y +  S+  N A++ + +VF  +FT E +LK++AF     P  Y+ + WN+ D L+VI  ++  +LS++              +   R FRV+R ++L+S    ++ ++ + +++   L ++ALL   +  IYA+IG+++F GK+          M++      T +N+                  N N              F  F  A+L +F+C T E W +IM                     + G  +  IYF+S  ++ +F ++NL + V+   F

HSP 7 Score: 77.0258 bits (188), Expect = 3.811e-13
Identity = 61/257 (23.74%), Postives = 114/257 (44.36%), Query Frame = 1
            L+  +PF+  I + I  N ++LA+             Q ++ +   F  +FT+E  +K+ A+G      +Y  + WN+ DF+IV+     ++ + +    ++          F     R FRV+R ++L+S    ++ +L + +K+   L ++ALL++ +  IYA+IG+++F GK+                                 T   E      N   NF  F  A+L +F+  T E W ++ L+ + DAM

HSP 8 Score: 63.929 bits (154), Expect = 2.967e-9
Identity = 77/320 (24.06%), Postives = 139/320 (43.44%), Query Frame = 1
            R+ C   V+   F +L++  +F N   +A+   Y + D  T +     K   V + +FT E ++K+ + G      AY  + +N  D  +V  G++ T+L +++   P  +   R  R+LR  ++     SL  ++ S++ +M  +  + LL    III++++G++LF GK +                                         ++  T R        ++FDNF  A+LTVFQ +T E W  +MY  +  +    P        IYF+ L I G++ ++N+ L +     +         +E E+AKKR
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Medaka
Match: cacna1c (voltage-dependent L-type calcium channel subunit alpha-1C [Source:NCBI gene;Acc:101173517])

HSP 1 Score: 1218.37 bits (3151), Expect = 0.000e+0
Identity = 727/1279 (56.84%), Postives = 897/1279 (70.13%), Query Frame = 1

HSP 2 Score: 468.003 bits (1203), Expect = 1.363e-132
Identity = 222/367 (60.49%), Postives = 269/367 (73.30%), Query Frame = 1

HSP 3 Score: 104.375 bits (259), Expect = 2.218e-21
Identity = 96/342 (28.07%), Postives = 158/342 (46.20%), Query Frame = 1
            P P+ RA F  +  N FR  C KIV    F  LILF I  +  +LAA  P   ++ +  N  L   + VF  +FT E +LK+ A+G  +H G++ RN +N+LD       ++  G+ S+ ++        VK LR  RVLRPLR ++    L+ V+  +  A+  + +I ++   +  ++A IG++LF GK     +   D   ++   C  S    Y+  D    G      +N +             +FD+    M+ +F   T EGW  ++Y   DS       IY   ++         II +FF+MN+ +G +   F ++ E+  K  +  K + Q

HSP 4 Score: 97.4413 bits (241), Expect = 2.661e-19
Identity = 79/320 (24.69%), Postives = 140/320 (43.75%), Query Frame = 1
            +NP++     +V    FEYL+   I  N   LA         +   N A+  + ++F  +FT E +LK++AF     P  Y  + WN+ DFLIVI  +I  +LS++     SE    +     R FRV+R ++L+S    ++ ++ + +++   L ++ALL + +  IYA+IG+++F GK+                                    + + + N+N             +F  F  A+L +F+C T E W +IM                    ++  G  +  IYFVS  ++ +F ++NL + V+   F

HSP 5 Score: 92.4337 bits (228), Expect = 7.657e-18
Identity = 59/211 (27.96%), Postives = 109/211 (51.66%), Query Frame = 1
            FR +    + S+ F +++  L+ LNT+++A +  +QPQ    V D  N V   +FT E LLK+ + G + YF   +N FD  +V G  ++ I       +        + I+  R  R++R+ K+      +  L+ + + S +++  + LL+ +   I++++GMQ+FG     +E       R + F  FPQ++L +F+  TGE W ++M

