Voltage-dependent L-type calcium channel subunit alpha

Overview
NameVoltage-dependent L-type calcium channel subunit alpha
Smed IDSMED30005127
Length (bp)9129
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Voltage-dependent L-type calcium channel subunit alpha (SMED30005127) t-SNE clustered cells

Violin plots show distribution of expression levels for Voltage-dependent L-type calcium channel subunit alpha (SMED30005127) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Voltage-dependent L-type calcium channel subunit alpha (SMED30005127) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Voltage-dependent L-type calcium channel subunit alpha (SMED30005127) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005127

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30005127SMESG000000524.1 dd_Smed_v4_8899_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005127SMESG000000524.1 dd_Smed_v4_8899_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30005127SMESG000000524.1 dd_Smed_v4_8899_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30005127SMESG000000524.1 dd_Smed_v4_8899_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30005127SMESG000000524.1 dd_Smed_v4_8899_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30005127SMESG000000524.1 dd_Smed_v4_8899_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30005127SMESG000000524.1 dd_Smed_v4_8899_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30005127SMESG000000524.1 dd_Smed_v4_8899_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005127SMESG000000524.1 dd_Smed_v4_8899_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005127SMESG000000524.1 Contig35674newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005127SMESG000000524.1 Contig35674uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005127SMESG000000524.1 Contig43570newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005127SMESG000000524.1 Contig43570uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005127SMESG000000524.1 Contig45524newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005127SMESG000000524.1 Contig45524uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
zeta neoblastSMED30005127SMESG000000524.1 dd_Smed_v4_8899_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Human
Match: CACNA1S (calcium voltage-gated channel subunit alpha1 S [Source:HGNC Symbol;Acc:HGNC:1397])

HSP 1 Score: 1634 bits (4230), Expect = 0.000e+0
Identity = 930/1751 (53.11%), Postives = 1172/1751 (66.93%), Query Frame = 1
Query:  958 GGRKRTPARSQSGN-PRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKM-----------SEG-GPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCY-SKNDVMM----ESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNET-SRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGK----ENGK--ESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGGAHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSXXXXXXXXXXXXXXXPTNVDGEEAKACNSSNVSPNIDEKTRFTDAERLIKSEEMNG--DIADESMRKMSTRIDTXXXXXXXXXXXXXXXXXNGQ---TSAIRRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRTHGRGSGPLISLISPTLVTTNECDEKDKDYLPSHLGAERRTHSIFGTMMNVLQRVGSTRRDSNASPSTGSINHSTELPRDRSNSRPMILNQSKSPTNHPPVKLTLAP 6120
            G RK+ P +      PRP RALFCLTL NP RK CI IVEWKPFE +IL TIFANC ALA   P PE D+N++N  LEK+E  F+++F+ E  +KI+A+GF+ H  AYLR+GWN+LDF IV +G+ + +L ++           S+G G DVKALRAFRVLRPLRLVSG+PSLQVV+NSI +AM+PLFHIALL LF++IIYAIIGLELF GK+H TCY    D++     E P PC+              +G    C  N +E    W GPN GIT FDNFG +MLTV+QCITMEGWT ++YW+ND++G  WPWIYFV+LI++GSFF++NLVLGVLSGEF+KEREKAK RG +QK RE+ Q DED++GY+ WI   E +  ++  +GK    E G   ES +++ GL K  +                      H +Q   +F +                    +VKS+ FYW+VI++V LNT  + SEH+ Q +WL   Q+ AN + + LFT EML+KMY LG+R YF  +FNRFD FVV   ILEI+++++ AM PLG+SVLRC RLLR+FK+T+YW+SL NLV SLL S++SI SLL+LLFLFIVIF+LLGMQLFGG+++F+     RSNFD+F Q+L++VFQ+LTGEDW  +MY+GI +YG      ML C+Y++ILF+CGNYILLNVFLAIAVDNLA+  S                     EE K    S   P+  E+ + T A++L +  +  G    A   + +  + ++  K+         +++E+  +   +   R ++E+  KEK  PIP ASSFFIF P NK R  CH I N   F N +L+ I++SSA LAAEDP+ A+S RN+IL +FD  FTSVFTVEI LK+ TYG   H G+FCR+  N+LDLLVV  S+IS  + + AISVVKILRVLRVLRPLRAINRAKGLK VVQC+ VA+ +IGNI+LVT LL+FMFA IGVQLF GKF  C D+SK T   CRG Y  Y + D  ++ +  REW+++  +FDNV +AM++LF VSTFEGWP +LYK+IDS  ED   IYNNR  ++IF+I YII+IAFFM+NIFVGFVIVTFQ++GE EYKNCELDKNQR+C+++ALKA+P+R YIPK  ++Y+VW+++TS  FEY++F LIMLNTI L ++   Q ++   + D LN+ FT +FT+E +LKL AF  + YF D WNVFDF+IV+GS ID+I   ++  + + R    IS  FFRLFRVMRL+KLLSR EG+RTLLWTF+KSFQALPYVALLIVMLFFIYAVIGMQMFGKI   +     +INRNNNFQTFPQA+L+LFR ATGEAWQ I+L C    +CD  SD    E Y                                            CG+NFAY YFISFYM+C+FL+INLFVAVIMDNFDYLTRDWSILGPHHLDEF  +W+EYDPEAKGRIKHLDVVTLLR+I PPLGFGK+CPHR AC  LV MNMPLNSDGTV FNATLFALVRT LKIKT+G+  +Q NEELR +IKKIWKRTS K+LDQV+PP G+D+VTVGKFYATFLIQE FR++  KR EE  G    +         RT    + P I       +   E  E+         G  RRT  +FG + N L+R  S                   LP   +N RP+   + +      PV L   P
Sbjct:   10 GLRKKQPKKPVPEILPRPPRALFCLTLENPLRKACISIVEWKPFETIILLTIFANCVALAVYLPMPEDDNNSLNLGLEKLEYFFLIVFSIEAAMKIIAYGFLFHQDAYLRSGWNVLDFTIVFLGVFTVILEQVNVIQSHTAPMSSKGAGLDVKALRAFRVLRPLRLVSGVPSLQVVLNSIFKAMLPLFHIALLVLFMVIIYAIIGLELFKGKMHKTCYFIGTDIVATVENEEPSPCA-------------RTGSGRRCTINGSECRGGWPGPNHGITHFDNFGFSMLTVYQCITMEGWTDVLYWVNDAIGNEWPWIYFVTLILLGSFFILNLVLGVLSGEFTKEREKAKSRGTFQKLREKQQLDEDLRGYMSWITQGEVMDVEDFREGKLSLDEGGSDTESLYEIAGLNKIIQFI-------------------RHWRQWNRIFRWKCHD----------------IVKSKVFYWLVILIVALNTLSIASEHHNQPLWLTRLQDIANRVLLSLFTTEMLMKMYGLGLRQYFMSIFNRFDCFVVCSGILEILLVESGAMTPLGISVLRCIRLLRIFKITKYWTSLSNLVASLLNSIRSIASLLLLLFLFIVIFALLGMQLFGGRYDFEDTEVRRSNFDNFPQALISVFQVLTGEDWTSMMYNGIMAYGGPSYPGMLVCIYFIILFVCGNYILLNVFLAIAVDNLAEAESLTSA------------QKAKAEEKKRRKMSKGLPDKSEEEKSTMAKKLEQKPKGEGIPTTAKLKIDEFESNVNEVKDPYPSADFPGDDEEDEPEIPLSPRPRPLAELQLKEKAVPIPEASSFFIFSPTNKIRVLCHRIVNATWFTNFILLFILLSSAALAAEDPIRADSMRNQILKHFDIGFTSVFTVEIVLKMTTYGAFLHKGSFCRNYFNMLDLLVVAVSLISMGLESSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCMFVAISTIGNIVLVTTLLQFMFACIGVQLFKGKFFRCTDLSKMTEEECRGYYYVYKDGDPMQIELRHREWVHSDFHFDNVLSAMMSLFTVSTFEGWPQLLYKAIDSNAEDVGPIYNNRVEMAIFFIIYIILIAFFMMNIFVGFVIVTFQEQGETEYKNCELDKNQRQCVQYALKARPLRCYIPKNPYQYQVWYIVTSSYFEYLMFALIMLNTICLGMQHYNQSEQMNHISDILNVAFTIIFTLEMILKLMAFKARGYFGDPWNVFDFLIVIGSIIDVILSEIDDPDESAR----ISSAFFRLFRVMRLIKLLSRAEGVRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIALVDG---TQINRNNNFQTFPQAVLLLFRCATGEAWQEILLACSYGKLCDPESDYAPGEEYT-------------------------------------------CGTNFAYYYFISFYMLCAFLVINLFVAVIMDNFDYLTRDWSILGPHHLDEFKAIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKFCPHRVACKRLVGMNMPLNSDGTVTFNATLFALVRTALKIKTEGN-FEQANEELRAIIKKIWKRTSMKLLDQVIPPIGDDEVTVGKFYATFLIQEHFRKF-MKRQEEYYGYRPKKDIVQIQAGLRTIEEEAAPEICRTVSGDLAAEEELERAMVEAAMEEGIFRRTGGLFGQVDNFLERTNS-------------------LPPVMANQRPLQFAEIEMEEMESPVFLEDFP 1629          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Human
Match: CACNA1S (calcium voltage-gated channel subunit alpha1 S [Source:HGNC Symbol;Acc:HGNC:1397])

HSP 1 Score: 1624.37 bits (4205), Expect = 0.000e+0
Identity = 930/1766 (52.66%), Postives = 1171/1766 (66.31%), Query Frame = 1
Query:  958 GGRKRTPARSQSGN-PRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKM-----------SEG-GPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCY-SKNDVMM----ESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNET-SRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGK----ENGK--ESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGGAHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSXXXXXXXXXXXXXXXPTNVDGEEAKACNSSNVSPNIDEKTRFTDAERLIKSEEMNG--DIADESMRKMSTRIDTXXXXXXXXXXXXXXXXXNGQ---TSAIRRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNG---------------TNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRTHGRGSGPLISLISPTLVTTNECDEKDKDYLPSHLGAERRTHSIFGTMMNVLQRVGSTRRDSNASPSTGSINHSTELPRDRSNSRPMILNQSKSPTNHPPVKLTLAP 6120
            G RK+ P +      PRP RALFCLTL NP RK CI IVEWKPFE +IL TIFANC ALA   P PE D+N++N  LEK+E  F+++F+ E  +KI+A+GF+ H  AYLR+GWN+LDF IV +G+ + +L ++           S+G G DVKALRAFRVLRPLRLVSG+PSLQVV+NSI +AM+PLFHIALL LF++IIYAIIGLELF GK+H TCY    D++     E P PC+              +G    C  N +E    W GPN GIT FDNFG +MLTV+QCITMEGWT ++YW+ND++G  WPWIYFV+LI++GSFF++NLVLGVLSGEF+KEREKAK RG +QK RE+ Q DED++GY+ WI   E +  ++  +GK    E G   ES +++ GL K  +                      H +Q   +F +                    +VKS+ FYW+VI++V LNT  + SEH+ Q +WL   Q+ AN + + LFT EML+KMY LG+R YF  +FNRFD FVV   ILEI+++++ AM PLG+SVLRC RLLR+FK+T+YW+SL NLV SLL S++SI SLL+LLFLFIVIF+LLGMQLFGG+++F+     RSNFD+F Q+L++VFQ+LTGEDW  +MY+GI +YG      ML C+Y++ILF+CGNYILLNVFLAIAVDNLA+  S                     EE K    S   P+  E+ + T A++L +  +  G    A   + +  + ++  K+         +++E+  +   +   R ++E+  KEK  PIP ASSFFIF P NK R  CH I N   F N +L+ I++SSA LAAEDP+ A+S RN+IL +FD  FTSVFTVEI LK+ TYG   H G+FCR+  N+LDLLVV  S+IS  + + AISVVKILRVLRVLRPLRAINRAKGLK VVQC+ VA+ +IGNI+LVT LL+FMFA IGVQLF GKF  C D+SK T   CRG Y  Y + D  ++ +  REW+++  +FDNV +AM++LF VSTFEGWP +LYK+IDS  ED   IYNNR  ++IF+I YII+IAFFM+NIFVGFVIVTFQ++GE EYKNCELDKNQR+C+++ALKA+P+R YIPK  ++Y+VW+++TS  FEY++F LIMLNTI L ++   Q ++   + D LN+ FT +FT+E +LKL AF  + YF D WNVFDF+IV+GS ID+I   ++                 N +      IS  FFRLFRVMRL+KLLSR EG+RTLLWTF+KSFQALPYVALLIVMLFFIYAVIGMQMFGKI   +     +INRNNNFQTFPQA+L+LFR ATGEAWQ I+L C    +CD  SD    E Y                                            CG+NFAY YFISFYM+C+FL+INLFVAVIMDNFDYLTRDWSILGPHHLDEF  +W+EYDPEAKGRIKHLDVVTLLR+I PPLGFGK+CPHR AC  LV MNMPLNSDGTV FNATLFALVRT LKIKT+G+  +Q NEELR +IKKIWKRTS K+LDQV+PP G+D+VTVGKFYATFLIQE FR++  KR EE  G    +         RT    + P I       +   E  E+         G  RRT  +FG + N L+R  S                   LP   +N RP+   + +      PV L   P
Sbjct:   10 GLRKKQPKKPVPEILPRPPRALFCLTLENPLRKACISIVEWKPFETIILLTIFANCVALAVYLPMPEDDNNSLNLGLEKLEYFFLIVFSIEAAMKIIAYGFLFHQDAYLRSGWNVLDFTIVFLGVFTVILEQVNVIQSHTAPMSSKGAGLDVKALRAFRVLRPLRLVSGVPSLQVVLNSIFKAMLPLFHIALLVLFMVIIYAIIGLELFKGKMHKTCYFIGTDIVATVENEEPSPCA-------------RTGSGRRCTINGSECRGGWPGPNHGITHFDNFGFSMLTVYQCITMEGWTDVLYWVNDAIGNEWPWIYFVTLILLGSFFILNLVLGVLSGEFTKEREKAKSRGTFQKLREKQQLDEDLRGYMSWITQGEVMDVEDFREGKLSLDEGGSDTESLYEIAGLNKIIQFI-------------------RHWRQWNRIFRWKCHD----------------IVKSKVFYWLVILIVALNTLSIASEHHNQPLWLTRLQDIANRVLLSLFTTEMLMKMYGLGLRQYFMSIFNRFDCFVVCSGILEILLVESGAMTPLGISVLRCIRLLRIFKITKYWTSLSNLVASLLNSIRSIASLLLLLFLFIVIFALLGMQLFGGRYDFEDTEVRRSNFDNFPQALISVFQVLTGEDWTSMMYNGIMAYGGPSYPGMLVCIYFIILFVCGNYILLNVFLAIAVDNLAEAESLTSA------------QKAKAEEKKRRKMSKGLPDKSEEEKSTMAKKLEQKPKGEGIPTTAKLKIDEFESNVNEVKDPYPSADFPGDDEEDEPEIPLSPRPRPLAELQLKEKAVPIPEASSFFIFSPTNKIRVLCHRIVNATWFTNFILLFILLSSAALAAEDPIRADSMRNQILKHFDIGFTSVFTVEIVLKMTTYGAFLHKGSFCRNYFNMLDLLVVAVSLISMGLESSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCMFVAISTIGNIVLVTTLLQFMFACIGVQLFKGKFFRCTDLSKMTEEECRGYYYVYKDGDPMQIELRHREWVHSDFHFDNVLSAMMSLFTVSTFEGWPQLLYKAIDSNAEDVGPIYNNRVEMAIFFIIYIILIAFFMMNIFVGFVIVTFQEQGETEYKNCELDKNQRQCVQYALKARPLRCYIPKNPYQYQVWYIVTSSYFEYLMFALIMLNTICLGMQHYNQSEQMNHISDILNVAFTIIFTLEMILKLMAFKARGYFGDPWNVFDFLIVIGSIIDVILSEIDTFLASSGGLYCLGGGCGNVDPDESARISSAFFRLFRVMRLIKLLSRAEGVRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIALVDG---TQINRNNNFQTFPQAVLLLFRCATGEAWQEILLACSYGKLCDPESDYAPGEEYT-------------------------------------------CGTNFAYYYFISFYMLCAFLVINLFVAVIMDNFDYLTRDWSILGPHHLDEFKAIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKFCPHRVACKRLVGMNMPLNSDGTVTFNATLFALVRTALKIKTEGN-FEQANEELRAIIKKIWKRTSMKLLDQVIPPIGDDEVTVGKFYATFLIQEHFRKF-MKRQEEYYGYRPKKDIVQIQAGLRTIEEEAAPEICRTVSGDLAAEEELERAMVEAAMEEGIFRRTGGLFGQVDNFLERTNS-------------------LPPVMANQRPLQFAEIEMEEMESPVFLEDFP 1648          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Human
Match: CACNA1D (calcium voltage-gated channel subunit alpha1 D [Source:HGNC Symbol;Acc:HGNC:1391])

HSP 1 Score: 975.696 bits (2521), Expect = 0.000e+0
Identity = 542/902 (60.09%), Postives = 658/902 (72.95%), Query Frame = 1
Query: 3295 RRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMP-FRTHGRGSGPLISLISPTLVTTNECDEKDKDYLPSHLGAE----RRTHSIFGTMMNVLQRVGSTRRDS 5985
            RR+SE+  KEKI PIP  S+FFI    N  R  CH + NH  F N++LV IM+SSA LAAEDP+ + S RN IL YFDY FT++FTVEI LK+ T+G   H GAFCR+  N+LD+LVV  S++S+ I + AISVVKILRVLRVLRPLRAINRAKGLK VVQCV VA+++IGNIM+VT LL+FMFA IGVQLF GKF  C D +K+    CRG +I Y + D+    V +R W N+  NFDNV +AM+ LF VSTFEGWP +LYK+IDS  E+   IYN+R  +SIF+I YII++AFFM+NIFVGFVIVTFQ++GE+EYKNCELDKNQR+C+E+ALKA+P+RRYIPK  ++Y+ W+++ S PFEY++FVLIMLNT+ LA++  +Q + +   MD LNMVFTGVFTVE +LK+ AF  K YFSDAWN FD +IV+GS ID+     + +  ++R    ISI FFRLFRVMRLVKLLSRGEGIRTLLWTF+KSFQALPYVALLI MLFFIYAVIGMQMFGK+     ++  +INRNNNFQTFPQA+L+LFR ATGEAWQ IML CLP  +CD  SD    E Y                                            CGSNFA  YFISFYM+C+FLIINLFVAVIMDNFDYLTRDWSILGPHHLDEF R+WSEYDPEAKGRIKHLDVVTLLR+I PPLGFGK CPHR AC  LV MNMPLNSDGTVMFNATLFALVRT LKIKT+G+ ++Q NEELR VIKKIWK+TS K+LDQVVPPAG+D+VTVGKFYATFLIQ++FR++K+++ +   G   +++  ++L    RT        +  I P +     CD +D +   +    E    +R  ++ G  +N    V S RRDS
Sbjct:  846 RRISELNMKEKIAPIPEGSAFFILSKTNPIRVGCHKLINHHIFTNLILVFIMLSSAALAAEDPIRSHSFRNTILGYFDYAFTAIFTVEILLKMTTFGAFLHKGAFCRNYFNLLDMLVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYRCTDEAKSNPEECRGLFILYKDGDVDSPVVRERIWQNSDFNFDNVLSAMMALFTVSTFEGWPALLYKAIDSNGENIGPIYNHRVEISIFFIIYIIIVAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKFWYVVNSSPFEYMMFVLIMLNTLCLAMQHYEQSKMFNDAMDILNMVFTGVFTVEMVLKVIAFKPKGYFSDAWNTFDSLIVIGSIIDVALSEADNSEESNR----ISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQMFGKVAM---RDNNQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPGKLCDPESDYNPGEEYT-------------------------------------------CGSNFAIVYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTALKIKTEGN-LEQANEELRAVIKKIWKKTSMKLLDQVVPPAGDDEVTVGKFYATFLIQDYFRKFKKRKEQGLVGKYPAKNTTIALQAGLRT--------LHDIGPEIRRAISCDLQDDEPEETKREEEDDVFKRNGALLGNHVN---HVNSDRRDS 1685          

HSP 2 Score: 713.375 bits (1840), Expect = 0.000e+0
Identity = 400/693 (57.72%), Postives = 496/693 (71.57%), Query Frame = 1
Query:  970 RTPARSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSE------------GGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCY-SKNDVMMES-PVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGGAHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGS 3006
            ++  +  S N RP RALFCL+L NP R+ CI IVEWKPF+  IL  IFANC ALA   P+PE DSN+ N  LEK+E  F++IFT E  LKI+A+G ++HP AY+RNGWNLLDF+IVI+GL S +L ++++            GG DVKALRAFRVLRPLRLVSG+PSLQVV+NSI++AMVPL HIALL LFVIIIYAIIGLELF GK+H TC+ + +D++ E  P PC+ S N G QC    ++G +  C+      S W GPN GIT+FDNF  AMLTVFQCITMEGWT ++YW+ND++G  WPW+YFVSLII+GSFFV+NLVLGVLSGEFSKEREKAK RG +QK RE+ Q +ED++GYLDWI  AEDI  + E +G E GK +         +S  + + +   ++ +  E E         Q +    L  R  R      RR    +     ++ V++ LVFLNT  ++SEHY Q  WL   Q+ AN + + LFT EML+KMYSLG++ YF  +FNRFD FVV   I E ++++ + M PLG+SV RC RLLR+FKVTR+W+SL NLV SLL SMKSI SLL+LLFLFI+IFSLLGMQLFGGKFNFD+    RS FD+F Q+LLTVFQILTGEDWN VMYDGI +YG    S M+ C+Y++ILFICGNYILLNVFLAIAVDNLAD  S
Sbjct:   90 KSKKQGNSSNSRPARALFCLSLNNPIRRACISIVEWKPFDIFILLAIFANCVALAIYIPFPEDDSNSTNHNLEKVEYAFLIIFTVETFLKIIAYGLLLHPNAYVRNGWNLLDFVIVIVGLFSVILEQLTKETEGGNHSSGKSGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHKTCFFADSDIVAEEDPAPCAFSGN-GRQCT---ANGTE--CR------SGWVGPNGGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAIGWEWPWVYFVSLIILGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEGGEEGKRN---------TSMPTSETESVNTENVSGEGENRGCCGSLCQAISKSKLSRRWRRWNRFNRRRCRAAVKSVTFYWLVIV-LVFLNTLTISSEHYNQPDWLTQIQDIANKVLLALFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVELEIMSPLGISVFRCVRLLRIFKVTRHWTSLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETQTKRSTFDNFPQALLTVFQILTGEDWNAVMYDGIMAYGGPSSSGMIVCIYFIILFICGNYILLNVFLAIAVDNLADAES 760          

HSP 3 Score: 122.865 bits (307), Expect = 8.423e-27
Identity = 112/372 (30.11%), Postives = 168/372 (45.16%), Query Frame = 1
Query:  910 RPLNLAALTLSAQIASGGRKRTPARSQSGNPRPQ-RALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSR-----WSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIY---------FVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQ 1980
            RP  ++ L +  +IA               P P+  A F L+  NP R  C K++    F  LIL  I  +  ALAA  P   R  +  N+ L   +  F  IFT E +LK+  FG  +H GA+ RN +NLLD L+V + L+S      S     VK LR  RVLRPLR ++    L+ V+  +  A+  + +I ++   +  ++A IG++LF GK     Y   D    +P  C                G   + KD   ++       W   +    +FDN   AM+ +F   T EGW  ++Y   DS G +   IY         F+  III +FF+MN+ +G +   F ++ EK  K  +  K + Q
Sbjct:  844 RPRRISELNMKEKIA---------------PIPEGSAFFILSKTNPIRVGCHKLINHHIFTNLILVFIMLSSAALAAEDPI--RSHSFRNTILGYFDYAFTAIFTVEILLKMTTFGAFLHKGAFCRNYFNLLDMLVVGVSLVS--FGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKF----YRCTDEAKSNPEEC---------------RGLFILYKDGDVDSPVVRERIWQNSDF---NFDNVLSAMMALFTVSTFEGWPALLYKAIDSNGENIGPIYNHRVEISIFFIIYIIIVAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQ 1174          

HSP 4 Score: 91.2781 bits (225), Expect = 3.776e-17
Identity = 57/203 (28.08%), Postives = 106/203 (52.22%), Query Frame = 1
Query: 4363 ITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIM 4971
            + S  F +++ VL+ LNT++++ +   QP    Q+ D  N V   +FT E L+K+ + G + YF   +N FD  +V G   + I   +   +        + I+ FR  R++R+ K+      +  L+ + + S +++  + LL+ +   I++++GMQ+FG     +E + K     + F  FPQA+L +F+  TGE W  +M
Sbjct:  520 VKSVTFYWLVIVLVFLNTLTISSEHYNQPDWLTQIQDIANKVLLALFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVELEIMSP-------LGISVFRCVRLLRIFKVTRHWTSLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETQTKR----STFDNFPQALLTVFQILTGEDWNAVM 711          

HSP 5 Score: 87.8113 bits (216), Expect = 3.468e-16
Identity = 55/178 (30.90%), Postives = 92/178 (51.69%), Query Frame = 1
Query: 1036 RNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPD----VKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKL 1557
            +NP++     +V   PFEY++   I  N   LA         S   N A++ + +VF  +FT E VLK++AF     P  Y  + WN  D LIVI  +I   LS+           +   R FRV+R ++L+S    ++ ++ + +++   L ++ALL   +  IYA+IG+++F GK+
Sbjct: 1191 KNPYQYKFWYVVNSSPFEYMMFVLIMLNTLCLAMQH---YEQSKMFNDAMDILNMVFTGVFTVEMVLKVIAF----KPKGYFSDAWNTFDSLIVIGSIIDVALSEADNSEESNRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQMF-GKV 1360          

HSP 6 Score: 85.8853 bits (211), Expect = 1.573e-15
Identity = 79/286 (27.62%), Postives = 128/286 (44.76%), Query Frame = 1
Query: 3346 ASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPL--DAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPI-----------NNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEF---MFAVIGVQLFNGK------FQSCNDVSKNTHISC----RGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIY 4125
            A + F    NN  R+ C  I     F   +L+ I  +   LA   P   D  +S N  L   +Y F  +FTVE  LK+I YGL+ H  A+ R+  N+LD ++V+  + S  +           ++   S    ++ LR  R LR +    G+  +   +   +K++  ++ +  L+ F   ++A+IG++LF GK      F   + V++     C     G+    N  +    +V     I    NFDN   AMLT+F   T EGW  VLY   D+   ++  +Y
Sbjct:  103 ARALFCLSLNNPIRRACISIVEWKPFDIFILLAIFANCVALAIYIPFPEDDSNSTNHNLEKVEYAFLIIFTVETFLKIIAYGLLLHPNAYVRNGWNLLDFVIVIVGLFSVILEQLTKETEGGNHSSGKSGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHKTCFFADSDIVAEEDPAPCAFSGNGRQCTANGTECRSGWVGPNGGIT---NFDNFAFAMLTVFQCITMEGWTDVLYWVNDAIGWEWPWVY 385          

HSP 7 Score: 85.5001 bits (210), Expect = 1.769e-15
Identity = 59/249 (23.69%), Postives = 112/249 (44.98%), Query Frame = 1
Query: 4360 LITSRPFEYIIFVLIMLNTISLALKF---DKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGF----KNYFSDAWNVFDFIIVLGSFIDIIYDHVN----GTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMF-----------------------------GKITTENEKEMKE--INRN---NNFQTFPQAILVLFRSATGEAWQNIM 4971
            ++  +PF+  I + I  N ++LA+     +         ++ +   F  +FTVE  LK+ A+G       Y  + WN+ DF+IV+     +I + +     G N++        +   R FRV+R ++L+S    ++ +L + +K+   L ++ALL++ +  IYA+IG+++F                             G+  T N  E +   +  N    NF  F  A+L +F+  T E W +++
Sbjct:  122 IVEWKPFDIFILLAIFANCVALAIYIPFPEDDSNSTNHNLEKVEYAFLIIFTVETFLKIIAYGLLLHPNAYVRNGWNLLDFVIVIVGLFSVILEQLTKETEGGNHSSGKSGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHKTCFFADSDIVAEEDPAPCAFSGNGRQCTANGTECRSGWVGPNGGITNFDNFAFAMLTVFQCITMEGWTDVL 370          

HSP 8 Score: 85.1149 bits (209), Expect = 2.393e-15
Identity = 67/252 (26.59%), Postives = 138/252 (54.76%), Query Frame = 1
Query: 2281 LVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPP---LGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFD-KKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGI-------RSYGNLGK----SSMLSCLYYVILFICGNYILLNVFLAIAVDNL 2991
            +V S  F +++ VL+ LNT  L  +HY QS   +   +  N++F  +FT+EM++K+ +   + YF   +N FD  +VI SI+++ + + D       + ++  R  R++R+ K+      +R L+ + + S +++  + +L+ +   I++++GMQ+FG     D  +    +NF +F Q++L +F+  TGE W E+M   +        S  N G+     S  + +Y++  ++   ++++N+F+A+ +DN 
Sbjct: 1201 VVNSSPFEYMMFVLIMLNTLCLAMQHYEQSKMFNDAMDILNMVFTGVFTVEMVLKVIAFKPKGYFSDAWNTFDSLIVIGSIIDVALSEADNSEESNRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQMFGKVAMRDNNQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPGKLCDPESDYNPGEEYTCGSNFAIVYFISFYMLCAFLIINLFVAVIMDNF 1452          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Human
Match: CACNA1D (calcium voltage-gated channel subunit alpha1 D [Source:HGNC Symbol;Acc:HGNC:1391])

HSP 1 Score: 975.696 bits (2521), Expect = 0.000e+0
Identity = 542/902 (60.09%), Postives = 658/902 (72.95%), Query Frame = 1
Query: 3295 RRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMP-FRTHGRGSGPLISLISPTLVTTNECDEKDKDYLPSHLGAE----RRTHSIFGTMMNVLQRVGSTRRDS 5985
            RR+SE+  KEKI PIP  S+FFI    N  R  CH + NH  F N++LV IM+SSA LAAEDP+ + S RN IL YFDY FT++FTVEI LK+ T+G   H GAFCR+  N+LD+LVV  S++S+ I + AISVVKILRVLRVLRPLRAINRAKGLK VVQCV VA+++IGNIM+VT LL+FMFA IGVQLF GKF  C D +K+    CRG +I Y + D+    V +R W N+  NFDNV +AM+ LF VSTFEGWP +LYK+IDS  E+   IYN+R  +SIF+I YII++AFFM+NIFVGFVIVTFQ++GE+EYKNCELDKNQR+C+E+ALKA+P+RRYIPK  ++Y+ W+++ S PFEY++FVLIMLNT+ LA++  +Q + +   MD LNMVFTGVFTVE +LK+ AF  K YFSDAWN FD +IV+GS ID+     + +  ++R    ISI FFRLFRVMRLVKLLSRGEGIRTLLWTF+KSFQALPYVALLI MLFFIYAVIGMQMFGK+     ++  +INRNNNFQTFPQA+L+LFR ATGEAWQ IML CLP  +CD  SD    E Y                                            CGSNFA  YFISFYM+C+FLIINLFVAVIMDNFDYLTRDWSILGPHHLDEF R+WSEYDPEAKGRIKHLDVVTLLR+I PPLGFGK CPHR AC  LV MNMPLNSDGTVMFNATLFALVRT LKIKT+G+ ++Q NEELR VIKKIWK+TS K+LDQVVPPAG+D+VTVGKFYATFLIQ++FR++K+++ +   G   +++  ++L    RT        +  I P +     CD +D +   +    E    +R  ++ G  +N    V S RRDS
Sbjct:  870 RRISELNMKEKIAPIPEGSAFFILSKTNPIRVGCHKLINHHIFTNLILVFIMLSSAALAAEDPIRSHSFRNTILGYFDYAFTAIFTVEILLKMTTFGAFLHKGAFCRNYFNLLDMLVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYRCTDEAKSNPEECRGLFILYKDGDVDSPVVRERIWQNSDFNFDNVLSAMMALFTVSTFEGWPALLYKAIDSNGENIGPIYNHRVEISIFFIIYIIIVAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKFWYVVNSSPFEYMMFVLIMLNTLCLAMQHYEQSKMFNDAMDILNMVFTGVFTVEMVLKVIAFKPKGYFSDAWNTFDSLIVIGSIIDVALSEADNSEESNR----ISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQMFGKVAM---RDNNQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPGKLCDPESDYNPGEEYT-------------------------------------------CGSNFAIVYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTALKIKTEGN-LEQANEELRAVIKKIWKKTSMKLLDQVVPPAGDDEVTVGKFYATFLIQDYFRKFKKRKEQGLVGKYPAKNTTIALQAGLRT--------LHDIGPEIRRAISCDLQDDEPEETKREEEDDVFKRNGALLGNHVN---HVNSDRRDS 1709          

HSP 2 Score: 713.375 bits (1840), Expect = 0.000e+0
Identity = 400/693 (57.72%), Postives = 496/693 (71.57%), Query Frame = 1
Query:  970 RTPARSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSE------------GGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCY-SKNDVMMES-PVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGGAHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGS 3006
            ++  +  S N RP RALFCL+L NP R+ CI IVEWKPF+  IL  IFANC ALA   P+PE DSN+ N  LEK+E  F++IFT E  LKI+A+G ++HP AY+RNGWNLLDF+IVI+GL S +L ++++            GG DVKALRAFRVLRPLRLVSG+PSLQVV+NSI++AMVPL HIALL LFVIIIYAIIGLELF GK+H TC+ + +D++ E  P PC+ S N G QC    ++G +  C+      S W GPN GIT+FDNF  AMLTVFQCITMEGWT ++YW+ND++G  WPW+YFVSLII+GSFFV+NLVLGVLSGEFSKEREKAK RG +QK RE+ Q +ED++GYLDWI  AEDI  + E +G E GK +         +S  + + +   ++ +  E E         Q +    L  R  R      RR    +     ++ V++ LVFLNT  ++SEHY Q  WL   Q+ AN + + LFT EML+KMYSLG++ YF  +FNRFD FVV   I E ++++ + M PLG+SV RC RLLR+FKVTR+W+SL NLV SLL SMKSI SLL+LLFLFI+IFSLLGMQLFGGKFNFD+    RS FD+F Q+LLTVFQILTGEDWN VMYDGI +YG    S M+ C+Y++ILFICGNYILLNVFLAIAVDNLAD  S
Sbjct:  114 KSKKQGNSSNSRPARALFCLSLNNPIRRACISIVEWKPFDIFILLAIFANCVALAIYIPFPEDDSNSTNHNLEKVEYAFLIIFTVETFLKIIAYGLLLHPNAYVRNGWNLLDFVIVIVGLFSVILEQLTKETEGGNHSSGKSGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHKTCFFADSDIVAEEDPAPCAFSGN-GRQCT---ANGTE--CR------SGWVGPNGGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAIGWEWPWVYFVSLIILGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEGGEEGKRN---------TSMPTSETESVNTENVSGEGENRGCCGSLCQAISKSKLSRRWRRWNRFNRRRCRAAVKSVTFYWLVIV-LVFLNTLTISSEHYNQPDWLTQIQDIANKVLLALFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVELEIMSPLGISVFRCVRLLRIFKVTRHWTSLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETQTKRSTFDNFPQALLTVFQILTGEDWNAVMYDGIMAYGGPSSSGMIVCIYFIILFICGNYILLNVFLAIAVDNLADAES 784          

HSP 3 Score: 122.865 bits (307), Expect = 8.892e-27
Identity = 112/372 (30.11%), Postives = 168/372 (45.16%), Query Frame = 1
Query:  910 RPLNLAALTLSAQIASGGRKRTPARSQSGNPRPQ-RALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSR-----WSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIY---------FVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQ 1980
            RP  ++ L +  +IA               P P+  A F L+  NP R  C K++    F  LIL  I  +  ALAA  P   R  +  N+ L   +  F  IFT E +LK+  FG  +H GA+ RN +NLLD L+V + L+S      S     VK LR  RVLRPLR ++    L+ V+  +  A+  + +I ++   +  ++A IG++LF GK     Y   D    +P  C                G   + KD   ++       W   +    +FDN   AM+ +F   T EGW  ++Y   DS G +   IY         F+  III +FF+MN+ +G +   F ++ EK  K  +  K + Q
Sbjct:  868 RPRRISELNMKEKIA---------------PIPEGSAFFILSKTNPIRVGCHKLINHHIFTNLILVFIMLSSAALAAEDPI--RSHSFRNTILGYFDYAFTAIFTVEILLKMTTFGAFLHKGAFCRNYFNLLDMLVVGVSLVS--FGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKF----YRCTDEAKSNPEEC---------------RGLFILYKDGDVDSPVVRERIWQNSDF---NFDNVLSAMMALFTVSTFEGWPALLYKAIDSNGENIGPIYNHRVEISIFFIIYIIIVAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQ 1198          

HSP 4 Score: 90.8929 bits (224), Expect = 4.222e-17
Identity = 57/203 (28.08%), Postives = 106/203 (52.22%), Query Frame = 1
Query: 4363 ITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIM 4971
            + S  F +++ VL+ LNT++++ +   QP    Q+ D  N V   +FT E L+K+ + G + YF   +N FD  +V G   + I   +   +        + I+ FR  R++R+ K+      +  L+ + + S +++  + LL+ +   I++++GMQ+FG     +E + K     + F  FPQA+L +F+  TGE W  +M
Sbjct:  544 VKSVTFYWLVIVLVFLNTLTISSEHYNQPDWLTQIQDIANKVLLALFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVELEIMSP-------LGISVFRCVRLLRIFKVTRHWTSLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETQTKR----STFDNFPQALLTVFQILTGEDWNAVM 735          

HSP 5 Score: 87.8113 bits (216), Expect = 3.418e-16
Identity = 55/178 (30.90%), Postives = 92/178 (51.69%), Query Frame = 1
Query: 1036 RNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPD----VKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKL 1557
            +NP++     +V   PFEY++   I  N   LA         S   N A++ + +VF  +FT E VLK++AF     P  Y  + WN  D LIVI  +I   LS+           +   R FRV+R ++L+S    ++ ++ + +++   L ++ALL   +  IYA+IG+++F GK+
Sbjct: 1215 KNPYQYKFWYVVNSSPFEYMMFVLIMLNTLCLAMQH---YEQSKMFNDAMDILNMVFTGVFTVEMVLKVIAF----KPKGYFSDAWNTFDSLIVIGSIIDVALSEADNSEESNRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQMF-GKV 1384          

HSP 6 Score: 85.8853 bits (211), Expect = 1.563e-15
Identity = 79/286 (27.62%), Postives = 128/286 (44.76%), Query Frame = 1
Query: 3346 ASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPL--DAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPI-----------NNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEF---MFAVIGVQLFNGK------FQSCNDVSKNTHISC----RGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIY 4125
            A + F    NN  R+ C  I     F   +L+ I  +   LA   P   D  +S N  L   +Y F  +FTVE  LK+I YGL+ H  A+ R+  N+LD ++V+  + S  +           ++   S    ++ LR  R LR +    G+  +   +   +K++  ++ +  L+ F   ++A+IG++LF GK      F   + V++     C     G+    N  +    +V     I    NFDN   AMLT+F   T EGW  VLY   D+   ++  +Y
Sbjct:  127 ARALFCLSLNNPIRRACISIVEWKPFDIFILLAIFANCVALAIYIPFPEDDSNSTNHNLEKVEYAFLIIFTVETFLKIIAYGLLLHPNAYVRNGWNLLDFVIVIVGLFSVILEQLTKETEGGNHSSGKSGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHKTCFFADSDIVAEEDPAPCAFSGNGRQCTANGTECRSGWVGPNGGIT---NFDNFAFAMLTVFQCITMEGWTDVLYWVNDAIGWEWPWVY 409          

HSP 7 Score: 85.5001 bits (210), Expect = 1.773e-15
Identity = 59/249 (23.69%), Postives = 112/249 (44.98%), Query Frame = 1
Query: 4360 LITSRPFEYIIFVLIMLNTISLALKF---DKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGF----KNYFSDAWNVFDFIIVLGSFIDIIYDHVN----GTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMF-----------------------------GKITTENEKEMKE--INRN---NNFQTFPQAILVLFRSATGEAWQNIM 4971
            ++  +PF+  I + I  N ++LA+     +         ++ +   F  +FTVE  LK+ A+G       Y  + WN+ DF+IV+     +I + +     G N++        +   R FRV+R ++L+S    ++ +L + +K+   L ++ALL++ +  IYA+IG+++F                             G+  T N  E +   +  N    NF  F  A+L +F+  T E W +++
Sbjct:  146 IVEWKPFDIFILLAIFANCVALAIYIPFPEDDSNSTNHNLEKVEYAFLIIFTVETFLKIIAYGLLLHPNAYVRNGWNLLDFVIVIVGLFSVILEQLTKETEGGNHSSGKSGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHKTCFFADSDIVAEEDPAPCAFSGNGRQCTANGTECRSGWVGPNGGITNFDNFAFAMLTVFQCITMEGWTDVL 394          

HSP 8 Score: 85.1149 bits (209), Expect = 2.419e-15
Identity = 67/252 (26.59%), Postives = 138/252 (54.76%), Query Frame = 1
Query: 2281 LVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPP---LGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFD-KKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGI-------RSYGNLGK----SSMLSCLYYVILFICGNYILLNVFLAIAVDNL 2991
            +V S  F +++ VL+ LNT  L  +HY QS   +   +  N++F  +FT+EM++K+ +   + YF   +N FD  +VI SI+++ + + D       + ++  R  R++R+ K+      +R L+ + + S +++  + +L+ +   I++++GMQ+FG     D  +    +NF +F Q++L +F+  TGE W E+M   +        S  N G+     S  + +Y++  ++   ++++N+F+A+ +DN 
Sbjct: 1225 VVNSSPFEYMMFVLIMLNTLCLAMQHYEQSKMFNDAMDILNMVFTGVFTVEMVLKVIAFKPKGYFSDAWNTFDSLIVIGSIIDVALSEADNSEESNRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQMFGKVAMRDNNQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPGKLCDPESDYNPGEEYTCGSNFAIVYFISFYMLCAFLIINLFVAVIMDNF 1476          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Human
Match: CACNA1D (calcium voltage-gated channel subunit alpha1 D [Source:HGNC Symbol;Acc:HGNC:1391])