HSP 6 Score: 85.1149 bits (209), Expect = 1.242e-15
Identity = 76/273 (27.84%), Postives = 125/273 (45.79%), Query Frame = 1
            N  R+ C  I     F  I+L+ I  +   LA   P   D  ++ N  L   +YLF  +FTVE  LKVI YGL+FH  A+ R+  N+LD ++V+    ++I+      D  + +        ++ LRA      +    G+  +   +   +K++  ++ +  L+ F   ++A+IG++LF GK  ++C       N   K    +  G Y  +   +  +  V      +   NFDN   AMLT+F   T EGW  VLY   D+    +  +Y

HSP 7 Score: 85.1149 bits (209), Expect = 1.374e-15
Identity = 64/259 (24.71%), Postives = 115/259 (44.40%), Query Frame = 1
            K   R     ++  +PFE II + I  N ++LA+     +         ++ +  +F  +FTVE  LK+ A+G       Y  + WN+ DFIIV+ G F  I+     G      G +     +   R FRV+R ++L+S    ++ +L + +K+   L ++ALL++ +  IYA+IG+++F                              G+  T+N  + +       +   NF  F  A+L +F+  T E W +++

HSP 8 Score: 83.9593 bits (206), Expect = 3.262e-15
Identity = 67/256 (26.17%), Postives = 137/256 (53.52%), Query Frame = 1
            +V S  F +++  L+ LNT  L  +H+ Q+   +   N  N++F  LFT+EM++K+ +   R YF   +N FDF +VI SI+++++ + + +        + ++  R  R++R+ K+      +R L+ + + S +++  + +L+ +   I++++GMQ+FG     D     R +NF +F Q++L +F+  TGE W E+M                 S  +    S  + +Y+V  ++   ++++N+F+A+ +DN 

HSP 9 Score: 75.0998 bits (183), Expect = 1.366e-12
Identity = 75/294 (25.51%), Postives = 131/294 (44.56%), Query Frame = 1
            FR+ C   V+ + F +L++F +F N   +A+      R    +    +    V + +FT E +LK+ + G      AY  + +N  D  +V  G++ T+L +     P  +  LR  R+LR  ++     SL  ++ S++ ++  +  + LL    III++++G++LF GK                                           N +ET R        ++FDNF  ++LTVFQ +T E W  +MY  I    G S+P     IYF+ L I G++ ++N+ L +
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Medaka
Match: cacna1c (voltage-dependent L-type calcium channel subunit alpha-1C [Source:NCBI gene;Acc:101173517])

HSP 1 Score: 1213.75 bits (3139), Expect = 0.000e+0
Identity = 725/1279 (56.68%), Postives = 895/1279 (69.98%), Query Frame = 1

HSP 2 Score: 461.455 bits (1186), Expect = 1.677e-130
Identity = 219/367 (59.67%), Postives = 267/367 (72.75%), Query Frame = 1

HSP 3 Score: 104.375 bits (259), Expect = 2.136e-21
Identity = 96/342 (28.07%), Postives = 158/342 (46.20%), Query Frame = 1
            P P+ RA F  +  N FR  C KIV    F  LILF I  +  +LAA  P   ++ +  N  L   + VF  +FT E +LK+ A+G  +H G++ RN +N+LD       ++  G+ S+ ++        VK LR  RVLRPLR ++    L+ V+  +  A+  + +I ++   +  ++A IG++LF GK     +   D   ++   C  S    Y+  D    G      +N +             +FD+    M+ +F   T EGW  ++Y   DS       IY   ++         II +FF+MN+ +G +   F ++ E+  K  +  K + Q

HSP 4 Score: 92.4337 bits (228), Expect = 7.814e-18
Identity = 59/211 (27.96%), Postives = 109/211 (51.66%), Query Frame = 1
            FR +    + S+ F +++  L+ LNT+++A +  +QPQ    V D  N V   +FT E LLK+ + G + YF   +N FD  +V G  ++ I       +        + I+  R  R++R+ K+      +  L+ + + S +++  + LL+ +   I++++GMQ+FG     +E       R + F  FPQ++L +F+  TGE W ++M