HSP 1 Score: 974.926 bits (2519), Expect = 0.000e+0
Identity = 542/902 (60.09%), Postives = 658/902 (72.95%), Query Frame = 1
Query: 3295 RRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMP-FRTHGRGSGPLISLISPTLVTTNECDEKDKDYLPSHLGAE----RRTHSIFGTMMNVLQRVGSTRRDS 5985
            RR+SE+  KEKI PIP  S+FFI    N  R  CH + NH  F N++LV IM+SSA LAAEDP+ + S RN IL YFDY FT++FTVEI LK+ T+G   H GAFCR+  N+LD+LVV  S++S+ I + AISVVKILRVLRVLRPLRAINRAKGLK VVQCV VA+++IGNIM+VT LL+FMFA IGVQLF GKF  C D +K+    CRG +I Y + D+    V +R W N+  NFDNV +AM+ LF VSTFEGWP +LYK+IDS  E+   IYN+R  +SIF+I YII++AFFM+NIFVGFVIVTFQ++GE+EYKNCELDKNQR+C+E+ALKA+P+RRYIPK  ++Y+ W+++ S PFEY++FVLIMLNT+ LA++  +Q + +   MD LNMVFTGVFTVE +LK+ AF  K YFSDAWN FD +IV+GS ID+     + +  ++R    ISI FFRLFRVMRLVKLLSRGEGIRTLLWTF+KSFQALPYVALLI MLFFIYAVIGMQMFGK+     ++  +INRNNNFQTFPQA+L+LFR ATGEAWQ IML CLP  +CD  SD    E Y                                            CGSNFA  YFISFYM+C+FLIINLFVAVIMDNFDYLTRDWSILGPHHLDEF R+WSEYDPEAKGRIKHLDVVTLLR+I PPLGFGK CPHR AC  LV MNMPLNSDGTVMFNATLFALVRT LKIKT+G+ ++Q NEELR VIKKIWK+TS K+LDQVVPPAG+D+VTVGKFYATFLIQ++FR++K+++ +   G   +++  ++L    RT        +  I P +     CD +D +   +    E    +R  ++ G  +N    V S RRDS
Sbjct:  846 RRISELNMKEKIAPIPEGSAFFILSKTNPIRVGCHKLINHHIFTNLILVFIMLSSAALAAEDPIRSHSFRNTILGYFDYAFTAIFTVEILLKMTTFGAFLHKGAFCRNYFNLLDMLVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYRCTDEAKSNPEECRGLFILYKDGDVDSPVVRERIWQNSDFNFDNVLSAMMALFTVSTFEGWPALLYKAIDSNGENIGPIYNHRVEISIFFIIYIIIVAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKFWYVVNSSPFEYMMFVLIMLNTLCLAMQHYEQSKMFNDAMDILNMVFTGVFTVEMVLKVIAFKPKGYFSDAWNTFDSLIVIGSIIDVALSEADNSEESNR----ISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQMFGKVAM---RDNNQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPGKLCDPESDYNPGEEYT-------------------------------------------CGSNFAIVYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTALKIKTEGN-LEQANEELRAVIKKIWKKTSMKLLDQVVPPAGDDEVTVGKFYATFLIQDYFRKFKKRKEQGLVGKYPAKNTTIALQAGLRT--------LHDIGPEIRRAISCDLQDDEPEETKREEEDDVFKRNGALLGNHVN---HVNSDRRDS 1685          

HSP 2 Score: 706.057 bits (1821), Expect = 0.000e+0
Identity = 398/693 (57.43%), Postives = 494/693 (71.28%), Query Frame = 1
Query:  970 RTPARSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSE------------GGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCY-SKNDVMMES-PVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGGAHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGS 3006
            ++  +  S N RP RALFCL+L NP R+ CI IVEWKPF+  IL  IFANC ALA   P+PE DSN+ N  LEK+E  F++IFT E  LKI+A+G ++HP AY+RNGWNLLDF+IVI+GL S +L ++++            GG DVKALRAFRVLRPLRLVSG+PSLQVV+NSI++AMVPL HIALL LFVIIIYAIIGLELF GK+H TC+ + +D++ E  P PC+ S N G QC    ++G +  C+      S W GPN GIT+FDNF  AMLTVFQCITMEGWT ++YW+ND++G   PW+YFVSL+I GSFFV+NLVLGVLSGEFSKEREKAK RG +QK RE+ Q +ED++GYLDWI  AEDI  + E +G E GK +         +S  + + +   ++ +  E E         Q +    L  R  R      RR    +     ++ V++ LVFLNT  ++SEHY Q  WL   Q+ AN + + LFT EML+KMYSLG++ YF  +FNRFD FVV   I E ++++ + M PLG+SV RC RLLR+FKVTR+W+SL NLV SLL SMKSI SLL+LLFLFI+IFSLLGMQLFGGKFNFD+    RS FD+F Q+LLTVFQILTGEDWN VMYDGI +YG    S M+ C+Y++ILFICGNYILLNVFLAIAVDNLAD  S
Sbjct:   90 KSKKQGNSSNSRPARALFCLSLNNPIRRACISIVEWKPFDIFILLAIFANCVALAIYIPFPEDDSNSTNHNLEKVEYAFLIIFTVETFLKIIAYGLLLHPNAYVRNGWNLLDFVIVIVGLFSVILEQLTKETEGGNHSSGKSGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHKTCFFADSDIVAEEDPAPCAFSGN-GRQCT---ANGTE--CR------SGWVGPNGGITNFDNFAFAMLTVFQCITMEGWTDVLYWMNDAMGFELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEGGEEGKRN---------TSMPTSETESVNTENVSGEGENRGCCGSLCQAISKSKLSRRWRRWNRFNRRRCRAAVKSVTFYWLVIV-LVFLNTLTISSEHYNQPDWLTQIQDIANKVLLALFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVELEIMSPLGISVFRCVRLLRIFKVTRHWTSLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETQTKRSTFDNFPQALLTVFQILTGEDWNAVMYDGIMAYGGPSSSGMIVCIYFIILFICGNYILLNVFLAIAVDNLADAES 760          

HSP 3 Score: 122.865 bits (307), Expect = 9.382e-27
Identity = 112/372 (30.11%), Postives = 168/372 (45.16%), Query Frame = 1
Query:  910 RPLNLAALTLSAQIASGGRKRTPARSQSGNPRPQ-RALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSR-----WSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIY---------FVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQ 1980
            RP  ++ L +  +IA               P P+  A F L+  NP R  C K++    F  LIL  I  +  ALAA  P   R  +  N+ L   +  F  IFT E +LK+  FG  +H GA+ RN +NLLD L+V + L+S      S     VK LR  RVLRPLR ++    L+ V+  +  A+  + +I ++   +  ++A IG++LF GK     Y   D    +P  C                G   + KD   ++       W   +    +FDN   AM+ +F   T EGW  ++Y   DS G +   IY         F+  III +FF+MN+ +G +   F ++ EK  K  +  K + Q
Sbjct:  844 RPRRISELNMKEKIA---------------PIPEGSAFFILSKTNPIRVGCHKLINHHIFTNLILVFIMLSSAALAAEDPI--RSHSFRNTILGYFDYAFTAIFTVEILLKMTTFGAFLHKGAFCRNYFNLLDMLVVGVSLVS--FGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKF----YRCTDEAKSNPEEC---------------RGLFILYKDGDVDSPVVRERIWQNSDF---NFDNVLSAMMALFTVSTFEGWPALLYKAIDSNGENIGPIYNHRVEISIFFIIYIIIVAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQ 1174          

HSP 4 Score: 90.8929 bits (224), Expect = 4.351e-17
Identity = 57/203 (28.08%), Postives = 106/203 (52.22%), Query Frame = 1
Query: 4363 ITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIM 4971
            + S  F +++ VL+ LNT++++ +   QP    Q+ D  N V   +FT E L+K+ + G + YF   +N FD  +V G   + I   +   +        + I+ FR  R++R+ K+      +  L+ + + S +++  + LL+ +   I++++GMQ+FG     +E + K     + F  FPQA+L +F+  TGE W  +M
Sbjct:  520 VKSVTFYWLVIVLVFLNTLTISSEHYNQPDWLTQIQDIANKVLLALFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVELEIMSP-------LGISVFRCVRLLRIFKVTRHWTSLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETQTKR----STFDNFPQALLTVFQILTGEDWNAVM 711          

HSP 5 Score: 87.8113 bits (216), Expect = 4.168e-16
Identity = 55/178 (30.90%), Postives = 92/178 (51.69%), Query Frame = 1
Query: 1036 RNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPD----VKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKL 1557
            +NP++     +V   PFEY++   I  N   LA         S   N A++ + +VF  +FT E VLK++AF     P  Y  + WN  D LIVI  +I   LS+           +   R FRV+R ++L+S    ++ ++ + +++   L ++ALL   +  IYA+IG+++F GK+
Sbjct: 1191 KNPYQYKFWYVVNSSPFEYMMFVLIMLNTLCLAMQH---YEQSKMFNDAMDILNMVFTGVFTVEMVLKVIAF----KPKGYFSDAWNTFDSLIVIGSIIDVALSEADNSEESNRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQMF-GKV 1360          

HSP 6 Score: 87.0409 bits (214), Expect = 5.881e-16
Identity = 63/257 (24.51%), Postives = 117/257 (45.53%), Query Frame = 1
Query: 4360 LITSRPFEYIIFVLIMLNTISLALKF---DKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGF----KNYFSDAWNVFDFIIVLGSFIDIIYDHVN----GTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMF-----------------------------GKITTENEKEMKE--INRN---NNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAM 4995
            ++  +PF+  I + I  N ++LA+     +         ++ +   F  +FTVE  LK+ A+G       Y  + WN+ DF+IV+     +I + +     G N++        +   R FRV+R ++L+S    ++ +L + +K+   L ++ALL++ +  IYA+IG+++F                             G+  T N  E +   +  N    NF  F  A+L +F+  T E W ++ L+ + DAM
Sbjct:  122 IVEWKPFDIFILLAIFANCVALAIYIPFPEDDSNSTNHNLEKVEYAFLIIFTVETFLKIIAYGLLLHPNAYVRNGWNLLDFVIVIVGLFSVILEQLTKETEGGNHSSGKSGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHKTCFFADSDIVAEEDPAPCAFSGNGRQCTANGTECRSGWVGPNGGITNFDNFAFAMLTVFQCITMEGWTDV-LYWMNDAM 377          

HSP 7 Score: 85.1149 bits (209), Expect = 2.536e-15
Identity = 67/252 (26.59%), Postives = 138/252 (54.76%), Query Frame = 1
Query: 2281 LVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPP---LGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFD-KKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGI-------RSYGNLGK----SSMLSCLYYVILFICGNYILLNVFLAIAVDNL 2991
            +V S  F +++ VL+ LNT  L  +HY QS   +   +  N++F  +FT+EM++K+ +   + YF   +N FD  +VI SI+++ + + D       + ++  R  R++R+ K+      +R L+ + + S +++  + +L+ +   I++++GMQ+FG     D  +    +NF +F Q++L +F+  TGE W E+M   +        S  N G+     S  + +Y++  ++   ++++N+F+A+ +DN 
Sbjct: 1201 VVNSSPFEYMMFVLIMLNTLCLAMQHYEQSKMFNDAMDILNMVFTGVFTVEMVLKVIAFKPKGYFSDAWNTFDSLIVIGSIIDVALSEADNSEESNRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQMFGKVAMRDNNQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPGKLCDPESDYNPGEEYTCGSNFAIVYFISFYMLCAFLIINLFVAVIMDNF 1452          

HSP 8 Score: 83.9593 bits (206), Expect = 5.492e-15
Identity = 79/286 (27.62%), Postives = 127/286 (44.41%), Query Frame = 1
Query: 3346 ASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPL--DAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPI-----------NNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEF---MFAVIGVQLFNGK------FQSCNDVSKNTHISC----RGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIY 4125
            A + F    NN  R+ C  I     F   +L+ I  +   LA   P   D  +S N  L   +Y F  +FTVE  LK+I YGL+ H  A+ R+  N+LD ++V+  + S  +           ++   S    ++ LR  R LR +    G+  +   +   +K++  ++ +  L+ F   ++A+IG++LF GK      F   + V++     C     G+    N  +    +V     I    NFDN   AMLT+F   T EGW  VLY   D+   +   +Y
Sbjct:  103 ARALFCLSLNNPIRRACISIVEWKPFDIFILLAIFANCVALAIYIPFPEDDSNSTNHNLEKVEYAFLIIFTVETFLKIIAYGLLLHPNAYVRNGWNLLDFVIVIVGLFSVILEQLTKETEGGNHSSGKSGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHKTCFFADSDIVAEEDPAPCAFSGNGRQCTANGTECRSGWVGPNGGIT---NFDNFAFAMLTVFQCITMEGWTDVLYWMNDAMGFELPWVY 385          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Celegans
Match: egl-19 (Voltage-dependent L-type calcium channel subunit alpha [Source:UniProtKB/TrEMBL;Acc:W6RY76])

HSP 1 Score: 1032.32 bits (2668), Expect = 0.000e+0
Identity = 589/1014 (58.09%), Postives = 707/1014 (69.72%), Query Frame = 1
Query: 3295 RRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHC--LPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAG-NDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMP--FRTHGRGSGPLISLISPTLVTTNECDEKDKDYLPSHLGAERRTHSIFGTMMNVLQRVGSTRRDSNASPSTGSINHSTELPRDRSNSRPMILNQSKSPTNHPPVKLTL---APVIEGQVISNEEYSAEIPPKLPKTVSKQSLNYDKKPL---TSKQPRVEYTMRDKLSLRSPPLDID 6303
            RR+SEV A   +KPIP ASS FI    N FR FC+ + NH +F N VL CI+VSSAMLAAEDPL A S+RN ILNYFDY FTSVFTVEITLKVI +GLVFH G+FCR++ N+LD+LVV  S+ S+ +  DA+SVVKILRVLRVLRPLRAINRAKGLK VVQCV+VAVK+IGNIMLVTF+L+FMFA+IGVQLF G F  CND+SK T   CRG+YI+Y + D  K    KR W NN  NFDNV +AM++LF VSTFEGWP +LY +IDS +ED   I+N+R  V++F+IA+IIVIAFFM+NIFVGFVIVTFQ EGE EY+NCELDKNQRKCIEFALKAKP RRYIP+   +YRVWW +TSR FEY+IF++I++NT+SLA K     + +E  +D  N++FTGVF  E +LK+ A   KNY SD WNVFD ++V+GSFIDI Y  +N    N     LISINFFRLFRVMRLVKLLSRGEGIRTLLWTF+KSFQALPYVALLIV+LFFIYAVIGMQ FGK+  ++      I+RNNNF +FP AILVLFRSATGEAWQ+IML C    D  CD +SD   K                G N+S                         +CG+NFAYPYFISF+M+CSFL+INLFVAVIMDNFDYLTRDWSILGPHHL+EFVRLWSEYDP+AKGRIKHLDVVTLLRKI+PPLGFGK CPHR AC  LV MNMPLNSDGTV FNATLFALVRTNLKI T+G+ +D+ NE+LR  IK+IWKRT + +LD+VVPPAG  DDVTVGKFYATFLIQ++FRR+K+++  E KG+  +Q+ +   +    RT       L   IS  L T    DE +    P H    RR HS+F  +++ L   GS     +     G    ST LP    +  P     S +     PV   +   AP+ +   +     SA   P LP   +      D  P    T  +   + + R  ++ R+ P+D D
Sbjct:  758 RRMSEVPAASTVKPIPKASSLFILSHTNSFRVFCNMVVNHSYFTNAVLFCILVSSAMLAAEDPLQANSTRNMILNYFDYFFTSVFTVEITLKVIVFGLVFHKGSFCRNAFNLLDILVVAVSLTSFVLRTDAMSVVKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIMLVTFMLQFMFAIIGVQLFKGTFFLCNDLSKMTEAECRGEYIHYEDGDPTKPVSKKRVWSNNDFNFDNVGDAMISLFVVSTFEGWPQLLYVAIDSNEEDKGPIHNSRQAVALFFIAFIIVIAFFMMNIFVGFVIVTFQNEGEREYENCELDKNQRKCIEFALKAKPHRRYIPRNRLQYRVWWFVTSRAFEYVIFLIIVMNTVSLACKHYPSSRGFEDFLDVFNLIFTGVFAFEAVLKIVALNPKNYISDRWNVFDLLVVVGSFIDITYGKLNPGGTN-----LISINFFRLFRVMRLVKLLSRGEGIRTLLWTFMKSFQALPYVALLIVLLFFIYAVIGMQFFGKVALDDS---TSIHRNNNFHSFPAAILVLFRSATGEAWQDIMLSCSDREDVRCDPMSDDYHKG---------------GLNES-------------------------RCGNNFAYPYFISFFMLCSFLVINLFVAVIMDNFDYLTRDWSILGPHHLEEFVRLWSEYDPDAKGRIKHLDVVTLLRKISPPLGFGKLCPHRLACKRLVSMNMPLNSDGTVCFNATLFALVRTNLKIYTEGN-IDEANEQLRSAIKRIWKRTHKDLLDEVVPPAGKEDDVTVGKFYATFLIQDYFRRFKKRKEMEAKGVLPAQTPQAMALQAGLRTLHEIGPELKRAISGNLETDFNFDEPE----PQH----RRPHSLFNNLVHRLSGAGSKSPTEHERIEKG----STLLPFQPRSFSP---THSLAGAEGSPVPSQMHRGAPINQSINLPPVNGSARRLPALPPYANHIHDETDDGPRYRDTGDRAGYDQSSRMVVANRNLPVDPD 1707          

HSP 2 Score: 502.286 bits (1292), Expect = 5.728e-145
Identity = 243/393 (61.83%), Postives = 297/393 (75.57%), Query Frame = 1
Query:  916 LNLAALTLSAQIASGGR--KRTPARSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCY--SKNDVMMESPVPCSTSV-NKGYQC---DDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDI---SDDEEND 2061
            L  A    S+Q A+  R  +R P R  +   R +R+L CL+L NP RK CI IVEWKPFE+LILF I ANC ALA   PYP +DS+  N+ LE IE VFIV+FT ECVLKI+A GF+ HP AYLRN WN+LDF+IV+IGL+ST+LSKMS  G DVKALRAFRVLRPLRLVSG+PSLQVV+N+I+RAM+PL HIALL LFVI+IYAIIGLELF GKLHSTC   +   +  + P PC T      ++C   D   + G ++ C  N    + W GPN GIT+FDNFGLAMLTVFQC+++EGWT +MYW+ND+VG  WPWIYFV+L+I+GSFFV+NLVLGVLSGEFSKEREKA+ RG +QK RE+ Q +ED++GYLDWI  AEDI   ++DE+ D
Sbjct:   32 LQAAVAASSSQDATKKRPAQRKPLRQTNVVERSERSLLCLSLNNPIRKLCISIVEWKPFEFLILFMICANCIALAIYQPYPAQDSDYKNTLLETIEYVFIVVFTIECVLKIVAMGFMFHPSAYLRNAWNILDFIIVVIGLVSTILSKMSIQGFDVKALRAFRVLRPLRLVSGVPSLQVVLNAILRAMIPLLHIALLVLFVILIYAIIGLELFCGKLHSTCIDPATGQLAQKDPTPCGTDTEGSAFKCQPSDSLTNMGVRWECSSN----TTWPGPNNGITNFDNFGLAMLTVFQCVSLEGWTDVMYWVNDAVGREWPWIYFVTLVILGSFFVLNLVLGVLSGEFSKEREKARARGLFQKFREKQQLEEDLKGYLDWITQAEDIEPVNEDEQED 420          

HSP 3 Score: 276.174 bits (705), Expect = 7.591e-74
Identity = 174/243 (71.60%), Postives = 205/243 (84.36%), Query Frame = 1
Query: 2281 LVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFD-KKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGS 3006
            LVKSQ FYW+VI+LV LNT VLTSEHY QS WLD FQ  AN+ FV+LF++EML+KMYSLG   Y    FNRFD FVVI SILE V++  D M PLGVSVLR ARLLR+FKVT+YW+SLRNLV SLL S++SI+SLL+LLFLFIVIF+LLGMQ+FGGKFNF+ ++ KPR+NFD+FVQ+LLTVFQILTGEDWN VMY GI S+G +G   ++ C+YY++LFICGNYILLNVFLAIAVDNLAD  S
Sbjct:  469 LVKSQTFYWLVILLVLLNTLVLTSEHYGQSEWLDHFQTMANLFFVILFSMEMLLKMYSLGFTTYTTSQFNRFDCFVVISSILEFVLVYFDLMKPLGVSVLRSARLLRIFKVTKYWTSLRNLVSSLLNSLRSIISLLLLLFLFIVIFALLGMQVFGGKFNFNPQQPKPRANFDTFVQALLTVFQILTGEDWNTVMYHGIESFGGVGTLGVIVCIYYIVLFICGNYILLNVFLAIAVDNLADADS 711          

HSP 4 Score: 142.51 bits (358), Expect = 3.605e-33
Identity = 106/349 (30.37%), Postives = 169/349 (48.42%), Query Frame = 1
Query:  973 TPARSQSGNPRPQ-RALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSR---WSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDS---------VGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQ 1980
             PA S +  P P+  +LF L+  N FR FC  +V    F   +LF I  +   LAA  P   + ++T N  L   +  F  +FT E  LK++ FG + H G++ RN +NLLD L+V + L S VL   ++    VK LR  RVLRPLR ++    L+ V+  ++ A+  + +I L+   +  ++AIIG++LF G    T +  ND+   +   C                   Y   D     S+   WS  +    +FDN G AM+++F   T EGW Q++Y   DS                ++F++ II+ +FF+MN+ +G +   F  E E+  +  +  K + +
Sbjct:  763 VPAAS-TVKPIPKASSLFILSHTNSFRVFCNMVVNHSYFTNAVLFCILVSSAMLAAEDPL--QANSTRNMILNYFDYFFTSVFTVEITLKVIVFGLVFHKGSFCRNAFNLLDILVVAVSLTSFVLR--TDAMSVVKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIMLVTFMLQFMFAIIGVQLFKG----TFFLCNDLSKMTEAEC-------------RGEYIHYEDGDPTKPVSKKRVWSNNDF---NFDNVGDAMISLFVVSTFEGWPQLLYVAIDSNEEDKGPIHNSRQAVALFFIAFIIVIAFFMMNIFVGFVIVTFQNEGEREYENCELDKNQRK 1086          

HSP 5 Score: 95.1301 bits (235), Expect = 7.336e-19
Identity = 90/355 (25.35%), Postives = 156/355 (43.94%), Query Frame = 1
Query: 1069 VEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKAL---RAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWIND---------------------SVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKY---QKAREQMQFDEDVQG---YLDWIGAAEDIS 2043
            V  + FEY+I   I  N  +LA    YP   S      L+   L+F  +F  E VLKI+A    ++P  Y+ + WN+ D L+V+   I     K++ GG ++ ++   R FRV+R ++L+S    ++ ++ + M++   L ++ALL + +  IYA+IG++ F GK+     + +D         STS+++    ++FHS                             F  A+L +F+  T E W  IM   +D                       G ++ + YF+S  ++ SF V+NL + V+   F          G +   +  R   ++D D +G   +LD +     IS
Sbjct: 1114 VTSRAFEYVIFLIIVMNTVSLACKH-YPS--SRGFEDFLDVFNLIFTGVFAFEAVLKIVA----LNPKNYISDRWNVFDLLVVVGSFIDITYGKLNPGGTNLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFMKSFQALPYVALLIVLLFFIYAVIGMQFF-GKV-----ALDD---------STSIHRN---NNFHS-----------------------------FPAAILVLFRSATGEAWQDIMLSCSDREDVRCDPMSDDYHKGGLNESRCGNNFAYPYFISFFMLCSFLVINLFVAVIMDNFDYLTRDWSILGPHHLEEFVRLWSEYDPDAKGRIKHLDVVTLLRKIS 1414          

HSP 6 Score: 90.1225 bits (222), Expect = 2.547e-17
Identity = 78/320 (24.38%), Postives = 144/320 (45.00%), Query Frame = 1
Query: 4360 LITSRPFEYIIFVLIMLNTISLAL--KFDKQPQRYEQ-VMDYLNMVFTGVFTVEFLLKLAAFGF----KNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMF-GKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNL---GFNDSMVIWPPHNFVKVKINKYIS--HYQDVA-----KCGSNFAYPYFISFYMICSFLIINLFVAVIMDNF 5265
            ++  +PFE++I  +I  N I+LA+   +  Q   Y+  +++ +  VF  VFT+E +LK+ A GF      Y  +AWN+ DFIIV+   +  I   ++             +   R FRV+R ++L+S    ++ +L   +++   L ++ALL++ +  IYA+IG+++F GK+ +                            ATG+  Q     C  D    A   Q      N+ V R   + N    G N+ +  +       + + + +S   + DV        G  + + YF++  ++ SF ++NL + V+   F
Sbjct:   84 IVEWKPFEFLILFMICANCIALAIYQPYPAQDSDYKNTLLETIEYVFIVVFTIECVLKIVAMGFMFHPSAYLRNAWNILDFIIVVIGLVSTILSKMSIQG--------FDVKALRAFRVLRPLRLVSGVPSLQVVLNAILRAMIPLLHIALLVLFVILIYAIIGLELFCGKLHS-----------------------TCIDPATGQLAQKDPTPCGTDTEGSAFKCQPSDSLTNMGV-RWECSSNTTWPGPNNGITNFDNFGLAMLTVFQCVSLEGWTDVMYWVNDAVGREWPWIYFVTLVILGSFFVLNLVLGVLSGEF 371          

HSP 7 Score: 89.3521 bits (220), Expect = 4.705e-17
Identity = 84/282 (29.79%), Postives = 134/282 (47.52%), Query Frame = 1
Query: 3352 SFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESS--RNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAIS--XXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQS-----------------CNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWI---NNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIY 4125
            S      NN  RK C  I     F  ++L  I  +   LA   P  A+ S  +N +L   +Y+F  VFT+E  LK++  G +FH  A+ R++ NILD ++V+  ++S  ++  +I    VK LR  RVLRPLR ++    L+ V+  ++ A+  + +I L+   +  ++A+IG++LF GK  S                 C   ++ +   C+      N     +   N   W    N   NFDN   AMLT+F   + EGW  V+Y   D+   ++  IY
Sbjct:   67 SLLCLSLNNPIRKLCISIVEWKPFEFLILFMICANCIALAIYQPYPAQDSDYKNTLLETIEYVFIVVFTIECVLKIVAMGFMFHPSAYLRNAWNILDFIIVVIGLVSTILSKMSIQGFDVKALRAFRVLRPLRLVSGVPSLQVVLNAILRAMIPLLHIALLVLFVILIYAIIGLELFCGKLHSTCIDPATGQLAQKDPTPCGTDTEGSAFKCQPSDSLTNMGVRWECSSNT-TWPGPNNGITNFDNFGLAMLTVFQCVSLEGWTDVMYWVNDAVGREWPWIY 347          

HSP 8 Score: 75.8702 bits (185), Expect = 5.080e-13
Identity = 66/256 (25.78%), Postives = 133/256 (51.95%), Query Frame = 1
Query: 2281 LVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVM--IQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPR-SNFDSFVQSLLTVFQILTGEDWNEVMY-----DGIRS--------YGNLGKSSM---LSCLYYVILFICGNYILLNVFLAIAVDNL 2991
             V S+AF +V+ +++ +NT  L  +HY  S   + F +  N+IF  +F  E ++K+ +L  + Y    +N FD  VV+ S ++I    +       + ++  R  R++R+ K+      +R L+ + + S +++  + +L+ L   I++++GMQ FG     D  +  R +NF SF  ++L +F+  TGE W ++M      + +R          G L +S      +  Y++  F+  +++++N+F+A+ +DN 
Sbjct: 1113 FVTSRAFEYVIFLIIVMNTVSLACKHYPSSRGFEDFLDVFNLIFTGVFAFEAVLKIVALNPKNYISDRWNVFDLLVVVGSFIDITYGKLNPGGTNLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFMKSFQALPYVALLIVLLFFIYAVIGMQFFGKVALDDSTSIHRNNNFHSFPAAILVLFRSATGEAWQDIMLSCSDREDVRCDPMSDDYHKGGLNESRCGNNFAYPYFISFFMLCSFLVINLFVAVIMDNF 1368          

HSP 9 Score: 67.3958 bits (163), Expect = 1.981e-10
Identity = 56/206 (27.18%), Postives = 111/206 (53.88%), Query Frame = 1
Query: 4360 LITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLH 4977
            L+ S+ F +++ +L++LNT+ L  +   Q +  +      N+ F  +F++E LLK+ + GF  Y +  +N FD  +V+ S ++ +  + +         + + ++  R  R++R+ K+      +R L+ + + S +++  + LL+ +   I+A++GMQ+FG     N ++ K      NF TF QA+L +F+  TGE W  +M H
Sbjct:  469 LVKSQTFYWLVILLVLLNTLVLTSEHYGQSEWLDHFQTMANLFFVILFSMEMLLKMYSLGFTTYTTSQFNRFDCFVVISSILEFVLVYFDLM-------KPLGVSVLRSARLLRIFKVTKYWTSLRNLVSSLLNSLRSIISLLLLLFLFIVIFALLGMQVFGGKFNFNPQQPKP---RANFDTFVQALLTVFQILTGEDWNTVMYH 664          

HSP 10 Score: 56.9954 bits (136), Expect = 3.329e-7
Identity = 59/243 (24.28%), Postives = 108/243 (44.44%), Query Frame = 1
Query: 1198 LVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGP-DVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPW-----IYFVSLIIIGSFFVMNLVLGV 1908
            L F+++F+ E +LK+ + GF      Y  + +N  D  +VI  ++  VL       P  V  LR+ R+LR  ++     SL+ +++S++ ++  +  + LL    I+I+A++G+++F GK +           + P P +                                       +FD F  A+LTVFQ +T E W  +MY   +S G          IY++ L I G++ ++N+ L +
Sbjct:  510 LFFVILFSMEMLLKMYSLGFT----TYTTSQFNRFDCFVVISSILEFVLVYFDLMKPLGVSVLRSARLLRIFKVTKYWTSLRNLVSSLLNSLRSIISLLLLLFLFIVIFALLGMQVFGGKFNFNP--------QQPKPRA---------------------------------------NFDTFVQALLTVFQILTGEDWNTVMYHGIESFGGVGTLGVIVCIYYIVLFICGNYILLNVFLAI 701          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Celegans
Match: egl-19 (Voltage-dependent L-type calcium channel subunit alpha [Source:UniProtKB/TrEMBL;Acc:W6RY76])

HSP 1 Score: 1031.94 bits (2667), Expect = 0.000e+0
Identity = 567/910 (62.31%), Postives = 671/910 (73.74%), Query Frame = 1
Query: 3295 RRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHC--LPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAG-NDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMP--FRTHGRGSGPLISLISPTLVTTNECDEKDKDYLPSHLGAERRTHSIFGTMMNVLQRVGSTRRDSNASPSTGS 6009
            RR+SEV A   +KPIP ASS FI    N FR FC+ + NH +F N VL CI+VSSAMLAAEDPL A S+RN ILNYFDY FTSVFTVEITLKVI +GLVFH G+FCR++ N+LD+LVV  S+ S+ +  DA+SVVKILRVLRVLRPLRAINRAKGLK VVQCV+VAVK+IGNIMLVTF+L+FMFA+IGVQLF G F  CND+SK T   CRG+YI+Y + D  K    KR W NN  NFDNV +AM++LF VSTFEGWP +LY +IDS +ED   I+N+R  V++F+IA+IIVIAFFM+NIFVGFVIVTFQ EGE EY+NCELDKNQRKCIEFALKAKP RRYIP+   +YRVWW +TSR FEY+IF++I++NT+SLA K     + +E  +D  N++FTGVF  E +LK+ A   KNY SD WNVFD ++V+GSFIDI Y  +N    N     LISINFFRLFRVMRLVKLLSRGEGIRTLLWTF+KSFQALPYVALLIV+LFFIYAVIGMQ FGK+  ++      I+RNNNF +FP AILVLFRSATGEAWQ+IML C    D  CD +SD   K                G N+S                         +CG+NFAYPYFISF+M+CSFL+INLFVAVIMDNFDYLTRDWSILGPHHL+EFVRLWSEYDP+AKGRIKHLDVVTLLRKI+PPLGFGK CPHR AC  LV MNMPLNSDGTV FNATLFALVRTNLKI T+G+ +D+ NE+LR  IK+IWKRT + +LD+VVPPAG  DDVTVGKFYATFLIQ++FRR+K+++  E KG+  +Q+ +   +    RT       L   IS  L T    DE +    P H    RR HS+F  +++ L   GS     +     GS
Sbjct:  758 RRMSEVPAASTVKPIPKASSLFILSHTNSFRVFCNMVVNHSYFTNAVLFCILVSSAMLAAEDPLQANSTRNMILNYFDYFFTSVFTVEITLKVIVFGLVFHKGSFCRNAFNLLDILVVAVSLTSFVLRTDAMSVVKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIMLVTFMLQFMFAIIGVQLFKGTFFLCNDLSKMTEAECRGEYIHYEDGDPTKPVSKKRVWSNNDFNFDNVGDAMISLFVVSTFEGWPQLLYVAIDSNEEDKGPIHNSRQAVALFFIAFIIVIAFFMMNIFVGFVIVTFQNEGEREYENCELDKNQRKCIEFALKAKPHRRYIPRNRLQYRVWWFVTSRAFEYVIFLIIVMNTVSLACKHYPSSRGFEDFLDVFNLIFTGVFAFEAVLKIVALNPKNYISDRWNVFDLLVVVGSFIDITYGKLNPGGTN-----LISINFFRLFRVMRLVKLLSRGEGIRTLLWTFMKSFQALPYVALLIVLLFFIYAVIGMQFFGKVALDDS---TSIHRNNNFHSFPAAILVLFRSATGEAWQDIMLSCSDREDVRCDPMSDDYHKG---------------GLNES-------------------------RCGNNFAYPYFISFFMLCSFLVINLFVAVIMDNFDYLTRDWSILGPHHLEEFVRLWSEYDPDAKGRIKHLDVVTLLRKISPPLGFGKLCPHRLACKRLVSMNMPLNSDGTVCFNATLFALVRTNLKIYTEGN-IDEANEQLRSAIKRIWKRTHKDLLDEVVPPAGKEDDVTVGKFYATFLIQDYFRRFKKRKEMEAKGVLPAQTPQAMALQAGLRTLHEIGPELKRAISGNLETDFNFDEPE----PQH----RRPHSLFNNLVHRLSGAGSKSPTEHERIEKGS 1610          

HSP 2 Score: 502.671 bits (1293), Expect = 1.438e-145
Identity = 243/393 (61.83%), Postives = 297/393 (75.57%), Query Frame = 1
Query:  916 LNLAALTLSAQIASGGR--KRTPARSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCY--SKNDVMMESPVPCSTSV-NKGYQC---DDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDI---SDDEEND 2061
            L  A    S+Q A+  R  +R P R  +   R +R+L CL+L NP RK CI IVEWKPFE+LILF I ANC ALA   PYP +DS+  N+ LE IE VFIV+FT ECVLKI+A GF+ HP AYLRN WN+LDF+IV+IGL+ST+LSKMS  G DVKALRAFRVLRPLRLVSG+PSLQVV+N+I+RAM+PL HIALL LFVI+IYAIIGLELF GKLHSTC   +   +  + P PC T      ++C   D   + G ++ C  N    + W GPN GIT+FDNFGLAMLTVFQC+++EGWT +MYW+ND+VG  WPWIYFV+L+I+GSFFV+NLVLGVLSGEFSKEREKA+ RG +QK RE+ Q +ED++GYLDWI  AEDI   ++DE+ D
Sbjct:   32 LQAAVAASSSQDATKKRPAQRKPLRQTNVVERSERSLLCLSLNNPIRKLCISIVEWKPFEFLILFMICANCIALAIYQPYPAQDSDYKNTLLETIEYVFIVVFTIECVLKIVAMGFMFHPSAYLRNAWNILDFIIVVIGLVSTILSKMSIQGFDVKALRAFRVLRPLRLVSGVPSLQVVLNAILRAMIPLLHIALLVLFVILIYAIIGLELFCGKLHSTCIDPATGQLAQKDPTPCGTDTEGSAFKCQPSDSLTNMGVRWECSSN----TTWPGPNNGITNFDNFGLAMLTVFQCVSLEGWTDVMYWVNDAVGREWPWIYFVTLVILGSFFVLNLVLGVLSGEFSKEREKARARGLFQKFREKQQLEEDLKGYLDWITQAEDIEPVNEDEQED 420          

HSP 3 Score: 276.174 bits (705), Expect = 6.758e-74
Identity = 174/243 (71.60%), Postives = 205/243 (84.36%), Query Frame = 1
Query: 2281 LVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFD-KKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGS 3006
            LVKSQ FYW+VI+LV LNT VLTSEHY QS WLD FQ  AN+ FV+LF++EML+KMYSLG   Y    FNRFD FVVI SILE V++  D M PLGVSVLR ARLLR+FKVT+YW+SLRNLV SLL S++SI+SLL+LLFLFIVIF+LLGMQ+FGGKFNF+ ++ KPR+NFD+FVQ+LLTVFQILTGEDWN VMY GI S+G +G   ++ C+YY++LFICGNYILLNVFLAIAVDNLAD  S
Sbjct:  469 LVKSQTFYWLVILLVLLNTLVLTSEHYGQSEWLDHFQTMANLFFVILFSMEMLLKMYSLGFTTYTTSQFNRFDCFVVISSILEFVLVYFDLMKPLGVSVLRSARLLRIFKVTKYWTSLRNLVSSLLNSLRSIISLLLLLFLFIVIFALLGMQVFGGKFNFNPQQPKPRANFDTFVQALLTVFQILTGEDWNTVMYHGIESFGGVGTLGVIVCIYYIVLFICGNYILLNVFLAIAVDNLADADS 711          

HSP 4 Score: 142.51 bits (358), Expect = 3.534e-33
Identity = 106/349 (30.37%), Postives = 169/349 (48.42%), Query Frame = 1
Query:  973 TPARSQSGNPRPQ-RALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSR---WSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDS---------VGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQ 1980
             PA S +  P P+  +LF L+  N FR FC  +V    F   +LF I  +   LAA  P   + ++T N  L   +  F  +FT E  LK++ FG + H G++ RN +NLLD L+V + L S VL   ++    VK LR  RVLRPLR ++    L+ V+  ++ A+  + +I L+   +  ++AIIG++LF G    T +  ND+   +   C                   Y   D     S+   WS  +    +FDN G AM+++F   T EGW Q++Y   DS                ++F++ II+ +FF+MN+ +G +   F  E E+  +  +  K + +
Sbjct:  763 VPAAS-TVKPIPKASSLFILSHTNSFRVFCNMVVNHSYFTNAVLFCILVSSAMLAAEDPL--QANSTRNMILNYFDYFFTSVFTVEITLKVIVFGLVFHKGSFCRNAFNLLDILVVAVSLTSFVLR--TDAMSVVKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIMLVTFMLQFMFAIIGVQLFKG----TFFLCNDLSKMTEAEC-------------RGEYIHYEDGDPTKPVSKKRVWSNNDF---NFDNVGDAMISLFVVSTFEGWPQLLYVAIDSNEEDKGPIHNSRQAVALFFIAFIIVIAFFMMNIFVGFVIVTFQNEGEREYENCELDKNQRK 1086          

HSP 5 Score: 95.1301 bits (235), Expect = 8.336e-19
Identity = 89/352 (25.28%), Postives = 155/352 (44.03%), Query Frame = 1
Query: 1078 KPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKAL---RAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWIND---------------------SVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKY---QKAREQMQFDEDVQG---YLDWIGAAEDIS 2043
            + FEY+I   I  N  +LA    YP   S      L+   L+F  +F  E VLKI+A    ++P  Y+ + WN+ D L+V+   I     K++ GG ++ ++   R FRV+R ++L+S    ++ ++ + M++   L ++ALL + +  IYA+IG++ F GK+     + +D         STS+++    ++FHS                             F  A+L +F+  T E W  IM   +D                       G ++ + YF+S  ++ SF V+NL + V+   F          G +   +  R   ++D D +G   +LD +     IS
Sbjct: 1117 RAFEYVIFLIIVMNTVSLACKH-YPS--SRGFEDFLDVFNLIFTGVFAFEAVLKIVA----LNPKNYISDRWNVFDLLVVVGSFIDITYGKLNPGGTNLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFMKSFQALPYVALLIVLLFFIYAVIGMQFF-GKV-----ALDD---------STSIHRN---NNFHS-----------------------------FPAAILVLFRSATGEAWQDIMLSCSDREDVRCDPMSDDYHKGGLNESRCGNNFAYPYFISFFMLCSFLVINLFVAVIMDNFDYLTRDWSILGPHHLEEFVRLWSEYDPDAKGRIKHLDVVTLLRKIS 1414          

HSP 6 Score: 89.3521 bits (220), Expect = 5.048e-17
Identity = 78/320 (24.38%), Postives = 144/320 (45.00%), Query Frame = 1
Query: 4360 LITSRPFEYIIFVLIMLNTISLAL--KFDKQPQRYEQ-VMDYLNMVFTGVFTVEFLLKLAAFGF----KNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMF-GKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNL---GFNDSMVIWPPHNFVKVKINKYIS--HYQDVA-----KCGSNFAYPYFISFYMICSFLIINLFVAVIMDNF 5265
            ++  +PFE++I  +I  N I+LA+   +  Q   Y+  +++ +  VF  VFT+E +LK+ A GF      Y  +AWN+ DFIIV+   +  I   ++             +   R FRV+R ++L+S    ++ +L   +++   L ++ALL++ +  IYA+IG+++F GK+ +                            ATG+  Q     C  D    A   Q      N+ V R   + N    G N+ +  +       + + + +S   + DV        G  + + YF++  ++ SF ++NL + V+   F
Sbjct:   84 IVEWKPFEFLILFMICANCIALAIYQPYPAQDSDYKNTLLETIEYVFIVVFTIECVLKIVAMGFMFHPSAYLRNAWNILDFIIVVIGLVSTILSKMSIQG--------FDVKALRAFRVLRPLRLVSGVPSLQVVLNAILRAMIPLLHIALLVLFVILIYAIIGLELFCGKLHS-----------------------TCIDPATGQLAQKDPTPCGTDTEGSAFKCQPSDSLTNMGV-RWECSSNTTWPGPNNGITNFDNFGLAMLTVFQCVSLEGWTDVMYWVNDAVGREWPWIYFVTLVILGSFFVLNLVLGVLSGEF 371          

HSP 7 Score: 88.9669 bits (219), Expect = 5.972e-17
Identity = 75/282 (26.60%), Postives = 127/282 (45.04%), Query Frame = 1
Query: 3352 SFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESS--RNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXX--XXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQS-----------------CNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWI---NNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIY 4125
            S      NN  RK C  I     F  ++L  I  +   LA   P  A+ S  +N +L   +Y+F  VFT+E  LK++  G +FH  A+ R++ NILD ++V+  ++S  ++  +I    +  +        LR ++    L+ V+  ++ A+  + +I L+   +  ++A+IG++LF GK  S                 C   ++ +   C+      N     +   N   W    N   NFDN   AMLT+F   + EGW  V+Y   D+   ++  IY
Sbjct:   67 SLLCLSLNNPIRKLCISIVEWKPFEFLILFMICANCIALAIYQPYPAQDSDYKNTLLETIEYVFIVVFTIECVLKIVAMGFMFHPSAYLRNAWNILDFIIVVIGLVSTILSKMSIQGFDVKALRAFRVLRPLRLVSGVPSLQVVLNAILRAMIPLLHIALLVLFVILIYAIIGLELFCGKLHSTCIDPATGQLAQKDPTPCGTDTEGSAFKCQPSDSLTNMGVRWECSSNT-TWPGPNNGITNFDNFGLAMLTVFQCVSLEGWTDVMYWVNDAVGREWPWIY 347          

HSP 8 Score: 75.8702 bits (185), Expect = 6.252e-13
Identity = 66/256 (25.78%), Postives = 133/256 (51.95%), Query Frame = 1
Query: 2281 LVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVM--IQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPR-SNFDSFVQSLLTVFQILTGEDWNEVMY-----DGIRS--------YGNLGKSSM---LSCLYYVILFICGNYILLNVFLAIAVDNL 2991
             V S+AF +V+ +++ +NT  L  +HY  S   + F +  N+IF  +F  E ++K+ +L  + Y    +N FD  VV+ S ++I    +       + ++  R  R++R+ K+      +R L+ + + S +++  + +L+ L   I++++GMQ FG     D  +  R +NF SF  ++L +F+  TGE W ++M      + +R          G L +S      +  Y++  F+  +++++N+F+A+ +DN 
Sbjct: 1113 FVTSRAFEYVIFLIIVMNTVSLACKHYPSSRGFEDFLDVFNLIFTGVFAFEAVLKIVALNPKNYISDRWNVFDLLVVVGSFIDITYGKLNPGGTNLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFMKSFQALPYVALLIVLLFFIYAVIGMQFFGKVALDDSTSIHRNNNFHSFPAAILVLFRSATGEAWQDIMLSCSDREDVRCDPMSDDYHKGGLNESRCGNNFAYPYFISFFMLCSFLVINLFVAVIMDNF 1368          

HSP 9 Score: 67.0106 bits (162), Expect = 2.442e-10
Identity = 56/206 (27.18%), Postives = 111/206 (53.88%), Query Frame = 1
Query: 4360 LITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLH 4977
            L+ S+ F +++ +L++LNT+ L  +   Q +  +      N+ F  +F++E LLK+ + GF  Y +  +N FD  +V+ S ++ +  + +         + + ++  R  R++R+ K+      +R L+ + + S +++  + LL+ +   I+A++GMQ+FG     N ++ K      NF TF QA+L +F+  TGE W  +M H
Sbjct:  469 LVKSQTFYWLVILLVLLNTLVLTSEHYGQSEWLDHFQTMANLFFVILFSMEMLLKMYSLGFTTYTTSQFNRFDCFVVISSILEFVLVYFDLM-------KPLGVSVLRSARLLRIFKVTKYWTSLRNLVSSLLNSLRSIISLLLLLFLFIVIFALLGMQVFGGKFNFNPQQPKP---RANFDTFVQALLTVFQILTGEDWNTVMYH 664          

HSP 10 Score: 56.6102 bits (135), Expect = 4.216e-7
Identity = 59/243 (24.28%), Postives = 108/243 (44.44%), Query Frame = 1
Query: 1198 LVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGP-DVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPW-----IYFVSLIIIGSFFVMNLVLGV 1908
            L F+++F+ E +LK+ + GF      Y  + +N  D  +VI  ++  VL       P  V  LR+ R+LR  ++     SL+ +++S++ ++  +  + LL    I+I+A++G+++F GK +           + P P +                                       +FD F  A+LTVFQ +T E W  +MY   +S G          IY++ L I G++ ++N+ L +
Sbjct:  510 LFFVILFSMEMLLKMYSLGFT----TYTTSQFNRFDCFVVISSILEFVLVYFDLMKPLGVSVLRSARLLRIFKVTKYWTSLRNLVSSLLNSLRSIISLLLLLFLFIVIFALLGMQVFGGKFNFNP--------QQPKPRA---------------------------------------NFDTFVQALLTVFQILTGEDWNTVMYHGIESFGGVGTLGVIVCIYYIVLFICGNYILLNVFLAI 701          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Celegans
Match: unc-2 (High voltage activated calcium channel alpha-1 subunit [Source:UniProtKB/TrEMBL;Acc:Q86G45])

HSP 1 Score: 647.506 bits (1669), Expect = 0.000e+0
Identity = 367/813 (45.14%), Postives = 497/813 (61.13%), Query Frame = 1
Query: 3331 KPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXX------XXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQY-IYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIP--KQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDG-STVDQLNEELRVVIKKIWKRTSQK-MLDQVVPPAGN---DDVTVGKFYATFLIQEWFRRWK 5727
            KP+   SS F   P N FR   H I    +F  +V+  I +SS  LAAEDP+D E+ RN++L Y DY FT VF  E+ LK+I  G++ H G++CR   NILD +VV  ++ ++       S  K L  ++ LR LR +   K +KR+ +   V      ++K++ NI++V FL +F+FAVI VQLFNGKF  C D ++    +C GQ+ +Y N+ D  +V   +REW   P N+DN  NAMLTLF V+T EGWPG+   S+D+  ED       R  V++FY+ + IV  FF +NIFV  +I+TFQ++GE E    +LDKNQ++CI+FAL A+P   ++P  K S +YR+W L+TS PFEY I  +I  NT+ L +K+   P  YE+++   N   T VFTVE +LK+ AFG +NYF D WN FDF+ V+GS  D +     G          +S+ F RLFR  RL++LL +G  IR LLWTFV+SF+ALPYV LLI MLFFIYA++GMQ+FG I         EINR+NNFQ+F  A+++LFR ATGE WQ+IM+  +    C                    +AG+   N                      ++    CGSN +Y YF SF  + SFL++NLFVAVIMDNFDYLTRD SILGPHHLDEF+R+W++YDP A GRI + ++  +LR + PP+GFGK CP+R A   L+RMNMP+  DGTV F  TLFAL+R +L IK      +D+ +EELR+ +KKIW   ++K M+D VVPP        +TVGK YA  LI E +R  K
Sbjct:  970 KPMVPYSSMFFLSPTNPFRVLIHSIVCTKYFEMMVMTVICLSSVSLAAEDPVDEENPRNKVLQYMDYCFTGVFACEMLLKLIDQGILLHPGSYCRDFWNILDGIVVTCALFAFGFAGTEGSAGKNLNTIKSLRVLRVLRPLKTIKRIPKLKAVFDCVVNSLKNVFNILIVYFLFQFIFAVIAVQLFNGKFFFCTDKNRKFANTCHGQFFVYDNQNDPPRV--EQREWRLRPFNYDNTINAMLTLFVVTTGEGWPGIRQNSMDTTFEDQGPSPFFRVEVALFYVMFFIVFPFFFVNIFVALIIITFQEQGEAELSEGDLDKNQKQCIDFALNARPRSLFMPEDKNSTKYRIWRLVTSPPFEYFIMTMICCNTLILMMKYYNNPLFYEEILRLFNTALTAVFTVESILKILAFGVRNYFRDGWNRFDFVTVVGSITDALVTEFGG--------HFVSLGFLRLFRAARLIRLLQQGYTIRILLWTFVQSFKALPYVCLLIGMLFFIYAIVGMQVFGNIWL---NAATEINRHNNFQSFFNAVILLFRCATGEGWQDIMMAAVQGKDC-------------------ARAGSAEIN----------------------FEKGQTCGSNVSYAYFTSFVFLSSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEFIRVWADYDPAATGRIHYSEMYEMLRIMAPPVGFGKKCPYRLAYKHLIRMNMPVAEDGTVHFTTTLFALIRESLSIKMRPVEEMDEADEELRLTLKKIWPLKAKKNMVDLVVPPNHELCFQKLTVGKIYAGLLILENYRARK 1728          

HSP 2 Score: 505.368 bits (1300), Expect = 9.128e-145
Identity = 315/705 (44.68%), Postives = 442/705 (62.70%), Query Frame = 1
Query:  964 RKRTPARSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLIS-------TVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKN---DVMMESPVPCS--TSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDI------SDDEEN----DGKENGKESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGGA----HHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADT 3000
            RK T + +     +   +LF     N  R+    I+EW PFEY IL TI  NC  L+     P+ D   ++  LE+ E  F+ IF  ECVLK++AFGF +H G+YLR+GWN++DF++V+ G+++       T  +       D++ LRA RVLRPL+LVSG+PSLQVV+ SI+ AM PL  I LL LF III+AIIGLE +SG  HS CY++    + + E P+PC+  TS    Y CD   ++  +           +W GPN GITSFDN G AM+TVFQCITMEGWT +MY+ NDS+G ++ W YF+ LI++GSFF++NLVLGVLSGEF+KERE+ + R ++ K R Q Q + ++ GYL+WI  AE++      + +EE     + +      + K     +S+E  +D ++   +  +   + G       +++++   C  +       + ++ R   R +VK+Q FYW VI LVFLNT  + SEHY Q  W   F   A  +F+ +F +EML+K++++G R YF   FNRFD  V++ S  E++  +       G+SV+R  RLLR+FK+T YW SLRNLV SL+ SM+SI+SLL LLFLFI+IF+LLGMQLFGG+FNF     P ++FD+F  +L+TVFQILTGEDWNEVMY  I S G +        +Y+++L + GNY LLNVFLAIAVDNLA+ 
Sbjct:  214 RKTTLSSNAPVKEKGPSSLFIFAEDNIIRRNAKAIIEWGPFEYFILLTIIGNCVVLSMEQHLPKNDKKALSEWLERTEPYFMGIFCLECVLKVIAFGFALHKGSYLRSGWNIMDFIVVVSGVVTMLPFSPATQTANQPVDSVDLRTLRAVRVLRPLKLVSGIPSLQVVLKSILCAMAPLLQIGLLVLFAIIIFAIIGLEFYSGAFHSACYNERGEIENVSERPMPCTNKTSPMGVYNCDVKGTTCLQ-----------KWIGPNYGITSFDNIGFAMITVFQCITMEGWTTVMYYTNDSLGSTYNWAYFIPLIVLGSFFMLNLVLGVLSGEFAKERERVENRREFLKLRRQQQIERELNGYLEWILTAEEVILKEDRTTEEEKAAIMEARRRAANKKLKQASKQQSTETEEDFEEDEDEMEEEYVDEGGTVEDEFAERKKRGCCHSVGK-----FIKQLRIQIRIMVKTQIFYWSVITLVFLNTCCVASEHYGQPQWFTDFLKYAEFVFLGIFVVEMLLKLFAMGSRTYFASKFNRFDCVVIVGSAAEVIWAEVYG-GSFGISVMRALRLLRIFKLTSYWVSLRNLVRSLMNSMRSIISLLFLLFLFILIFALLGMQLFGGRFNF-PTMHPYTHFDTFPVALITVFQILTGEDWNEVMYLAIESQGGIYSGGWPYSIYFIVLVLFGNYTLLNVFLAIAVDNLANA 900          

HSP 3 Score: 122.865 bits (307), Expect = 3.139e-27
Identity = 87/280 (31.07%), Postives = 138/280 (49.29%), Query Frame = 1
Query:  994 GNPRPQ---RALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPD-----VKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSF--DNFGLAMLTVFQCITMEGWTQI 1803
            G P+P     ++F L+  NPFR     IV  K FE +++  I  +  +LAA  P  E   N  N  L+ ++  F  +F  E +LK++  G ++HPG+Y R+ WN+LD ++V   L +   +  +EG        +K+LR  RVLRPL+ +  +P L+ V + ++ ++  +F+I ++      I+A+I ++LF+GK    C  KN     +   C             H   F Y   DN+N+  R       +  F  DN   AMLT+F   T EGW  I
Sbjct:  967 GGPKPMVPYSSMFFLSPTNPFRVLIHSIVCTKYFEMMVMTVICLSSVSLAAEDPVDEE--NPRNKVLQYMDYCFTGVFACEMLLKLIDQGILLHPGSYCRDFWNILDGIVVTCALFAFGFAG-TEGSAGKNLNTIKSLRVLRVLRPLKTIKRIPKLKAVFDCVVNSLKNVFNILIVYFLFQFIFAVIAVQLFNGKFF-FCTDKNRKFANT---C-------------HGQFFVY---DNQNDPPRVEQREWRLRPFNYDNTINAMLTLFVVTTGEGWPGI 1223          

HSP 4 Score: 102.449 bits (254), Expect = 5.933e-21
Identity = 62/213 (29.11%), Postives = 114/213 (53.52%), Query Frame = 1
Query: 4333 QSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIM 4971
            +  R ++  ++ ++ F + +  L+ LNT  +A +   QPQ +   + Y   VF G+F VE LLKL A G + YF+  +N FD ++++GS  ++I+  V G +          I+  R  R++R+ KL S    +R L+ + + S +++  +  L+ +   I+A++GMQ+FG            ++   +F TFP A++ +F+  TGE W  +M
Sbjct:  654 KQLRIQIRIMVKTQIFYWSVITLVFLNTCCVASEHYGQPQWFTDFLKYAEFVFLGIFVVEMLLKLFAMGSRTYFASKFNRFDCVVIVGSAAEVIWAEVYGGS--------FGISVMRALRLLRIFKLTSYWVSLRNLVRSLMNSMRSIISLLFLLFLFILIFALLGMQLFG-----GRFNFPTMHPYTHFDTFPVALITVFQILTGEDWNEVM 853          

HSP 5 Score: 87.4261 bits (215), Expect = 2.066e-16
Identity = 85/367 (23.16%), Postives = 152/367 (41.42%), Query Frame = 1
Query:  997 NPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAA---NTP-YPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIM------------------YWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAA 2031
            N RP R+LF    +N  +    ++V   PFEY I+  I  N   L     N P + E      N+AL         +FT E +LKILAFG       Y R+GWN  DF+ V+  +   ++++       +  LR FR  R +RL+    ++++++ + +++   L ++ LL   +  IYAI+G+++F            ++ + +    +T +N+                                  +F +F  A++ +F+C T EGW  IM                  +    + G +  + YF S + + SF ++NL + V+   F      +   G +         DE ++ + D+  AA
Sbjct: 1298 NARP-RSLFMPEDKNSTKYRIWRLVTSPPFEYFIMTMICCNTLILMMKYYNNPLFYEEILRLFNTAL-------TAVFTVESILKILAFGV----RNYFRDGWNRFDFVTVVGSITDALVTEFGGHFVSLGFLRLFRAARLIRLLQQGYTIRILLWTFVQSFKALPYVCLLIGMLFFIYAIVGMQVF-----------GNIWLNA----ATEINRH--------------------------------NNFQSFFNAVILLFRCATGEGWQDIMMAAVQGKDCARAGSAEINFEKGQTCGSNVSYAYFTSFVFLSSFLMLNLFVAVIMDNFDYLTRDSSILGPH-------HLDEFIRVWADYDPAA 1598          

HSP 6 Score: 80.4925 bits (197), Expect = 2.520e-14
Identity = 73/309 (23.62%), Postives = 138/309 (44.66%), Query Frame = 1
Query: 1066 IVEWKPFEYLILFTIFAN-CCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMG-ITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVG----MSWPW-IYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKA 1971
            +V+ + F + ++  +F N CC  + +   P+  ++ +  A    E VF+ IF  E +LK+ A G       Y  + +N  D ++++      + +++  G   +  +RA R+LR  +L S   SL+ ++ S+M +M  +  +  L    I+I+A++G++LF G                                                  R++ P M   T FD F +A++TVFQ +T E W ++MY   +S G      WP+ IYF+ L++ G++ ++N+ L +     +  +E        +KA
Sbjct:  663 MVKTQIFYWSVITLVFLNTCCVASEHYGQPQWFTDFLKYA----EFVFLGIFVVEMLLKLFAMG----SRTYFASKFNRFDCVVIVGSAAEVIWAEVYGGSFGISVMRALRLLRIFKLTSYWVSLRNLVRSLMNSMRSIISLLFLLFLFILIFALLGMQLFGG--------------------------------------------------RFNFPTMHPYTHFDTFPVALITVFQILTGEDWNEVMYLAIESQGGIYSGGWPYSIYFIVLVLFGNYTLLNVFLAIAVDNLANAQELTAAEEADEKA 913          

HSP 7 Score: 72.4034 bits (176), Expect = 7.295e-12
Identity = 76/281 (27.05%), Postives = 129/281 (45.91%), Query Frame = 1
Query: 3349 SSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAED--PLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLK--RXXXXXXXXXKSIGNIM-------LVTFLLEFMFAVIGVQLFNGKFQSC--NDVSKNTHISCRGQYIYYNEADIA------KVFVNKREWIN---NPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIY 4125
            SS FIF  +N  R+    I     F   +L+ I+ +  +L+ E   P + + + +  L   +  F  +F +E  LKVI +G   H G++ RS  NI+D +VV++ +++    + A            LR LRA+   + LK    +  + V +KSI   M       L+      +FA+IG++ ++G F S   N+  +  ++S R        + +       K     ++WI       +FDN+  AM+T+F   T EGW  V+Y + DS    Y+  Y
Sbjct:  230 SSLFIFAEDNIIRRNAKAIIEWGPFEYFILLTIIGNCVVLSMEQHLPKNDKKALSEWLERTEPYFMGIFCLECVLKVIAFGFALHKGSYLRSGWNIMDFIVVVSGVVTMLPFSPATQTANQPVDSVDLRTLRAVRVLRPLKLVSGIPSLQVVLKSILCAMAPLLQIGLLVLFAIIIFAIIGLEFYSGAFHSACYNERGEIENVSERPMPCTNKTSPMGVYNCDVKGTTCLQKWIGPNYGITSFDNIGFAMITVFQCITMEGWTTVMYYTNDSLGSTYNWAY 510          

HSP 8 Score: 68.1662 bits (165), Expect = 1.438e-10
Identity = 62/251 (24.70%), Postives = 130/251 (51.79%), Query Frame = 1
Query: 2281 LVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKF-NFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYG---------NLGK----SSMLSCLYYVILFICGNYILLNVFLAIAVDNL 2991
            LV S  F + ++ ++  NT +L  ++Y   ++ +      N     +FT+E ++K+ + G+R YF   +NRFDF  V+ SI + ++ +      + +  LR  R  R+ ++ +   ++R L+ + + S K++  + +L+ +   I++++GMQ+FG  + N   +    +NF SF  +++ +F+  TGE W ++M   ++            N  K     S +S  Y+       ++++LN+F+A+ +DN 
Sbjct: 1320 LVTSPPFEYFIMTMICCNTLILMMKYYNNPLFYEEILRLFNTALTAVFTVESILKILAFGVRNYFRDGWNRFDFVTVVGSITDALVTEFGGH-FVSLGFLRLFRAARLIRLLQQGYTIRILLWTFVQSFKALPYVCLLIGMLFFIYAIVGMQVFGNIWLNAATEINRHNNFQSFFNAVILLFRCATGEGWQDIMMAAVQGKDCARAGSAEINFEKGQTCGSNVSYAYFTSFVFLSSFLMLNLFVAVIMDNF 1569          

HSP 9 Score: 63.5438 bits (153), Expect = 3.674e-9
Identity = 55/246 (22.36%), Postives = 107/246 (43.50%), Query Frame = 1
Query: 4375 PFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMV---FTGVFTVEFLLKLAAFGFK----NYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMF------------GKITTENEKEMKEINRNN--------------------------NFQTFPQAILVLFRSATGEAWQNIMLH 4977
            PFEY I + I+ N + L+++        + + ++L      F G+F +E +LK+ AFGF     +Y    WN+ DFI+V+   + ++         N   D  + +   R  RV+R +KL+S    ++ +L + + +   L  + LL++    I+A+IG++ +            G+I   +E+ M   N+ +                          +F     A++ +F+  T E W  +M +
Sbjct:  253 PFEYFILLTIIGNCVVLSMEQHLPKNDKKALSEWLERTEPYFMGIFCLECVLKVIAFGFALHKGSYLRSGWNIMDFIVVVSGVVTMLPFSPATQTANQPVDS-VDLRTLRAVRVLRPLKLVSGIPSLQVVLKSILCAMAPLLQIGLLVLFAIIIFAIIGLEFYSGAFHSACYNERGEIENVSERPMPCTNKTSPMGVYNCDVKGTTCLQKWIGPNYGITSFDNIGFAMITVFQCITMEGWTTVMYY 497          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Celegans
Match: unc-2 (High voltage activated calcium channel alpha-1 subunit [Source:UniProtKB/TrEMBL;Acc:Q86G45])

HSP 1 Score: 647.506 bits (1669), Expect = 0.000e+0
Identity = 375/813 (46.13%), Postives = 503/813 (61.87%), Query Frame = 1
Query: 3331 KPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDA------ISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQY-IYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIP--KQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDG-STVDQLNEELRVVIKKIWKRTSQK-MLDQVVPPAGN---DDVTVGKFYATFLIQEWFRRWK 5727
            KP+   SS F   P N FR   H I    +F  +V+  I +SS  LAAEDP+D E+ RN++L Y DY FT VF  E+ LK+I  G++ H G++CR   NILD +VV  ++ ++            ++ +K LRVLRVLRPL+ I R   LK V  CVV ++K++ NI++V FL +F+FAVI VQLFNGKF  C D ++    +C GQ+ +Y N+ D  +V   +REW   P N+DN  NAMLTLF V+T EGWPG+   S+D+  ED       R  V++FY+ + IV  FF +NIFV  +I+TFQ++GE E    +LDKNQ++CI+FAL A+P   ++P  K S +YR+W L+TS PFEY I  +I  NT+ L +K+   P  YE+++   N   T VFTVE +LK+ AFG +NYF D WN FDF+ V+GS  D +     G          +S+ F RLFR  RL++LL +G  IR LLWTFV+SF+ALPYV LLI MLFFIYA++GMQ+FG I         EINR+NNFQ+F  A+++LFR ATGE WQ+IM+  +    C                    +AG+   N                      ++    CGSN +Y YF SF  + SFL++NLFVAVIMDNFDYLTRD SILGPHHLDEF+R+W++YDP A GRI + ++  +LR + PP+GFGK CP+R A   L+RMNMP+  DGTV F  TLFAL+R +L IK      +D+ +EELR+ +KKIW   ++K M+D VVPP        +TVGK YA  LI E +R  K
Sbjct:  918 KPMVPYSSMFFLSPTNPFRVLIHSIVCTKYFEMMVMTVICLSSVSLAAEDPVDEENPRNKVLQYMDYCFTGVFACEMLLKLIDQGILLHPGSYCRDFWNILDGIVVTCALFAFGFAGTEGSAGKNLNTIKSLRVLRVLRPLKTIKRIPKLKAVFDCVVNSLKNVFNILIVYFLFQFIFAVIAVQLFNGKFFFCTDKNRKFANTCHGQFFVYDNQNDPPRV--EQREWRLRPFNYDNTINAMLTLFVVTTGEGWPGIRQNSMDTTFEDQGPSPFFRVEVALFYVMFFIVFPFFFVNIFVALIIITFQEQGEAELSEGDLDKNQKQCIDFALNARPRSLFMPEDKNSTKYRIWRLVTSPPFEYFIMTMICCNTLILMMKYYNNPLFYEEILRLFNTALTAVFTVESILKILAFGVRNYFRDGWNRFDFVTVVGSITDALVTEFGG--------HFVSLGFLRLFRAARLIRLLQQGYTIRILLWTFVQSFKALPYVCLLIGMLFFIYAIVGMQVFGNIWL---NAATEINRHNNFQSFFNAVILLFRCATGEGWQDIMMAAVQGKDC-------------------ARAGSAEIN----------------------FEKGQTCGSNVSYAYFTSFVFLSSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEFIRVWADYDPAATGRIHYSEMYEMLRIMAPPVGFGKKCPYRLAYKHLIRMNMPVAEDGTVHFTTTLFALIRESLSIKMRPVEEMDEADEELRLTLKKIWPLKAKKNMVDLVVPPNHELCFQKLTVGKIYAGLLILENYRARK 1676          

HSP 2 Score: 505.368 bits (1300), Expect = 6.506e-145
Identity = 315/705 (44.68%), Postives = 442/705 (62.70%), Query Frame = 1
Query:  964 RKRTPARSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLIS-------TVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKN---DVMMESPVPCS--TSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDI------SDDEEN----DGKENGKESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGGA----HHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADT 3000
            RK T + +     +   +LF     N  R+    I+EW PFEY IL TI  NC  L+     P+ D   ++  LE+ E  F+ IF  ECVLK++AFGF +H G+YLR+GWN++DF++V+ G+++       T  +       D++ LRA RVLRPL+LVSG+PSLQVV+ SI+ AM PL  I LL LF III+AIIGLE +SG  HS CY++    + + E P+PC+  TS    Y CD   ++  +           +W GPN GITSFDN G AM+TVFQCITMEGWT +MY+ NDS+G ++ W YF+ LI++GSFF++NLVLGVLSGEF+KERE+ + R ++ K R Q Q + ++ GYL+WI  AE++      + +EE     + +      + K     +S+E  +D ++   +  +   + G       +++++   C  +       + ++ R   R +VK+Q FYW VI LVFLNT  + SEHY Q  W   F   A  +F+ +F +EML+K++++G R YF   FNRFD  V++ S  E++  +       G+SV+R  RLLR+FK+T YW SLRNLV SL+ SM+SI+SLL LLFLFI+IF+LLGMQLFGG+FNF     P ++FD+F  +L+TVFQILTGEDWNEVMY  I S G +        +Y+++L + GNY LLNVFLAIAVDNLA+ 
Sbjct:  162 RKTTLSSNAPVKEKGPSSLFIFAEDNIIRRNAKAIIEWGPFEYFILLTIIGNCVVLSMEQHLPKNDKKALSEWLERTEPYFMGIFCLECVLKVIAFGFALHKGSYLRSGWNIMDFIVVVSGVVTMLPFSPATQTANQPVDSVDLRTLRAVRVLRPLKLVSGIPSLQVVLKSILCAMAPLLQIGLLVLFAIIIFAIIGLEFYSGAFHSACYNERGEIENVSERPMPCTNKTSPMGVYNCDVKGTTCLQ-----------KWIGPNYGITSFDNIGFAMITVFQCITMEGWTTVMYYTNDSLGSTYNWAYFIPLIVLGSFFMLNLVLGVLSGEFAKERERVENRREFLKLRRQQQIERELNGYLEWILTAEEVILKEDRTTEEEKAAIMEARRRAANKKLKQASKQQSTETEEDFEEDEDEMEEEYVDEGGTVEDEFAERKKRGCCHSVGK-----FIKQLRIQIRIMVKTQIFYWSVITLVFLNTCCVASEHYGQPQWFTDFLKYAEFVFLGIFVVEMLLKLFAMGSRTYFASKFNRFDCVVIVGSAAEVIWAEVYG-GSFGISVMRALRLLRIFKLTSYWVSLRNLVRSLMNSMRSIISLLFLLFLFILIFALLGMQLFGGRFNF-PTMHPYTHFDTFPVALITVFQILTGEDWNEVMYLAIESQGGIYSGGWPYSIYFIVLVLFGNYTLLNVFLAIAVDNLANA 848          

HSP 3 Score: 122.865 bits (307), Expect = 3.531e-27
Identity = 87/280 (31.07%), Postives = 138/280 (49.29%), Query Frame = 1
Query:  994 GNPRPQ---RALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPD-----VKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSF--DNFGLAMLTVFQCITMEGWTQI 1803
            G P+P     ++F L+  NPFR     IV  K FE +++  I  +  +LAA  P  E   N  N  L+ ++  F  +F  E +LK++  G ++HPG+Y R+ WN+LD ++V   L +   +  +EG        +K+LR  RVLRPL+ +  +P L+ V + ++ ++  +F+I ++      I+A+I ++LF+GK    C  KN     +   C             H   F Y   DN+N+  R       +  F  DN   AMLT+F   T EGW  I
Sbjct:  915 GGPKPMVPYSSMFFLSPTNPFRVLIHSIVCTKYFEMMVMTVICLSSVSLAAEDPVDEE--NPRNKVLQYMDYCFTGVFACEMLLKLIDQGILLHPGSYCRDFWNILDGIVVTCALFAFGFAG-TEGSAGKNLNTIKSLRVLRVLRPLKTIKRIPKLKAVFDCVVNSLKNVFNILIVYFLFQFIFAVIAVQLFNGKFF-FCTDKNRKFANT---C-------------HGQFFVY---DNQNDPPRVEQREWRLRPFNYDNTINAMLTLFVVTTGEGWPGI 1171          

HSP 4 Score: 102.064 bits (253), Expect = 6.358e-21
Identity = 68/233 (29.18%), Postives = 123/233 (52.79%), Query Frame = 1
Query: 4288 EFALKAK-----PVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIM 4971
            EFA + K      V ++I +   + R+  ++ ++ F + +  L+ LNT  +A +   QPQ +   + Y   VF G+F VE LLKL A G + YF+  +N FD ++++GS  ++I+  V G +          I+  R  R++R+ KL S    +R L+ + + S +++  +  L+ +   I+A++GMQ+FG            ++   +F TFP A++ +F+  TGE W  +M
Sbjct:  584 EFAERKKRGCCHSVGKFIKQLRIQIRI--MVKTQIFYWSVITLVFLNTCCVASEHYGQPQWFTDFLKYAEFVFLGIFVVEMLLKLFAMGSRTYFASKFNRFDCVVIVGSAAEVIWAEVYGGS--------FGISVMRALRLLRIFKLTSYWVSLRNLVRSLMNSMRSIISLLFLLFLFILIFALLGMQLFG-----GRFNFPTMHPYTHFDTFPVALITVFQILTGEDWNEVM 801          

HSP 5 Score: 87.0409 bits (214), Expect = 2.370e-16
Identity = 85/367 (23.16%), Postives = 152/367 (41.42%), Query Frame = 1
Query:  997 NPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAA---NTP-YPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIM------------------YWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAA 2031
            N RP R+LF    +N  +    ++V   PFEY I+  I  N   L     N P + E      N+AL         +FT E +LKILAFG       Y R+GWN  DF+ V+  +   ++++       +  LR FR  R +RL+    ++++++ + +++   L ++ LL   +  IYAI+G+++F            ++ + +    +T +N+                                  +F +F  A++ +F+C T EGW  IM                  +    + G +  + YF S + + SF ++NL + V+   F      +   G +         DE ++ + D+  AA
Sbjct: 1246 NARP-RSLFMPEDKNSTKYRIWRLVTSPPFEYFIMTMICCNTLILMMKYYNNPLFYEEILRLFNTAL-------TAVFTVESILKILAFGV----RNYFRDGWNRFDFVTVVGSITDALVTEFGGHFVSLGFLRLFRAARLIRLLQQGYTIRILLWTFVQSFKALPYVCLLIGMLFFIYAIVGMQVF-----------GNIWLNA----ATEINRH--------------------------------NNFQSFFNAVILLFRCATGEGWQDIMMAAVQGKDCARAGSAEINFEKGQTCGSNVSYAYFTSFVFLSSFLMLNLFVAVIMDNFDYLTRDSSILGPH-------HLDEFIRVWADYDPAA 1546          

HSP 6 Score: 80.1073 bits (196), Expect = 2.728e-14
Identity = 73/309 (23.62%), Postives = 138/309 (44.66%), Query Frame = 1
Query: 1066 IVEWKPFEYLILFTIFAN-CCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMG-ITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVG----MSWPW-IYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKA 1971
            +V+ + F + ++  +F N CC  + +   P+  ++ +  A    E VF+ IF  E +LK+ A G       Y  + +N  D ++++      + +++  G   +  +RA R+LR  +L S   SL+ ++ S+M +M  +  +  L    I+I+A++G++LF G                                                  R++ P M   T FD F +A++TVFQ +T E W ++MY   +S G      WP+ IYF+ L++ G++ ++N+ L +     +  +E        +KA
Sbjct:  611 MVKTQIFYWSVITLVFLNTCCVASEHYGQPQWFTDFLKYA----EFVFLGIFVVEMLLKLFAMG----SRTYFASKFNRFDCVVIVGSAAEVIWAEVYGGSFGISVMRALRLLRIFKLTSYWVSLRNLVRSLMNSMRSIISLLFLLFLFILIFALLGMQLFGG--------------------------------------------------RFNFPTMHPYTHFDTFPVALITVFQILTGEDWNEVMYLAIESQGGIYSGGWPYSIYFIVLVLFGNYTLLNVFLAIAVDNLANAQELTAAEEADEKA 861          

HSP 7 Score: 72.4034 bits (176), Expect = 7.026e-12
Identity = 76/281 (27.05%), Postives = 129/281 (45.91%), Query Frame = 1
Query: 3349 SSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAED--PLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLK--RXXXXXXXXXKSIGNIM-------LVTFLLEFMFAVIGVQLFNGKFQSC--NDVSKNTHISCRGQYIYYNEADIA------KVFVNKREWIN---NPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIY 4125
            SS FIF  +N  R+    I     F   +L+ I+ +  +L+ E   P + + + +  L   +  F  +F +E  LKVI +G   H G++ RS  NI+D +VV++ +++    + A            LR LRA+   + LK    +  + V +KSI   M       L+      +FA+IG++ ++G F S   N+  +  ++S R        + +       K     ++WI       +FDN+  AM+T+F   T EGW  V+Y + DS    Y+  Y
Sbjct:  178 SSLFIFAEDNIIRRNAKAIIEWGPFEYFILLTIIGNCVVLSMEQHLPKNDKKALSEWLERTEPYFMGIFCLECVLKVIAFGFALHKGSYLRSGWNIMDFIVVVSGVVTMLPFSPATQTANQPVDSVDLRTLRAVRVLRPLKLVSGIPSLQVVLKSILCAMAPLLQIGLLVLFAIIIFAIIGLEFYSGAFHSACYNERGEIENVSERPMPCTNKTSPMGVYNCDVKGTTCLQKWIGPNYGITSFDNIGFAMITVFQCITMEGWTTVMYYTNDSLGSTYNWAY 458          

HSP 8 Score: 68.1662 bits (165), Expect = 1.242e-10
Identity = 62/251 (24.70%), Postives = 130/251 (51.79%), Query Frame = 1
Query: 2281 LVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKF-NFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYG---------NLGK----SSMLSCLYYVILFICGNYILLNVFLAIAVDNL 2991
            LV S  F + ++ ++  NT +L  ++Y   ++ +      N     +FT+E ++K+ + G+R YF   +NRFDF  V+ SI + ++ +      + +  LR  R  R+ ++ +   ++R L+ + + S K++  + +L+ +   I++++GMQ+FG  + N   +    +NF SF  +++ +F+  TGE W ++M   ++            N  K     S +S  Y+       ++++LN+F+A+ +DN 
Sbjct: 1268 LVTSPPFEYFIMTMICCNTLILMMKYYNNPLFYEEILRLFNTALTAVFTVESILKILAFGVRNYFRDGWNRFDFVTVVGSITDALVTEFGGH-FVSLGFLRLFRAARLIRLLQQGYTIRILLWTFVQSFKALPYVCLLIGMLFFIYAIVGMQVFGNIWLNAATEINRHNNFQSFFNAVILLFRCATGEGWQDIMMAAVQGKDCARAGSAEINFEKGQTCGSNVSYAYFTSFVFLSSFLMLNLFVAVIMDNF 1517          

HSP 9 Score: 63.1586 bits (152), Expect = 4.259e-9
Identity = 55/246 (22.36%), Postives = 107/246 (43.50%), Query Frame = 1
Query: 4375 PFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMV---FTGVFTVEFLLKLAAFGFK----NYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMF------------GKITTENEKEMKEINRNN--------------------------NFQTFPQAILVLFRSATGEAWQNIMLH 4977
            PFEY I + I+ N + L+++        + + ++L      F G+F +E +LK+ AFGF     +Y    WN+ DFI+V+   + ++         N   D  + +   R  RV+R +KL+S    ++ +L + + +   L  + LL++    I+A+IG++ +            G+I   +E+ M   N+ +                          +F     A++ +F+  T E W  +M +
Sbjct:  201 PFEYFILLTIIGNCVVLSMEQHLPKNDKKALSEWLERTEPYFMGIFCLECVLKVIAFGFALHKGSYLRSGWNIMDFIVVVSGVVTMLPFSPATQTANQPVDS-VDLRTLRAVRVLRPLKLVSGIPSLQVVLKSILCAMAPLLQIGLLVLFAIIIFAIIGLEFYSGAFHSACYNERGEIENVSERPMPCTNKTSPMGVYNCDVKGTTCLQKWIGPNYGITSFDNIGFAMITVFQCITMEGWTTVMYY 445          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Celegans
Match: unc-2 (High voltage activated calcium channel alpha-1 subunit [Source:UniProtKB/TrEMBL;Acc:Q86G45])

HSP 1 Score: 647.506 bits (1669), Expect = 0.000e+0
Identity = 375/813 (46.13%), Postives = 503/813 (61.87%), Query Frame = 1
Query: 3331 KPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDA------ISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQY-IYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIP--KQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDG-STVDQLNEELRVVIKKIWKRTSQK-MLDQVVPPAGN---DDVTVGKFYATFLIQEWFRRWK 5727
            KP+   SS F   P N FR   H I    +F  +V+  I +SS  LAAEDP+D E+ RN++L Y DY FT VF  E+ LK+I  G++ H G++CR   NILD +VV  ++ ++            ++ +K LRVLRVLRPL+ I R   LK V  CVV ++K++ NI++V FL +F+FAVI VQLFNGKF  C D ++    +C GQ+ +Y N+ D  +V   +REW   P N+DN  NAMLTLF V+T EGWPG+   S+D+  ED       R  V++FY+ + IV  FF +NIFV  +I+TFQ++GE E    +LDKNQ++CI+FAL A+P   ++P  K S +YR+W L+TS PFEY I  +I  NT+ L +K+   P  YE+++   N   T VFTVE +LK+ AFG +NYF D WN FDF+ V+GS  D +     G          +S+ F RLFR  RL++LL +G  IR LLWTFV+SF+ALPYV LLI MLFFIYA++GMQ+FG I         EINR+NNFQ+F  A+++LFR ATGE WQ+IM+  +    C                    +AG+   N                      ++    CGSN +Y YF SF  + SFL++NLFVAVIMDNFDYLTRD SILGPHHLDEF+R+W++YDP A GRI + ++  +LR + PP+GFGK CP+R A   L+RMNMP+  DGTV F  TLFAL+R +L IK      +D+ +EELR+ +KKIW   ++K M+D VVPP        +TVGK YA  LI E +R  K
Sbjct:  926 KPMVPYSSMFFLSPTNPFRVLIHSIVCTKYFEMMVMTVICLSSVSLAAEDPVDEENPRNKVLQYMDYCFTGVFACEMLLKLIDQGILLHPGSYCRDFWNILDGIVVTCALFAFGFAGTEGSAGKNLNTIKSLRVLRVLRPLKTIKRIPKLKAVFDCVVNSLKNVFNILIVYFLFQFIFAVIAVQLFNGKFFFCTDKNRKFANTCHGQFFVYDNQNDPPRV--EQREWRLRPFNYDNTINAMLTLFVVTTGEGWPGIRQNSMDTTFEDQGPSPFFRVEVALFYVMFFIVFPFFFVNIFVALIIITFQEQGEAELSEGDLDKNQKQCIDFALNARPRSLFMPEDKNSTKYRIWRLVTSPPFEYFIMTMICCNTLILMMKYYNNPLFYEEILRLFNTALTAVFTVESILKILAFGVRNYFRDGWNRFDFVTVVGSITDALVTEFGG--------HFVSLGFLRLFRAARLIRLLQQGYTIRILLWTFVQSFKALPYVCLLIGMLFFIYAIVGMQVFGNIWL---NAATEINRHNNFQSFFNAVILLFRCATGEGWQDIMMAAVQGKDC-------------------ARAGSAEIN----------------------FEKGQTCGSNVSYAYFTSFVFLSSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEFIRVWADYDPAATGRIHYSEMYEMLRIMAPPVGFGKKCPYRLAYKHLIRMNMPVAEDGTVHFTTTLFALIRESLSIKMRPVEEMDEADEELRLTLKKIWPLKAKKNMVDLVVPPNHELCFQKLTVGKIYAGLLILENYRARK 1684          

HSP 2 Score: 504.982 bits (1299), Expect = 9.059e-145
Identity = 315/705 (44.68%), Postives = 442/705 (62.70%), Query Frame = 1
Query:  964 RKRTPARSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLIS-------TVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKN---DVMMESPVPCS--TSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDI------SDDEEN----DGKENGKESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGGA----HHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADT 3000
            RK T + +     +   +LF     N  R+    I+EW PFEY IL TI  NC  L+     P+ D   ++  LE+ E  F+ IF  ECVLK++AFGF +H G+YLR+GWN++DF++V+ G+++       T  +       D++ LRA RVLRPL+LVSG+PSLQVV+ SI+ AM PL  I LL LF III+AIIGLE +SG  HS CY++    + + E P+PC+  TS    Y CD   ++  +           +W GPN GITSFDN G AM+TVFQCITMEGWT +MY+ NDS+G ++ W YF+ LI++GSFF++NLVLGVLSGEF+KERE+ + R ++ K R Q Q + ++ GYL+WI  AE++      + +EE     + +      + K     +S+E  +D ++   +  +   + G       +++++   C  +       + ++ R   R +VK+Q FYW VI LVFLNT  + SEHY Q  W   F   A  +F+ +F +EML+K++++G R YF   FNRFD  V++ S  E++  +       G+SV+R  RLLR+FK+T YW SLRNLV SL+ SM+SI+SLL LLFLFI+IF+LLGMQLFGG+FNF     P ++FD+F  +L+TVFQILTGEDWNEVMY  I S G +        +Y+++L + GNY LLNVFLAIAVDNLA+ 
Sbjct:  170 RKTTLSSNAPVKEKGPSSLFIFAEDNIIRRNAKAIIEWGPFEYFILLTIIGNCVVLSMEQHLPKNDKKALSEWLERTEPYFMGIFCLECVLKVIAFGFALHKGSYLRSGWNIMDFIVVVSGVVTMLPFSPATQTANQPVDSVDLRTLRAVRVLRPLKLVSGIPSLQVVLKSILCAMAPLLQIGLLVLFAIIIFAIIGLEFYSGAFHSACYNERGEIENVSERPMPCTNKTSPMGVYNCDVKGTTCLQ-----------KWIGPNYGITSFDNIGFAMITVFQCITMEGWTTVMYYTNDSLGSTYNWAYFIPLIVLGSFFMLNLVLGVLSGEFAKERERVENRREFLKLRRQQQIERELNGYLEWILTAEEVILKEDRTTEEEKAAIMEARRRAANKKLKQASKQQSTETEEDFEEDEDEMEEEYVDEGGTVEDEFAERKKRGCCHSVGK-----FIKQLRIQIRIMVKTQIFYWSVITLVFLNTCCVASEHYGQPQWFTDFLKYAEFVFLGIFVVEMLLKLFAMGSRTYFASKFNRFDCVVIVGSAAEVIWAEVYG-GSFGISVMRALRLLRIFKLTSYWVSLRNLVRSLMNSMRSIISLLFLLFLFILIFALLGMQLFGGRFNF-PTMHPYTHFDTFPVALITVFQILTGEDWNEVMYLAIESQGGIYSGGWPYSIYFIVLVLFGNYTLLNVFLAIAVDNLANA 856          

HSP 3 Score: 122.865 bits (307), Expect = 3.506e-27
Identity = 87/280 (31.07%), Postives = 138/280 (49.29%), Query Frame = 1
Query:  994 GNPRPQ---RALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPD-----VKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSF--DNFGLAMLTVFQCITMEGWTQI 1803
            G P+P     ++F L+  NPFR     IV  K FE +++  I  +  +LAA  P  E   N  N  L+ ++  F  +F  E +LK++  G ++HPG+Y R+ WN+LD ++V   L +   +  +EG        +K+LR  RVLRPL+ +  +P L+ V + ++ ++  +F+I ++      I+A+I ++LF+GK    C  KN     +   C             H   F Y   DN+N+  R       +  F  DN   AMLT+F   T EGW  I
Sbjct:  923 GGPKPMVPYSSMFFLSPTNPFRVLIHSIVCTKYFEMMVMTVICLSSVSLAAEDPVDEE--NPRNKVLQYMDYCFTGVFACEMLLKLIDQGILLHPGSYCRDFWNILDGIVVTCALFAFGFAG-TEGSAGKNLNTIKSLRVLRVLRPLKTIKRIPKLKAVFDCVVNSLKNVFNILIVYFLFQFIFAVIAVQLFNGKFF-FCTDKNRKFANT---C-------------HGQFFVY---DNQNDPPRVEQREWRLRPFNYDNTINAMLTLFVVTTGEGWPGI 1179          