HSP 5 Score: 88.5817 bits (218), Expect = 1.110e-16
Identity = 74/320 (23.12%), Postives = 137/320 (42.81%), Query Frame = 1
            +NP++     +V    FEYL+   I  N   LA         +   N A+  + ++F  +FT E +LK++AF     P  Y  + WN  D LIV+  ++   ++++     SE    +     R FRV+R ++L+S    ++ ++ + +++   L ++ALL + +  IYA+IG+++F GK+                                    + + + N+N             +F  F  A+L +F+C T E W +IM                    ++  G  +  IYFVS  ++ +F ++NL + V+   F

HSP 6 Score: 87.4261 bits (215), Expect = 2.964e-16
Identity = 68/267 (25.47%), Postives = 120/267 (44.94%), Query Frame = 1
            K   R     ++  +PFE II + I  N ++LA+     +         ++ +  +F  +FTVE  LK+ A+G       Y  + WN+ DFIIV+ G F  I+     G      G +     +   R FRV+R ++L+S    ++ +L + +K+   L ++ALL++ +  IYA+IG+++F                              G+  T+N  + +       +   NF  F  A+L +F+  T E W ++ L+ + DAM

HSP 7 Score: 85.8853 bits (211), Expect = 6.922e-16
Identity = 76/273 (27.84%), Postives = 125/273 (45.79%), Query Frame = 1
            N  R+ C  I     F  I+L+ I  +   LA   P   D  ++ N  L   +YLF  +FTVE  LKVI YGL+FH  A+ R+  N+LD ++V+    ++I+      D  + +        ++ LRA      +    G+  +   +   +K++  ++ +  L+ F   ++A+IG++LF GK  ++C       N   K    +  G Y  +   +  +  V      +   NFDN   AMLT+F   T EGW  VLY   D+   +   +Y

HSP 8 Score: 84.7297 bits (208), Expect = 1.864e-15
Identity = 66/256 (25.78%), Postives = 135/256 (52.73%), Query Frame = 1
            +V S  F +++  L+ LNT  L  +H+ Q+   +   N  N++F  LFT+EM++K+ +   R YF   +N FD  +V+ SI++I + + + +        + ++  R  R++R+ K+      +R L+ + + S +++  + +L+ +   I++++GMQ+FG     D     R +NF +F Q++L +F+  TGE W E+M                 S  +    S  + +Y+V  ++   ++++N+F+A+ +DN 

HSP 9 Score: 75.485 bits (184), Expect = 1.259e-12
Identity = 75/294 (25.51%), Postives = 131/294 (44.56%), Query Frame = 1
            FR+ C   V+ + F +L++F +F N   +A+      R    +    +    V + +FT E +LK+ + G      AY  + +N  D  +V  G++ T+L +     P  +  LR  R+LR  ++     SL  ++ S++ ++  +  + LL    III++++G++LF GK                                           N +ET R        ++FDNF  ++LTVFQ +T E W  +MY  I    G S+P     IYF+ L I G++ ++N+ L +
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Planmine SMEST
Match: SMESG000000524.1 (SMESG000000524.1)

HSP 1 Score: 4475.23 bits (11606), Expect = 0.000e+0
Identity = 2449/2471 (99.11%), Postives = 2462/2471 (99.64%), Query Frame = 1

HSP 2 Score: 164.851 bits (416), Expect = 6.466e-40
Identity = 71/72 (98.61%), Postives = 71/72 (98.61%), Query Frame = 1
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Planmine SMEST
Match: SMESG000000524.1 (SMESG000000524.1)

HSP 1 Score: 4474.85 bits (11605), Expect = 0.000e+0
Identity = 2449/2471 (99.11%), Postives = 2462/2471 (99.64%), Query Frame = 1

HSP 2 Score: 186.422 bits (472), Expect = 1.962e-46
Identity = 81/82 (98.78%), Postives = 81/82 (98.78%), Query Frame = 1
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Planmine SMEST
Match: SMESG000000524.1 (SMESG000000524.1)

HSP 1 Score: 4418.61 bits (11459), Expect = 0.000e+0
Identity = 2417/2471 (97.81%), Postives = 2432/2471 (98.42%), Query Frame = 1

HSP 2 Score: 186.422 bits (472), Expect = 2.107e-46
Identity = 81/82 (98.78%), Postives = 81/82 (98.78%), Query Frame = 1
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Planmine SMEST
Match: SMESG000000524.1 (SMESG000000524.1)