HSP 4 Score: 102.064 bits (253), Expect = 7.280e-21
Identity = 68/233 (29.18%), Postives = 123/233 (52.79%), Query Frame = 1
Query: 4288 EFALKAK-----PVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIM 4971
            EFA + K      V ++I +   + R+  ++ ++ F + +  L+ LNT  +A +   QPQ +   + Y   VF G+F VE LLKL A G + YF+  +N FD ++++GS  ++I+  V G +          I+  R  R++R+ KL S    +R L+ + + S +++  +  L+ +   I+A++GMQ+FG            ++   +F TFP A++ +F+  TGE W  +M
Sbjct:  592 EFAERKKRGCCHSVGKFIKQLRIQIRI--MVKTQIFYWSVITLVFLNTCCVASEHYGQPQWFTDFLKYAEFVFLGIFVVEMLLKLFAMGSRTYFASKFNRFDCVVIVGSAAEVIWAEVYGGS--------FGISVMRALRLLRIFKLTSYWVSLRNLVRSLMNSMRSIISLLFLLFLFILIFALLGMQLFG-----GRFNFPTMHPYTHFDTFPVALITVFQILTGEDWNEVM 809          

HSP 5 Score: 87.0409 bits (214), Expect = 2.624e-16
Identity = 85/367 (23.16%), Postives = 152/367 (41.42%), Query Frame = 1
Query:  997 NPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAA---NTP-YPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIM------------------YWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAA 2031
            N RP R+LF    +N  +    ++V   PFEY I+  I  N   L     N P + E      N+AL         +FT E +LKILAFG       Y R+GWN  DF+ V+  +   ++++       +  LR FR  R +RL+    ++++++ + +++   L ++ LL   +  IYAI+G+++F            ++ + +    +T +N+                                  +F +F  A++ +F+C T EGW  IM                  +    + G +  + YF S + + SF ++NL + V+   F      +   G +         DE ++ + D+  AA
Sbjct: 1254 NARP-RSLFMPEDKNSTKYRIWRLVTSPPFEYFIMTMICCNTLILMMKYYNNPLFYEEILRLFNTAL-------TAVFTVESILKILAFGV----RNYFRDGWNRFDFVTVVGSITDALVTEFGGHFVSLGFLRLFRAARLIRLLQQGYTIRILLWTFVQSFKALPYVCLLIGMLFFIYAIVGMQVF-----------GNIWLNA----ATEINRH--------------------------------NNFQSFFNAVILLFRCATGEGWQDIMMAAVQGKDCARAGSAEINFEKGQTCGSNVSYAYFTSFVFLSSFLMLNLFVAVIMDNFDYLTRDSSILGPH-------HLDEFIRVWADYDPAA 1554          

HSP 6 Score: 80.1073 bits (196), Expect = 2.994e-14
Identity = 73/309 (23.62%), Postives = 138/309 (44.66%), Query Frame = 1
Query: 1066 IVEWKPFEYLILFTIFAN-CCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMG-ITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVG----MSWPW-IYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKA 1971
            +V+ + F + ++  +F N CC  + +   P+  ++ +  A    E VF+ IF  E +LK+ A G       Y  + +N  D ++++      + +++  G   +  +RA R+LR  +L S   SL+ ++ S+M +M  +  +  L    I+I+A++G++LF G                                                  R++ P M   T FD F +A++TVFQ +T E W ++MY   +S G      WP+ IYF+ L++ G++ ++N+ L +     +  +E        +KA
Sbjct:  619 MVKTQIFYWSVITLVFLNTCCVASEHYGQPQWFTDFLKYA----EFVFLGIFVVEMLLKLFAMG----SRTYFASKFNRFDCVVIVGSAAEVIWAEVYGGSFGISVMRALRLLRIFKLTSYWVSLRNLVRSLMNSMRSIISLLFLLFLFILIFALLGMQLFGG--------------------------------------------------RFNFPTMHPYTHFDTFPVALITVFQILTGEDWNEVMYLAIESQGGIYSGGWPYSIYFIVLVLFGNYTLLNVFLAIAVDNLANAQELTAAEEADEKA 869          

HSP 7 Score: 72.4034 bits (176), Expect = 6.914e-12
Identity = 76/281 (27.05%), Postives = 129/281 (45.91%), Query Frame = 1
Query: 3349 SSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAED--PLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLK--RXXXXXXXXXKSIGNIM-------LVTFLLEFMFAVIGVQLFNGKFQSC--NDVSKNTHISCRGQYIYYNEADIA------KVFVNKREWIN---NPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIY 4125
            SS FIF  +N  R+    I     F   +L+ I+ +  +L+ E   P + + + +  L   +  F  +F +E  LKVI +G   H G++ RS  NI+D +VV++ +++    + A            LR LRA+   + LK    +  + V +KSI   M       L+      +FA+IG++ ++G F S   N+  +  ++S R        + +       K     ++WI       +FDN+  AM+T+F   T EGW  V+Y + DS    Y+  Y
Sbjct:  186 SSLFIFAEDNIIRRNAKAIIEWGPFEYFILLTIIGNCVVLSMEQHLPKNDKKALSEWLERTEPYFMGIFCLECVLKVIAFGFALHKGSYLRSGWNIMDFIVVVSGVVTMLPFSPATQTANQPVDSVDLRTLRAVRVLRPLKLVSGIPSLQVVLKSILCAMAPLLQIGLLVLFAIIIFAIIGLEFYSGAFHSACYNERGEIENVSERPMPCTNKTSPMGVYNCDVKGTTCLQKWIGPNYGITSFDNIGFAMITVFQCITMEGWTTVMYYTNDSLGSTYNWAY 466          

HSP 8 Score: 67.781 bits (164), Expect = 1.470e-10
Identity = 62/251 (24.70%), Postives = 130/251 (51.79%), Query Frame = 1
Query: 2281 LVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKF-NFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYG---------NLGK----SSMLSCLYYVILFICGNYILLNVFLAIAVDNL 2991
            LV S  F + ++ ++  NT +L  ++Y   ++ +      N     +FT+E ++K+ + G+R YF   +NRFDF  V+ SI + ++ +      + +  LR  R  R+ ++ +   ++R L+ + + S K++  + +L+ +   I++++GMQ+FG  + N   +    +NF SF  +++ +F+  TGE W ++M   ++            N  K     S +S  Y+       ++++LN+F+A+ +DN 
Sbjct: 1276 LVTSPPFEYFIMTMICCNTLILMMKYYNNPLFYEEILRLFNTALTAVFTVESILKILAFGVRNYFRDGWNRFDFVTVVGSITDALVTEFGGH-FVSLGFLRLFRAARLIRLLQQGYTIRILLWTFVQSFKALPYVCLLIGMLFFIYAIVGMQVFGNIWLNAATEINRHNNFQSFFNAVILLFRCATGEGWQDIMMAAVQGKDCARAGSAEINFEKGQTCGSNVSYAYFTSFVFLSSFLMLNLFVAVIMDNF 1525          

HSP 9 Score: 63.1586 bits (152), Expect = 4.370e-9
Identity = 55/246 (22.36%), Postives = 107/246 (43.50%), Query Frame = 1
Query: 4375 PFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMV---FTGVFTVEFLLKLAAFGFK----NYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMF------------GKITTENEKEMKEINRNN--------------------------NFQTFPQAILVLFRSATGEAWQNIMLH 4977
            PFEY I + I+ N + L+++        + + ++L      F G+F +E +LK+ AFGF     +Y    WN+ DFI+V+   + ++         N   D  + +   R  RV+R +KL+S    ++ +L + + +   L  + LL++    I+A+IG++ +            G+I   +E+ M   N+ +                          +F     A++ +F+  T E W  +M +
Sbjct:  209 PFEYFILLTIIGNCVVLSMEQHLPKNDKKALSEWLERTEPYFMGIFCLECVLKVIAFGFALHKGSYLRSGWNIMDFIVVVSGVVTMLPFSPATQTANQPVDS-VDLRTLRAVRVLRPLKLVSGIPSLQVVLKSILCAMAPLLQIGLLVLFAIIIFAIIGLEFYSGAFHSACYNERGEIENVSERPMPCTNKTSPMGVYNCDVKGTTCLQKWIGPNYGITSFDNIGFAMITVFQCITMEGWTTVMYY 453          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Fly
Match: Ca-alpha1D (gene:FBgn0001991 transcript:FBtr0332020)

HSP 1 Score: 1739.93 bits (4505), Expect = 0.000e+0
Identity = 996/1701 (58.55%), Postives = 1194/1701 (70.19%), Query Frame = 1
Query:  970 RTPARSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPV-PCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGGAHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFD-KKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSXXXXXXXXXXXXXXXPTNVDGEEAKACNSSNVSPNIDEKTRFTDAERLIKSEEMNGDIADESMRKMSTRIDTXXXXXXXXXXXXXXXXXNGQTSAIRRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIY--------------DHVNGTNNNHR--GDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHC--LPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDD-VTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMP-FRTHGRGSGPLISLISPTLVTTNECDEKDKDYLPSHLGAERRTHSIFGTMMNVLQRVGST--RRDSNASPS 6000
            R   R +    RPQRALFCL+++NP R  CI+IVEWKPFE+LIL TIFANC ALA  TPYP  DSN  N  LEK+E VF+VIFT ECV+KILA+GF++H GAYLRNGWNLLDF IV+IG IST LS++ +   DVKALRAFRVLRPLRLVSG+PSLQVV+NSI++AMVPLFHIALL LFVIIIYAIIGLELFSGKLH  C  +     E  + PC      GYQC         Y C         W GPN GIT+FDNFGLAMLTVFQC+T+EGWT ++Y I D++G  W W+YF+S++I+G+FFVMNL+LGVLSGEFSKER KAK RG +QK RE+ Q +ED++GYLDWI  AEDI  D       +GK  +                    ++    E  G      Q        +K    R   R  R   + +     ++ +++ LVFLNTGVL +EHY Q  WLD+FQ   N+ F+ LFT EML+KMYSLG + YF  +FNRFD FVVI SI E ++  T  MPPLGVSVLRC RLLRVFKVT+YW SL NLV SLL S++SI SLL+LLFLFIVIF+LLGMQ+FGGKFNFD K+ K R NFD F Q+LLTVFQI+TGEDWN VMY GI +YG +     L+C+Y++ILFICGNYILLNVFLAIAVDNLAD  S ++ EK+E  +          +E+    S + +P ID        +  ++ +E++    DE      T  D E     E  E          T+  RR+SEV  K+  KPIP  S+FFIF   N+FR FCH++CNH +FGNI+L CIM SSAMLAAE+PL A    N++LN FDY FT+VFT+E+ LK+I+YG V H+GAFCRS+ N+LDLLVV  S+IS   +++AISVVKILRVLRVLRPLRAINRAKGLK VV+CVVVA+K+IGNIMLVT+LL+FMFAVIGVQLF GKF  C D SK T   C G Y+ Y++ D+ K  + +REW NN  +FD+V   MLTLF VSTFEGWPG+LY SIDS KE+   I+N RPIV+ +YI YII+IAFFM+NIFVGFVIVTFQ EGE+EYKNC+LDKNQR CIEFALKAKPVRRYIPK   +Y+VWW +TS  FEY IF+LIM+NT++LA+KF  QP  Y +++D LNM+FT VF +EF+ KLAAF FKNYF DAWNVFDFIIVLGSFIDI+Y              D V G  +  +  G  LISINFFRLFRVMRLVKLLS+GEGIRTLLWTF+KSFQALPYVALLIV+LFFIYAV+GMQ+FGKI  +       I  NNNFQTF QA+LVLFRSATGEAWQ IM+ C   PD  CD  SD   +                                               CGS+ AYPYFISFY++CSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEF+RLWSEYDP+AKGRIKHLDVVTLLRKI+PPLGFGK CPHR AC  LV MNMPLNSDGTV+FNATLFA+VRT+L IKTDG+ +D  N ELR  IK+IWKRT+ K+LDQVVPP GNDD VTVGKFYAT+LIQ++FRR+K KR E++    +  S  ++L    RT    S  L   IS  L      DE D++  P H    RR H++FG++ + ++R G+   RR + A+ S
Sbjct:  611 RQQRRGKPQPDRPQRALFCLSVKNPLRALCIRIVEWKPFEFLILLTIFANCIALAVYTPYPGSDSNVTNQTLEKVEYVFLVIFTAECVMKILAYGFVLHNGAYLRNGWNLLDFTIVVIGAISTALSQLMKDAFDVKALRAFRVLRPLRLVSGVPSLQVVLNSILKAMVPLFHIALLVLFVIIIYAIIGLELFSGKLHKACRDEITGEYEENIRPCGV----GYQCPP------GYKCYGG------WDGPNDGITNFDNFGLAMLTVFQCVTLEGWTDVLYSIQDAMGSDWQWMYFISMVILGAFFVMNLILGVLSGEFSKERNKAKNRGDFQKLREKQQIEEDLRGYLDWITQAEDIEPDAVGGLISDGKGKQ-------------------PNEMDSTENLGEEMPEVQMTESRWRKMKKDFDRVNRRMRRACRKAVKSQAFYWLIIV-LVFLNTGVLATEHYGQLDWLDNFQEYTNVFFIGLFTCEMLLKMYSLGFQGYFVSLFNRFDCFVVIGSITETLLTNTGMMPPLGVSVLRCVRLLRVFKVTKYWRSLSNLVASLLNSIQSIASLLLLLFLFIVIFALLGMQVFGGKFNFDGKEEKYRMNFDCFWQALLTVFQIMTGEDWNAVMYVGINAYGGVSSYGALACIYFIILFICGNYILLNVFLAIAVDNLADADSLSEVEKEEEPH----------DESAQKKSHSPTPTIDGMDDHLSIDIDMEQQELD----DEDKMDHETLSDEEVREMCEEEEEVSARV----TARPRRLSEVSMKKTKKPIPRGSAFFIFSYTNRFRVFCHWLCNHSNFGNIILCCIMFSSAMLAAENPLRANDDLNKVLNKFDYFFTAVFTIELILKLISYGFVLHDGAFCRSAFNLLDLLVVCVSLISLVSSSNAISVVKILRVLRVLRPLRAINRAKGLKYVVKCVVVAIKTIGNIMLVTYLLQFMFAVIGVQLFKGKFFKCTDGSKMTQDECYGTYLVYDDGDVHKPRLREREWSNNRFHFDDVAKGMLTLFTVSTFEGWPGLLYVSIDSNKENGGPIHNFRPIVAAYYIIYIIIIAFFMVNIFVGFVIVTFQNEGEQEYKNCDLDKNQRNCIEFALKAKPVRRYIPKHGIQYKVWWFVTSSSFEYTIFILIMINTVTLAMKFYNQPLWYTELLDALNMIFTAVFALEFVFKLAAFRFKNYFGDAWNVFDFIIVLGSFIDIVYSEIKSKDTSQIAECDIVEGCKSTKKSAGSNLISINFFRLFRVMRLVKLLSKGEGIRTLLWTFIKSFQALPYVALLIVLLFFIYAVVGMQVFGKIALDGG---NAITANNNFQTFQQAVLVLFRSATGEAWQEIMMSCSAQPDVKCDMNSDTPGE----------------------------------------------PCGSSIAYPYFISFYVLCSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFIRLWSEYDPDAKGRIKHLDVVTLLRKISPPLGFGKLCPHRMACKRLVSMNMPLNSDGTVLFNATLFAVVRTSLSIKTDGN-IDDANSELRATIKQIWKRTNPKLLDQVVPPPGNDDEVTVGKFYATYLIQDYFRRFK-KRKEQEGKEGHPDSNTVTLQAGLRTLHEVSPALKRAISGNL------DELDQEPEPMH----RRHHTLFGSVWSSIRRHGNGTFRRSAKATAS 2196          

HSP 2 Score: 118.242 bits (295), Expect = 1.026e-25
Identity = 97/349 (27.79%), Postives = 163/349 (46.70%), Query Frame = 1
Query:  937 LSAQIASGGRKRTP-ARSQSGNPRPQ-RALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLII---------IGSFFVMNLVLGVLSGEFSKEREKAKK 1950
            +SA++ +  R+ +  +  ++  P P+  A F  +  N FR FC  +     F  +IL  I  +   LAA  P   R ++ +N  L K +  F  +FT E +LK++++GF++H GA+ R+ +NLLD L+V   +    L   S     VK LR  RVLRPLR ++    L+ V+  ++ A+  + +I L+   +  ++A+IG++LF GK    C   + +  +         + G    D H    +            WS        FD+    MLT+F   T EGW  ++Y   DS   +   I+    I+         I +FF++N+ +G +   F  E E+  K
Sbjct: 1325 VSARVTARPRRLSEVSMKKTKKPIPRGSAFFIFSYTNRFRVFCHWLCNHSNFGNIILCCIMFSSAMLAAENPL--RANDDLNKVLNKFDYFFTAVFTIELILKLISYGFVLHDGAFCRSAFNLLDLLVVC--VSLISLVSSSNAISVVKILRVLRVLRPLRAINRAKGLKYVVKCVVVAIKTIGNIMLVTYLLQFMFAVIGVQLFKGKFFK-CTDGSKMTQDECYGTYLVYDDG----DVHKPRLR---------EREWSNNRF---HFDDVAKGMLTLFTVSTFEGWPGLLYVSIDSNKENGGPIHNFRPIVAAYYIIYIIIIAFFMVNIFVGFVIVTFQNEGEQEYK 1652          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Fly
Match: Ca-alpha1D (gene:FBgn0001991 transcript:FBtr0090005)

HSP 1 Score: 1736.85 bits (4497), Expect = 0.000e+0
Identity = 998/1702 (58.64%), Postives = 1197/1702 (70.33%), Query Frame = 1
Query:  970 RTPARSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPV-PCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGGAHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFD-KKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSXXXXXXXXXXXXXXXPTNVDGEEAKACNSSNVSPNIDEKTRFTDAERLIKSEEMNGDIADESMRKMSTRIDTXXXXXXXXXXXXXXXXXNGQTSA-IRRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIY--------------DHVNGTNNNHR--GDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHC--LPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDD-VTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMP-FRTHGRGSGPLISLISPTLVTTNECDEKDKDYLPSHLGAERRTHSIFGTMMNVLQRVGST--RRDSNASPS 6000
            R   R +    RPQRALFCL+++NP R  CI+IVEWKPFE+LIL TIFANC ALA  TPYP  DSN  N  LEK+E VF+VIFT ECV+KILA+GF++H GAYLRNGWNLLDF IV+IG IST LS++ +   DVKALRAFRVLRPLRLVSG+PSLQVV+NSI++AMVPLFHIALL LFVIIIYAIIGLELFSGKLH  C  +     E  + PC      GYQC         Y C         W GPN GIT+FDNFGLAMLTVFQC+T+EGWT ++Y I D++G  W W+YF+S++I+G+FFVMNL+LGVLSGEFSKER KAK RG +QK RE+ Q +ED++GYLDWI  AEDI  D       +GK  +                    ++    E  G      Q        +K    R   R  R   + +     ++ +++ LVFLNTGVL +EHY Q  WLD+FQ   N+ F+ LFT EML+KMYSLG + YF  +FNRFD FVVI SI E ++  T  MPPLGVSVLRC RLLRVFKVT+YW SL NLV SLL S++SI SLL+LLFLFIVIF+LLGMQ+FGGKFNFD K+ K R NFD F Q+LLTVFQI+TGEDWN VMY GI +YG +     L+C+Y++ILFICGNYILLNVFLAIAVDNLAD  S ++ EK+E  +          +E+    S + +P ID        +  ++ +E++    DE      T  D E     E  E D   E + + +A  RR+SEV  K+  KPIP  S+FFIF   N+FR FCH++CNH +FGNI+L CIM SSAMLAAE+PL A    N++LN FDY FT+VFT+E+ LK+I+YG V H+GAFCRS+ N+LDLLVV  S+IS   +++AISVVKILRVLRVLRPLRAINRAKGLK VVQCV+VAVK+IGNI+LVT LL+FMFAVIGVQLF GKF  C D SK T   C G Y+ Y++ D+ K  + +REW NN  +FD+V   MLTLF VSTFEGWPG+LY SIDS KE+   I+N RPIV+ +YI YII+IAFFM+NIFVGFVIVTFQ EGE+EYKNC+LDKNQR CIEFALKAKPVRRYIPK   +Y+VWW +TS  FEY IF+LIM+NT++LA+KF  QP  Y +++D LNM+FT VF +EF+ KLAAF FKNYF DAWNVFDFIIVLGSFIDI+Y              D V G  +  +  G  LISINFFRLFRVMRLVKLLS+GEGIRTLLWTF+KSFQALPYVALLIV+LFFIYAV+GMQ+FGKI  +       I  NNNFQTF QA+LVLFRSATGEAWQ IM+ C   PD  CD  SD   +                                               CGS+ AYPYFISFY++CSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEF+RLWSEYDP+AKGRIKHLDVVTLLRKI+PPLGFGK CPHR AC  LV MNMPLNSDGTV+FNATLFA+VRT+L IKTDG+ +D  N ELR  IK+IWKRT+ K+LDQVVPP GNDD VTVGKFYAT+LIQ++FRR+K KR E++    +  S  ++L    RT    S  L   IS  L      DE D++  P H    RR H++FG++ + ++R G+   RR + A+ S
Sbjct:  579 RQQRRGKPQPDRPQRALFCLSVKNPLRALCIRIVEWKPFEFLILLTIFANCIALAVYTPYPGSDSNVTNQTLEKVEYVFLVIFTAECVMKILAYGFVLHNGAYLRNGWNLLDFTIVVIGAISTALSQLMKDAFDVKALRAFRVLRPLRLVSGVPSLQVVLNSILKAMVPLFHIALLVLFVIIIYAIIGLELFSGKLHKACRDEITGEYEENIRPCGV----GYQCPP------GYKCYGG------WDGPNDGITNFDNFGLAMLTVFQCVTLEGWTDVLYSIQDAMGSDWQWMYFISMVILGAFFVMNLILGVLSGEFSKERNKAKNRGDFQKLREKQQIEEDLRGYLDWITQAEDIEPDAVGGLISDGKGKQ-------------------PNEMDSTENLGEEMPEVQMTESRWRKMKKDFDRVNRRMRRACRKAVKSQAFYWLIIV-LVFLNTGVLATEHYGQLDWLDNFQEYTNVFFIGLFTCEMLLKMYSLGFQGYFVSLFNRFDCFVVIGSITETLLTNTGMMPPLGVSVLRCVRLLRVFKVTKYWRSLSNLVASLLNSIQSIASLLLLLFLFIVIFALLGMQVFGGKFNFDGKEEKYRMNFDCFWQALLTVFQIMTGEDWNAVMYVGINAYGGVSSYGALACIYFIILFICGNYILLNVFLAIAVDNLADADSLSEVEKEEEPH----------DESAQKKSHSPTPTIDGMDDHLSIDIDMEQQELD----DEDKMDHETLSDEEVREMCEEEEEDSNSEVSARVTARPRRLSEVSMKKTKKPIPRGSAFFIFSYTNRFRVFCHWLCNHSNFGNIILCCIMFSSAMLAAENPLRANDDLNKVLNKFDYFFTAVFTIELILKLISYGFVLHDGAFCRSAFNLLDLLVVCVSLISLVSSSNAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIVLVTCLLQFMFAVIGVQLFKGKFFKCTDGSKMTQDECYGTYLVYDDGDVHKPRLREREWSNNRFHFDDVAKGMLTLFTVSTFEGWPGLLYVSIDSNKENGGPIHNFRPIVAAYYIIYIIIIAFFMVNIFVGFVIVTFQNEGEQEYKNCDLDKNQRNCIEFALKAKPVRRYIPKHGIQYKVWWFVTSSSFEYTIFILIMINTVTLAMKFYNQPLWYTELLDALNMIFTAVFALEFVFKLAAFRFKNYFGDAWNVFDFIIVLGSFIDIVYSEIKSKDTSQIAECDIVEGCKSTKKSAGSNLISINFFRLFRVMRLVKLLSKGEGIRTLLWTFIKSFQALPYVALLIVLLFFIYAVVGMQVFGKIALDGG---NAITANNNFQTFQQAVLVLFRSATGEAWQEIMMSCSAQPDVKCDMNSDTPGE----------------------------------------------PCGSSIAYPYFISFYVLCSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFIRLWSEYDPDAKGRIKHLDVVTLLRKISPPLGFGKLCPHRMACKRLVSMNMPLNSDGTVLFNATLFAVVRTSLSIKTDGN-IDDANSELRATIKQIWKRTNPKLLDQVVPPPGNDDEVTVGKFYATYLIQDYFRRFK-KRKEQEGKEGHPDSNTVTLQAGLRTLHEVSPALKRAISGNL------DELDQEPEPMH----RRHHTLFGSVWSSIRRHGNGTFRRSAKATAS 2169          

HSP 2 Score: 118.242 bits (295), Expect = 1.220e-25
Identity = 98/355 (27.61%), Postives = 164/355 (46.20%), Query Frame = 1
Query:  937 LSAQIASGGRKRTP-ARSQSGNPRPQ-RALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLII---------IGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQK 1968
            +SA++ +  R+ +  +  ++  P P+  A F  +  N FR FC  +     F  +IL  I  +   LAA  P   R ++ +N  L K +  F  +FT E +LK++++GF++H GA+ R+ +NLLD L+V   +    L   S     VK LR  RVLRPLR ++    L+ V+  ++ A+  + +I L+   +  ++A+IG++LF GK    C   + +  +         + G    D H    +            WS        FD+    MLT+F   T EGW  ++Y   DS   +   I+    I+         I +FF++N+ +G +   F  E E+  K     K
Sbjct: 1298 VSARVTARPRRLSEVSMKKTKKPIPRGSAFFIFSYTNRFRVFCHWLCNHSNFGNIILCCIMFSSAMLAAENPL--RANDDLNKVLNKFDYFFTAVFTIELILKLISYGFVLHDGAFCRSAFNLLDLLVVC--VSLISLVSSSNAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIVLVTCLLQFMFAVIGVQLFKGKFFK-CTDGSKMTQDECYGTYLVYDDG----DVHKPRLR---------EREWSNNRF---HFDDVAKGMLTLFTVSTFEGWPGLLYVSIDSNKENGGPIHNFRPIVAAYYIIYIIIIAFFMVNIFVGFVIVTFQNEGEQEYKNCDLDK 1631          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Fly
Match: Ca-alpha1D (gene:FBgn0001991 transcript:FBtr0332024)

HSP 1 Score: 1733 bits (4487), Expect = 0.000e+0
Identity = 998/1702 (58.64%), Postives = 1197/1702 (70.33%), Query Frame = 1
Query:  970 RTPARSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPV-PCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGGAHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFD-KKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSXXXXXXXXXXXXXXXPTNVDGEEAKACNSSNVSPNIDEKTRFTDAERLIKSEEMNGDIADESMRKMSTRIDTXXXXXXXXXXXXXXXXXNGQTSA-IRRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIY--------------DHVNGTNNNHR--GDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHC--LPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDD-VTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMP-FRTHGRGSGPLISLISPTLVTTNECDEKDKDYLPSHLGAERRTHSIFGTMMNVLQRVGST--RRDSNASPS 6000
            R   R +    RPQRALFCL+++NP R  CI+IVEWKPFE+LIL TIFANC ALA  TPYP  DSN  N  LEK+E VF+VIFT ECV+KILA+GF++H GAYLRNGWNLLDF IV+IG IST LS++ +   DVKALRAFRVLRPLRLVSG+PSLQVV+NSI++AMVPLFHIALL LFVIIIYAIIGLELFSGKLH  C  +     E  + PC      GYQC         Y C         W GPN GIT+FDNFGLAMLTVFQC+T+EGWT ++Y I D++G  W W+YF+S++I+G+FFVMNL+LGVLSGEFSKER KAK RG +QK RE+ Q +ED++GYLDWI  AEDI  D       +GK  +                    ++    E  G      Q        +K    R   R  R   + +     ++ +++ LVFLNTGVL +EHY Q  WLD+FQ   N+ F+ LFT EML+KMYSLG + YF  +FNRFD FVVI SI E ++  T  MPPLGVSVLRC RLLRVFKVT+YW SL NLV SLL S++SI SLL+LLFLFIVIF+LLGMQ+FGGKFNFD K+ K R NFD F Q+LLTVFQI+TGEDWN VMY GI +YG +     L+C+Y++ILFICGNYILLNVFLAIAVDNLAD  S ++ EK+E  +          +E+    S + +P ID        +  ++ +E++    DE      T  D E     E  E D   E + + +A  RR+SEV  K+  KPIP  S+FFIF   N+FR FCH++CNH +FGNI+L CIM SSAMLAAE+PL A    N++LN FDY FT+VFT+E+ LK+I+YG V H+GAFCRS+ N+LDLLVV  S+IS   +++AISVVKILRVLRVLRPLRAINRAKGLK VVQCV+VAVK+IGNI+LVT LL+FMFAVIGVQLF GKF  C D SK T   C G Y+ Y++ D+ K  + +REW NN  +FD+V   MLTLF VSTFEGWPG+LY SIDS KE+   I+N RPIV+ +YI YII+IAFFM+NIFVGFVIVTFQ EGE+EYKNC+LDKNQR CIEFALKAKPVRRYIPK   +Y+VWW +TS  FEY IF+LIM+NT++LA+KF  QP  Y +++D LNM+FT VF +EF+ KLAAF FKNYF DAWNVFDFIIVLGSFIDI+Y              D V G  +  +  G  LISINFFRLFRVMRLVKLLS+GEGIRTLLWTF+KSFQALPYVALLIV+LFFIYAV+GMQ+FGKI  +       I  NNNFQTF QA+LVLFRSATGEAWQ IM+ C   PD  CD  SD   +                                               CGS+ AYPYFISFY++CSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEF+RLWSEYDP+AKGRIKHLDVVTLLRKI+PPLGFGK CPHR AC  LV MNMPLNSDGTV+FNATLFA+VRT+L IKTDG+ +D  N ELR  IK+IWKRT+ K+LDQVVPP GNDD VTVGKFYAT+LIQ++FRR+K KR E++    +  S  ++L    RT    S  L   IS  L      DE D++  P H    RR H++FG++ + ++R G+   RR + A+ S
Sbjct:   86 RQQRRGKPQPDRPQRALFCLSVKNPLRALCIRIVEWKPFEFLILLTIFANCIALAVYTPYPGSDSNVTNQTLEKVEYVFLVIFTAECVMKILAYGFVLHNGAYLRNGWNLLDFTIVVIGAISTALSQLMKDAFDVKALRAFRVLRPLRLVSGVPSLQVVLNSILKAMVPLFHIALLVLFVIIIYAIIGLELFSGKLHKACRDEITGEYEENIRPCGV----GYQCPP------GYKCYGG------WDGPNDGITNFDNFGLAMLTVFQCVTLEGWTDVLYSIQDAMGSDWQWMYFISMVILGAFFVMNLILGVLSGEFSKERNKAKNRGDFQKLREKQQIEEDLRGYLDWITQAEDIEPDAVGGLISDGKGKQ-------------------PNEMDSTENLGEEMPEVQMTESRWRKMKKDFDRVNRRMRRACRKAVKSQAFYWLIIV-LVFLNTGVLATEHYGQLDWLDNFQEYTNVFFIGLFTCEMLLKMYSLGFQGYFVSLFNRFDCFVVIGSITETLLTNTGMMPPLGVSVLRCVRLLRVFKVTKYWRSLSNLVASLLNSIQSIASLLLLLFLFIVIFALLGMQVFGGKFNFDGKEEKYRMNFDCFWQALLTVFQIMTGEDWNAVMYVGINAYGGVSSYGALACIYFIILFICGNYILLNVFLAIAVDNLADADSLSEVEKEEEPH----------DESAQKKSHSPTPTIDGMDDHLSIDIDMEQQELD----DEDKMDHETLSDEEVREMCEEEEEDSNSEVSARVTARPRRLSEVSMKKTKKPIPRGSAFFIFSYTNRFRVFCHWLCNHSNFGNIILCCIMFSSAMLAAENPLRANDDLNKVLNKFDYFFTAVFTIELILKLISYGFVLHDGAFCRSAFNLLDLLVVCVSLISLVSSSNAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIVLVTCLLQFMFAVIGVQLFKGKFFKCTDGSKMTQDECYGTYLVYDDGDVHKPRLREREWSNNRFHFDDVAKGMLTLFTVSTFEGWPGLLYVSIDSNKENGGPIHNFRPIVAAYYIIYIIIIAFFMVNIFVGFVIVTFQNEGEQEYKNCDLDKNQRNCIEFALKAKPVRRYIPKHGIQYKVWWFVTSSSFEYTIFILIMINTVTLAMKFYNQPLWYTELLDALNMIFTAVFALEFVFKLAAFRFKNYFGDAWNVFDFIIVLGSFIDIVYSEIKSKDTSQIAECDIVEGCKSTKKSAGSNLISINFFRLFRVMRLVKLLSKGEGIRTLLWTFIKSFQALPYVALLIVLLFFIYAVVGMQVFGKIALDGG---NAITANNNFQTFQQAVLVLFRSATGEAWQEIMMSCSAQPDVKCDMNSDTPGE----------------------------------------------PCGSSIAYPYFISFYVLCSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFIRLWSEYDPDAKGRIKHLDVVTLLRKISPPLGFGKLCPHRMACKRLVSMNMPLNSDGTVLFNATLFAVVRTSLSIKTDGN-IDDANSELRATIKQIWKRTNPKLLDQVVPPPGNDDEVTVGKFYATYLIQDYFRRFK-KRKEQEGKEGHPDSNTVTLQAGLRTLHEVSPALKRAISGNL------DELDQEPEPMH----RRHHTLFGSVWSSIRRHGNGTFRRSAKATAS 1676          

HSP 2 Score: 117.472 bits (293), Expect = 1.874e-25
Identity = 98/355 (27.61%), Postives = 164/355 (46.20%), Query Frame = 1
Query:  937 LSAQIASGGRKRTP-ARSQSGNPRPQ-RALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLII---------IGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQK 1968
            +SA++ +  R+ +  +  ++  P P+  A F  +  N FR FC  +     F  +IL  I  +   LAA  P   R ++ +N  L K +  F  +FT E +LK++++GF++H GA+ R+ +NLLD L+V   +    L   S     VK LR  RVLRPLR ++    L+ V+  ++ A+  + +I L+   +  ++A+IG++LF GK    C   + +  +         + G    D H    +            WS        FD+    MLT+F   T EGW  ++Y   DS   +   I+    I+         I +FF++N+ +G +   F  E E+  K     K
Sbjct:  805 VSARVTARPRRLSEVSMKKTKKPIPRGSAFFIFSYTNRFRVFCHWLCNHSNFGNIILCCIMFSSAMLAAENPL--RANDDLNKVLNKFDYFFTAVFTIELILKLISYGFVLHDGAFCRSAFNLLDLLVVC--VSLISLVSSSNAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIVLVTCLLQFMFAVIGVQLFKGKFFK-CTDGSKMTQDECYGTYLVYDDG----DVHKPRLR---------EREWSNNRF---HFDDVAKGMLTLFTVSTFEGWPGLLYVSIDSNKENGGPIHNFRPIVAAYYIIYIIIIAFFMVNIFVGFVIVTFQNEGEQEYKNCDLDK 1138          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Fly
Match: Ca-alpha1D (gene:FBgn0001991 transcript:FBtr0090006)

HSP 1 Score: 1732.61 bits (4486), Expect = 0.000e+0
Identity = 999/1701 (58.73%), Postives = 1200/1701 (70.55%), Query Frame = 1
Query:  970 RTPARSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPV-PCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGGAHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFD-KKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSXXXXXXXXXXXXXXXPTNVDGEEAKACNSSNVSPNIDEKTRFTDAERLIKSEEMNGDIADESMRKMSTRIDTXXXXXXXXXXXXXXXXXNGQTSAIRRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIY--------------DHVNGTNNNHR--GDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHC--LPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDD-VTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMP-FRTHGRGSGPLISLISPTLVTTNECDEKDKDYLPSHLGAERRTHSIFGTMMNVLQRVGST--RRDSNASPS 6000
            R   R +    RPQRALFCL+++NP R  CI+IVEWKPFE+LIL TIFANC ALA  TPYP  DSN  N  LEK+E VF+VIFT ECV+KILA+GF++H GAYLRNGWNLLDF IV+IG IST LS++ +   DVKALRAFRVLRPLRLVSG+PSLQVV+NSI++AMVPLFHIALL LFVIIIYAIIGLELFSGKLH  C  +     E  + PC      GYQC         Y C         W GPN GIT+FDNFGLAMLTVFQC+T+EGWT ++Y I D++G  W W+YF+S++I+G+FFVMNL+LGVLSGEFSKER KAK RG +QK RE+ Q +ED++GYLDWI  AEDI  D       +GK  +                    ++    E  G      Q        +K    R   R  R   + +     ++ +++ LVFLNTGVL +EHY Q  WLD+FQ   N+ F+ LFT EML+KMYSLG + YF  +FNRFD FVVI SI E ++  T  MPPLGVSVLRC RLLRVFKVT+YW SL NLV SLL S++SI SLL+LLFLFIVIF+LLGMQ+FGGKFNFD K+ K R NFD F Q+LLTVFQI+TGEDWN VMY GI +YG +     L+C+Y++ILFICGNYILLNVFLAIAVDNLAD  S ++ EK+E  +          +E+    S + +P ID        +  ++ +E++    DE   KM     +++E  E   E +E DEE   T+  RR+SEV    KI PIP  +SFF+F   N+FR FCH++CNH +FGNI+L CIM SSAMLAAE+PL A    N++LN FDY FT+VFT+E+ LK+I+YG V H+GAFCRS+ N+LDLLVV  S+IS   +++AISVVKILRVLRVLRPLRAINRAKGLK VVQCV+VAVK+IGNI+LVT LL+FMFAVIGVQLF GKF  C D SK T   C G Y+ Y++ D+ K  + +REW NN  +FD+V   MLTLF VSTFEGWPG+LY SIDS KE+   I+N RPIV+ +YI YII+IAFFM+NIFVGFVIVTFQ EGE+EYKNC+LDKNQR CIEFALKAKPVRRYIPK   +Y+VWW +TS  FEY IF+LIM+NT++LA+KF  QP  Y +++D LNM+FT VF +EF+ KLAAF FKNYF DAWNVFDFIIVLGSFIDI+Y              D V G  +  +  G  LISINFFRLFRVMRLVKLLS+GEGIRTLLWTF+KSFQALPYVALLIV+LFFIYAV+GMQ+FGKI  +       I  NNNFQTF QA+LVLFRSATGEAWQ IM+ C   PD  CD  SD   +                                               CGS+ AYPYFISFY++CSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEF+RLWSEYDP+AKGRIKHLDVVTLLRKI+PPLGFGK CPHR AC  LV MNMPLNSDGTV+FNATLFA+VRT+L IKTDG+ +D  N ELR  IK+IWKRT+ K+LDQVVPP GNDD VTVGKFYAT+LIQ++FRR+K KR E++    +  S  ++L    RT    S  L   IS  L      DE D++  P H    RR H++FG++ + ++R G+   RR + A+ S
Sbjct:  579 RQQRRGKPQPDRPQRALFCLSVKNPLRALCIRIVEWKPFEFLILLTIFANCIALAVYTPYPGSDSNVTNQTLEKVEYVFLVIFTAECVMKILAYGFVLHNGAYLRNGWNLLDFTIVVIGAISTALSQLMKDAFDVKALRAFRVLRPLRLVSGVPSLQVVLNSILKAMVPLFHIALLVLFVIIIYAIIGLELFSGKLHKACRDEITGEYEENIRPCGV----GYQCPP------GYKCYGG------WDGPNDGITNFDNFGLAMLTVFQCVTLEGWTDVLYSIQDAMGSDWQWMYFISMVILGAFFVMNLILGVLSGEFSKERNKAKNRGDFQKLREKQQIEEDLRGYLDWITQAEDIEPDAVGGLISDGKGKQ-------------------PNEMDSTENLGEEMPEVQMTESRWRKMKKDFDRVNRRMRRACRKAVKSQAFYWLIIV-LVFLNTGVLATEHYGQLDWLDNFQEYTNVFFIGLFTCEMLLKMYSLGFQGYFVSLFNRFDCFVVIGSITETLLTNTGMMPPLGVSVLRCVRLLRVFKVTKYWRSLSNLVASLLNSIQSIASLLLLLFLFIVIFALLGMQVFGGKFNFDGKEEKYRMNFDCFWQALLTVFQIMTGEDWNAVMYVGINAYGGVSSYGALACIYFIILFICGNYILLNVFLAIAVDNLADADSLSEVEKEEEPH----------DESAQKKSHSPTPTIDGMDDHLSIDIDMEQQELD----DED--KMDHETLSDEEVREMCEEEEEVDEEGMITARPRRMSEVNTATKILPIPPGTSFFLFSQTNRFRVFCHWLCNHSNFGNIILCCIMFSSAMLAAENPLRANDDLNKVLNKFDYFFTAVFTIELILKLISYGFVLHDGAFCRSAFNLLDLLVVCVSLISLVSSSNAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIVLVTCLLQFMFAVIGVQLFKGKFFKCTDGSKMTQDECYGTYLVYDDGDVHKPRLREREWSNNRFHFDDVAKGMLTLFTVSTFEGWPGLLYVSIDSNKENGGPIHNFRPIVAAYYIIYIIIIAFFMVNIFVGFVIVTFQNEGEQEYKNCDLDKNQRNCIEFALKAKPVRRYIPKHGIQYKVWWFVTSSSFEYTIFILIMINTVTLAMKFYNQPLWYTELLDALNMIFTAVFALEFVFKLAAFRFKNYFGDAWNVFDFIIVLGSFIDIVYSEIKSKDTSQIAECDIVEGCKSTKKSAGSNLISINFFRLFRVMRLVKLLSKGEGIRTLLWTFIKSFQALPYVALLIVLLFFIYAVVGMQVFGKIALDGG---NAITANNNFQTFQQAVLVLFRSATGEAWQEIMMSCSAQPDVKCDMNSDTPGE----------------------------------------------PCGSSIAYPYFISFYVLCSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFIRLWSEYDPDAKGRIKHLDVVTLLRKISPPLGFGKLCPHRMACKRLVSMNMPLNSDGTVLFNATLFAVVRTSLSIKTDGN-IDDANSELRATIKQIWKRTNPKLLDQVVPPPGNDDEVTVGKFYATYLIQDYFRRFK-KRKEQEGKEGHPDSNTVTLQAGLRTLHEVSPALKRAISGNL------DELDQEPEPMH----RRHHTLFGSVWSSIRRHGNGTFRRSAKATAS 2166          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Fly
Match: Ca-alpha1D (gene:FBgn0001991 transcript:FBtr0332023)

HSP 1 Score: 1730.69 bits (4481), Expect = 0.000e+0
Identity = 999/1701 (58.73%), Postives = 1201/1701 (70.61%), Query Frame = 1
Query:  970 RTPARSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPV-PCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGGAHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFD-KKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSXXXXXXXXXXXXXXXPTNVDGEEAKACNSSNVSPNIDEKTRFTDAERLIKSEEMNGDIADESMRKMSTRIDTXXXXXXXXXXXXXXXXXNGQTSAIRRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIY--------------DHVNGTNNNHR--GDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHC--LPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDD-VTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMP-FRTHGRGSGPLISLISPTLVTTNECDEKDKDYLPSHLGAERRTHSIFGTMMNVLQRVGST--RRDSNASPS 6000
            R   R +    RPQRALFCL+++NP R  CI+IVEWKPFE+LIL TIFANC ALA  TPYP  DSN  N  LEK+E VF+VIFT ECV+KILA+GF++H GAYLRNGWNLLDF IV+IG IST LS++ +   DVKALRAFRVLRPLRLVSG+PSLQVV+NSI++AMVPLFHIALL LFVIIIYAIIGLELFSGKLH  C  +     E  + PC      GYQC         Y C         W GPN GIT+FDNFGLAMLTVFQC+T+EGWT ++Y I D++G  W W+YF+S++I+G+FFVMNL+LGVLSGEFSKER KAK RG +QK RE+ Q +ED++GYLDWI  AEDI  D       +GK  +                    ++    E  G      Q        +K    R   R  R   + +     ++ +++ LVFLNTGVL +EHY Q  WLD+FQ   N+ F+ LFT EML+KMYSLG + YF  +FNRFD FVVI SI E ++  T  MPPLGVSVLRC RLLRVFKVT+YW SL NLV SLL S++SI SLL+LLFLFIVIF+LLGMQ+FGGKFNFD K+ K R NFD F Q+LLTVFQI+TGEDWN VMY GI +YG +     L+C+Y++ILFICGNYILLNVFLAIAVDNLAD  S ++ EK+E  +          +E+    S + +P ID        +  ++ +E++    DE   KM     +++E  E   E +E DEE   T+  RR+SEV    KI PIP  +SFF+F   N+FR FCH++CNH +FGNI+L CIM SSAMLAAE+PL A    N++LN FDY FT+VFT+E+ LK+I+YG V H+GAFCRS+ N+LDLLVV  S+IS   +++AISVVKILRVLRVLRPLRAINRAKGLK VV+CVVVA+K+IGNIMLVT+LL+FMFAVIGVQLF GKF  C D SK T   C G Y+ Y++ D+ K  + +REW NN  +FD+V   MLTLF VSTFEGWPG+LY SIDS KE+   I+N RPIV+ +YI YII+IAFFM+NIFVGFVIVTFQ EGE+EYKNC+LDKNQR CIEFALKAKPVRRYIPK   +Y+VWW +TS  FEY IF+LIM+NT++LA+KF  QP  Y +++D LNM+FT VF +EF+ KLAAF FKNYF DAWNVFDFIIVLGSFIDI+Y              D V G  +  +  G  LISINFFRLFRVMRLVKLLS+GEGIRTLLWTF+KSFQALPYVALLIV+LFFIYAV+GMQ+FGKI  +       I  NNNFQTF QA+LVLFRSATGEAWQ IM+ C   PD  CD  SD   +                                               CGS+ AYPYFISFY++CSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEF+RLWSEYDP+AKGRIKHLDVVTLLRKI+PPLGFGK CPHR AC  LV MNMPLNSDGTV+FNATLFA+VRT+L IKTDG+ +D  N ELR  IK+IWKRT+ K+LDQVVPP GNDD VTVGKFYAT+LIQ++FRR+K KR E++    +  S  ++L    RT    S  L   IS  L      DE D++  P H    RR H++FG++ + ++R G+   RR + A+ S
Sbjct:   86 RQQRRGKPQPDRPQRALFCLSVKNPLRALCIRIVEWKPFEFLILLTIFANCIALAVYTPYPGSDSNVTNQTLEKVEYVFLVIFTAECVMKILAYGFVLHNGAYLRNGWNLLDFTIVVIGAISTALSQLMKDAFDVKALRAFRVLRPLRLVSGVPSLQVVLNSILKAMVPLFHIALLVLFVIIIYAIIGLELFSGKLHKACRDEITGEYEENIRPCGV----GYQCPP------GYKCYGG------WDGPNDGITNFDNFGLAMLTVFQCVTLEGWTDVLYSIQDAMGSDWQWMYFISMVILGAFFVMNLILGVLSGEFSKERNKAKNRGDFQKLREKQQIEEDLRGYLDWITQAEDIEPDAVGGLISDGKGKQ-------------------PNEMDSTENLGEEMPEVQMTESRWRKMKKDFDRVNRRMRRACRKAVKSQAFYWLIIV-LVFLNTGVLATEHYGQLDWLDNFQEYTNVFFIGLFTCEMLLKMYSLGFQGYFVSLFNRFDCFVVIGSITETLLTNTGMMPPLGVSVLRCVRLLRVFKVTKYWRSLSNLVASLLNSIQSIASLLLLLFLFIVIFALLGMQVFGGKFNFDGKEEKYRMNFDCFWQALLTVFQIMTGEDWNAVMYVGINAYGGVSSYGALACIYFIILFICGNYILLNVFLAIAVDNLADADSLSEVEKEEEPH----------DESAQKKSHSPTPTIDGMDDHLSIDIDMEQQELD----DED--KMDHETLSDEEVREMCEEEEEVDEEGMITARPRRMSEVNTATKILPIPPGTSFFLFSQTNRFRVFCHWLCNHSNFGNIILCCIMFSSAMLAAENPLRANDDLNKVLNKFDYFFTAVFTIELILKLISYGFVLHDGAFCRSAFNLLDLLVVCVSLISLVSSSNAISVVKILRVLRVLRPLRAINRAKGLKYVVKCVVVAIKTIGNIMLVTYLLQFMFAVIGVQLFKGKFFKCTDGSKMTQDECYGTYLVYDDGDVHKPRLREREWSNNRFHFDDVAKGMLTLFTVSTFEGWPGLLYVSIDSNKENGGPIHNFRPIVAAYYIIYIIIIAFFMVNIFVGFVIVTFQNEGEQEYKNCDLDKNQRNCIEFALKAKPVRRYIPKHGIQYKVWWFVTSSSFEYTIFILIMINTVTLAMKFYNQPLWYTELLDALNMIFTAVFALEFVFKLAAFRFKNYFGDAWNVFDFIIVLGSFIDIVYSEIKSKDTSQIAECDIVEGCKSTKKSAGSNLISINFFRLFRVMRLVKLLSKGEGIRTLLWTFIKSFQALPYVALLIVLLFFIYAVVGMQVFGKIALDGG---NAITANNNFQTFQQAVLVLFRSATGEAWQEIMMSCSAQPDVKCDMNSDTPGE----------------------------------------------PCGSSIAYPYFISFYVLCSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFIRLWSEYDPDAKGRIKHLDVVTLLRKISPPLGFGKLCPHRMACKRLVSMNMPLNSDGTVLFNATLFAVVRTSLSIKTDGN-IDDANSELRATIKQIWKRTNPKLLDQVVPPPGNDDEVTVGKFYATYLIQDYFRRFK-KRKEQEGKEGHPDSNTVTLQAGLRTLHEVSPALKRAISGNL------DELDQEPEPMH----RRHHTLFGSVWSSIRRHGNGTFRRSAKATAS 1673          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Zebrafish
Match: cacna1sb (calcium channel, voltage-dependent, L type, alpha 1S subunit, b [Source:ZFIN;Acc:ZDB-GENE-051227-1])

HSP 1 Score: 1520.37 bits (3935), Expect = 0.000e+0
Identity = 875/1693 (51.68%), Postives = 1129/1693 (66.69%), Query Frame = 1
Query:  985 SQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVL---------SKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMM-----ESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGGAHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSXXXXXXXXXXXXXXXPTNVDGEEAKACNSSNVSPNIDEKTRFTDAERLIKSEEMNGDIADESMRKMS------TRIDTXXXXXXXXXXXXXXXXXNGQTSAIRRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRG--------------------DRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMP-FRTHGRGSGP-LISLISPTLVTTNECDEKDKDYLPSHLGAERRTHSIFG 5937
            +  GNPRP R LF   LRNPFRK C  IVEWKPFE +IL TIFANC ALA   P PE D+N  N  LE +E +F+VIFT EC LKI+A+G + H GAYLRN WN+LDF+IV +GL + V+          K   GG D+KALRAFRVLRPLRLVSG+PSLQVVM+S++++M+PLFHI LL  F++ IYAI+GLELF  K+H TCY +   ++     E P PC+ + N G +C    +      C+D       W GPN GIT FDNFG AMLTVFQCIT E WT ++YWIND++G  WPWIYF+SLI++GSFF++NLVLGVLSGEF+KEREK++ RG++Q  RE+ Q DED++GY++WI  A      E  DG  +      K  G                     ET+         + V+ + L  R      R+C       VKS++F W V+++V LNT V+ +EH+ Q+  L +FQ+TAN+I +  FT+EM++KMY+ G R YF  +FNRFD FVV   ILEI+++ +  M PLG+SV+RC RLLR+FK+T+YW+SL NLV SLL S+KSI SLL+LLFLFIVIF+LLGMQ+FGGKFNF  +   RSNFD+F Q+L++VFQ+LTGE+W+ +MY+GI ++G      +L  +Y++IL++CGN++LLNVFLAIAVDNLA+  S    +K+              EE          P   E+ +   A+RL++S +    +   +  K+         +       +   + +EE+ E   +   R ++++  KE + P+P ASSFFIFGP NKFRK CH I NH  F NI+L+ I++SS  LAAEDP+D  S RN++L Y D +FT+VFT+EI LK+  YG   H G+FCR+S NILDL+VV  S++S  + +  ISVVKILRVLRVLRPLRAINRAKGLK VVQC+ VA+K+IGNI+LVT LL+FMF+ IGVQLF G    C D  + T   C+G ++ + +  +    +++R W+N+  NFDNV N ML LF +STFEGWP +LYK+IDS+  D   +YNNR  +SIF+I YII+IAFFM+NIFVGFVIVTFQ++GE+EYKNCELDKNQR+C+++ALKA+P++ YIP+   +YRVW+L+TS  FEY++F LIMLNT+SL +++  QP    ++ D LN++FT +FT E ++KL AF  K YF D WNVFDF+IV+GS +D++   V+ T     G                    +  +SI FFRLFRV+RL+KLL+R EGIR LLWTF+KSFQALP+V LLIVMLFFIYAVIGMQMFGKI   +     EINRNNNFQTFPQA+L+LFR ATGE W  IML  +   +CD  SD    E Y                                            CGS+ A  YF+SFYM+C+FL+INLFVA+IMDNFDYLT DWSILGPHHLDEF ++W EYDPEA GRIKHLDVVTLLR+I PPLGFGK+CPH  AC  L+ MNMPLNSDGTV FNATLFALVRT LKIKT+G+  +Q NEELR +IK IWKRTS K+LDQV+PP G D+VTVGKFYATFLIQE FR++ Q R EE  G   ++     +    R+    + P L   IS  L+     DE ++       G  RRT  +FG
Sbjct:   43 ATGGNPRPPRTLFFFKLRNPFRKACTNIVEWKPFEIIILLTIFANCVALAVFLPMPEEDTNNTNLTLESLEYIFLVIFTLECFLKIIAYGLLFHEGAYLRNCWNILDFVIVFMGLFTLVVDTIDTITGVQKEKGGGFDMKALRAFRVLRPLRLVSGVPSLQVVMSSVLKSMLPLFHILLLVFFMVTIYAIMGLELFKCKMHKTCYYQGTNIIALRENEKPSPCAQAGN-GRRCTINGTE-----CRDG------WPGPNFGITHFDNFGFAMLTVFQCITTESWTDVLYWINDAMGNDWPWIYFLSLIMLGSFFILNLVLGVLSGEFTKEREKSRSRGEWQVLRERQQMDEDLKGYMEWITHA------EVMDGDSDAMLLLRKDTG--------------------SETDSLYKMEGINKVVYFYRLARRWNIVIRRKCHG----WVKSKSFNWWVLIVVLLNTLVIATEHHNQTEGLTNFQDTANVILLACFTIEMIMKMYAFGPRSYFMSIFNRFDCFVVTIGILEIILVGSGIMTPLGISVMRCIRLLRLFKLTKYWTSLNNLVVSLLNSVKSIASLLLLLFLFIVIFALLGMQVFGGKFNFPDRPIQRSNFDNFPQALISVFQVLTGEEWDTIMYNGIMAHGGPKSPGILVSIYFIILYVCGNFVLLNVFLAIAVDNLAEAESLAAAQKER------------AEERARKKLMKPLPEKTEEEKALMAKRLMESRQKTEGMPTTAKLKIDEFESNVNEVKDPFPPADFPGDDEEEEPEIPISPRPRPMADLQLKETVVPMPEASSFFIFGPQNKFRKLCHRIINHTTFTNIILLFILLSSISLAAEDPIDPHSFRNKVLAYADIVFTTVFTIEIVLKMTVYGAFLHPGSFCRNSFNILDLIVVAVSLLSMGMESSTISVVKILRVLRVLRPLRAINRAKGLKHVVQCMFVAIKTIGNIVLVTMLLDFMFSCIGVQLFKGTLFYCTDPLQKTAEQCQGTFLKHVQNSLHDTEIHQRRWVNSDFNFDNVLNGMLALFTISTFEGWPEILYKAIDSYDVDTGPLYNNRVGISIFFIIYIIIIAFFMMNIFVGFVIVTFQRQGEQEYKNCELDKNQRQCVQYALKARPLKCYIPENPHQYRVWYLVTSCYFEYLMFFLIMLNTLSLGMQYCNQPFYITKLSDNLNVIFTVLFTGEMIVKLIAFKAKGYFGDPWNVFDFVIVIGSIVDVVLSEVDRTLEASGGLWCLHGCSEVDPMQAIAEAENVKLSITFFRLFRVLRLIKLLNRSEGIRNLLWTFIKSFQALPHVGLLIVMLFFIYAVIGMQMFGKIALVDG---TEINRNNNFQTFPQAVLLLFRVATGEQWPKIMLASMYGKLCDPKSDYGPGEEYT-------------------------------------------CGSSIAVCYFLSFYMLCAFLVINLFVAIIMDNFDYLTHDWSILGPHHLDEFKKIWGEYDPEATGRIKHLDVVTLLRRIQPPLGFGKFCPHHAACKRLISMNMPLNSDGTVTFNATLFALVRTALKIKTEGN-FEQANEELRAIIKSIWKRTSMKLLDQVIPPIGEDEVTVGKFYATFLIQEHFRKFMQ-RQEELYGYRPTKKNADEIKAGLRSIEEEAAPELHRAISGDLIAE---DEMERAMESGEEGIYRRTGGLFG 1630          

HSP 2 Score: 83.1889 bits (204), Expect = 6.353e-15
Identity = 100/445 (22.47%), Postives = 175/445 (39.33%), Query Frame = 1
Query: 4237 EEEYKNCELDKNQRKCIEFALKAKPVRR---YIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQR----YEQVMDYLNMVFTGVFTVEFLLKLAAFGF----KNYFSDAWNVFDFIIVLGSFIDIIYDHVN---GTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMF--------------------------------GKITTENEKEMKEINRNNN-----FQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTR------DWSILGP-HHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRK 5397
            EEE K  + +K  +K +      +P R    +  +  FR     ++  +PFE II + I  N ++LA+ F   P+         ++ L  +F  +FT+E  LK+ A+G       Y  + WN+ DF+IV      ++ D ++   G      G     +   R FRV+R ++L+S    ++ ++ + +KS   L ++ LL+  +  IYA++G+++F                                G+  T N  E ++     N     F  F  A+L +F+  T E+W ++ L+ + DAM                            ND    WP                           + YF+S  M+ SF I+NL + V+   F           +W +L     +DE ++ + E+   A+      D + LLRK
Sbjct:   27 EEELKRKQREK-LKKLLATGGNPRPPRTLFFFKLRNPFRKACTNIVEWKPFEIIILLTIFANCVALAV-FLPMPEEDTNNTNLTLESLEYIFLVIFTLECFLKIIAYGLLFHEGAYLRNCWNILDFVIVFMGLFTLVVDTIDTITGVQKEKGGG--FDMKALRAFRVLRPLRLVSGVPSLQVVMSSVLKSMLPLFHILLLVFFMVTIYAIMGLELFKCKMHKTCYYQGTNIIALRENEKPSPCAQAGNGRRCTINGTECRDGWPGPNFGITHFDNFGFAMLTVFQCITTESWTDV-LYWINDAMG---------------------------ND----WP---------------------------WIYFLSLIMLGSFFILNLVLGVLSGEFTKEREKSRSRGEWQVLRERQQMDEDLKGYMEWITHAEVMDGDSDAMLLLRK 408          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Zebrafish
Match: cacna1da (calcium channel, voltage-dependent, L type, alpha 1D subunit, a [Source:ZFIN;Acc:ZDB-GENE-030616-135])

HSP 1 Score: 989.949 bits (2558), Expect = 0.000e+0
Identity = 550/916 (60.04%), Postives = 666/916 (72.71%), Query Frame = 1
Query: 3298 RVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRTHGRGSGPLISLISPTLVTTNECDEKDK---DYLPSH-LGAERRTHSIFGTMMNVLQRVGSTRRDSNASPSTGSINHSTELP 6033
            ++SE++ KEKI PIP  S+FFIF   N  R  CH + NH  F N++LV IM+SSA LAAEDP+   S+RN IL YFDY FT++FTVEI LK+ TYG   H GAFCR+  N+LDLLVV  S++S+ I + AISVVKILRVLRVLRPLRAINRAKGLK VVQCV VA+++IGNIM+VT LL+FMFA IGVQLF GKF  CND +K++   C+G YI Y E D+ +  + KR W N+  NFDNV  AM+ LF VSTFEGWP +LYK+IDS +E+   IYN R  +SIF+I YII+IAFFM+NIFVGFVIVTFQ++GE+EYKNCELDKNQR+C+E+ALKA+P+RRYIPK  ++Y+ W+++ S  FEYI+FVLI+LNTI LA++   Q + +  VMD LNMVFT VFTVE +LKL AF  ++YF+DAWN FD +IV+GS +DI    VN T ++ R    ISI FFRLFRVMRLVKLLSRGEGIRTLLWTF+KSFQALPYVALLI MLFFIYAVIGMQ+FGKI   +     +INRNNNFQTFPQA+L+LFR ATGEAWQ IML C+P  +CD  SD      YN                     P                     CGS+FA  YFI+FYM+C+FLIINLFVAVIMDNFDYLTRDWSILGPHHLDEF R+WSEYDPEAKGRIKHLDVVTLLR+I PPLGFGK CPHR AC  LV MNMPLNSDGTVMFNATLFALVRT LKIKT+G+ ++Q NEELR VIKKIWKRTS K+LDQVVPPAG+D+VTVGKFYATFLIQ++FR++K+++ E   G+  +Q+     +      +     +  I P +     CD +D    D++P       RR   +FG  +N +   G  RR      S+G   ++T+ P
Sbjct:  790 KISELVKKEKITPIPEGSAFFIFSNTNPVRVACHKLINHHIFTNLILVFIMLSSASLAAEDPIRNFSARNIILGYFDYAFTAIFTVEIVLKMTTYGAFLHKGAFCRNYFNLLDLLVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYRCNDEAKSSPEECKGTYIMYKEGDVNQPIIQKRHWHNSDFNFDNVLMAMMALFTVSTFEGWPALLYKAIDSNRENMGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKFWYVVNSTGFEYIMFVLILLNTICLAVQHYGQSELFNYVMDILNMVFTAVFTVEMVLKLIAFKPRHYFTDAWNTFDALIVVGSVVDIAITEVNNTEDSAR----ISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQVFGKIAMVDH---TQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACMPGKLCDPESD------YN---------------------PGEEMT----------------CGSSFAIIYFITFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTALKIKTEGN-LEQANEELRAVIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQDYFRKFKKRKEEGLVGVHPAQNNTAIAL------QAGLRTLHDIGPEIRRAISCDLQDDELVDFIPEEDEEIYRRNGGLFGNHINHIN--GDPRR------SSGHQTNATQRP 1640          

HSP 2 Score: 719.924 bits (1857), Expect = 0.000e+0
Identity = 403/729 (55.28%), Postives = 501/729 (68.72%), Query Frame = 1
Query:  943 AQIASGGRKRTPARSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSE---------------------GGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCY-SKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGL-----------CKSSEXXXXXXXXXXXXXXXETEGGAHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXL--------VKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGS 3006
            AQ       ++  +  S N RPQRALFCL L NP R+ CI +VEWKPF+  IL  IFANC ALA   P+PE DSN+ N  LE +E  F++IFT E  LKI+A+G +MH  AY+RNGWN+LDF+IV+IGL S VL  +++                     GG DVKALRAFRVLRPLRLVSG+PSLQVV+NSI++AMVPL HIALL LFVIIIYAIIGLELF GK+H++CY    D++ + P PC+ +   G  C    +     +CK+       W GPN GIT+FDNF  AMLTVFQCITMEGWT ++YW+ND++G+  PW+YFVSL+I GSFFV+NLVLGVLSGEFSKEREKAK RG +QK RE+ Q +ED++GYLDWI  AEDI D E  + +E  K +R  L  L            +SS+         ++ ++ E E G    + ++   C P   +  +    R  R   RL        VKS  FYW+VI+LVFLNT  ++SEHY Q +WL   Q+ AN + + +FT EML+KMYSLG++ YF  +FNRFD FVV   I E ++++ + M PLG+SV RC RLLR+FKVTR+W+SL NLV SLL SMKSI SLL+LLFLFI+IFSLLGMQ+FGGKFNFD+    RS FD+F Q+LLTVFQILTGEDWN VMYDGI +YG    S M+ C+Y++ILFICGNYILLNVFLAIAVDNLAD  S
Sbjct:   33 AQKKRAQYAKSKKQGSSANTRPQRALFCLNLNNPIRRACISLVEWKPFDIFILIAIFANCMALAVYVPFPEDDSNSTNHDLETVEYAFLIIFTIETFLKIIAYGLVMHQNAYVRNGWNMLDFVIVVIGLFSVVLEVLTKEGGEKEEVGENLSAHGHGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHASCYFQGTDILEDEPAPCAVN-GHGRTCPINGT-----LCKEG------WQGPNGGITNFDNFMFAMLTVFQCITMEGWTDVLYWMNDAMGLELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDI-DPENEEEEEESKRNRVTLASLMEKKKKGFGWFSQSSDTHASMPASETESMNTENEKG----EDEKATCCGPTCQKISKSKFSRRWRRWNRLCRRNCRLAVKSVPFYWLVIILVFLNTLTISSEHYNQPMWLTQVQDVANKVLLAMFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVEFEIMSPLGISVFRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQVFGGKFNFDETQTKRSTFDNFPQALLTVFQILTGEDWNAVMYDGIMAYGGPSSSGMIVCIYFIILFICGNYILLNVFLAIAVDNLADAES 744          

HSP 3 Score: 120.553 bits (301), Expect = 2.596e-26
Identity = 105/337 (31.16%), Postives = 159/337 (47.18%), Query Frame = 1
Query: 1000 PRPQ-RALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIY---------FVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQ 1980
            P P+  A F  +  NP R  C K++    F  LIL  I  +  +LAA  P   R+ +  N  L   +  F  IFT E VLK+  +G  +H GA+ RN +NLLD L+V + L+S      S     VK LR  RVLRPLR ++    L+ V+  +  A+  + +I ++   +  ++A IG++LF GK     Y  ND    SP  C  +    Y+  D +             +   W   +    +FDN  +AM+ +F   T EGW  ++Y   DS   +   IY         F+  III +FF+MN+ +G +   F ++ EK  K  +  K + Q
Sbjct:  802 PIPEGSAFFIFSNTNPVRVACHKLINHHIFTNLILVFIMLSSASLAAEDPI--RNFSARNIILGYFDYAFTAIFTVEIVLKMTTYGAFLHKGAFCRNYFNLLDLLVVGVSLVS--FGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKF----YRCNDEAKSSPEECKGTYIM-YKEGDVNQPII---------QKRHWHNSDF---NFDNVLMAMMALFTVSTFEGWPALLYKAIDSNRENMGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQ 1117          

HSP 4 Score: 95.9005 bits (237), Expect = 9.472e-19
Identity = 72/256 (28.12%), Postives = 124/256 (48.44%), Query Frame = 1
Query: 4237 EEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSF--RYRVW---------WLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIM 4971
            E E  N E +K +    E A    P  + I K  F  R+R W           + S PF +++ +L+ LNT++++ +   QP    QV D  N V   +FT E L+K+ + G + YF   +N FD  +V G   + I       +        + I+ FR  R++R+ K+      +  L+ + + S +++  + LL+ +   I++++GMQ+FG     +E + K     + F  FPQA+L +F+  TGE W  +M
Sbjct:  454 ETESMNTENEKGED---EKATCCGPTCQKISKSKFSRRWRRWNRLCRRNCRLAVKSVPFYWLVIILVFLNTLTISSEHYNQPMWLTQVQDVANKVLLAMFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVEFEIMSP-------LGISVFRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQVFGGKFNFDETQTKR----STFDNFPQALLTVFQILTGEDWNAVM 695          

HSP 5 Score: 93.5893 bits (231), Expect = 3.757e-18
Identity = 68/252 (26.98%), Postives = 139/252 (55.16%), Query Frame = 1
Query: 2281 LVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQ---TDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPR-SNFDSFVQSLLTVFQILTGEDWNEVMYDGI-------RSYGNLGK----SSMLSCLYYVILFICGNYILLNVFLAIAVDNL 2991
            +V S  F +++ VL+ LNT  L  +HY QS   +   +  N++F  +FT+EM++K+ +   R YF   +N FD  +V+ S+++I + +   T+    + ++  R  R++R+ K+      +R L+ + + S +++  + +L+ +   I++++GMQ+FG     D     R +NF +F Q++L +F+  TGE W E+M   +        S  N G+     S  + +Y++  ++   ++++N+F+A+ +DN 
Sbjct: 1144 VVNSTGFEYIMFVLILLNTICLAVQHYGQSELFNYVMDILNMVFTAVFTVEMVLKLIAFKPRHYFTDAWNTFDALIVVGSVVDIAITEVNNTEDSARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQVFGKIAMVDHTQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACMPGKLCDPESDYNPGEEMTCGSSFAIIYFITFYMLCAFLIINLFVAVIMDNF 1395          

HSP 6 Score: 88.9669 bits (219), Expect = 1.167e-16
Identity = 75/316 (23.73%), Postives = 137/316 (43.35%), Query Frame = 1
Query: 1036 RNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKA----LRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWI----------------NDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEF 1923
            +NP++     +V    FEY++   I  N   LA         S   N  ++ + +VF  +FT E VLK++AF     P  Y  + WN  D LIV+  ++   +++++      +      R FRV+R ++L+S    ++ ++ + +++   L ++ALL   +  IYA+IG+++F GK+          M++      T +N+                  N N              F  F  A+L +F+C T E W +IM                     + G S+  IYF++  ++ +F ++NL + V+   F
Sbjct: 1134 KNPYQYKFWYVVNSTGFEYIMFVLILLNTICLAVQH---YGQSELFNYVMDILNMVFTAVFTVEMVLKLIAF----KPRHYFTDAWNTFDALIVVGSVVDIAITEVNNTEDSARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQVF-GKI---------AMVD-----HTQINR------------------NNN--------------FQTFPQAVLLLFRCATGEAWQEIMLACMPGKLCDPESDYNPGEEMTCGSSFAIIYFITFYMLCAFLIINLFVAVIMDNF 1395          

HSP 7 Score: 78.1814 bits (191), Expect = 2.222e-13
Identity = 62/265 (23.40%), Postives = 116/265 (43.77%), Query Frame = 1
Query: 4360 LITSRPFEYIIFVLIMLNTISLALKF---DKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGF----KNYFSDAWNVFDFIIVLGSFIDIIYD------------HVNGTNNNHRGD-RLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMF-----------GKITTENEKEMKEINRN----------------------NNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAM 4995
            L+  +PF+  I + I  N ++LA+     +         ++ +   F  +FT+E  LK+ A+G       Y  + WN+ DF+IV+     ++ +              N + + H G      +   R FRV+R ++L+S    ++ +L + +K+   L ++ALL++ +  IYA+IG+++F           G    E+E     +N +                       NF  F  A+L +F+  T E W ++ L+ + DAM
Sbjct:   74 LVEWKPFDIFILIAIFANCMALAVYVPFPEDDSNSTNHDLETVEYAFLIIFTIETFLKIIAYGLVMHQNAYVRNGWNMLDFVIVVIGLFSVVLEVLTKEGGEKEEVGENLSAHGHGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHASCYFQGTDILEDEPAPCAVNGHGRTCPINGTLCKEGWQGPNGGITNFDNFMFAMLTVFQCITMEGWTDV-LYWMNDAM 337          

HSP 8 Score: 77.0258 bits (188), Expect = 4.207e-13
Identity = 79/299 (26.42%), Postives = 123/299 (41.14%), Query Frame = 1
Query: 3352 SFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPL--DAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPI--------------------NNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEF---MFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNK------------REWINNP----LNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIY 4125
            + F    NN  R+ C  +     F   +L+ I  +   LA   P   D  +S N  L   +Y F  +FT+E  LK+I YGLV H  A+ R+  N+LD ++V+  + S  +                     +        ++ LR  R LR +    G+  +   +   +K++  ++ +  L+ F   ++A+IG++LF GK           H SC  Q     E + A   VN             +E    P     NFDN   AMLT+F   T EGW  VLY   D+   +   +Y
Sbjct:   57 ALFCLNLNNPIRRACISLVEWKPFDIFILIAIFANCMALAVYVPFPEDDSNSTNHDLETVEYAFLIIFTIETFLKIIAYGLVMHQNAYVRNGWNMLDFVIVVIGLFSVVLEVLTKEGGEKEEVGENLSAHGHGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKM----------HASCYFQGTDILEDEPAPCAVNGHGRTCPINGTLCKEGWQGPNGGITNFDNFMFAMLTVFQCITMEGWTDVLYWMNDAMGLELPWVY 345          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Zebrafish
Match: cacna1da (calcium channel, voltage-dependent, L type, alpha 1D subunit, a [Source:ZFIN;Acc:ZDB-GENE-030616-135])

HSP 1 Score: 980.704 bits (2534), Expect = 0.000e+0
Identity = 548/923 (59.37%), Postives = 664/923 (71.94%), Query Frame = 1
Query: 3298 RVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGT-------NNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRTHGRGSGPLISLISPTLVTTNECDEKDK---DYLPSH-LGAERRTHSIFGTMMNVLQRVGSTRRDSNASPSTGSINHSTELP 6033
            ++SE++ KEKI PIP  S+FFIF   N  R  CH + NH  F N++LV IM+SSA LAAEDP+   S+RN +L Y DY+FTS+FT EI LK+ TYG   H GAFCR+  N+LDLLVV  S++S+ I + AISVVKILRVLRVLRPLRAINRAKGLK VVQCV VA+++IGNIM+VT LL+FMFA IGVQLF GKF  CND +K++   C+G YI Y E D+ +  + KR W N+  NFDNV  AM+ LF VSTFEGWP +LYK+IDS +E+   IYN R  +SIF+I YII+IAFFM+NIFVGFVIVTFQ++GE+EYKNCELDKNQR+C+E+ALKA+P+RRYIPK  ++Y+ W+++ S  FEYI+FVLI+LNTI LA++   Q + +  VMD LNMVFT VFTVE +LKL AF  ++YF+DAWN FD +IV+GS +DI    VN T       + N      ISI FFRLFRVMRLVKLLSRGEGIRTLLWTF+KSFQALPYVALLI MLFFIYAVIGMQ+FGKI   +     +INRNNNFQTFPQA+L+LFR ATGEAWQ IML C+P  +CD  SD      YN                     P                     CGS+FA  YFI+FYM+C+FLIINLFVAVIMDNFDYLTRDWSILGPHHLDEF R+WSEYDPEAKGRIKHLDVVTLLR+I PPLGFGK CPHR AC  LV MNMPLNSDGTVMFNATLFALVRT LKIKT+G+ ++Q NEELR VIKKIWKRTS K+LDQVVPPAG+D+VTVGKFYATFLIQ++FR++K+++ E   G+  +Q+     +      +     +  I P +     CD +D    D++P       RR   +FG  +N +   G  RR      S+G   ++T+ P
Sbjct:  765 KISELVKKEKITPIPEGSAFFIFSNTNPVRVACHKLINHHIFTNLILVFIMLSSASLAAEDPIRNFSARNIVLGYADYVFTSMFTFEIVLKMTTYGAFLHKGAFCRNYFNLLDLLVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYRCNDEAKSSPEECKGTYIMYKEGDVNQPIIQKRHWHNSDFNFDNVLMAMMALFTVSTFEGWPALLYKAIDSNRENMGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKFWYVVNSTGFEYIMFVLILLNTICLAVQHYGQSELFNYVMDILNMVFTAVFTVEMVLKLIAFKPRHYFTDAWNTFDALIVVGSVVDIAITEVNPTEAPQVDESGNTEDSARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQVFGKIAMVDH---TQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACMPGKLCDPESD------YN---------------------PGEEMT----------------CGSSFAIIYFITFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTALKIKTEGN-LEQANEELRAVIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQDYFRKFKKRKEEGLVGVHPAQNNTAIAL------QAGLRTLHDIGPEIRRAISCDLQDDELVDFIPEEDEEIYRRNGGLFGNHINHIN--GDPRR------SSGHQTNATQRP 1626          

HSP 2 Score: 708.368 bits (1827), Expect = 0.000e+0
Identity = 396/718 (55.15%), Postives = 496/718 (69.08%), Query Frame = 1
Query:  943 AQIASGGRKRTPARSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSE---------------------GGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCY-SKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGGAHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVK--------SQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGS 3006
            AQ       ++  +  S N RPQRALFCL L NP R+ CI +VEWKPF+  IL  IFANC ALA   P+PE DSN+ N  LE +E  F++IFT E  LKI+A+G +MH  AY+RNGWN+LDF+IV+IGL S VL  +++                     GG DVKALRAFRVLRPLRLVSG+PSLQVV+NSI++AMVPL HIALL LFVIIIYAIIGLELF GK+H++CY    D++ + P PC+ +   G  C    +     +CK+       W GPN GIT+FDNF  AMLTVFQCITMEGWT ++YW+ND++G+  PW+YFVSL+I GSFFV+NLVLGVLSGEFSKEREKAK RG +QK RE+ Q +ED++GYLDWI  AEDI  + E + +E+ +           +SE         ++ ++ E E G    + ++   C P   +  +    R  R   RL +        S  FYW+VI+LVFLNT  ++SEHY Q +WL   Q+ AN + + +FT EML+KMYSLG++ YF  +FNRFD FVV   I E ++++ + M PLG+SV RC RLLR+FKVTR+W+SL NLV SLL SMKSI SLL+LLFLFI+IFSLLGMQ+FGGKFNFD+    RS FD+F Q+LLTVFQILTGEDWN VMYDGI +YG    S M+ C+Y++ILFICGNYILLNVFLAIAVDNLAD  S
Sbjct:   33 AQKKRAQYAKSKKQGSSANTRPQRALFCLNLNNPIRRACISLVEWKPFDIFILIAIFANCMALAVYVPFPEDDSNSTNHDLETVEYAFLIIFTIETFLKIIAYGLVMHQNAYVRNGWNMLDFVIVVIGLFSVVLEVLTKEGGEKEEVGENLSAHGHGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHASCYFQGTDILEDEPAPCAVN-GHGRTCPINGT-----LCKEG------WQGPNGGITNFDNFMFAMLTVFQCITMEGWTDVLYWMNDAMGLELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEEEESKRNPSM------PASE---------TESMNTENEKG----EDEKATCCGPTCQKISKSKFSRRWRRWNRLCRRNCRLAVKSVPFYWLVIILVFLNTLTISSEHYNQPMWLTQVQDVANKVLLAMFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVEFEIMSPLGISVFRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQVFGGKFNFDETQTKRSTFDNFPQALLTVFQILTGEDWNAVMYDGIMAYGGPSSSGMIVCIYFIILFICGNYILLNVFLAIAVDNLADAES 719          

HSP 3 Score: 119.398 bits (298), Expect = 6.420e-26
Identity = 105/337 (31.16%), Postives = 160/337 (47.48%), Query Frame = 1
Query: 1000 PRPQ-RALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIY---------FVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQ 1980
            P P+  A F  +  NP R  C K++    F  LIL  I  +  +LAA  P   R+ +  N  L   + VF  +FT E VLK+  +G  +H GA+ RN +NLLD L+V + L+S      S     VK LR  RVLRPLR ++    L+ V+  +  A+  + +I ++   +  ++A IG++LF GK     Y  ND    SP  C  +    Y+  D +             +   W   +    +FDN  +AM+ +F   T EGW  ++Y   DS   +   IY         F+  III +FF+MN+ +G +   F ++ EK  K  +  K + Q
Sbjct:  777 PIPEGSAFFIFSNTNPVRVACHKLINHHIFTNLILVFIMLSSASLAAEDPI--RNFSARNIVLGYADYVFTSMFTFEIVLKMTTYGAFLHKGAFCRNYFNLLDLLVVGVSLVS--FGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKF----YRCNDEAKSSPEECKGTYIM-YKEGDVNQPII---------QKRHWHNSDF---NFDNVLMAMMALFTVSTFEGWPALLYKAIDSNRENMGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQ 1092          

HSP 4 Score: 95.5153 bits (236), Expect = 9.861e-19
Identity = 72/256 (28.12%), Postives = 124/256 (48.44%), Query Frame = 1
Query: 4237 EEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSF--RYRVW---------WLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIM 4971
            E E  N E +K +    E A    P  + I K  F  R+R W           + S PF +++ +L+ LNT++++ +   QP    QV D  N V   +FT E L+K+ + G + YF   +N FD  +V G   + I       +        + I+ FR  R++R+ K+      +  L+ + + S +++  + LL+ +   I++++GMQ+FG     +E + K     + F  FPQA+L +F+  TGE W  +M
Sbjct:  429 ETESMNTENEKGED---EKATCCGPTCQKISKSKFSRRWRRWNRLCRRNCRLAVKSVPFYWLVIILVFLNTLTISSEHYNQPMWLTQVQDVANKVLLAMFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVEFEIMSP-------LGISVFRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQVFGGKFNFDETQTKR----STFDNFPQALLTVFQILTGEDWNAVM 670          

HSP 5 Score: 89.3521 bits (220), Expect = 7.219e-17
Identity = 68/263 (25.86%), Postives = 139/263 (52.85%), Query Frame = 1
Query: 2281 LVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQ--------------TDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPR-SNFDSFVQSLLTVFQILTGEDWNEVMYDGI-------RSYGNLGK----SSMLSCLYYVILFICGNYILLNVFLAIAVDNL 2991
            +V S  F +++ VL+ LNT  L  +HY QS   +   +  N++F  +FT+EM++K+ +   R YF   +N FD  +V+ S+++I + +              T+    + ++  R  R++R+ K+      +R L+ + + S +++  + +L+ +   I++++GMQ+FG     D     R +NF +F Q++L +F+  TGE W E+M   +        S  N G+     S  + +Y++  ++   ++++N+F+A+ +DN 
Sbjct: 1119 VVNSTGFEYIMFVLILLNTICLAVQHYGQSELFNYVMDILNMVFTAVFTVEMVLKLIAFKPRHYFTDAWNTFDALIVVGSVVDIAITEVNPTEAPQVDESGNTEDSARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQVFGKIAMVDHTQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACMPGKLCDPESDYNPGEEMTCGSSFAIIYFITFYMLCAFLIINLFVAVIMDNF 1381          

HSP 6 Score: 85.1149 bits (209), Expect = 1.424e-15
Identity = 77/327 (23.55%), Postives = 138/327 (42.20%), Query Frame = 1
Query: 1036 RNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEG-GPDVKA--------------LRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWI----------------NDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEF 1923
            +NP++     +V    FEY++   I  N   LA         S   N  ++ + +VF  +FT E VLK++AF     P  Y  + WN  D LIV+  ++   +++++    P V                 R FRV+R ++L+S    ++ ++ + +++   L ++ALL   +  IYA+IG+++F GK+          M++      T +N+                  N N              F  F  A+L +F+C T E W +IM                     + G S+  IYF++  ++ +F ++NL + V+   F
Sbjct: 1109 KNPYQYKFWYVVNSTGFEYIMFVLILLNTICLAVQH---YGQSELFNYVMDILNMVFTAVFTVEMVLKLIAF----KPRHYFTDAWNTFDALIVVGSVVDIAITEVNPTEAPQVDESGNTEDSARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQVF-GKI---------AMVD-----HTQINR------------------NNN--------------FQTFPQAVLLLFRCATGEAWQEIMLACMPGKLCDPESDYNPGEEMTCGSSFAIIYFITFYMLCAFLIINLFVAVIMDNF 1381          

HSP 7 Score: 77.7962 bits (190), Expect = 2.276e-13
Identity = 62/265 (23.40%), Postives = 116/265 (43.77%), Query Frame = 1
Query: 4360 LITSRPFEYIIFVLIMLNTISLALKF---DKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGF----KNYFSDAWNVFDFIIVLGSFIDIIYD------------HVNGTNNNHRGD-RLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMF-----------GKITTENEKEMKEINRN----------------------NNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAM 4995
            L+  +PF+  I + I  N ++LA+     +         ++ +   F  +FT+E  LK+ A+G       Y  + WN+ DF+IV+     ++ +              N + + H G      +   R FRV+R ++L+S    ++ +L + +K+   L ++ALL++ +  IYA+IG+++F           G    E+E     +N +                       NF  F  A+L +F+  T E W ++ L+ + DAM
Sbjct:   74 LVEWKPFDIFILIAIFANCMALAVYVPFPEDDSNSTNHDLETVEYAFLIIFTIETFLKIIAYGLVMHQNAYVRNGWNMLDFVIVVIGLFSVVLEVLTKEGGEKEEVGENLSAHGHGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHASCYFQGTDILEDEPAPCAVNGHGRTCPINGTLCKEGWQGPNGGITNFDNFMFAMLTVFQCITMEGWTDV-LYWMNDAM 337          

HSP 8 Score: 77.0258 bits (188), Expect = 4.456e-13
Identity = 79/299 (26.42%), Postives = 123/299 (41.14%), Query Frame = 1
Query: 3352 SFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPL--DAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPI--------------------NNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEF---MFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNK------------REWINNP----LNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIY 4125
            + F    NN  R+ C  +     F   +L+ I  +   LA   P   D  +S N  L   +Y F  +FT+E  LK+I YGLV H  A+ R+  N+LD ++V+  + S  +                     +        ++ LR  R LR +    G+  +   +   +K++  ++ +  L+ F   ++A+IG++LF GK           H SC  Q     E + A   VN             +E    P     NFDN   AMLT+F   T EGW  VLY   D+   +   +Y
Sbjct:   57 ALFCLNLNNPIRRACISLVEWKPFDIFILIAIFANCMALAVYVPFPEDDSNSTNHDLETVEYAFLIIFTIETFLKIIAYGLVMHQNAYVRNGWNMLDFVIVVIGLFSVVLEVLTKEGGEKEEVGENLSAHGHGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKM----------HASCYFQGTDILEDEPAPCAVNGHGRTCPINGTLCKEGWQGPNGGITNFDNFMFAMLTVFQCITMEGWTDVLYWMNDAMGLELPWVY 345          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Zebrafish
Match: cacna1c (calcium channel, voltage-dependent, L type, alpha 1C subunit [Source:ZFIN;Acc:ZDB-GENE-020129-1])