HSP 1 Score: 4418.61 bits (11459), Expect = 0.000e+0
Identity = 2417/2471 (97.81%), Postives = 2432/2471 (98.42%), Query Frame = 1

HSP 2 Score: 164.851 bits (416), Expect = 7.067e-40
Identity = 71/72 (98.61%), Postives = 71/72 (98.61%), Query Frame = 1
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Planmine SMEST
Match: SMESG000000524.1 (SMESG000000524.1)

HSP 1 Score: 3380.88 bits (8765), Expect = 0.000e+0
Identity = 1817/1817 (100.00%), Postives = 1817/1817 (100.00%), Query Frame = 1

HSP 2 Score: 166.777 bits (421), Expect = 1.683e-40
Identity = 71/72 (98.61%), Postives = 71/72 (98.61%), Query Frame = 1
The following BLAST results are available for this feature:
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CACNA1S0.000e+053.11calcium voltage-gated channel subunit alpha1 S [So... [more]
CACNA1S0.000e+052.66calcium voltage-gated channel subunit alpha1 S [So... [more]
CACNA1D8.423e-2760.09calcium voltage-gated channel subunit alpha1 D [So... [more]
CACNA1D8.892e-2760.09calcium voltage-gated channel subunit alpha1 D [So... [more]
CACNA1D9.382e-2760.09calcium voltage-gated channel subunit alpha1 D [So... [more]
back to top
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egl-195.728e-14558.09Voltage-dependent L-type calcium channel subunit a... [more]
egl-191.438e-14562.31Voltage-dependent L-type calcium channel subunit a... [more]
unc-29.128e-14545.14High voltage activated calcium channel alpha-1 sub... [more]
unc-26.506e-14546.13High voltage activated calcium channel alpha-1 sub... [more]
unc-29.059e-14546.13High voltage activated calcium channel alpha-1 sub... [more]
back to top
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ca-alpha1D1.026e-2558.55gene:FBgn0001991 transcript:FBtr0332020[more]
Ca-alpha1D1.220e-2558.64gene:FBgn0001991 transcript:FBtr0090005[more]
Ca-alpha1D1.874e-2558.64gene:FBgn0001991 transcript:FBtr0332024[more]
Ca-alpha1D0.000e+058.73gene:FBgn0001991 transcript:FBtr0090006[more]
Ca-alpha1D0.000e+058.73gene:FBgn0001991 transcript:FBtr0332023[more]
back to top
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cacna1sb6.353e-1551.68calcium channel, voltage-dependent, L type, alpha ... [more]
cacna1da2.596e-2660.04calcium channel, voltage-dependent, L type, alpha ... [more]
cacna1da6.420e-2659.37calcium channel, voltage-dependent, L type, alpha ... [more]
cacna1c1.411e-2157.17calcium channel, voltage-dependent, L type, alpha ... [more]
cacna1c1.620e-2155.89calcium channel, voltage-dependent, L type, alpha ... [more]
back to top
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CACNA1C0.000e+055.06calcium channel, voltage-dependent, L type, alpha ... [more]
CACNA1C0.000e+054.58calcium channel, voltage-dependent, L type, alpha ... [more]
CACNA1C0.000e+054.53calcium channel, voltage-dependent, L type, alpha ... [more]
CACNA1C0.000e+054.34calcium channel, voltage-dependent, L type, alpha ... [more]
CACNA1C0.000e+053.80calcium channel, voltage-dependent, L type, alpha ... [more]
back to top
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cacna1s0.000e+054.58calcium channel, voltage-dependent, L type, alpha ... [more]
Cacna1s0.000e+054.11calcium channel, voltage-dependent, L type, alpha ... [more]
Cacna1s0.000e+054.11calcium channel, voltage-dependent, L type, alpha ... [more]
Cacna1s1.919e-2754.64calcium channel, voltage-dependent, L type, alpha ... [more]
Cacna1f1.387e-12958.36calcium channel, voltage-dependent, alpha 1F subun... [more]
back to top
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q25452|CAC1M_MUSDO0.000e+057.80Muscle calcium channel subunit alpha-1 OS=Musca do... [more]
sp|Q24270|CAC1D_DROME0.000e+058.73Voltage-dependent calcium channel type D subunit a... [more]
sp|Q02485|CAC1S_RAT0.000e+054.14Voltage-dependent L-type calcium channel subunit a... [more]