HSP 1 Score: 957.977 bits (2475), Expect = 0.000e+0
Identity = 542/948 (57.17%), Postives = 665/948 (70.15%), Query Frame = 1
Query: 3295 RRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTN---------------NNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRTHGRGSGPLI-SLISPTLVTTNECDEKDKDYL--PSHLGAERRTHSIFGTMMNVLQRVGSTRRDSNASPSTGSINHSTELPRDRSNSRPMILNQSKSP 6084
            R +S++  KEK  P+P A +FFIF P+NKFR  CH I NH  F N++L  I++SS  LAAEDP+  +S RN+IL Y DY+FT +FT+EI LK+  YG   H G+FCR+  NILDL+VV  S+IS  I + AI+VVKILRVLRVLRPLRAINRAKGLK VVQCV VA+++IGNI++VT LL+FMFA IGVQLF GKF  C D SK T   CRG YI Y + ++ K    +R W N+  NFD+V   M+ LFAVSTFEGWPG+LY++IDS  ED   IYN R ++SIF+I YII+IAFFM+NIFVGFVIVTFQ++GE+EYKNCELDKNQR+C+E+ALKA+P+RRYIPK  ++Y+VW+++ S  FEY++F LI+LNTI LA++   Q Q + + M+ LNM+FTG+FTVE +LKL AF  ++YF DAWN FD +IV+GS +DI    VN  +                N   +  ISI FFRLFRVMRLVKLLSRGEGIRTLLWTF+KSFQALPYVALLIVMLFFIYAVIGMQMFGKI     ++  +INRNNNFQTFPQA+L+LFR ATGEAWQ IML C P+  C+  S+                                          I+H  +   CGS+FA  YF+SFYM+C+FLIINLFVAVIMDNFDYLTRDWSILGPHHLDEF R+W+EYDPEAKGRIKHLDVVTLLR+I PPLGFGK CPHR AC  LV MNMPLNSDGTVMFNATLFALVRT L+IKT+G+ ++Q NEELR ++KKIWKRTS K+LDQVVPPAG+D+VTVGKFYATFLIQE+FR++K KR E+           LSL          GP I   IS  L    E +   K+ +   S     RR+  +FG  +N   +            S G ++     P+  +  RP+ +++S SP
Sbjct:  872 RPLSDIQLKEKAVPMPQAKAFFIFSPSNKFRVLCHKIVNHNIFTNLILFFILLSSISLAAEDPVKNDSFRNQILGYADYVFTGIFTIEIILKMTAYGAFLHKGSFCRNYFNILDLVVVSVSLISSGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTSLLQFMFACIGVQLFKGKFFYCTDTSKQTQAECRGAYILYKDGNVGKPEKAQRSWENSDFNFDDVLQGMMALFAVSTFEGWPGLLYRAIDSHAEDVGPIYNYRVVISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKVWYVVNSTYFEYLMFTLILLNTICLAMQHHGQSQSFNKAMNILNMLFTGLFTVEMILKLIAFKPRHYFVDAWNTFDALIVVGSVVDIAITEVNPADPSSSPPSSVVRPMGLQNTEDNARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIAL---RDNSQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACSPNRPCEKGSE------------------------------------------INHSSE--DCGSHFAIFYFVSFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGN-LEQANEELRAIVKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFK-KRKEQGLVAKIPPKTALSLQAGLRTLHDMGPEIRRAISGDLTVEEELERAMKETVCAASEDDIFRRSGGLFGNHVNYYHQ------------SDGHVS----FPQSFTTQRPLHISKSGSP 1754          

HSP 2 Score: 720.309 bits (1858), Expect = 0.000e+0
Identity = 405/691 (58.61%), Postives = 500/691 (72.36%), Query Frame = 1
Query:  982 RSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEG-----------GPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCY-----SKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGGAHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGS 3006
            ++ + + RP RAL CLTL+NP R+ CI IVEWKPFE +IL TIFANC ALA   P+PE DSN  NS LE++E +F++IFT E  LK++A+G + HP AYLRNGWNLLDF+IV++GL S +L + ++G           G DVKALRAFRVLRPLRLVSG+PSLQVV+NSI++AMVPL HIALL LFVIIIYAIIGLELF GK+H TC+      K  +  E P PC+ S   G  C   + +     C         W GPN GIT+FDNF  AMLTVFQCITMEGWT ++YW+ D++G   PW+YFVSL+I GSFFV+NLVLGVLSGEFSKEREKAK RG +QK RE+ Q +ED++GYLDWI  AEDI  + +++G ++ K     +     S  +S + D+  +  ++ ET      ++  +  F     SR  R+WNR CRR CR  VKS  FYW+VI LVFLNT  + SEH++Q  WL + Q+ AN + + LFT EML+KMYSLG++ YF  +FNRFD FVV   ILE ++++T  M PLG+SVLRC RLLR+FK+TRYW+SL NLV SLL S++SI SLL+LLFLFI+IFSLLGMQLFGGKFNFD+    RS FD+F QSLLTVFQILTGEDWN VMYDGI +YG      ML C+Y++ILFICGNYILLNVFLAIAVDNLAD  S
Sbjct:  102 QASTASTRPPRALLCLTLKNPIRRACINIVEWKPFEIIILMTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLCHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKGDGGTSMGGKAAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHRTCFFYKDGHKGHIAEEKPAPCAPSSAHGRHCSPPNIT----QCMMG------WEGPNDGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENDDEGLDDDKPRNLSMPA---SENESVNTDNAPAGDMEGETCCTRMANRISKSKF-----SRYSRRWNRLCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHHQQPEWLTNVQDIANKVLLALFTGEMLLKMYSLGLQAYFVSLFNRFDSFVVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETR--RSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAES 772          

HSP 3 Score: 105.145 bits (261), Expect = 1.411e-21
Identity = 99/345 (28.70%), Postives = 160/345 (46.38%), Query Frame = 1
Query: 1000 PRPQ-RALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLD-----FLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKD---NKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLI---------IIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQ 1980
            P PQ +A F  +  N FR  C KIV    F  LILF I  +  +LAA  P   ++ +  N  L   + VF  IFT E +LK+ A+G  +H G++ RN +N+LD       ++  G+ S+ ++        VK LR  RVLRPLR ++    L+ V+  +  A+  + +I ++   +  ++A IG++LF GK     +   D   ++   C                G   + KD    K E ++ S  N    +FD+    M+ +F   T EGW  ++Y   DS       IY   ++         II +FF+MN+ +G +   F ++ E+  K  +  K + Q
Sbjct:  885 PMPQAKAFFIFSPSNKFRVLCHKIVNHNIFTNLILFFILLSSISLAAEDPV--KNDSFRNQILGYADYVFTGIFTIEIILKMTAYGAFLHKGSFCRNYFNILDLVVVSVSLISSGIQSSAINV-------VKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTSLLQFMFACIGVQLFKGKF----FYCTDTSKQTQAEC---------------RGAYILYKDGNVGKPEKAQRSWENSDF-NFDDVLQGMMALFAVSTFEGWPGLLYRAIDSHAEDVGPIYNYRVVISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQ 1200          

HSP 4 Score: 87.8113 bits (216), Expect = 2.508e-16
Identity = 56/203 (27.59%), Postives = 105/203 (51.72%), Query Frame = 1
Query: 4363 ITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIM 4971
            + S  F +++  L+ LNT+++A +  +QP+    V D  N V   +FT E LLK+ + G + YF   +N FD  +V G  ++ I       +        + I+  R  R++R+ K+      +  L+ + + S +++  + LL+ +   I++++GMQ+FG     +E       R + F  FPQ++L +F+  TGE W ++M
Sbjct:  534 VKSNVFYWLVIFLVFLNTLTIASEHHQQPEWLTNVQDIANKVLLALFTGEMLLKMYSLGLQAYFVSLFNRFDSFVVCGGILETILVETKIMSP-------LGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDE------TRRSTFDNFPQSLLTVFQILTGEDWNSVM 723          

HSP 5 Score: 86.6557 bits (213), Expect = 5.476e-16
Identity = 66/261 (25.29%), Postives = 115/261 (44.06%), Query Frame = 1
Query: 4360 LITSRPFEYIIFVLIMLNTISLALKF---DKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGF----KNYFSDAWNVFDFIIVL-GSFIDIIYDHVNGTNNNHRGDRL--ISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMF----------------GKITTENEKEMKEINRN-----------------------NNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAM 4995
            ++  +PFE II + I  N ++LA+     +         ++ +  +F  +FTVE  LK+ A+G       Y  + WN+ DFIIV+ G F  I+     G      G +     +   R FRV+R ++L+S    ++ +L + +K+   L ++ALL++ +  IYA+IG+++F                G I  E        + +                        NF  F  A+L +F+  T E W ++ L+ + DAM
Sbjct:  130 IVEWKPFEIIILMTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLCHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKGDGGTSMGGKAAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHRTCFFYKDGHKGHIAEEKPAPCAPSSAHGRHCSPPNITQCMMGWEGPNDGITNFDNFAFAMLTVFQCITMEGWTDV-LYWMQDAM 389          

HSP 6 Score: 82.0333 bits (201), Expect = 1.378e-14
Identity = 76/334 (22.75%), Postives = 137/334 (41.02%), Query Frame = 1
Query: 1036 RNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGP-----------------------DVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYW------------INDS---VGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEF 1923
            +NP++     +V    FEYL+   I  N   LA         S + N A+  + ++F  +FT E +LK++AF     P  Y  + WN  D LIV+  ++   +++++   P                        +   R FRV+R ++L+S    ++ ++ + +++   L ++ALL + +  IYA+IG+++F GK+                                    +   + N+N             +F  F  A+L +F+C T E W +IM              IN S    G  +   YFVS  ++ +F ++NL + V+   F
Sbjct: 1217 KNPYQYKVWYVVNSTYFEYLMFTLILLNTICLAMQH---HGQSQSFNKAMNILNMLFTGLFTVEMILKLIAF----KPRHYFVDAWNTFDALIVVGSVVDIAITEVNPADPSSSPPSSVVRPMGLQNTEDNARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMF-GKI----------------------------------ALRDNSQINRN------------NNFQTFPQAVLLLFRCATGEAWQEIMLACSPNRPCEKGSEINHSSEDCGSHFAIFYFVSFYMLCAFLIINLFVAVIMDNF 1496          

HSP 7 Score: 81.6481 bits (200), Expect = 1.864e-14
Identity = 77/280 (27.50%), Postives = 124/280 (44.29%), Query Frame = 1
Query: 3376 NKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPL--DAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVL----TSIISYPINNDAISXXXXXXXXXXXXXXXA------INRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEF---MFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKR--------------EWINNPL-NFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIY 4125
            N  R+ C  I     F  I+L+ I  +   LA   P   D  ++ N  L   +YLF  +FTVE  LKVI YGL+ H  A+ R+  N+LD ++V+    ++I+      D  + +        ++ LRA      +    G+  +   +   +K++  ++ +  L+ F   ++A+IG++LF GK        K+ H   +G       A  A    + R              E  N+ + NFDN   AMLT+F   T EGW  VLY   D+   +   +Y
Sbjct:  121 NPIRRACINIVEWKPFEIIILMTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLCHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKGDGGTSMGGKAAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHRTCFFYKDGH---KGHIAEEKPAPCAPSSAHGRHCSPPNITQCMMGWEGPNDGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVY 397          

HSP 8 Score: 80.4925 bits (197), Expect = 3.649e-14
Identity = 67/270 (24.81%), Postives = 137/270 (50.74%), Query Frame = 1
Query: 2281 LVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTD-----------AMPPLG-----------VSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPR-SNFDSFVQSLLTVFQILTGEDWNEVMY----------DGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNL 2991
            +V S  F +++  L+ LNT  L  +H+ QS   +   N  N++F  LFT+EM++K+ +   R YF   +N FD  +V+ S+++I + + +            + P+G           ++  R  R++R+ K+      +R L+ + + S +++  + +L+ +   I++++GMQ+FG     D     R +NF +F Q++L +F+  TGE W E+M               ++ +    S  +  Y+V  ++   ++++N+F+A+ +DN 
Sbjct: 1227 VVNSTYFEYLMFTLILLNTICLAMQHHGQSQSFNKAMNILNMLFTGLFTVEMILKLIAFKPRHYFVDAWNTFDALIVVGSVVDIAITEVNPADPSSSPPSSVVRPMGLQNTEDNARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIALRDNSQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACSPNRPCEKGSEINHSSEDCGSHFAIFYFVSFYMLCAFLIINLFVAVIMDNF 1496          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Zebrafish
Match: cacna1c (calcium channel, voltage-dependent, L type, alpha 1C subunit [Source:ZFIN;Acc:ZDB-GENE-020129-1])

HSP 1 Score: 952.584 bits (2461), Expect = 0.000e+0
Identity = 546/977 (55.89%), Postives = 667/977 (68.27%), Query Frame = 1
Query: 3295 RRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVN--------------------------------------------GTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRTHGRGSGPLI-SLISPTLVTTNECDEKDKDYL--PSHLGAERRTHSIFGTMMNVLQRVGSTRRDSNASPSTGSINHSTELPRDRSNSRPMILNQSKSP 6084
            R +S++  KEK  P+P A +FFIF P+NKFR  CH I NH  F N++L  I++SS  LAAEDP+  +S RN+IL Y DY+FT +FT+EI LK+  YG   H G+FCR+  NILDL+VV  S+IS  I + AI+VVKILRVLRVLRPLRAINRAKGLK VVQCV VA+++IGNI++VT LL+FMFA IGVQLF GKF  C D SK T   CRG YI Y + ++ K    +R W N+  NFD+V   M+ LFAVSTFEGWPG+LY++IDS  ED   IYN R ++SIF+I YII+IAFFM+NIFVGFVIVTFQ++GE+EYKNCELDKNQR+C+E+ALKA+P+RRYIPK  ++Y+VW+++ S  FEY++F LI+LNTI LA++   Q Q + + M+ LNM+FTG+FTVE +LKL AF  + YFSD WNVFDF+IV+GS ID+I   +N                                            G  N     R ISI FFRLFRVMRLVKLLSRGEGIRTLLWTF+KSFQALPYVALLIVMLFFIYAVIGMQMFGKI     ++  +INRNNNFQTFPQA+L+LFR ATGEAWQ IML C P+  C+  S+                                          I+H  +   CGS+FA  YF+SFYM+C+FLIINLFVAVIMDNFDYLTRDWSILGPHHLDEF R+W+EYDPEAKGRIKHLDVVTLLR+I PPLGFGK CPHR AC  LV MNMPLNSDGTVMFNATLFALVRT L+IKT+G+ ++Q NEELR ++KKIWKRTS K+LDQVVPPAG+D+VTVGKFYATFLIQE+FR++K KR E+           LSL          GP I   IS  L    E +   K+ +   S     RR+  +FG  +N   +            S G ++     P+  +  RP+ +++S SP
Sbjct:  872 RPLSDIQLKEKAVPMPQAKAFFIFSPSNKFRVLCHKIVNHNIFTNLILFFILLSSISLAAEDPVKNDSFRNQILGYADYVFTGIFTIEIILKMTAYGAFLHKGSFCRNYFNILDLVVVSVSLISSGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTSLLQFMFACIGVQLFKGKFFYCTDTSKQTQAECRGAYILYKDGNVGKPEKAQRSWENSDFNFDDVLQGMMALFAVSTFEGWPGLLYRAIDSHAEDVGPIYNYRVVISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKVWYVVNSTYFEYLMFTLILLNTICLAMQHHGQSQSFNKAMNILNMLFTGLFTVEMILKLIAFKPRGYFSDPWNVFDFLIVIGSIIDVILSEINHYFVDAWNTFDALIVVGSVVDIAITEVNPADPSSSPPSSVVRPMGLQNTEDNAR-ISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIAL---RDNSQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACSPNRPCEKGSE------------------------------------------INHSSE--DCGSHFAIFYFVSFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGN-LEQANEELRAIVKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFK-KRKEQGLVAKIPPKTALSLQAGLRTLHDMGPEIRRAISGDLTVEEELERAMKETVCAASEDDIFRRSGGLFGNHVNYYHQ------------SDGHVS----FPQSFTTQRPLHISKSGSP 1782          

HSP 2 Score: 719.153 bits (1855), Expect = 0.000e+0
Identity = 405/691 (58.61%), Postives = 500/691 (72.36%), Query Frame = 1
Query:  982 RSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEG-----------GPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCY-----SKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGGAHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGS 3006
            ++ + + RP RAL CLTL+NP R+ CI IVEWKPFE +IL TIFANC ALA   P+PE DSN  NS LE++E +F++IFT E  LK++A+G + HP AYLRNGWNLLDF+IV++GL S +L + ++G           G DVKALRAFRVLRPLRLVSG+PSLQVV+NSI++AMVPL HIALL LFVIIIYAIIGLELF GK+H TC+      K  +  E P PC+ S   G  C   + +     C         W GPN GIT+FDNF  AMLTVFQCITMEGWT ++YW+ D++G   PW+YFVSL+I GSFFV+NLVLGVLSGEFSKEREKAK RG +QK RE+ Q +ED++GYLDWI  AEDI  + +++G ++ K     +     S  +S + D+  +  ++ ET      ++  +  F     SR  R+WNR CRR CR  VKS  FYW+VI LVFLNT  + SEH++Q  WL + Q+ AN + + LFT EML+KMYSLG++ YF  +FNRFD FVV   ILE ++++T  M PLG+SVLRC RLLR+FK+TRYW+SL NLV SLL S++SI SLL+LLFLFI+IFSLLGMQLFGGKFNFD+    RS FD+F QSLLTVFQILTGEDWN VMYDGI +YG      ML C+Y++ILFICGNYILLNVFLAIAVDNLAD  S
Sbjct:  102 QASTASTRPPRALLCLTLKNPIRRACINIVEWKPFEIIILMTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLCHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKGDGGTSMGGKAAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHRTCFFYKDGHKGHIAEEKPAPCAPSSAHGRHCSPPNIT----QCMMG------WEGPNDGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENDDEGLDDDKPRNLSMPA---SENESVNTDNAPAGDMEGETCCTRMANRISKSKF-----SRYSRRWNRLCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHHQQPEWLTNVQDIANKVLLALFTGEMLLKMYSLGLQAYFVSLFNRFDSFVVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETR--RSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAES 772          

HSP 3 Score: 104.76 bits (260), Expect = 1.620e-21
Identity = 99/345 (28.70%), Postives = 160/345 (46.38%), Query Frame = 1
Query: 1000 PRPQ-RALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLD-----FLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKD---NKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLI---------IIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQ 1980
            P PQ +A F  +  N FR  C KIV    F  LILF I  +  +LAA  P   ++ +  N  L   + VF  IFT E +LK+ A+G  +H G++ RN +N+LD       ++  G+ S+ ++        VK LR  RVLRPLR ++    L+ V+  +  A+  + +I ++   +  ++A IG++LF GK     +   D   ++   C                G   + KD    K E ++ S  N    +FD+    M+ +F   T EGW  ++Y   DS       IY   ++         II +FF+MN+ +G +   F ++ E+  K  +  K + Q
Sbjct:  885 PMPQAKAFFIFSPSNKFRVLCHKIVNHNIFTNLILFFILLSSISLAAEDPV--KNDSFRNQILGYADYVFTGIFTIEIILKMTAYGAFLHKGSFCRNYFNILDLVVVSVSLISSGIQSSAINV-------VKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTSLLQFMFACIGVQLFKGKF----FYCTDTSKQTQAEC---------------RGAYILYKDGNVGKPEKAQRSWENSDF-NFDDVLQGMMALFAVSTFEGWPGLLYRAIDSHAEDVGPIYNYRVVISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQ 1200          

HSP 4 Score: 87.4261 bits (215), Expect = 2.876e-16
Identity = 56/203 (27.59%), Postives = 105/203 (51.72%), Query Frame = 1
Query: 4363 ITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIM 4971
            + S  F +++  L+ LNT+++A +  +QP+    V D  N V   +FT E LLK+ + G + YF   +N FD  +V G  ++ I       +        + I+  R  R++R+ K+      +  L+ + + S +++  + LL+ +   I++++GMQ+FG     +E       R + F  FPQ++L +F+  TGE W ++M
Sbjct:  534 VKSNVFYWLVIFLVFLNTLTIASEHHQQPEWLTNVQDIANKVLLALFTGEMLLKMYSLGLQAYFVSLFNRFDSFVVCGGILETILVETKIMSP-------LGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDE------TRRSTFDNFPQSLLTVFQILTGEDWNSVM 723          

HSP 5 Score: 86.2705 bits (212), Expect = 6.495e-16
Identity = 66/261 (25.29%), Postives = 115/261 (44.06%), Query Frame = 1
Query: 4360 LITSRPFEYIIFVLIMLNTISLALKF---DKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGF----KNYFSDAWNVFDFIIVL-GSFIDIIYDHVNGTNNNHRGDRL--ISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMF----------------GKITTENEKEMKEINRN-----------------------NNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAM 4995
            ++  +PFE II + I  N ++LA+     +         ++ +  +F  +FTVE  LK+ A+G       Y  + WN+ DFIIV+ G F  I+     G      G +     +   R FRV+R ++L+S    ++ +L + +K+   L ++ALL++ +  IYA+IG+++F                G I  E        + +                        NF  F  A+L +F+  T E W ++ L+ + DAM
Sbjct:  130 IVEWKPFEIIILMTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLCHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKGDGGTSMGGKAAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHRTCFFYKDGHKGHIAEEKPAPCAPSSAHGRHCSPPNITQCMMGWEGPNDGITNFDNFAFAMLTVFQCITMEGWTDV-LYWMQDAM 389          

HSP 6 Score: 81.2629 bits (199), Expect = 2.210e-14
Identity = 77/280 (27.50%), Postives = 124/280 (44.29%), Query Frame = 1
Query: 3376 NKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPL--DAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVL----TSIISYPINNDAISXXXXXXXXXXXXXXXA------INRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEF---MFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKR--------------EWINNPL-NFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIY 4125
            N  R+ C  I     F  I+L+ I  +   LA   P   D  ++ N  L   +YLF  +FTVE  LKVI YGL+ H  A+ R+  N+LD ++V+    ++I+      D  + +        ++ LRA      +    G+  +   +   +K++  ++ +  L+ F   ++A+IG++LF GK        K+ H   +G       A  A    + R              E  N+ + NFDN   AMLT+F   T EGW  VLY   D+   +   +Y
Sbjct:  121 NPIRRACINIVEWKPFEIIILMTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLCHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKGDGGTSMGGKAAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHRTCFFYKDGH---KGHIAEEKPAPCAPSSAHGRHCSPPNITQCMMGWEGPNDGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVY 397          

HSP 7 Score: 80.8777 bits (198), Expect = 2.726e-14
Identity = 82/362 (22.65%), Postives = 141/362 (38.95%), Query Frame = 1
Query: 1036 RNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKM-------------------------SEGGP--------------------------DVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYW------------INDS---VGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEF 1923
            +NP++     +V    FEYL+   I  N   LA         S + N A+  + ++F  +FT E +LK++AF     P  Y  + WN+ DFLIVI  +I  +LS++                         +E  P                           +   R FRV+R ++L+S    ++ ++ + +++   L ++ALL + +  IYA+IG+++F GK+                                    +   + N+N             +F  F  A+L +F+C T E W +IM              IN S    G  +   YFVS  ++ +F ++NL + V+   F
Sbjct: 1217 KNPYQYKVWYVVNSTYFEYLMFTLILLNTICLAMQH---HGQSQSFNKAMNILNMLFTGLFTVEMILKLIAF----KPRGYFSDPWNVFDFLIVIGSIIDVILSEINHYFVDAWNTFDALIVVGSVVDIAITEVNPADPSSSPPSSVVRPMGLQNTEDNARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMF-GKI----------------------------------ALRDNSQINRN------------NNFQTFPQAVLLLFRCATGEAWQEIMLACSPNRPCEKGSEINHSSEDCGSHFAIFYFVSFYMLCAFLIINLFVAVIMDNF 1524          

HSP 8 Score: 70.4774 bits (171), Expect = 4.680e-11
Identity = 71/298 (23.83%), Postives = 140/298 (46.98%), Query Frame = 1
Query: 2281 LVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQ--------------------------TDAMP-------------PLG-----------VSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSN-FDSFVQSLLTVFQILTGEDWNEVMY----------DGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNL 2991
            +V S  F +++  L+ LNT  L  +H+ QS   +   N  N++F  LFT+EM++K+ +   R YF   +N FDF +VI SI+++++ +                          T+  P             P+G           ++  R  R++R+ K+      +R L+ + + S +++  + +L+ +   I++++GMQ+FG     D     R+N F +F Q++L +F+  TGE W E+M               ++ +    S  +  Y+V  ++   ++++N+F+A+ +DN 
Sbjct: 1227 VVNSTYFEYLMFTLILLNTICLAMQHHGQSQSFNKAMNILNMLFTGLFTVEMILKLIAFKPRGYFSDPWNVFDFLIVIGSIIDVILSEINHYFVDAWNTFDALIVVGSVVDIAITEVNPADPSSSPPSSVVRPMGLQNTEDNARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIALRDNSQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACSPNRPCEKGSEINHSSEDCGSHFAIFYFVSFYMLCAFLIINLFVAVIMDNF 1524          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Xenopus
Match: CACNA1C (calcium channel, voltage-dependent, L type, alpha 1C subunit [Source:NCBI gene;Acc:100488055])

HSP 1 Score: 1663.66 bits (4307), Expect = 0.000e+0
Identity = 979/1778 (55.06%), Postives = 1208/1778 (67.94%), Query Frame = 1
Query:  916 LNLAALTLSAQIASGGRKRTPARSQ-----SGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEG-----------GPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCY----SKNDVMMES-PVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGG---AHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSXXXXXXXXXXXXXXXP-TNVDGEEAKACNSS---NVSPNIDEKTRFTDAERLIKSEEM--NGDIADESMRKMSTRIDTXXXXXXXXXXXXXXXXXNGQTSAIRR-VSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNG--TNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRTHGRGSGPLI-SLISPTLVTTNECDEKDKDYLPSHLGAE--RRTHSIFGTMMNVLQRVGSTRRDSNASPSTGSINHSTELPRDRSNSRPMILNQSK-------SPTNHPPVKLTLAP 6120
            +  AA    + ++S  RKR     Q     +   RP RAL CLTL+NP R+ CI IVEWKPFE +IL TIFANC ALA   P+PE DSN  NS LE++E +F++IFT E  LK++A+G + HP AYLRNGWNLLDF+IV++GL S +L + ++            G DVKALRAFRVLRPLRLVSG+PSLQVV+NSI++AMVPL HIALL LFVIIIYAIIGLELF GK+H TCY       DV+ E  P PC+   N G  C +        +C+      S W GP  GIT+FDNF  AMLTVFQCITMEGWT ++YW+ D++G   P +YFVSL+I GSFFV+NLVLGVLSGEFSKEREKAK RG +QK RE+ Q +ED++GYLDWI  AEDI  + E++  +  K     +     +SE      D +      E   G   AH   + ++       SR  R+WNR CRR CR  VKS  FYW+VI LVFLNT  + SEHY Q  WL   Q+TAN + + LFT EML+KMYSLG++ YF  +FNRFD F+V   ILE ++++T  M PLG+SVLRC RLLR+FK+TRYW+SL NLV SLL S++SI SLL+LLFLFI+IFSLLGMQLFGGKFNFD+    RS FD+F Q+LLTVFQILTGEDWN VMYDGI +YG      ML C+Y++ILFICGNYILLNVFLAIAVDNLAD  S    +K+E E +E +        E K  N S   +  P ++E     + + +    E   N  I+ E          T   +  E    +EE+E         R +SE+  KEK  P+P AS+FF+F  +N+FR  CH I N+  F N++L  I++SS  LAAEDP+   S RN++L YFD +FT++FTVEI LK+  YG   H G+FCR+  NILDLLVV  S+IS+ I + AI+VVKILRVLRVLRPLRAINRAKGLK VVQCV VA+++IGNI++VT LL+FMFA IGVQLF GK  SC D SK T   C+G+YI Y + D+++  +  R W N+  +FDNV +AM+ LF VSTFEGWP +LY++IDS  ED   IYN+R  +SIF+I YII+IAFFM+NIFVGFVIVTFQ++GE+EYKNCELDKNQR+C+E+ALKA+P+RRYIPK  ++Y+VW+++ S  FEY++FVLI+LNTI LA++   Q   +++ M+ LNM+FTG+FTVE +LKL AF  K YFSD WNVFDF+IV+GS +D+I    N   +  N   +  ISI FFRLFRVMRLVKLLSRGEGIRTLLWTF+KSFQALPYVALLIVMLFFIYAVIGMQ+FGKI      +  EINRNNNFQTFPQA+L+LFR ATGEAWQ IML CLP   C   S+   +                                              KCGS+FA  YFISFYM+C+FLIINLFVAVIMDNFDYLTRDWSILGPHHLDEF R+W+EYDPEAKGRIKHLDVVTLLR+I PPLGFGK CPHR AC  LV MNMPLNSDGTVMFNATLFALVRT+L IKTDG+ ++Q NEELR +IKKIWKRTS K+LDQVVPPAG+D+VTVGKFYATFLIQE+FR++K+++ +   G   SQ   LSL          GP I   IS  L    E D+  K+ + +    +  RR   +FG  +   Q   S  R +               P+  +  RP+ +N++        SP++   V  T  P
Sbjct:   72 MGAAANATISTVSSTQRKRQQYSKQKKQGTTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGGSAIGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYYLTNGYPDVLTEEEPSPCALESNNGRHCPN------GTLCR------SGWVGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPCVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEDIDEEKPRNMSM----PTSETESVNTDNVGSGDVEEESCGVRLAHRISKSKF-------SRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPDWLTEVQDTANKVLLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETRIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMLTRRSTFDNFPQALLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQENESLGKSPVPAVEENKEKIELKAITADGESPPNTKISVEEFSTNENEEKTPYPSSNETPGEEEEEEPEMPVGPRPRPLSELHIKEKAAPMPEASAFFVFRSDNRFRVHCHRIVNNNIFTNLILFFILLSSISLAAEDPVRHNSFRNQVLFYFDIVFTAIFTVEIVLKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYSCTDSSKITEAECKGKYITYKDGDVSQPMIVDRSWENSKFDFDNVLSAMMALFTVSTFEGWPELLYRAIDSHTEDVGPIYNHRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQYQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCSFKEAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSVVDVILSETNVSISGQNVEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIAL---NDTTEINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPSKPCAPESETSEE----------------------------------------------KCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTSLCIKTDGN-LEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKP-SQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVGYYQ---SEVRSA--------------FPQTFTTQRPLHINKTSGGPGDLDSPSHEKLVDSTFTP 1758          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Xenopus
Match: CACNA1C (calcium channel, voltage-dependent, L type, alpha 1C subunit [Source:NCBI gene;Acc:100488055])

HSP 1 Score: 1654.03 bits (4282), Expect = 0.000e+0
Identity = 978/1792 (54.58%), Postives = 1209/1792 (67.47%), Query Frame = 1
Query:  916 LNLAALTLSAQIASGGRKRTPARSQ-----SGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEG-----------GPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCY----SKNDVMMES-PVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGG---AHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSXXXXXXXXXXXXXXXP-TNVDGEEAKACNSS---NVSPNIDEKTRFTDAERLIKSEEM--NGDIADESMRKMSTRIDTXXXXXXXXXXXXXXXXXNGQTSAIRR-VSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTN---NNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGST-------------VDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRTHGRGSGPLI-SLISPTLVTTNECDEKDKDYLPSHLGAE--RRTHSIFGTMMNVLQRVGSTRRDSNASPSTGSINHSTELPRDRSNSRPMILNQSK-------SPTNHPPVKLTLAP 6120
            +  AA    + ++S  RKR     Q     +   RP RAL CLTL+NP R+ CI IVEWKPFE +IL TIFANC ALA   P+PE DSN  NS LE++E +F++IFT E  LK++A+G + HP AYLRNGWNLLDF+IV++GL S +L + ++            G DVKALRAFRVLRPLRLVSG+PSLQVV+NSI++AMVPL HIALL LFVIIIYAIIGLELF GK+H TCY       DV+ E  P PC+   N G  C +        +C+      S W GP  GIT+FDNF  AMLTVFQCITMEGWT ++YW+ D++G   P +YFVSL+I GSFFV+NLVLGVLSGEFSKEREKAK RG +QK RE+ Q +ED++GYLDWI  AEDI  + E++  +  K     +     +SE      D +      E   G   AH   + ++       SR  R+WNR CRR CR  VKS  FYW+VI LVFLNT  + SEHY Q  WL   Q+TAN + + LFT EML+KMYSLG++ YF  +FNRFD F+V   ILE ++++T  M PLG+SVLRC RLLR+FK+TRYW+SL NLV SLL S++SI SLL+LLFLFI+IFSLLGMQLFGGKFNFD+    RS FD+F Q+LLTVFQILTGEDWN VMYDGI +YG      ML C+Y++ILFICGNYILLNVFLAIAVDNLAD  S    +K+E E +E +        E K  N S   +  P ++E     + + +    E   N  I+ E          T   +  E    +EE+E         R +SE+  KEK  P+P AS+FF+F  +N+FR  CH I N+  F N++L  I++SS  LAAEDP+   S RN+IL   DY+FTS+FT+EI LK+  YG   H G+FCR+  NILDLLVV  S+IS+ I + AI+VVKILRVLRVLRPLRAINRAKGLK VVQCV VA+++IGNI++VT LL+FMFA IGVQLF GK  SC D SK T   C+G+YI Y + D+++  +  R W N+  +FDNV +AM+ LF VSTFEGWP +LY++IDS  ED   IYN+R  +SIF+I YII+IAFFM+NIFVGFVIVTFQ++GE+EYKNCELDKNQR+C+E+ALKA+P+RRYIPK  ++Y+VW+++ S  FEY++FVLI+LNTI LA++   Q   +++ M+ LNM+FTG+FTVE +LKL AF  K+YF DAWN FD +IV+GS +DI    +N +N   +N   +  ISI FFRLFRVMRLVKLLSRGEGIRTLLWTF+KSFQALPYVALLIVMLFFIYAVIGMQ+FGKI      +  EINRNNNFQTFPQA+L+LFR ATGEAWQ IML CLP   C   S+   +                                              KCGS+FA  YFISFYM+C+FLIINLFVAVIMDNFDYLTRDWSILGPHHLDEF R+W+EYDPEAKGRIKHLDVVTLLR+I PPLGFGK CPHR AC  LV MNMPLNSDGTVMFNATLFALVRT+L IKTDG++             ++Q NEELR +IKKIWKRTS K+LDQVVPPAG+D+VTVGKFYATFLIQE+FR++K+++ +   G   SQ   LSL          GP I   IS  L    E D+  K+ + +    +  RR   +FG  +   Q   S  R +               P+  +  RP+ +N++        SP++   V  T  P
Sbjct:   71 MGAAANATISTVSSTQRKRQQYSKQKKQGTTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGGSAIGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYYLTNGYPDVLTEEEPSPCALESNNGRHCPN------GTLCR------SGWVGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPCVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEDIDEEKPRNMSM----PTSETESVNTDNVGSGDVEEESCGVRLAHRISKSKF-------SRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPDWLTEVQDTANKVLLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETRIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMLTRRSTFDNFPQALLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQENESLGKSPVPAVEENKEKIELKAITADGESPPNTKISVEEFSTNENEEKTPYPSSNETPGEEEEEEPEMPVGPRPRPLSELHIKEKAAPMPEASAFFVFRSDNRFRVHCHRIVNNNIFTNLILFFILLSSISLAAEDPVRHNSFRNQILGNADYVFTSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYSCTDSSKITEAECKGKYITYKDGDVSQPMIVDRSWENSKFDFDNVLSAMMALFTVSTFEGWPELLYRAIDSHTEDVGPIYNHRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQYQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCSFKEAMNILNMLFTGLFTVEMILKLIAFKPKHYFCDAWNTFDALIVVGSIVDIAITELNVSNPRLSNVEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIAL---NDTTEINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPSKPCAPESETSEE----------------------------------------------KCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTSLCIKTDGNSLLLLFACQIFSWNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKP-SQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVGYYQ---SEVRSA--------------FPQTFTTQRPLHINKTSGGPGDLDSPSHEKLVDSTFTP 1772          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Xenopus
Match: CACNA1C (calcium channel, voltage-dependent, L type, alpha 1C subunit [Source:NCBI gene;Acc:100488055])

HSP 1 Score: 1653.65 bits (4281), Expect = 0.000e+0
Identity = 976/1790 (54.53%), Postives = 1209/1790 (67.54%), Query Frame = 1
Query:  916 LNLAALTLSAQIASGGRKRTPARSQ-----SGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEG-----------GPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCY----SKNDVMMES-PVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGG---AHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNL--ADTGSXXXXXXXXXXXXXXXPTNVDGEEAKACNSSNVSP---------NIDEKTRFTDAER----LIKSEEMNGDIADESMRKMSTRIDTXXXXXXXXXXXXXXXXXNGQTSAIRRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTN------NNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRTHGRGSGPLI-SLISPTLVTTNECDEKDKDYLPSHLGAE--RRTHSIFGTMMNVLQRVGSTRRDSNASPSTGSINHSTELPRDRSNSRPMILNQSK-------SPTNHPPVKLTLAP 6120
            +  AA    + ++S  RKR     Q     +   RP RAL CLTL+NP R+ CI IVEWKPFE +IL TIFANC ALA   P+PE DSN  NS LE++E +F++IFT E  LK++A+G + HP AYLRNGWNLLDF+IV++GL S +L + ++            G DVKALRAFRVLRPLRLVSG+PSLQVV+NSI++AMVPL HIALL LFVIIIYAIIGLELF GK+H TCY       DV+ E  P PC+   N G  C +        +C+      S W GP  GIT+FDNF  AMLTVFQCITMEGWT ++YW+ D++G   P +YFVSL+I GSFFV+NLVLGVLSGEFSKEREKAK RG +QK RE+ Q +ED++GYLDWI  AEDI  + E++  +  K     +     +SE      D +      E   G   AH   + ++       SR  R+WNR CRR CR  VKS  FYW+VI LVFLNT  + SEHY Q  WL   Q+TAN + + LFT EML+KMYSLG++ YF  +FNRFD F+V   ILE ++++T  M PLG+SVLRC RLLR+FK+TRYW+SL NLV SLL S++SI SLL+LLFLFI+IFSLLGMQLFGGKFNFD+    RS FD+F Q+LLTVFQILTGEDWN VMYDGI +YG      ML C+Y++ILFICGNYILLNVFLAIAVDNL  A++ +  ++E++E +  +        E+ +   S   SP          I+ K    D E      I  EE + +  +E     S+     +E +EE                 R +SE+  KEK  P+P AS+FF+F  +N+FR  CH I N+  F N++L  I++SS  LAAEDP+   S RN++L YFD +FT++FTVEI LK+  YG   H G+FCR+  NILDLLVV  S+IS+ I + AI+VVKILRVLRVLRPLRAINRAKGLK VVQCV VA+++IGNI++VT LL+FMFA IGVQLF GK  SC D SK T   C+G+YI Y + D+++  +  R W N+  +FDNV +AM+ LF VSTFEGWP +LY++IDS  ED   IYN+R  +SIF+I YII+IAFFM+NIFVGFVIVTFQ++GE+EYKNCELDKNQR+C+E+ALKA+P+RRYIPK  ++Y+VW+++ S  FEY++FVLI+LNTI LA++   Q   +++ M+ LNM+FTG+FTVE +LKL AF  K+YF DAWN FD +IV+GS +DI    +N +N       N R    ISI FFRLFRVMRLVKLLSRGEGIRTLLWTF+KSFQALPYVALLIVMLFFIYAVIGMQ+FGKI      +  EINRNNNFQTFPQA+L+LFR ATGEAWQ IML CLP   C   S+   +                                              KCGS+FA  YFISFYM+C+FLIINLFVAVIMDNFDYLTRDWSILGPHHLDEF R+W+EYDPEAKGRIKHLDVVTLLR+I PPLGFGK CPHR AC  LV MNMPLNSDGTVMFNATLFALVRT+L IKTDG+ ++Q NEELR +IKKIWKRTS K+LDQVVPPAG+D+VTVGKFYATFLIQE+FR++K+++ +   G   SQ   LSL          GP I   IS  L    E D+  K+ + +    +  RR   +FG  +   Q   S  R +               P+  +  RP+ +N++        SP++   V  T  P
Sbjct:  106 MGAAANATISTVSSTQRKRQQYSKQKKQGTTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGGSAIGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYYLTNGYPDVLTEEEPSPCALESNNGRHCPN------GTLCR------SGWVGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPCVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEDIDEEKPRNMSM----PTSETESVNTDNVGSGDVEEESCGVRLAHRISKSKF-------SRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPDWLTEVQDTANKVLLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETRIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMLTRRSTFDNFPQALLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQENESLGKSPVPAVEENKEKIELKAITADGESPPNTKISVEEFSTNENEEKTPYPSSNETPGEEEEEEPEMPVGPRP--------RPLSELHIKEKAAPMPEASAFFVFRSDNRFRVHCHRIVNNNIFTNLILFFILLSSISLAAEDPVRHNSFRNQVLFYFDIVFTAIFTVEIVLKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYSCTDSSKITEAECKGKYITYKDGDVSQPMIVDRSWENSKFDFDNVLSAMMALFTVSTFEGWPELLYRAIDSHTEDVGPIYNHRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQYQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCSFKEAMNILNMLFTGLFTVEMILKLIAFKPKHYFCDAWNTFDALIVVGSIVDIAITELNVSNPRLSVTENSR----ISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIAL---NDTTEINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPSKPCAPESETSEE----------------------------------------------KCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTSLCIKTDGN-LEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKP-SQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVGYYQ---SEVRSA--------------FPQTFTTQRPLHINKTSGGPGDLDSPSHEKLVDSTFTP 1792          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Xenopus
Match: CACNA1C (calcium channel, voltage-dependent, L type, alpha 1C subunit [Source:NCBI gene;Acc:100488055])

HSP 1 Score: 1652.88 bits (4279), Expect = 0.000e+0
Identity = 982/1807 (54.34%), Postives = 1209/1807 (66.91%), Query Frame = 1
Query:  916 LNLAALTLSAQIASGGRKRTPARSQ-----SGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEG-----------GPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCY----SKNDVMMES-PVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGG---AHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSXXXXXXXXXXXXXXXP-TNVDGEEAKACNSS---NVSPNIDEKTRFTDAERLIKSEEM--NGDIADESMRKMSTRIDTXXXXXXXXXXXXXXXXXNGQTSAIRR-VSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNG-----------------------TNNNHRGDRL--------ISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRTHGRGSGPLI-SLISPTLVTTNECDEKDKDYLPSHLGAE--RRTHSIFGTMMNVLQRVGSTRRDSNASPSTGSINHSTELPRDRSNSRPMILNQSK-------SPTNHPPVKLTLAP 6120
            +  AA    + ++S  RKR     Q     +   RP RAL CLTL+NP R+ CI IVEWKPFE +IL TIFANC ALA   P+PE DSN  NS LE++E +F++IFT E  LK++A+G + HP AYLRNGWNLLDF+IV++GL S +L + ++            G DVKALRAFRVLRPLRLVSG+PSLQVV+NSI++AMVPL HIALL LFVIIIYAIIGLELF GK+H TCY       DV+ E  P PC+   N G  C +        +C+      S W GP  GIT+FDNF  AMLTVFQCITMEGWT ++YW+ D++G   P +YFVSL+I GSFFV+NLVLGVLSGEFSKEREKAK RG +QK RE+ Q +ED++GYLDWI  AEDI  + E++  +  K     +     +SE      D +      E   G   AH   + ++       SR  R+WNR CRR CR  VKS  FYW+VI LVFLNT  + SEHY Q  WL   Q+TAN + + LFT EML+KMYSLG++ YF  +FNRFD F+V   ILE ++++T  M PLG+SVLRC RLLR+FK+TRYW+SL NLV SLL S++SI SLL+LLFLFI+IFSLLGMQLFGGKFNFD+    RS FD+F Q+LLTVFQILTGEDWN VMYDGI +YG      ML C+Y++ILFICGNYILLNVFLAIAVDNLAD  S    +K+E E +E +        E K  N S   +  P ++E     + + +    E   N  I+ E          T   +  E    +EE+E         R +SE+  KEK  P+P AS+FF+F  +N+FR  CH I N+  F N++L  I++SS  LAAEDP+   S RN++L YFD +FT++FTVEI LK+  YG   H G+FCR+  NILDLLVV  S+IS+ I + AI+VVKILRVLRVLRPLRAINRAKGLK VVQCV VA+++IGNI++VT LL+FMFA IGVQLF GK  SC D SK T   C+G+YI Y + D+++  +  R W N+  +FDNV +AM+ LF VSTFEGWP +LY++IDS  ED   IYN+R  +SIF+I YII+IAFFM+NIFVGFVIVTFQ++GE+EYKNCELDKNQR+C+E+ALKA+P+RRYIPK  ++Y+VW+++ S  FEY++FVLI+LNTI LA++   Q   +++ M+ LNM+FTG+FTVE +LKL AF  K YFSD WNVFDF+IV+GS +D+I    N                        T  N    RL        ISI FFRLFRVMRLVKLLSRGEGIRTLLWTF+KSFQALPYVALLIVMLFFIYAVIGMQ+FGKI      +  EINRNNNFQTFPQA+L+LFR ATGEAWQ IML CLP   C   S+   +                                              KCGS+FA  YFISFYM+C+FLIINLFVAVIMDNFDYLTRDWSILGPHHLDEF R+W+EYDPEAKGRIKHLDVVTLLR+I PPLGFGK CPHR AC  LV MNMPLNSDGTVMFNATLFALVRT+L IKTDG+ ++Q NEELR +IKKIWKRTS K+LDQVVPPAG+D+VTVGKFYATFLIQE+FR++K+++ +   G   SQ   LSL          GP I   IS  L    E D+  K+ + +    +  RR   +FG  +   Q   S  R +               P+  +  RP+ +N++        SP++   V  T  P
Sbjct:   71 MGAAANATISTVSSTQRKRQQYSKQKKQGTTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGGSAIGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYYLTNGYPDVLTEEEPSPCALESNNGRHCPN------GTLCR------SGWVGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPCVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEDIDEEKPRNMSM----PTSETESVNTDNVGSGDVEEESCGVRLAHRISKSKF-------SRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPDWLTEVQDTANKVLLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETRIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMLTRRSTFDNFPQALLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQENESLGKSPVPAVEENKEKIELKAITADGESPPNTKISVEEFSTNENEEKTPYPSSNETPGEEEEEEPEMPVGPRPRPLSELHIKEKAAPMPEASAFFVFRSDNRFRVHCHRIVNNNIFTNLILFFILLSSISLAAEDPVRHNSFRNQVLFYFDIVFTAIFTVEIVLKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYSCTDSSKITEAECKGKYITYKDGDVSQPMIVDRSWENSKFDFDNVLSAMMALFTVSTFEGWPELLYRAIDSHTEDVGPIYNHRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQYQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCSFKEAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSVVDVILSETNHYFCDAWNTFDALIVVGSIVDIAITELNVSNPRLSNVEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIAL---NDTTEINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPSKPCAPESETSEE----------------------------------------------KCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTSLCIKTDGN-LEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKP-SQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVGYYQ---SEVRSA--------------FPQTFTTQRPLHINKTSGGPGDLDSPSHEKLVDSTFTP 1786          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Xenopus
Match: CACNA1C (calcium channel, voltage-dependent, L type, alpha 1C subunit [Source:NCBI gene;Acc:100488055])

HSP 1 Score: 1644.02 bits (4256), Expect = 0.000e+0
Identity = 983/1827 (53.80%), Postives = 1210/1827 (66.23%), Query Frame = 1
Query:  916 LNLAALTLSAQIASGGRKRTPARSQ-----SGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEG-----------GPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCY----SKNDVMMES-PVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGG---AHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSXXXXXXXXXXXXXXXP-TNVDGEEAKACNSS---NVSPNIDEKTRFTDAERLIKSEEM--NGDIADESMRKMSTRIDTXXXXXXXXXXXXXXXXXNGQTSAIRR-VSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYF--------------------DYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNG-----------------------TNNNHRGDRL--------ISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRTHGRGSGPLI-SLISPTLVTTNECDEKDKDYLPSHLGAE--RRTHSIFGTMMNVLQRVGSTRRDSNASPSTGSINHSTELPRDRSNSRPMILNQSK-------SPTNHPPVKLTLAP 6120
            +  AA    + ++S  RKR     Q     +   RP RAL CLTL+NP R+ CI IVEWKPFE +IL TIFANC ALA   P+PE DSN  NS LE++E +F++IFT E  LK++A+G + HP AYLRNGWNLLDF+IV++GL S +L + ++            G DVKALRAFRVLRPLRLVSG+PSLQVV+NSI++AMVPL HIALL LFVIIIYAIIGLELF GK+H TCY       DV+ E  P PC+   N G  C +        +C+      S W GP  GIT+FDNF  AMLTVFQCITMEGWT ++YW+ D++G   P +YFVSL+I GSFFV+NLVLGVLSGEFSKEREKAK RG +QK RE+ Q +ED++GYLDWI  AEDI  + E++  +  K     +     +SE      D +      E   G   AH   + ++       SR  R+WNR CRR CR  VKS  FYW+VI LVFLNT  + SEHY Q  WL   Q+TAN + + LFT EML+KMYSLG++ YF  +FNRFD F+V   ILE ++++T  M PLG+SVLRC RLLR+FK+TRYW+SL NLV SLL S++SI SLL+LLFLFI+IFSLLGMQLFGGKFNFD+    RS FD+F Q+LLTVFQILTGEDWN VMYDGI +YG      ML C+Y++ILFICGNYILLNVFLAIAVDNLAD  S    +K+E E +E +        E K  N S   +  P ++E     + + +    E   N  I+ E          T   +  E    +EE+E         R +SE+  KEK  P+P AS+FF+F  +N+FR  CH I N+  F N++L  I++SS  LAAEDP+   S RN++L YF                    DY+FTS+FT+EI LK+  YG   H G+FCR+  NILDLLVV  S+IS+ I + AI+VVKILRVLRVLRPLRAINRAKGLK VVQCV VA+++IGNI++VT LL+FMFA IGVQLF GK  SC D SK T   C+G+YI Y + D+++  +  R W N+  +FDNV +AM+ LF VSTFEGWP +LY++IDS  ED   IYN+R  +SIF+I YII+IAFFM+NIFVGFVIVTFQ++GE+EYKNCELDKNQR+C+E+ALKA+P+RRYIPK  ++Y+VW+++ S  FEY++FVLI+LNTI LA++   Q   +++ M+ LNM+FTG+FTVE +LKL AF  K YFSD WNVFDF+IV+GS +D+I    N                        T  N    RL        ISI FFRLFRVMRLVKLLSRGEGIRTLLWTF+KSFQALPYVALLIVMLFFIYAVIGMQ+FGKI      +  EINRNNNFQTFPQA+L+LFR ATGEAWQ IML CLP   C   S+   +                                              KCGS+FA  YFISFYM+C+FLIINLFVAVIMDNFDYLTRDWSILGPHHLDEF R+W+EYDPEAKGRIKHLDVVTLLR+I PPLGFGK CPHR AC  LV MNMPLNSDGTVMFNATLFALVRT+L IKTDG+ ++Q NEELR +IKKIWKRTS K+LDQVVPPAG+D+VTVGKFYATFLIQE+FR++K+++ +   G   SQ   LSL          GP I   IS  L    E D+  K+ + +    +  RR   +FG  +   Q   S  R +               P+  +  RP+ +N++        SP++   V  T  P
Sbjct:   71 MGAAANATISTVSSTQRKRQQYSKQKKQGTTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGGSAIGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYYLTNGYPDVLTEEEPSPCALESNNGRHCPN------GTLCR------SGWVGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPCVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEDIDEEKPRNMSM----PTSETESVNTDNVGSGDVEEESCGVRLAHRISKSKF-------SRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPDWLTEVQDTANKVLLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETRIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMLTRRSTFDNFPQALLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQENESLGKSPVPAVEENKEKIELKAITADGESPPNTKISVEEFSTNENEEKTPYPSSNETPGEEEEEEPEMPVGPRPRPLSELHIKEKAAPMPEASAFFVFRSDNRFRVHCHRIVNNNIFTNLILFFILLSSISLAAEDPVRHNSFRNQVLFYFDIVFTAIFTVEIVLKILGNADYVFTSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYSCTDSSKITEAECKGKYITYKDGDVSQPMIVDRSWENSKFDFDNVLSAMMALFTVSTFEGWPELLYRAIDSHTEDVGPIYNHRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQYQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCSFKEAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSVVDVILSETNHYFCDAWNTFDALIVVGSIVDIAITELNVSNPRLSNVEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIAL---NDTTEINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPSKPCAPESETSEE----------------------------------------------KCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTSLCIKTDGN-LEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKP-SQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVGYYQ---SEVRSA--------------FPQTFTTQRPLHINKTSGGPGDLDSPSHEKLVDSTFTP 1806          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Mouse
Match: Cacna1s (calcium channel, voltage-dependent, L type, alpha 1S subunit [Source:MGI Symbol;Acc:MGI:88294])

HSP 1 Score: 1649.03 bits (4269), Expect = 0.000e+0
Identity = 929/1702 (54.58%), Postives = 1169/1702 (68.68%), Query Frame = 1
Query:  955 SGGRKRTPARSQSGN-PRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKM-----------SEG-GPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCY-SKNDVMM----ESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNET-SRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGK----ENGK--ESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGGAHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSXXXXXXXXXXXXXXXPTNVDGEEAKACNSSNVSPNIDEKTRFTDAERLIKSEEMNG--DIADESMRKMSTRIDTXXXXXXXXXXXXXXXXXNGQ---TSAIRRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRTHGRGSGPLISLISPTLVTTNECDEKDKDYLPSHLGAERRTHSIFGTMMNVLQRVGS 5970
             G RK+ P +      PRP RALFCLTL+NP RK CI IVEWKPFE +IL TIFANC ALA   P PE D+NT+N  LEK+E  F+++F+ E  +KI+A+GF+ H  AYLR+GWN+LDF+IV +G+ + +L ++           S+G G DVKALRAFRVLRPLRLVSG+PSLQVV+NSI +AM+PLFHIALL LF++IIYAIIGLELF GK+H TCY    D++     E P PC+              +G    C  N +E    W GPN GIT FDNFG +MLTV+QCI+MEGWT ++YW+ND++G  WPWIYFV+LI++GSFF++NLVLGVLSGEF+KEREKAK RG +QK RE+ Q +ED++GY+ WI   E +  D+  +GK    E G   ES +++ GL K  +                      H +Q   VF +                    LVKS+ FYW+VI++V LNT  + SEH+ Q +WL   Q+ AN + + LFT+EML+KMY LG+R YF  +FNRFD FVV   ILEI+++++ AM PLG+SVLRC RLLR+FK+T+YW+SL NLV SLL S++SI SLL+LLFLFI+IF+LLGMQLFGG+++F+     RSNFD+F Q+L++VFQ+LTGEDWN VMY+GI +YG      +L C+Y++ILF+CGNYILLNVFLAIAVDNLA+  S                     EE K    S   P+  E+ R T  ++L +  +  G    A   + +  + ++  K+         +++E+  +   +   R ++E+  KEK  PIP ASSFFIF P NK R  CH I N   F N +L+ I++SSA LAAEDP+ A+S RN+IL YFDY+FT+VFTVEI LK+ TYG   H G+FCR+  NILDLLVV  S+IS  + + AISVVKILRVLRVLRPLRAINRAKGLK VVQCV VA+++IGNI+LVT LL+FMFA IGVQLF GKF SCND+SK T   CRG Y  Y + D  ++ +  R+WI+N  +FDNV +AM++LF VSTFEGWP +LYK+IDS +ED   +YNNR  ++IF+I YII+IAFFM+NIFVGFVIVTFQ++GE EYKNCELDKNQR+C+++ALKA+P+R YIPK  ++Y+VW+++TS  FEY++F LIMLNTI L ++   Q ++   + D LN+ FT +FT+E +LKL AF  + YF D WNVFDF+IV+GS ID+I   ++  + + R    IS  FFRLFRVMRLVKLL+R EG+RTLLWTF+KSFQALPYVALLIVMLFFIYAVIGMQMFGKI   +     +INRNNNFQTFPQA+L+LFR ATGEAWQ I+L C    +CD  SD    E +                                            CG+NFAY YFISFYM+C+FLIINLFVAVIMDNFDYLTRDWSILGPHHLDEF  +W+EYDPEAKGRIKHLDVVTLLR+I PPLGFGK+CPHR AC  LV MNMPLNSDGTV FNATLFALVRT LKIKT+G+  +Q NEELR +IKKIWKRTS K+LDQV+PP G+D+VTVGKFYATFLIQE FR++  KR EE  G    +         RT    + P I       +T  E  E+         G  RRT  +FG + N L+R  S
Sbjct:    9 EGLRKKQPKKPVPEILPRPPRALFCLTLQNPLRKACISIVEWKPFETIILLTIFANCVALAVYLPMPEDDNNTLNLGLEKLEYFFLIVFSIEAAMKIIAYGFLFHQDAYLRSGWNVLDFIIVFLGVFTVILEQVNIIQTNTAPMSSKGAGLDVKALRAFRVLRPLRLVSGVPSLQVVLNSIFKAMLPLFHIALLVLFMVIIYAIIGLELFKGKMHKTCYFIGTDIVATVENEKPSPCA-------------RTGSGRPCTINGSECRGGWPGPNHGITHFDNFGFSMLTVYQCISMEGWTDVLYWVNDAIGNEWPWIYFVTLILLGSFFILNLVLGVLSGEFTKEREKAKSRGTFQKLREKQQLEEDLRGYMSWITQGEVMDVDDLREGKLSLDEGGSDTESLYEIEGLNKIIQFI-------------------RHWRQWNRVFRWKCHD----------------LVKSKVFYWLVILIVALNTLSIASEHHNQPLWLTHLQDVANRVLLTLFTIEMLMKMYGLGLRQYFMSIFNRFDCFVVCSGILEILLVESGAMSPLGISVLRCIRLLRLFKITKYWTSLSNLVASLLNSIRSIASLLLLLFLFIIIFALLGMQLFGGRYDFEDTEVRRSNFDNFPQALISVFQVLTGEDWNSVMYNGIMAYGGPTYPGVLVCIYFIILFVCGNYILLNVFLAIAVDNLAEAESLTSA------------QKAKAEERKRRKMSKGLPDKSEEERATVTKKLEQKSKGEGIPTTAKLKIDEFESNVNEVKDPYPSADFPGDDEEDEPEIPVSPRPRPLAELQLKEKAVPIPEASSFFIFSPTNKIRVLCHRIVNATWFTNFILLFILLSSAALAAEDPIRADSMRNQILEYFDYVFTAVFTVEIVLKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLISMGLESSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVLVTTLLQFMFACIGVQLFKGKFYSCNDLSKMTEEECRGYYYIYKDGDPTQIELRPRQWIHNDFHFDNVLSAMMSLFTVSTFEGWPQLLYKAIDSNEEDTGPVYNNRVEMAIFFIIYIILIAFFMMNIFVGFVIVTFQEQGETEYKNCELDKNQRQCVQYALKARPLRCYIPKNPYQYQVWYVVTSSYFEYLMFALIMLNTICLGMQHYNQSEQMNHISDILNVAFTIIFTLEMVLKLIAFKPRGYFGDPWNVFDFLIVIGSIIDVILSEIDDPDESAR----ISSAFFRLFRVMRLVKLLNRAEGVRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIAMVDG---TQINRNNNFQTFPQAVLLLFRCATGEAWQEILLACSYGKLCDPESDYAPGEEHT-------------------------------------------CGTNFAYYYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKAIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKFCPHRVACKRLVGMNMPLNSDGTVTFNATLFALVRTALKIKTEGN-FEQANEELRAIIKKIWKRTSMKLLDQVIPPIGDDEVTVGKFYATFLIQEHFRKF-MKRQEEYYGYRPKKDTVQIQAGLRTIEEEAAPEIHRAISGDLTAEEELERAMVEAAMEEGIFRRTGGLFGQVDNFLERTNS 1598          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Mouse
Match: Cacna1s (calcium channel, voltage-dependent, L type, alpha 1S subunit [Source:MGI Symbol;Acc:MGI:88294])

HSP 1 Score: 1640.17 bits (4246), Expect = 0.000e+0
Identity = 929/1717 (54.11%), Postives = 1168/1717 (68.03%), Query Frame = 1
Query:  955 SGGRKRTPARSQSGN-PRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKM-----------SEG-GPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCY-SKNDVMM----ESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNET-SRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGK----ENGK--ESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGGAHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSXXXXXXXXXXXXXXXPTNVDGEEAKACNSSNVSPNIDEKTRFTDAERLIKSEEMNG--DIADESMRKMSTRIDTXXXXXXXXXXXXXXXXXNGQ---TSAIRRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNG---------------TNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRTHGRGSGPLISLISPTLVTTNECDEKDKDYLPSHLGAERRTHSIFGTMMNVLQRVGS 5970
             G RK+ P +      PRP RALFCLTL+NP RK CI IVEWKPFE +IL TIFANC ALA   P PE D+NT+N  LEK+E  F+++F+ E  +KI+A+GF+ H  AYLR+GWN+LDF+IV +G+ + +L ++           S+G G DVKALRAFRVLRPLRLVSG+PSLQVV+NSI +AM+PLFHIALL LF++IIYAIIGLELF GK+H TCY    D++     E P PC+              +G    C  N +E    W GPN GIT FDNFG +MLTV+QCI+MEGWT ++YW+ND++G  WPWIYFV+LI++GSFF++NLVLGVLSGEF+KEREKAK RG +QK RE+ Q +ED++GY+ WI   E +  D+  +GK    E G   ES +++ GL K  +                      H +Q   VF +                    LVKS+ FYW+VI++V LNT  + SEH+ Q +WL   Q+ AN + + LFT+EML+KMY LG+R YF  +FNRFD FVV   ILEI+++++ AM PLG+SVLRC RLLR+FK+T+YW+SL NLV SLL S++SI SLL+LLFLFI+IF+LLGMQLFGG+++F+     RSNFD+F Q+L++VFQ+LTGEDWN VMY+GI +YG      +L C+Y++ILF+CGNYILLNVFLAIAVDNLA+  S                     EE K    S   P+  E+ R T  ++L +  +  G    A   + +  + ++  K+         +++E+  +   +   R ++E+  KEK  PIP ASSFFIF P NK R  CH I N   F N +L+ I++SSA LAAEDP+ A+S RN+IL YFDY+FT+VFTVEI LK+ TYG   H G+FCR+  NILDLLVV  S+IS  + + AISVVKILRVLRVLRPLRAINRAKGLK VVQCV VA+++IGNI+LVT LL+FMFA IGVQLF GKF SCND+SK T   CRG Y  Y + D  ++ +  R+WI+N  +FDNV +AM++LF VSTFEGWP +LYK+IDS +ED   +YNNR  ++IF+I YII+IAFFM+NIFVGFVIVTFQ++GE EYKNCELDKNQR+C+++ALKA+P+R YIPK  ++Y+VW+++TS  FEY++F LIMLNTI L ++   Q ++   + D LN+ FT +FT+E +LKL AF  + YF D WNVFDF+IV+GS ID+I   ++                 N +      IS  FFRLFRVMRLVKLL+R EG+RTLLWTF+KSFQALPYVALLIVMLFFIYAVIGMQMFGKI   +     +INRNNNFQTFPQA+L+LFR ATGEAWQ I+L C    +CD  SD    E +                                            CG+NFAY YFISFYM+C+FLIINLFVAVIMDNFDYLTRDWSILGPHHLDEF  +W+EYDPEAKGRIKHLDVVTLLR+I PPLGFGK+CPHR AC  LV MNMPLNSDGTV FNATLFALVRT LKIKT+G+  +Q NEELR +IKKIWKRTS K+LDQV+PP G+D+VTVGKFYATFLIQE FR++  KR EE  G    +         RT    + P I       +T  E  E+         G  RRT  +FG + N L+R  S
Sbjct:    9 EGLRKKQPKKPVPEILPRPPRALFCLTLQNPLRKACISIVEWKPFETIILLTIFANCVALAVYLPMPEDDNNTLNLGLEKLEYFFLIVFSIEAAMKIIAYGFLFHQDAYLRSGWNVLDFIIVFLGVFTVILEQVNIIQTNTAPMSSKGAGLDVKALRAFRVLRPLRLVSGVPSLQVVLNSIFKAMLPLFHIALLVLFMVIIYAIIGLELFKGKMHKTCYFIGTDIVATVENEKPSPCA-------------RTGSGRPCTINGSECRGGWPGPNHGITHFDNFGFSMLTVYQCISMEGWTDVLYWVNDAIGNEWPWIYFVTLILLGSFFILNLVLGVLSGEFTKEREKAKSRGTFQKLREKQQLEEDLRGYMSWITQGEVMDVDDLREGKLSLDEGGSDTESLYEIEGLNKIIQFI-------------------RHWRQWNRVFRWKCHD----------------LVKSKVFYWLVILIVALNTLSIASEHHNQPLWLTHLQDVANRVLLTLFTIEMLMKMYGLGLRQYFMSIFNRFDCFVVCSGILEILLVESGAMSPLGISVLRCIRLLRLFKITKYWTSLSNLVASLLNSIRSIASLLLLLFLFIIIFALLGMQLFGGRYDFEDTEVRRSNFDNFPQALISVFQVLTGEDWNSVMYNGIMAYGGPTYPGVLVCIYFIILFVCGNYILLNVFLAIAVDNLAEAESLTSA------------QKAKAEERKRRKMSKGLPDKSEEERATVTKKLEQKSKGEGIPTTAKLKIDEFESNVNEVKDPYPSADFPGDDEEDEPEIPVSPRPRPLAELQLKEKAVPIPEASSFFIFSPTNKIRVLCHRIVNATWFTNFILLFILLSSAALAAEDPIRADSMRNQILEYFDYVFTAVFTVEIVLKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLISMGLESSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVLVTTLLQFMFACIGVQLFKGKFYSCNDLSKMTEEECRGYYYIYKDGDPTQIELRPRQWIHNDFHFDNVLSAMMSLFTVSTFEGWPQLLYKAIDSNEEDTGPVYNNRVEMAIFFIIYIILIAFFMMNIFVGFVIVTFQEQGETEYKNCELDKNQRQCVQYALKARPLRCYIPKNPYQYQVWYVVTSSYFEYLMFALIMLNTICLGMQHYNQSEQMNHISDILNVAFTIIFTLEMVLKLIAFKPRGYFGDPWNVFDFLIVIGSIIDVILSEIDTFLASSGGLYCLGGGCGNVDPDESARISSAFFRLFRVMRLVKLLNRAEGVRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIAMVDG---TQINRNNNFQTFPQAVLLLFRCATGEAWQEILLACSYGKLCDPESDYAPGEEHT-------------------------------------------CGTNFAYYYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKAIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKFCPHRVACKRLVGMNMPLNSDGTVTFNATLFALVRTALKIKTEGN-FEQANEELRAIIKKIWKRTSMKLLDQVIPPIGDDEVTVGKFYATFLIQEHFRKF-MKRQEEYYGYRPKKDTVQIQAGLRTIEEEAAPEIHRAISGDLTAEEELERAMVEAAMEEGIFRRTGGLFGQVDNFLERTNS 1617          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Mouse
Match: Cacna1s (calcium channel, voltage-dependent, L type, alpha 1S subunit [Source:MGI Symbol;Acc:MGI:88294])

HSP 1 Score: 1640.17 bits (4246), Expect = 0.000e+0
Identity = 929/1717 (54.11%), Postives = 1168/1717 (68.03%), Query Frame = 1
Query:  955 SGGRKRTPARSQSGN-PRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKM-----------SEG-GPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCY-SKNDVMM----ESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNET-SRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGK----ENGK--ESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGGAHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSXXXXXXXXXXXXXXXPTNVDGEEAKACNSSNVSPNIDEKTRFTDAERLIKSEEMNG--DIADESMRKMSTRIDTXXXXXXXXXXXXXXXXXNGQ---TSAIRRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNG---------------TNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRTHGRGSGPLISLISPTLVTTNECDEKDKDYLPSHLGAERRTHSIFGTMMNVLQRVGS 5970
             G RK+ P +      PRP RALFCLTL+NP RK CI IVEWKPFE +IL TIFANC ALA   P PE D+NT+N  LEK+E  F+++F+ E  +KI+A+GF+ H  AYLR+GWN+LDF+IV +G+ + +L ++           S+G G DVKALRAFRVLRPLRLVSG+PSLQVV+NSI +AM+PLFHIALL LF++IIYAIIGLELF GK+H TCY    D++     E P PC+              +G    C  N +E    W GPN GIT FDNFG +MLTV+QCI+MEGWT ++YW+ND++G  WPWIYFV+LI++GSFF++NLVLGVLSGEF+KEREKAK RG +QK RE+ Q +ED++GY+ WI   E +  D+  +GK    E G   ES +++ GL K  +                      H +Q   VF +                    LVKS+ FYW+VI++V LNT  + SEH+ Q +WL   Q+ AN + + LFT+EML+KMY LG+R YF  +FNRFD FVV   ILEI+++++ AM PLG+SVLRC RLLR+FK+T+YW+SL NLV SLL S++SI SLL+LLFLFI+IF+LLGMQLFGG+++F+     RSNFD+F Q+L++VFQ+LTGEDWN VMY+GI +YG      +L C+Y++ILF+CGNYILLNVFLAIAVDNLA+  S                     EE K    S   P+  E+ R T  ++L +  +  G    A   + +  + ++  K+         +++E+  +   +   R ++E+  KEK  PIP ASSFFIF P NK R  CH I N   F N +L+ I++SSA LAAEDP+ A+S RN+IL YFDY+FT+VFTVEI LK+ TYG   H G+FCR+  NILDLLVV  S+IS  + + AISVVKILRVLRVLRPLRAINRAKGLK VVQCV VA+++IGNI+LVT LL+FMFA IGVQLF GKF SCND+SK T   CRG Y  Y + D  ++ +  R+WI+N  +FDNV +AM++LF VSTFEGWP +LYK+IDS +ED   +YNNR  ++IF+I YII+IAFFM+NIFVGFVIVTFQ++GE EYKNCELDKNQR+C+++ALKA+P+R YIPK  ++Y+VW+++TS  FEY++F LIMLNTI L ++   Q ++   + D LN+ FT +FT+E +LKL AF  + YF D WNVFDF+IV+GS ID+I   ++                 N +      IS  FFRLFRVMRLVKLL+R EG+RTLLWTF+KSFQALPYVALLIVMLFFIYAVIGMQMFGKI   +     +INRNNNFQTFPQA+L+LFR ATGEAWQ I+L C    +CD  SD    E +                                            CG+NFAY YFISFYM+C+FLIINLFVAVIMDNFDYLTRDWSILGPHHLDEF  +W+EYDPEAKGRIKHLDVVTLLR+I PPLGFGK+CPHR AC  LV MNMPLNSDGTV FNATLFALVRT LKIKT+G+  +Q NEELR +IKKIWKRTS K+LDQV+PP G+D+VTVGKFYATFLIQE FR++  KR EE  G    +         RT    + P I       +T  E  E+         G  RRT  +FG + N L+R  S
Sbjct:    9 EGLRKKQPKKPVPEILPRPPRALFCLTLQNPLRKACISIVEWKPFETIILLTIFANCVALAVYLPMPEDDNNTLNLGLEKLEYFFLIVFSIEAAMKIIAYGFLFHQDAYLRSGWNVLDFIIVFLGVFTVILEQVNIIQTNTAPMSSKGAGLDVKALRAFRVLRPLRLVSGVPSLQVVLNSIFKAMLPLFHIALLVLFMVIIYAIIGLELFKGKMHKTCYFIGTDIVATVENEKPSPCA-------------RTGSGRPCTINGSECRGGWPGPNHGITHFDNFGFSMLTVYQCISMEGWTDVLYWVNDAIGNEWPWIYFVTLILLGSFFILNLVLGVLSGEFTKEREKAKSRGTFQKLREKQQLEEDLRGYMSWITQGEVMDVDDLREGKLSLDEGGSDTESLYEIEGLNKIIQFI-------------------RHWRQWNRVFRWKCHD----------------LVKSKVFYWLVILIVALNTLSIASEHHNQPLWLTHLQDVANRVLLTLFTIEMLMKMYGLGLRQYFMSIFNRFDCFVVCSGILEILLVESGAMSPLGISVLRCIRLLRLFKITKYWTSLSNLVASLLNSIRSIASLLLLLFLFIIIFALLGMQLFGGRYDFEDTEVRRSNFDNFPQALISVFQVLTGEDWNSVMYNGIMAYGGPTYPGVLVCIYFIILFVCGNYILLNVFLAIAVDNLAEAESLTSA------------QKAKAEERKRRKMSKGLPDKSEEERATVTKKLEQKSKGEGIPTTAKLKIDEFESNVNEVKDPYPSADFPGDDEEDEPEIPVSPRPRPLAELQLKEKAVPIPEASSFFIFSPTNKIRVLCHRIVNATWFTNFILLFILLSSAALAAEDPIRADSMRNQILEYFDYVFTAVFTVEIVLKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLISMGLESSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVLVTTLLQFMFACIGVQLFKGKFYSCNDLSKMTEEECRGYYYIYKDGDPTQIELRPRQWIHNDFHFDNVLSAMMSLFTVSTFEGWPQLLYKAIDSNEEDTGPVYNNRVEMAIFFIIYIILIAFFMMNIFVGFVIVTFQEQGETEYKNCELDKNQRQCVQYALKARPLRCYIPKNPYQYQVWYVVTSSYFEYLMFALIMLNTICLGMQHYNQSEQMNHISDILNVAFTIIFTLEMVLKLIAFKPRGYFGDPWNVFDFLIVIGSIIDVILSEIDTFLASSGGLYCLGGGCGNVDPDESARISSAFFRLFRVMRLVKLLNRAEGVRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIAMVDG---TQINRNNNFQTFPQAVLLLFRCATGEAWQEILLACSYGKLCDPESDYAPGEEHT-------------------------------------------CGTNFAYYYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKAIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKFCPHRVACKRLVGMNMPLNSDGTVTFNATLFALVRTALKIKTEGN-FEQANEELRAIIKKIWKRTSMKLLDQVIPPIGDDEVTVGKFYATFLIQEHFRKF-MKRQEEYYGYRPKKDTVQIQAGLRTIEEEAAPEIHRAISGDLTAEEELERAMVEAAMEEGIFRRTGGLFGQVDNFLERTNS 1617          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Mouse
Match: Cacna1s (calcium channel, voltage-dependent, L type, alpha 1S subunit [Source:MGI Symbol;Acc:MGI:88294])

HSP 1 Score: 1382.08 bits (3576), Expect = 0.000e+0
Identity = 789/1444 (54.64%), Postives = 993/1444 (68.77%), Query Frame = 1
Query: 1675 CKDNKNET-SRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGK----ENGK--ESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGGAHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSXXXXXXXXXXXXXXXPTNVDGEEAKACNSSNVSPNIDEKTRFTDAERLIKSEEMNG--DIADESMRKMSTRIDTXXXXXXXXXXXXXXXXXNGQ---TSAIRRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRTHGRGSGPLISLISPTLVTTNECDEKDKDYLPSHLGAERRTHSIFGTMMNVLQRVGS 5970
            C  N +E    W GPN GIT FDNFG +MLTV+QCI+MEGWT ++YW+ND++G  WPWIYFV+LI++GSFF++NLVLGVLSGEF+KEREKAK RG +QK RE+ Q +ED++GY+ WI   E +  D+  +GK    E G   ES +++ GL K  +                      H +Q   VF +                    LVKS+ FYW+VI++V LNT  + SEH+ Q +WL   Q+ AN + + LFT+EML+KMY LG+R YF  +FNRFD FVV   ILEI+++++ AM PLG+SVLRC RLLR+FK+T+YW+SL NLV SLL S++SI SLL+LLFLFI+IF+LLGMQLFGG+++F+     RSNFD+F Q+L++VFQ+LTGEDWN VMY+GI +YG      +L C+Y++ILF+CGNYILLNVFLAIAVDNLA+  S                     EE K    S   P+  E+ R T  ++L +  +  G    A   + +  + ++  K+         +++E+  +   +   R ++E+  KEK  PIP ASSFFIF P NK R  CH I N   F N +L+ I++SSA LAAEDP+ A+S RN+IL YFDY+FT+VFTVEI LK+ TYG   H G+FCR+  NILDLLVV  S+IS  + + AISVVKILRVLRVLRPLRAINRAKGLK VVQCV VA+++IGNI+LVT LL+FMFA IGVQLF GKF SCND+SK T   CRG Y  Y + D  ++ +  R+WI+N  +FDNV +AM++LF VSTFEGWP +LYK+IDS +ED   +YNNR  ++IF+I YII+IAFFM+NIFVGFVIVTFQ++GE EYKNCELDKNQR+C+++ALKA+P+R YIPK  ++Y+VW+++TS  FEY++F LIMLNTI L ++   Q ++   + D LN+ FT +FT+E +LKL AF  + YF D WNVFDF+IV+GS ID+I   ++  + + R    IS  FFRLFRVMRLVKLL+R EG+RTLLWTF+KSFQALPYVALLIVMLFFIYAVIGMQMFGKI   +     +INRNNNFQTFPQA+L+LFR ATGEAWQ I+L C    +CD  SD    E +                                            CG+NFAY YFISFYM+C+FLIINLFVAVIMDNFDYLTRDWSILGPHHLDEF  +W+EYDPEAKGRIKHLDVVTLLR+I PPLGFGK+CPHR AC  LV MNMPLNSDGTV FNATLFALVRT LKIKT+G+  +Q NEELR +IKKIWKRTS K+LDQV+PP G+D+VTVGKFYATFLIQE FR++  KR EE  G    +         RT    + P I       +T  E  E+         G  RRT  +FG + N L+R  S
Sbjct:    7 CTINGSECRGGWPGPNHGITHFDNFGFSMLTVYQCISMEGWTDVLYWVNDAIGNEWPWIYFVTLILLGSFFILNLVLGVLSGEFTKEREKAKSRGTFQKLREKQQLEEDLRGYMSWITQGEVMDVDDLREGKLSLDEGGSDTESLYEIEGLNKIIQFI-------------------RHWRQWNRVFRWKCHD----------------LVKSKVFYWLVILIVALNTLSIASEHHNQPLWLTHLQDVANRVLLTLFTIEMLMKMYGLGLRQYFMSIFNRFDCFVVCSGILEILLVESGAMSPLGISVLRCIRLLRLFKITKYWTSLSNLVASLLNSIRSIASLLLLLFLFIIIFALLGMQLFGGRYDFEDTEVRRSNFDNFPQALISVFQVLTGEDWNSVMYNGIMAYGGPTYPGVLVCIYFIILFVCGNYILLNVFLAIAVDNLAEAESLTSA------------QKAKAEERKRRKMSKGLPDKSEEERATVTKKLEQKSKGEGIPTTAKLKIDEFESNVNEVKDPYPSADFPGDDEEDEPEIPVSPRPRPLAELQLKEKAVPIPEASSFFIFSPTNKIRVLCHRIVNATWFTNFILLFILLSSAALAAEDPIRADSMRNQILEYFDYVFTAVFTVEIVLKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLISMGLESSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVLVTTLLQFMFACIGVQLFKGKFYSCNDLSKMTEEECRGYYYIYKDGDPTQIELRPRQWIHNDFHFDNVLSAMMSLFTVSTFEGWPQLLYKAIDSNEEDTGPVYNNRVEMAIFFIIYIILIAFFMMNIFVGFVIVTFQEQGETEYKNCELDKNQRQCVQYALKARPLRCYIPKNPYQYQVWYVVTSSYFEYLMFALIMLNTICLGMQHYNQSEQMNHISDILNVAFTIIFTLEMVLKLIAFKPRGYFGDPWNVFDFLIVIGSIIDVILSEIDDPDESAR----ISSAFFRLFRVMRLVKLLNRAEGVRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIAMVDG---TQINRNNNFQTFPQAVLLLFRCATGEAWQEILLACSYGKLCDPESDYAPGEEHT-------------------------------------------CGTNFAYYYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKAIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKFCPHRVACKRLVGMNMPLNSDGTVTFNATLFALVRTALKIKTEGN-FEQANEELRAIIKKIWKRTSMKLLDQVIPPIGDDEVTVGKFYATFLIQEHFRKF-MKRQEEYYGYRPKKDTVQIQAGLRTIEEEAAPEIHRAISGDLTAEEELERAMVEAAMEEGIFRRTGGLFGQVDNFLERTNS 1351          

HSP 2 Score: 124.405 bits (311), Expect = 1.919e-27
Identity = 93/279 (33.33%), Postives = 135/279 (48.39%), Query Frame = 1
Query: 1000 PRPQ-RALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITS---FDNFGLAMLTVFQCITMEGWTQIMYWINDS 1824
            P P+  + F  +  N  R  C +IV    F   IL  I  +  ALAA  P   R  +  N  LE  + VF  +FT E VLK+  +G  +H G++ RN +N+LD L+V + LIS  L   S     VK LR  RVLRPLR ++    L+ V+  +  A+  + +I L+   +  ++A IG++LF GK     YS ND+   +   C                G+ Y+ KD  + T     P   I +   FDN   AM+++F   T EGW Q++Y   DS
Sbjct:  525 PIPEASSFFIFSPTNKIRVLCHRIVNATWFTNFILLFILLSSAALAAEDPI--RADSMRNQILEYFDYVFTAVFTVEIVLKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLISMGLE--SSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVLVTTLLQFMFACIGVQLFKGKF----YSCNDLSKMTEEEC---------------RGYYYIYKDG-DPTQIELRPRQWIHNDFHFDNVLSAMMSLFTVSTFEGWPQLLYKAIDS 779          

HSP 3 Score: 99.3673 bits (246), Expect = 7.835e-20
Identity = 83/326 (25.46%), Postives = 146/326 (44.79%), Query Frame = 1
Query: 1012 RALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKA------LRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWIN----------------DSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEF 1923
            R L C   +NP++     +V    FEYL+   I  N   L          S  +N   + + + F +IFT E VLK++AF     P  Y  + WN+ DFLIVI  +I  +LS++ +  PD  A       R FRV+R ++L++    ++ ++ + +++   L ++ALL + +  IYA+IG+++F GK+          M++      T +N+                  N N              F  F  A+L +F+C T E W +I+   +                 + G ++ + YF+S  ++ +F ++NL + V+   F
Sbjct:  849 RPLRCYIPKNPYQYQVWYVVTSSYFEYLMFALIMLNTICLGMQH---YNQSEQMNHISDILNVAFTIIFTLEMVLKLIAF----KPRGYFGDPWNVFDFLIVIGSIIDVILSEIDD--PDESARISSAFFRLFRVMRLVKLLNRAEGVRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMF-GKI---------AMVD-----GTQINR------------------NNN--------------FQTFPQAVLLLFRCATGEAWQEILLACSYGKLCDPESDYAPGEEHTCGTNFAYYYFISFYMLCAFLIINLFVAVIMDNF 1118          

HSP 4 Score: 58.5362 bits (140), Expect = 1.670e-7
Identity = 73/324 (22.53%), Postives = 138/324 (42.59%), Query Frame = 1
Query: 1045 FRKFCIKIVEWKPFEYLILFTIFANCCALAA---NTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGP-DVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMY-WINDSVGMSWP----WIYFVSLIIIGSFFVMNLVLGVLSGEFSKERE--KAKKRGKYQKAREQM 1983
            FR  C  +V+ K F +L++  +  N  ++A+   N P        +    +    V + +FT E ++K+   G       Y  + +N  D  +V  G++  +L +     P  +  LR  R+LR  ++     SL  ++ S++ ++  +  + LL    III+A++G++LF G+                              DF  +           E  R        ++FDNF  A+++VFQ +T E W  +MY  I    G ++P     IYF+ L + G++ ++N+ L +     ++      A+K    ++ R +M
Sbjct:  174 FRWKCHDLVKSKVFYWLVILIVALNTLSIASEHHNQPL------WLTHLQDVANRVLLTLFTIEMLMKMYGLGL----RQYFMSIFNRFDCFVVCSGILEILLVESGAMSPLGISVLRCIRLLRLFKITKYWTSLSNLVASLLNSIRSIASLLLLLFLFIIIFALLGMQLFGGRY-----------------------------DFEDT-----------EVRR--------SNFDNFPQALISVFQVLTGEDWNSVMYNGIMAYGGPTYPGVLVCIYFIILFVCGNYILLNVFLAIAVDNLAEAESLTSAQKAKAEERKRRKM 439          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Mouse
Match: Cacna1f (calcium channel, voltage-dependent, alpha 1F subunit [Source:MGI Symbol;Acc:MGI:1859639])

HSP 1 Score: 1179.08 bits (3049), Expect = 0.000e+0
Identity = 677/1160 (58.36%), Postives = 834/1160 (71.90%), Query Frame = 1
Query: 2284 VKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLA--DTGSXXXXXXXXXXXXXXXPTNVDGEEAKACNSSNVSPNIDEKTRFTDAERLIKSEEMNGDIADESMRKMSTRIDTXXXXXXXXXXXXXXXXXNGQTSAIRRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGM 5757
            VKS A YW V++LVFLNT  + SEH+ Q +WL   Q  AN + + LFT+EML+K+Y LG   Y    FNRFD FVV   ILE  +++  AM PLG+SVLRC RLLR+FKVTR+W+SL NLV SLL SMKSI SLL+LLFLFI+IFSLLGMQLFGGKFNFD+    RS FD+F Q+LLTVFQILTGEDWN VMYDGI +YG      ML C+Y++ILFICGNYILLNVFLAIAVDNLA  D G+                    G E     SS  +P  + K      E    +E+  G  ++ +   M    + E+E +EE  E       NG    +  + EV+ KEK+ PIP  S+FF     N  RK CH + +H  F +++LV I++SS  LAAEDP+ A S RN IL YFDY FTS+FTVEI LK+  +G   H G+FCRS  N+LDLLVV  S+IS+ I++ AISVVKILRVLRVLRPLRAINRAKGLK VVQCV VA+++IGNIM+VT LL+FMFA IGVQLF GKF SC D +K+T   C+G ++ Y + D+++  V +R W+N+  NFDNV +AM+ LF VSTFEGWP +LYK+ID+  ED   IYN    +S+F+I YII+IAFFM+NIFVGFVI+TF+ +GE+EY+NCELDKNQR+C+E+ALKA+P+RRYIPK   +YRVW  + S  FEY++F+LI+LNT++LA++  +Q   +   MD LNMVFTG+FT+E +LK+ AF  K+YF+DAWN FD +IV+GS +DI    VN + ++ R    ISI FFRLFRVMRLVKLLS+GEGIRTLLWTF+KSFQALPYVALLI M+FFIYAVIGMQMFGK+  ++     +INRNNNFQTFPQA+L+LFR ATGEAWQ IML  LP   CD  SD                             P   F                 CGS+FA  YFISF+M+C+FLIINLFVAVIMDNFDYLTRDWSILGPHHLDEF R+WSEYDP AKGRIKHLDVV LLR+I PPLGFGK CPHR AC  LV MN+PLNSDGTV FNATLFALVRT+LKIKT+G+ +DQ N+ELR+VIKKIWKR  QK+LD+V+PP   ++VTVGKFYATFLIQ++FR++++++   +KG+
Sbjct:  526 VKSNACYWAVLLLVFLNTLTIASEHHGQPLWLTQTQEYANKVLLCLFTVEMLLKLYGLGPSVYVASFFNRFDCFVVCGGILETTLVEVGAMQPLGISVLRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDQTHTKRSTFDTFPQALLTVFQILTGEDWNVVMYDGIMAYGGPFFPGMLVCVYFIILFICGNYILLNVFLAIAVDNLASGDAGTAKD----------------KGRE----KSSEGNPPKENKVLVPGGE----NEDAKGARSEGAAPGMEEEEEEEEEEEEEEEEE------NG-AGHVELLQEVVPKEKVVPIPEGSAFFCLSQTNPLRKACHTLIHHHIFTSLILVFIILSSVSLAAEDPIRAHSFRNHILGYFDYAFTSIFTVEILLKMTVFGAFLHRGSFCRSWFNLLDLLVVSVSLISFGIHSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYSCTDEAKHTLKECKGSFLIYPDGDVSRPLVRERLWVNSDFNFDNVLSAMMALFTVSTFEGWPALLYKAIDANAEDEGPIYNYHVEISVFFIVYIIIIAFFMMNIFVGFVIITFRAQGEQEYQNCELDKNQRQCVEYALKAQPLRRYIPKNPHQYRVWATVNSAAFEYLMFLLILLNTVALAMQHYEQTAPFNYAMDILNMVFTGLFTIEMVLKIIAFKPKHYFADAWNTFDALIVVGSVVDIAVTEVNSSEDSSR----ISITFFRLFRVMRLVKLLSKGEGIRTLLWTFIKSFQALPYVALLIAMIFFIYAVIGMQMFGKVALQDG---TQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLASLPGNRCDPESD---------------------------FGPGEEFT----------------CGSSFAIVYFISFFMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPGAKGRIKHLDVVALLRRIQPPLGFGKLCPHRVACKRLVAMNVPLNSDGTVTFNATLFALVRTSLKIKTEGN-LDQANQELRMVIKKIWKRIKQKLLDEVIPPPDEEEVTVGKFYATFLIQDYFRKFRRRK---EKGL 1600          