sp|Q02789|CAC1S_MOUSE0.000e+054.14Voltage-dependent L-type calcium channel subunit a... [more]
sp|P07293|CAC1S_RABIT0.000e+053.85Voltage-dependent L-type calcium channel subunit a... [more]
back to top
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G0YP320.000e+087.45Voltage-dependent L-type calcium channel subunit a... [more]
A0A068WA300.000e+066.11Voltage-dependent L-type calcium channel subunit a... [more]
W6UN840.000e+062.42Voltage-dependent L-type calcium channel subunit a... [more]
A0A068YHX80.000e+062.38Voltage-dependent L-type calcium channel subunit a... [more]
A0A182J4Y30.000e+060.46Voltage-dependent L-type calcium channel subunit a... [more]
back to top
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cacna1db3.282e-2657.40calcium channel, voltage-dependent, L type, alpha ... [more]
cacna1sb0.000e+048.78calcium channel, voltage-dependent, L type, alpha ... [more]
cacna1da1.244e-2760.67calcium channel, voltage-dependent, L type, alpha ... [more]
cacna1da1.573e-2760.51calcium channel, voltage-dependent, L type, alpha ... [more]
cacna1da2.566e-2760.51calcium channel, voltage-dependent, L type, alpha ... [more]
back to top
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005302.16.590e-14967.34pep scaffold:Pmarinus_7.0:GL483978:134:5921:-1 gen... [more]
ENSPMAT00000007697.19.738e-8956.15pep scaffold:Pmarinus_7.0:GL478030:18311:55165:1 g... [more]
ENSPMAT00000010500.11.479e-8649.68pep scaffold:Pmarinus_7.0:GL477503:21958:35427:1 g... [more]
ENSPMAT00000007700.11.515e-8167.22pep scaffold:Pmarinus_7.0:GL478030:35286:55231:1 g... [more]
ENSPMAT00000008632.16.382e-8068.18pep scaffold:Pmarinus_7.0:GL481395:151307:166184:-... [more]
back to top
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
CCH11.016e-2221.07Voltage-gated high-affinity calcium channel; invol... [more]
back to top
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO469910.000e+051.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO368443.485e-5931.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354976.964e-5931.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO467972.556e-5730.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356613.853e-5728.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cacna1c2.149e-2154.58voltage-dependent L-type calcium channel subunit a... [more]
cacna1c2.897e-2155.05voltage-dependent L-type calcium channel subunit a... [more]
CACNA1D5.318e-13160.45calcium voltage-gated channel subunit alpha1 D [So... [more]
cacna1c1.363e-13256.84voltage-dependent L-type calcium channel subunit a... [more]
cacna1c1.677e-13056.68voltage-dependent L-type calcium channel subunit a... [more]
back to top
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
back to top
The following sequences are available for this feature:

transcript sequence

>SMED30005127 ID=SMED30005127|Name=Voltage-dependent L-type calcium channel subunit alpha|organism=Schmidtea mediterranea sexual|type=transcript|length=9129bp
back to top

protein sequence of SMED30005127-orf-1

>SMED30005127-orf-1 ID=SMED30005127-orf-1|Name=SMED30005127-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2712bp
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
PLANA:0000014zeta neoblast
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
Vocabulary: biological process
GO:0070588calcium ion transmembrane transport
GO:0006811ion transport
GO:0055085transmembrane transport
GO:0006816calcium ion transport
GO:0034765regulation of ion transmembrane transport
Vocabulary: molecular function
GO:0005245voltage-gated calcium channel activity
GO:0005216ion channel activity
GO:0005244voltage-gated ion channel activity
GO:0005262calcium channel activity
Vocabulary: cellular component
GO:0005891voltage-gated calcium channel complex
GO:0016021integral component of membrane