HSP 2 Score: 456.447 bits (1173), Expect = 1.387e-129
Identity = 226/369 (61.25%), Postives = 269/369 (72.90%), Query Frame = 1
Query: 1003 RPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKM------------SEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMM--ESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDIS-DDEENDG 2064
            R  RALFCLTL NP R+ CI IVEWKPF+ LIL TIFANC AL    P+PE DSNT N  LE++E VF+VIFT E VLKI+A+G ++HP AY+RNGWNLLDF+IV++GL S +L +               GG DVKALRAFRVLRPLRLVSG+PSL +V+NSIM+A+VPL HIALL LFVIIIYAIIGLELF G++H TCY     M   E P PC++S   G  C   H+      C+       RW GPN GIT+FDNF  AMLTVFQCITMEGWT ++YW+ D++G   PW+YFVSL+I GSFFV+NLVLGVLSGEFSKEREKAK RG +QK RE+ Q +ED++GYLDWI  AE++   D   DG
Sbjct:   67 RSPRALFCLTLTNPIRRSCISIVEWKPFDILILLTIFANCVALGVYIPFPEDDSNTANHNLEQVEYVFLVIFTVETVLKIVAYGLVLHPSAYIRNGWNLLDFIIVVVGLFSVLLEQGPGRPGDAPHTGGKPGGFDVKALRAFRVLRPLRLVSGVPSLHIVLNSIMKALVPLLHIALLVLFVIIIYAIIGLELFLGRMHKTCYFLGSDMEAEEDPSPCASS-GSGRSCTLNHTE-----CR------GRWPGPNGGITNFDNFFFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQMEEDLRGYLDWITQAEELDLHDPSVDG 423          

HSP 3 Score: 112.849 bits (281), Expect = 5.873e-24
Identity = 87/279 (31.18%), Postives = 128/279 (45.88%), Query Frame = 1
Query: 1000 PRPQ-RALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSR---WSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDS 1824
            P P+  A FCL+  NP RK C  ++    F  LIL  I  +  +LAA  P   R  +  N  L   +  F  IFT E +LK+  FG  +H G++ R+ +NLLD L+V + LIS      S     VK LR  RVLRPLR ++    L+ V+  +  A+  + +I ++   +  ++A IG++LF GK +S        + E    C  S                Y   D      R   W   +    +FDN   AM+ +F   T EGW  ++Y   D+
Sbjct:  847 PIPEGSAFFCLSQTNPLRKACHTLIHHHIFTSLILVFIILSSVSLAAEDPI--RAHSFRNHILGYFDYAFTSIFTVEILLKMTVFGAFLHRGSFCRSWFNLLDLLVVSVSLIS--FGIHSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYSCTDEAKHTLKE----CKGSF-------------LIYPDGDVSRPLVRERLWVNSDF---NFDNVLSAMMALFTVSTFEGWPALLYKAIDA 1101          

HSP 4 Score: 90.1225 bits (222), Expect = 4.979e-17
Identity = 77/316 (24.37%), Postives = 136/316 (43.04%), Query Frame = 1
Query: 1036 RNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPD----VKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWI----------------NDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEF 1923
            +NP +      V    FEYL+   I  N  ALA         +   N A++ + +VF  +FT E VLKI+AF     P  Y  + WN  D LIV+  ++   +++++         +   R FRV+R ++L+S    ++ ++ + +++   L ++ALL   +  IYA+IG+++F GK+                    ++  G Q               N+N             +F  F  A+L +F+C T E W +IM                     + G S+  +YF+S  ++ +F ++NL + V+   F
Sbjct: 1179 KNPHQYRVWATVNSAAFEYLMFLLILLNTVALAMQH---YEQTAPFNYAMDILNMVFTGLFTIEMVLKIIAF----KPKHYFADAWNTFDALIVVGSVVDIAVTEVNSSEDSSRISITFFRLFRVMRLVKLLSKGEGIRTLLWTFIKSFQALPYVALLIAMIFFIYAVIGMQMF-GKV--------------------ALQDGTQI--------------NRN------------NNFQTFPQAVLLLFRCATGEAWQEIMLASLPGNRCDPESDFGPGEEFTCGSSFAIVYFISFFMLCAFLIINLFVAVIMDNF 1440          

HSP 5 Score: 88.9669 bits (219), Expect = 1.154e-16
Identity = 65/247 (26.32%), Postives = 118/247 (47.77%), Query Frame = 1
Query: 4234 GEEEYKNCELDKNQRKCIEFALKAKPVRRYI-PKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIM 4971
            G+E+ +   +    R C+   +K +  R +    +  R R    + S    + + +L+ LNT+++A +   QP    Q  +Y N V   +FTVE LLKL   G   Y +  +N FD  +V G  ++     V            + I+  R  R++R+ K+      +  L+ + + S +++  + LL+ +   I++++GMQ+FG     ++   K     + F TFPQA+L +F+  TGE W  +M
Sbjct:  483 GDEDEEEGTMASCTR-CLNKIMKTRICRHFRRANRGLRARCRRAVKSNACYWAVLLLVFLNTLTIASEHHGQPLWLTQTQEYANKVLLCLFTVEMLLKLYGLGPSVYVASFFNRFDCFVVCGGILETTLVEVGAMQP-------LGISVLRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDQTHTKR----STFDTFPQALLTVFQILTGEDWNVVM 717          

HSP 6 Score: 82.8037 bits (203), Expect = 8.308e-15
Identity = 63/257 (24.51%), Postives = 116/257 (45.14%), Query Frame = 1
Query: 4360 LITSRPFEYIIFVLIMLNTISLALKF---DKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGF----KNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNN--HRGDRL--ISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMF-----------------------------GKITTENEKEMK-----EINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAM 4995
            ++  +PF+ +I + I  N ++L +     +         ++ +  VF  +FTVE +LK+ A+G       Y  + WN+ DFIIV+     ++ +   G   +  H G +     +   R FRV+R ++L+S    +  +L + +K+   L ++ALL++ +  IYA+IG+++F                             G+  T N  E +           NF  F  A+L +F+  T E W ++ L+ + DAM
Sbjct:   88 IVEWKPFDILILLTIFANCVALGVYIPFPEDDSNTANHNLEQVEYVFLVIFTVETVLKIVAYGLVLHPSAYIRNGWNLLDFIIVVVGLFSVLLEQGPGRPGDAPHTGGKPGGFDVKALRAFRVLRPLRLVSGVPSLHIVLNSIMKALVPLLHIALLVLFVIIIYAIIGLELFLGRMHKTCYFLGSDMEAEEDPSPCASSGSGRSCTLNHTECRGRWPGPNGGITNFDNFFFAMLTVFQCITMEGWTDV-LYWMQDAM 343          

HSP 7 Score: 75.0998 bits (183), Expect = 1.972e-12
Identity = 73/284 (25.70%), Postives = 124/284 (43.66%), Query Frame = 1
Query: 3352 SFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPL--DAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPIN------NDAISXXXX-----XXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEF---MFAVIGVQLFNGKF-QSCNDVSKNTHI---------SCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIY 4125
            + F     N  R+ C  I     F  ++L+ I  +   L    P   D  ++ N  L   +Y+F  +FTVE  LK++ YGLV H  A+ R+  N+LD ++V+  + S  +        DA           ++ LR  R LR +    G+  +   +   +K++  ++ +  L+ F   ++A+IG++LF G+  ++C  +  +            S  G+    N  +    +      I    NFDN   AMLT+F   T EGW  VLY   D+   +   +Y
Sbjct:   71 ALFCLTLTNPIRRSCISIVEWKPFDILILLTIFANCVALGVYIPFPEDDSNTANHNLEQVEYVFLVIFTVETVLKIVAYGLVLHPSAYIRNGWNLLDFIIVVVGLFSVLLEQGPGRPGDAPHTGGKPGGFDVKALRAFRVLRPLRLVSGVPSLHIVLNSIMKALVPLLHIALLVLFVIIIYAIIGLELFLGRMHKTCYFLGSDMEAEEDPSPCASSGSGRSCTLNHTECRGRWPGPNGGIT---NFDNFFFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVY 351          

HSP 8 Score: 63.929 bits (154), Expect = 4.223e-9
Identity = 73/314 (23.25%), Postives = 133/314 (42.36%), Query Frame = 1
Query: 1045 FRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGP-DVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMY-WINDSVGMSWP----WIYFVSLIIIGSFFVMNLVLGV-----LSGEFSKEREKAKKR 1953
             R  C + V+     + +L  +F N   +A+           +    E    V + +FT E +LK+   G    P  Y+ + +N  D  +V  G++ T L ++    P  +  LR  R+LR  ++     SL  ++ S++ +M  +  + LL    III++++G++LF GK                                    F +    ++  T R        ++FD F  A+LTVFQ +T E W  +MY  I    G  +P     +YF+ L I G++ ++N+ L +      SG+    ++K +++
Sbjct:  518 LRARCRRAVKSNACYWAVLLLVFLNTLTIASEH---HGQPLWLTQTQEYANKVLLCLFTVEMLLKLYGLG----PSVYVASFFNRFDCFVVCGGILETTLVEVGAMQPLGISVLRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQLFGGK------------------------------------FNF----DQTHTKR--------STFDTFPQALLTVFQILTGEDWNVVMYDGIMAYGGPFFPGMLVCVYFIILFICGNYILLNVFLAIAVDNLASGDAGTAKDKGREK 776          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. UniProt/SwissProt
Match: sp|Q25452|CAC1M_MUSDO (Muscle calcium channel subunit alpha-1 OS=Musca domestica OX=7370 PE=2 SV=1)

HSP 1 Score: 1766.51 bits (4574), Expect = 0.000e+0
Identity = 1004/1737 (57.80%), Postives = 1207/1737 (69.49%), Query Frame = 1
Query:  934 TLSAQIASGGRKRTPARSQSGN-----PRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGGAHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFD-KKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSXXXXXXXXXXXXXXXPTNVDGEEAKACNSSN-VSPNIDEKTRFTDAERLIKSEEMNGDI----ADESMRKMSTRIDTXXXXXXXXXXXXXXXXXNGQTSAIRRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHV------------NGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLP--DAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMP-FRTHGRGSGPLISLISPTLVTTNECDEKDKDYLPSHLGAERRTHSIFGTMMNVLQR--------VGSTRRDSNASPSTGSINHSTELPRDR 6042
            T +  + +  +  TP R+Q         RP+RALFCLTL+NP R FCIKIV+ K FEY IL TIFANC ALA  TPYP  DSN  N  LEKIE +F+VIFT+ECV+KI+A+GF++H G+YLRNGWN LDF IV+IG+IST LS + + G DVKALRAFRVLRPLRLVSG+PSLQVV+NSI++AM+PL HIALL LFVIIIYAIIGLELFSGKLH TC   N             +N     D+ H+ G  + C         W GPN GIT+FDNFGL+MLTVFQCIT+EGWT ++Y I D++G SW WIYFVS++I+G+FFVMNL+LGVLSGEFSKER KAK RG +QK RE+ Q +ED++GYLDWI  AEDI  D +    E+  +++ K                    ++        H ++ QQ    F  + +   + NRR RR CR+ VKSQAFYW++I+LVFLNTGVL +EHYRQ IWLD FQ   NI F+ LFT EM++KMYSLG + YF  +FNRFD FVVI SI E+V+  ++ M PLGVSVLRC RLLRVFKVT+YW SL NLV SLL S++SI SLL+LLFLFIVIF LLGMQ+FGG+F F  ++ KPRSNFDSF QSLLTVFQILTGEDWN VMYDGIR+YG +    +++C+YY+ILFICGNYILLNVFLAIAVDNLAD  S                + ++ E+       N +   ++ +    + + +    E   D+     DE     S   +T  +                 +S  RR +        K IP  +SFFIF   N+FR FCH +CNH +FGN +L CIM SSAMLAAE+PL A++SRN +LN FDY FT+VFT+E+ LK+I+YG V H+GAFCRS+ N+LDLLVV  S+IS   N++AISVVKILRVLRVLRPLRAINRAKGLK VVQCV+VAVK+IGNI+LVT LL+FMFAVIGVQLF GKF SC+D SK     C G Y++Y   DI K  + +REW NN  +FD+V  AMLTLF VSTFEGWP +LY SIDS KE+   IYN RPIV+ +YI YII+IAFFM+NIFVGFVIVTFQ EGE+EYKNCELDKNQR CIEFALKAKPVRRYIPK S +Y+VWW +TS  FEY IFVLIM+NT++LA+KF KQP+ Y +++D LNM+FT VF++EF+ KLAAF FKNYF DAWN FDFIIVLGSFIDI+Y  +               N    G  LISINFFRLFRVMRLVKLLS+GEGIRTLLWTF+KSFQALPYVALLIVMLFFIYAVIGMQ+FGKI  E   E   I+RNNNFQTFPQA+LVLFRSATGEAWQ IM+ C P  D  CD  SD                                                V  CGS+ A+PYFISFY++CSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEF+RLWSEYDP+AKGRIKHLDVVTLLRKI+PPLGFGK CPHR AC  LV MNMPLNSDGTV+FNATLFA+VR  L IKTDG+ +D+ N ELR  IK+IWKRT+ ++LDQVV    +D+VTVGKFYAT+LIQ++FRR+K+++  EQ+G        ++L    RT  + S  L   IS  L      DE   +  P H    RR HS+FG +M+ L R        +    R          + H  +L R++
Sbjct:    8 TETDNVQNKQKATTPKRTQRRGGKQQLDRPERALFCLTLKNPLRIFCIKIVDSKLFEYFILLTIFANCVALAVYTPYPSGDSNITNQMLEKIEYIFLVIFTSECVMKIIAYGFVLHTGSYLRNGWNFLDFFIVVIGMISTALSNLVKEGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSILKAMIPLLHIALLVLFVIIIYAIIGLELFSGKLHKTCRHSN---------TGEYLN---DLDELHACGVGFKCPSGYECFDDWVGPNDGITNFDNFGLSMLTVFQCITLEGWTDVLYSIQDAMGSSWEWIYFVSMVILGAFFVMNLILGVLSGEFSKERTKAKNRGDFQKLREKQQIEEDLRGYLDWITQAEDIEPDPDAQIIEDCHKNKVK--------------------EVVSIDNLKDHENETQQTDSWFRSQKKYLERINRRIRRACRKAVKSQAFYWLIILLVFLNTGVLATEHYRQPIWLDQFQEYTNIFFIALFTCEMILKMYSLGFQGYFVSLFNRFDCFVVIGSISEMVLTSSELMAPLGVSVLRCVRLLRVFKVTKYWHSLSNLVASLLNSIQSIASLLLLLFLFIVIFGLLGMQVFGGRFTFKPEEEKPRSNFDSFYQSLLTVFQILTGEDWNVVMYDGIRAYGGVFSFGIVACIYYIILFICGNYILLNVFLAIAVDNLADADSL---------------STIEKEDESQIQLDNQIKNEMENEEYLQNGDHISFKAEFGADLDTYLQDEECGSYSDDENTYNKLGGVKQRV---------SSLPRRNTNTDMDRIKKDIPYGTSFFIFSHTNRFRIFCHRLCNHSNFGNFILCCIMFSSAMLAAENPLKADASRNIVLNKFDYFFTAVFTIELVLKLISYGFVLHDGAFCRSAFNLLDLLVVCVSLISIFFNSNAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIVLVTCLLQFMFAVIGVQLFKGKFFSCSDGSKVYESDCHGTYLFYENGDINKPRLKEREWKNNKFHFDDVAKAMLTLFTVSTFEGWPTLLYVSIDSNKENGGPIYNFRPIVAAYYIIYIIIIAFFMVNIFVGFVIVTFQNEGEQEYKNCELDKNQRNCIEFALKAKPVRRYIPKHSIQYKVWWFVTSSSFEYSIFVLIMINTVTLAMKFYKQPEYYSEILDALNMIFTAVFSLEFIFKLAAFRFKNYFGDAWNTFDFIIVLGSFIDIVYSEIKTKEQALATCDGQSCNKAKGGSTLISINFFRLFRVMRLVKLLSKGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIMLE---EGTSIDRNNNFQTFPQAVLVLFRSATGEAWQEIMMACSPRDDVKCDPESDA-----------------------------------------------VNNCGSSIAFPYFISFYVLCSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFIRLWSEYDPDAKGRIKHLDVVTLLRKISPPLGFGKLCPHRMACKRLVSMNMPLNSDGTVLFNATLFAVVRLPLAIKTDGN-IDEANAELRATIKQIWKRTNPRLLDQVVLTGNDDEVTVGKFYATYLIQDYFRRFKKRK--EQEGKCDQTENAVTLQAGLRTLQQNSPALKRTISGYL------DELASEADPMH----RRHHSLFGKVMSSLLRHEEITSSKIKHLSRTKTIPYQVEFLQHKVQLERNK 1625          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. UniProt/SwissProt
Match: sp|Q24270|CAC1D_DROME (Voltage-dependent calcium channel type D subunit alpha-1 OS=Drosophila melanogaster OX=7227 GN=Ca-alpha1D PE=1 SV=2)

HSP 1 Score: 1732.61 bits (4486), Expect = 0.000e+0
Identity = 999/1701 (58.73%), Postives = 1200/1701 (70.55%), Query Frame = 1
Query:  970 RTPARSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPV-PCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGGAHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFD-KKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSXXXXXXXXXXXXXXXPTNVDGEEAKACNSSNVSPNIDEKTRFTDAERLIKSEEMNGDIADESMRKMSTRIDTXXXXXXXXXXXXXXXXXNGQTSAIRRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIY--------------DHVNGTNNNHR--GDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHC--LPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDD-VTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMP-FRTHGRGSGPLISLISPTLVTTNECDEKDKDYLPSHLGAERRTHSIFGTMMNVLQRVGST--RRDSNASPS 6000
            R   R +    RPQRALFCL+++NP R  CI+IVEWKPFE+LIL TIFANC ALA  TPYP  DSN  N  LEK+E VF+VIFT ECV+KILA+GF++H GAYLRNGWNLLDF IV+IG IST LS++ +   DVKALRAFRVLRPLRLVSG+PSLQVV+NSI++AMVPLFHIALL LFVIIIYAIIGLELFSGKLH  C  +     E  + PC      GYQC         Y C         W GPN GIT+FDNFGLAMLTVFQC+T+EGWT ++Y I D++G  W W+YF+S++I+G+FFVMNL+LGVLSGEFSKER KAK RG +QK RE+ Q +ED++GYLDWI  AEDI  D       +GK  +                    ++    E  G      Q        +K    R   R  R   + +     ++ +++ LVFLNTGVL +EHY Q  WLD+FQ   N+ F+ LFT EML+KMYSLG + YF  +FNRFD FVVI SI E ++  T  MPPLGVSVLRC RLLRVFKVT+YW SL NLV SLL S++SI SLL+LLFLFIVIF+LLGMQ+FGGKFNFD K+ K R NFD F Q+LLTVFQI+TGEDWN VMY GI +YG +     L+C+Y++ILFICGNYILLNVFLAIAVDNLAD  S ++ EK+E  +          +E+    S + +P ID        +  ++ +E++    DE   KM     +++E  E   E +E DEE   T+  RR+SEV    KI PIP  +SFF+F   N+FR FCH++CNH +FGNI+L CIM SSAMLAAE+PL A    N++LN FDY FT+VFT+E+ LK+I+YG V H+GAFCRS+ N+LDLLVV  S+IS   +++AISVVKILRVLRVLRPLRAINRAKGLK VVQCV+VAVK+IGNI+LVT LL+FMFAVIGVQLF GKF  C D SK T   C G Y+ Y++ D+ K  + +REW NN  +FD+V   MLTLF VSTFEGWPG+LY SIDS KE+   I+N RPIV+ +YI YII+IAFFM+NIFVGFVIVTFQ EGE+EYKNC+LDKNQR CIEFALKAKPVRRYIPK   +Y+VWW +TS  FEY IF+LIM+NT++LA+KF  QP  Y +++D LNM+FT VF +EF+ KLAAF FKNYF DAWNVFDFIIVLGSFIDI+Y              D V G  +  +  G  LISINFFRLFRVMRLVKLLS+GEGIRTLLWTF+KSFQALPYVALLIV+LFFIYAV+GMQ+FGKI  +       I  NNNFQTF QA+LVLFRSATGEAWQ IM+ C   PD  CD  SD   +                                               CGS+ AYPYFISFY++CSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEF+RLWSEYDP+AKGRIKHLDVVTLLRKI+PPLGFGK CPHR AC  LV MNMPLNSDGTV+FNATLFA+VRT+L IKTDG+ +D  N ELR  IK+IWKRT+ K+LDQVVPP GNDD VTVGKFYAT+LIQ++FRR+K KR E++    +  S  ++L    RT    S  L   IS  L      DE D++  P H    RR H++FG++ + ++R G+   RR + A+ S
Sbjct:  579 RQQRRGKPQPDRPQRALFCLSVKNPLRALCIRIVEWKPFEFLILLTIFANCIALAVYTPYPGSDSNVTNQTLEKVEYVFLVIFTAECVMKILAYGFVLHNGAYLRNGWNLLDFTIVVIGAISTALSQLMKDAFDVKALRAFRVLRPLRLVSGVPSLQVVLNSILKAMVPLFHIALLVLFVIIIYAIIGLELFSGKLHKACRDEITGEYEENIRPCGV----GYQCPP------GYKCYGG------WDGPNDGITNFDNFGLAMLTVFQCVTLEGWTDVLYSIQDAMGSDWQWMYFISMVILGAFFVMNLILGVLSGEFSKERNKAKNRGDFQKLREKQQIEEDLRGYLDWITQAEDIEPDAVGGLISDGKGKQ-------------------PNEMDSTENLGEEMPEVQMTESRWRKMKKDFDRVNRRMRRACRKAVKSQAFYWLIIV-LVFLNTGVLATEHYGQLDWLDNFQEYTNVFFIGLFTCEMLLKMYSLGFQGYFVSLFNRFDCFVVIGSITETLLTNTGMMPPLGVSVLRCVRLLRVFKVTKYWRSLSNLVASLLNSIQSIASLLLLLFLFIVIFALLGMQVFGGKFNFDGKEEKYRMNFDCFWQALLTVFQIMTGEDWNAVMYVGINAYGGVSSYGALACIYFIILFICGNYILLNVFLAIAVDNLADADSLSEVEKEEEPH----------DESAQKKSHSPTPTIDGMDDHLSIDIDMEQQELD----DED--KMDHETLSDEEVREMCEEEEEVDEEGMITARPRRMSEVNTATKILPIPPGTSFFLFSQTNRFRVFCHWLCNHSNFGNIILCCIMFSSAMLAAENPLRANDDLNKVLNKFDYFFTAVFTIELILKLISYGFVLHDGAFCRSAFNLLDLLVVCVSLISLVSSSNAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIVLVTCLLQFMFAVIGVQLFKGKFFKCTDGSKMTQDECYGTYLVYDDGDVHKPRLREREWSNNRFHFDDVAKGMLTLFTVSTFEGWPGLLYVSIDSNKENGGPIHNFRPIVAAYYIIYIIIIAFFMVNIFVGFVIVTFQNEGEQEYKNCDLDKNQRNCIEFALKAKPVRRYIPKHGIQYKVWWFVTSSSFEYTIFILIMINTVTLAMKFYNQPLWYTELLDALNMIFTAVFALEFVFKLAAFRFKNYFGDAWNVFDFIIVLGSFIDIVYSEIKSKDTSQIAECDIVEGCKSTKKSAGSNLISINFFRLFRVMRLVKLLSKGEGIRTLLWTFIKSFQALPYVALLIVLLFFIYAVVGMQVFGKIALDGG---NAITANNNFQTFQQAVLVLFRSATGEAWQEIMMSCSAQPDVKCDMNSDTPGE----------------------------------------------PCGSSIAYPYFISFYVLCSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFIRLWSEYDPDAKGRIKHLDVVTLLRKISPPLGFGKLCPHRMACKRLVSMNMPLNSDGTVLFNATLFAVVRTSLSIKTDGN-IDDANSELRATIKQIWKRTNPKLLDQVVPPPGNDDEVTVGKFYATYLIQDYFRRFK-KRKEQEGKEGHPDSNTVTLQAGLRTLHEVSPALKRAISGNL------DELDQEPEPMH----RRHHTLFGSVWSSIRRHGNGTFRRSAKATAS 2166          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. UniProt/SwissProt
Match: sp|Q02485|CAC1S_RAT (Voltage-dependent L-type calcium channel subunit alpha-1S OS=Rattus norvegicus OX=10116 GN=Cacna1s PE=1 SV=2)

HSP 1 Score: 1642.09 bits (4251), Expect = 0.000e+0
Identity = 929/1716 (54.14%), Postives = 1167/1716 (68.01%), Query Frame = 1
Query:  958 GGRKRTPARSQSGN-PRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKM-----------SEG-GPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCY-SKNDVMM----ESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNET-SRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGK----ENGK--ESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGGAHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSXXXXXXXXXXXXXXXPTNVDGEEAKACNSSNVSPNIDEKTRFTDAERLIKSEEMNG--DIADESMRKMSTRIDTXXXXXXXXXXXXXXXXXNGQTSAIRR---VSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNG---------------TNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRTHGRGSGPLISLISPTLVTTNECDEKDKDYLPSHLGAERRTHSIFGTMMNVLQRVGS 5970
            G RK+ P +      PRP RALFCLTL+NP RK CI +VEWKPFE +IL TIFANC ALA   P PE D+NT+N  LEK+E  F+++F+ E  +KI+A+GF+ H  AYLR+GWN+LDF+IV +G+ + +L ++           S+G G DVKALRAFRVLRPLRLVSG+PSLQVV+NSI +AM+PLFHIALL LF++IIYAIIGLELF GK+H TCY    D++     E P PC+              +G    C  N +E    W GPN GIT FDNFG +MLTV+QCI+MEGWT ++YW+ND++G  WPWIYFV+LI++GSFF++NLVLGVLSGEF+KEREKAK RG +QK RE+ Q +ED++GY+ WI   E +  D+  +GK    E G   ES +++ GL K  +                      H +Q   VF +                    LVKS+ FYW+VI++V LNT  + SEH+ Q +WL   Q+ AN + + LFT+EML+KMY LG+R YF  +FNRFD FVV   ILEI+++++ AM PLG+SVLRC RLLR+FK+T+YW+SL NLV SLL S++SI SLL+LLFLF++IF+LLGMQLFGG+++F+     RSNFD+F Q+L++VFQ+LTGEDWN VMY+GI +YG      +L C+Y++ILF+CGNYILLNVFLAIAVDNLA+  S                     EE K    S   P+  E+ R T  ++L +  +  G    A   + +  + ++  K+         +++E+  +  A  R   ++E+  KEK  PIP ASSFFIF P NK R  CH I N   F N +L+ I++SSA LAAEDP+ A+S RN+IL YFDY+FT+VFTVEI LK+ TYG   H G+FCR+  NILDLLVV  S+IS  + + AISVVKILRVLRVLRPLRAINRAKGLK VVQCV VA+++IGNI+LVT LL+FMFA IGVQLF GKF SCND+SK T   CRG Y  Y + D  ++ +  R+WI+N  +FDNV +AM++LF VSTFEGWP +LYK+IDS +ED   +YNNR  ++IF+I YII+IAFFM+NIFVGFVIVTFQ++GE EYKNCELDKNQR+C+++ALKA+P+R YIPK  ++Y+VW+++TS  FEY++F LIMLNTI L ++   Q ++   + D LN+ FT +FT+E +LKL AF  + YF D WNVFDF+IV+GS ID+I   ++                 N +      IS  FFRLFRVMRL+KLLSR EG+RTLLWTF+KSFQALPYVALLIVMLFFIYAVIGMQMFGKI   +     +INRNNNFQTFPQA+L+LFR ATGEAWQ I+L C     CD  SD    E Y                                            CG+NFAY YFISFYM+C+FLIINLFVAVIMDNFDYLTRDWSILGPHHLDEF  +W+EYDPEAKGRIKHLDVVTLLR+I PPLGFGK+CPHR AC  LV MNMPLNSDGTV FNATLFALVRT LKIKT+G+  +Q NEELR +IKKIWKRTS K+LDQV+PP G+D+VTVGKFYATFLIQE FR++  KR EE  G    +         RT    + P I       +T  E  E+         G  RRT  +FG + N L+R  S
Sbjct:   10 GLRKKQPKKPVPEILPRPPRALFCLTLQNPLRKACISVVEWKPFETIILLTIFANCVALAVYLPMPEDDNNTLNLGLEKLEYFFLIVFSIEAAMKIIAYGFLFHQDAYLRSGWNVLDFIIVFLGVFTAILEQVNIIQTNTAPMSSKGAGLDVKALRAFRVLRPLRLVSGVPSLQVVLNSIFKAMLPLFHIALLVLFMVIIYAIIGLELFKGKMHKTCYFIGTDIVATVENEKPSPCA-------------RTGSGRPCTINGSECRGGWPGPNHGITHFDNFGFSMLTVYQCISMEGWTDVLYWVNDAIGNEWPWIYFVTLILLGSFFILNLVLGVLSGEFTKEREKAKSRGTFQKLREKQQLEEDLRGYMSWITQGEVMDVDDLREGKLSLDEGGSDTESLYEIEGLNKIIQFI-------------------RHWRQWNRVFRWKCHD----------------LVKSKVFYWLVILIVALNTLSIASEHHNQPLWLTHLQDVANRVLLALFTIEMLMKMYGLGLRQYFMSIFNRFDCFVVCSGILEILLVESGAMTPLGISVLRCIRLLRLFKITKYWTSLSNLVASLLNSIRSIASLLLLLFLFMIIFALLGMQLFGGRYDFEDTEVRRSNFDNFPQALISVFQVLTGEDWNSVMYNGIMAYGGPSYPGVLVCIYFIILFVCGNYILLNVFLAIAVDNLAEAESLTSA------------QKAKAEERKRRKMSRGLPDKSEEERSTMTKKLEQKPKGEGIPTTAKLKIDEFESNVNEVKDPYPSADFPGDDEEDEPEIPASPRPRPLAELQLKEKAVPIPEASSFFIFSPTNKIRVLCHRIVNATWFTNFILLFILLSSAALAAEDPIRADSMRNQILEYFDYVFTAVFTVEIVLKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLISMGLESSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVLVTTLLQFMFACIGVQLFKGKFYSCNDLSKMTEEECRGYYYIYKDGDPTQIELRPRQWIHNDFHFDNVLSAMMSLFTVSTFEGWPQLLYKAIDSNEEDTGPVYNNRVEMAIFFIIYIILIAFFMMNIFVGFVIVTFQEQGETEYKNCELDKNQRQCVQYALKARPLRCYIPKNPYQYQVWYVVTSSYFEYLMFALIMLNTICLGMQHYNQSEQMNHISDILNVAFTIIFTLEMILKLIAFKPRGYFGDPWNVFDFLIVIGSIIDVILSEIDTLLASSGGLYCLGGGCGNVDPDESARISSAFFRLFRVMRLIKLLSRAEGVRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIAMVDG---TQINRNNNFQTFPQAVLLLFRCATGEAWQEILLACSYGKRCDPESDYAPGEEY-------------------------------------------ACGTNFAYYYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKAIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKFCPHRVACKRLVGMNMPLNSDGTVTFNATLFALVRTALKIKTEGN-FEQANEELRAIIKKIWKRTSMKLLDQVIPPIGDDEVTVGKFYATFLIQEHFRKF-MKRQEEYYGYRPKKDTVQIQAGLRTIEEEAAPEIHRAISGDLTAEEELERAMVEAAMEEGIFRRTGGLFGQVDNFLERTNS 1617          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. UniProt/SwissProt
Match: sp|Q02789|CAC1S_MOUSE (Voltage-dependent L-type calcium channel subunit alpha-1S OS=Mus musculus OX=10090 GN=Cacna1s PE=1 SV=2)

HSP 1 Score: 1637.47 bits (4239), Expect = 0.000e+0
Identity = 929/1716 (54.14%), Postives = 1167/1716 (68.01%), Query Frame = 1
Query:  958 GGRKRTPARSQSGN-PRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKM-----------SEG-GPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCY-SKNDVMM----ESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNET-SRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGK----ENGK--ESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGGAHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSXXXXXXXXXXXXXXXPTNVDGEEAKACNSSNVSPNIDEKTRFTDAERLIKSEEMNG--DIADESMRKMSTRIDTXXXXXXXXXXXXXXXXXNGQ---TSAIRRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNG---------------TNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRTHGRGSGPLISLISPTLVTTNECDEKDKDYLPSHLGAERRTHSIFGTMMNVLQRVGS 5970
            G RK+ P +      PRP RALFCLTL+NP RK CI IVEWKPFE +IL TIFANC ALA   P PE D+NT+N  LEK+E  F+++F+ E  +KI+A+GF+ H  AYLR+GWN+LDF+IV +G+ + +L ++           S+G G DVKALRAFRVLRPLRLVSG+PSLQVV+NSI +AM+PLFHIALL LF++IIYAIIGLELF GK+H TCY    D++     E P PC+              +G    C  N +E    W GPN GIT FDNFG +MLTV+QCI+MEGWT ++YW+ND++G  WPWIYFV+LI++GSFF++NLVLGVLSGEF+KEREKAK RG +QK RE+ Q +ED++GY+ WI   E +  D+  +GK    E G   ES +++ GL K  +                      H +Q   VF +                    LVKS+ FYW+VI++V LNT  + SEH+ Q +WL   Q+ AN + + LFT+EML+KMY LG+R YF  +FNRFD FVV   ILEI+++++ AM PLG+SVLRC RLLR+FK+T+YW+SL NLV SLL S++SI SLL+LLFLFI+IF+LLGMQLFGG+++F+     RSNFD+F Q+L++VFQ+LTGEDWN VMY+GI +YG      +L C+Y++ILF+CGNYILLNVFLAIAVDNLA+  S                     EE K    S   P+  E+ R T  ++L +  +  G    A   + +  + ++  K+         +++E+  +   +   R ++E+  KEK  PIP ASSFFIF P NK R  CH I N   F N +L+ I++SSA LAAEDP+ A+S RN+IL YFDY+FT+VFTVEI LK+ TYG   H G+FCR+  NILDLLVV  S+IS  + + AISVVKILRVLRVLRPLRAINRAKGLK VVQCV VA+++IGNI+LVT LL+FMFA IGVQLF GKF SCND+SK T   CRG Y  Y + D  ++ +  R+WI+N  +FDNV +AM++LF VSTFEGWP +LYK+IDS +ED   +YNNR  ++IF+I YII+IAFFM+NIFVGFVIVTFQ++GE EYKNCELDKNQR+C+++ALKA+P+R YIPK  ++Y+VW+++TS  FEY++F LIMLNTI L ++   Q ++   + D LN+ FT +FT+E +LKL AF  + YF D WNVFDF+IV+GS ID+I   ++                 N +      IS  FFRLFRVMRLVKLL+R EG+RTLLWTF+KSFQALPYVALLIVMLFFIYAVIGMQMFGKI   +     +INRNNNFQTFPQA+L+LFR ATGEAWQ I+L C    +CD  SD    E +                                            CG+NFAY YFISFYM+C+FLIINLFVAVIMDNFDYLTRDWSILGPHHLDEF  +W+EYDPEAKGRIKHLDVVTLLR+I PPLGFGK+CPHR AC  LV MNMPLNSDGTV FNATLFALVRT LKIKT+G+  +Q NEELR +IKKIWKRTS K+LDQV+PP G+D+VTVGKFYATFLIQE FR++  KR EE  G    +         RT    + P I        T  E  E+         G  RRT  +FG + N L+R  S
Sbjct:   10 GLRKKQPKKPVPEILPRPPRALFCLTLQNPLRKACISIVEWKPFETIILLTIFANCVALAVYLPMPEDDNNTLNLGLEKLEYFFLIVFSIEAAMKIIAYGFLFHQDAYLRSGWNVLDFIIVFLGVFTVILEQVNIIQTNTAPMSSKGAGLDVKALRAFRVLRPLRLVSGVPSLQVVLNSIFKAMLPLFHIALLVLFMVIIYAIIGLELFKGKMHKTCYFIGTDIVATVENEKPSPCA-------------RTGSGRPCTINGSECRGGWPGPNHGITHFDNFGFSMLTVYQCISMEGWTDVLYWVNDAIGNEWPWIYFVTLILLGSFFILNLVLGVLSGEFTKEREKAKSRGTFQKLREKQQLEEDLRGYMSWITQGEVMDVDDLREGKLSLDEGGSDTESLYEIEGLNKIIQFI-------------------RHWRQWNRVFRWKCHD----------------LVKSKVFYWLVILIVALNTLSIASEHHNQPLWLTHLQDVANRVLLTLFTIEMLMKMYGLGLRQYFMSIFNRFDCFVVCSGILEILLVESGAMSPLGISVLRCIRLLRLFKITKYWTSLSNLVASLLNSIRSIASLLLLLFLFIIIFALLGMQLFGGRYDFEDTEVRRSNFDNFPQALISVFQVLTGEDWNSVMYNGIMAYGGPTYPGVLVCIYFIILFVCGNYILLNVFLAIAVDNLAEAESLTSA------------QKAKAEERKRRKMSKGLPDKSEEERATVTKKLEQKSKGEGIPTTAKLKIDEFESNVNEVKDPYPSADFPGDDEEDEPEIPVSPRPRPLAELQLKEKAVPIPEASSFFIFSPTNKIRVLCHRIVNATWFTNFILLFILLSSAALAAEDPIRADSMRNQILEYFDYVFTAVFTVEIVLKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLISMGLESSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVLVTTLLQFMFACIGVQLFKGKFYSCNDLSKMTEEECRGYYYIYKDGDPTQIELRPRQWIHNDFHFDNVLSAMMSLFTVSTFEGWPQLLYKAIDSNEEDTGPVYNNRVEMAIFFIIYIILIAFFMMNIFVGFVIVTFQEQGETEYKNCELDKNQRQCVQYALKARPLRCYIPKNPYQYQVWYVVTSSYFEYLMFALIMLNTICLGMQHYNQSEQMNHISDILNVAFTIIFTLEMVLKLIAFKPRAYFGDPWNVFDFLIVIGSIIDVILSEIDTFLASSGGLYCLGGGCGNVDPDESARISSAFFRLFRVMRLVKLLNRAEGVRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIAMVDG---TQINRNNNFQTFPQAVLLLFRCATGEAWQEILLACSYGKLCDPESDYAPGEEHT-------------------------------------------CGTNFAYYYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKAIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKFCPHRVACKRLVGMNMPLNSDGTVTFNATLFALVRTALKIKTEGN-FEQANEELRAIIKKIWKRTSMKLLDQVIPPIGDDEVTVGKFYATFLIQEHFRKF-MKRQEEYYGYRPKKDTVQIQAGLRTIEEEAAPEIHRAISGDPTAEEELERAMVEAAMEEGIFRRTGGLFGQVDNFLERTNS 1617          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. UniProt/SwissProt
Match: sp|P07293|CAC1S_RABIT (Voltage-dependent L-type calcium channel subunit alpha-1S OS=Oryctolagus cuniculus OX=9986 GN=CACNA1S PE=1 SV=1)

HSP 1 Score: 1627.45 bits (4213), Expect = 0.000e+0
Identity = 924/1716 (53.85%), Postives = 1161/1716 (67.66%), Query Frame = 1
Query:  958 GGRKRTPARSQSGN-PRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKM-----------SEG-GPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYS-KNDVMM----ESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNET-SRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGK----ENGK--ESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGGAHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSXXXXXXXXXXXXXXXPTNVDGEEAKACNSSNVSPNIDEKTRFTDAERLIKSEEMNG--DIADESMRKMSTRIDTXXXXXXXXXXXXXXXXXNGQ---TSAIRRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNG---------------TNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRTHGRGSGPLISLISPTLVTTNECDEKDKDYLPSHLGAERRTHSIFGTMMNVLQRVGS 5970
            G RK+ P +      PRP RALFCLTL+NP RK CI IVEWKPFE +IL TIFANC ALA   P PE D+N++N  LEK+E  F+ +F+ E  +KI+A+GF+ H  AYLR+GWN+LDF+IV +G+ + +L ++           S+G G DVKALRAFRVLRPLRLVSG+PSLQVV+NSI +AM+PLFHIALL LF++IIYAIIGLELF GK+H TCY    D++     E P PC+              +G    C  N +E    W GPN GIT FDNFG +MLTV+QCITMEGWT ++YW+ND++G  WPWIYFV+LI++GSFF++NLVLGVLSGEF+KEREKAK RG +QK RE+ Q +ED++GY+ WI   E +  ++  +GK    E G   ES +++ GL K  +                      H +Q   VF +                    LVKS+ FYW+VI++V LNT  + SEH+ Q +WL   Q+ AN + + LFT+EML+KMY LG+R YF  +FNRFD FVV   ILE++++++ AM PLG+SVLRC RLLR+FK+T+YW+SL NLV SLL S++SI SLL+LLFLFI+IF+LLGMQLFGG+++F+     RSNFD+F Q+L++VFQ+LTGEDWN VMY+GI +YG      +L C+Y++ILF+CGNYILLNVFLAIAVDNLA+  S                     EE K    S   P+  E+ +   A++L +  +  G    A   + +  + ++  K+         +++E+  +   +   R ++E+  KEK  PIP ASSFFIF P NK R  CH I N   F N +L+ I++SSA LAAEDP+ AES RN+IL YFD  FTSVFTVEI LK+ TYG   H G+FCR+  NILDLLVV  S+IS  + +  ISVVKILRVLRVLRPLRAINRAKGLK VVQCV VA+++IGNI+LVT LL+FMFA IGVQLF GKF SCND+SK T   CRG Y  Y + D  ++ +  R+WI+N  +FDNV +AM++LF VSTFEGWP +LY++IDS +ED   +YNNR  ++IF+I YII+IAFFM+NIFVGFVIVTFQ++GE EYKNCELDKNQR+C+++ALKA+P+R YIPK  ++Y+VW+++TS  FEY++F LIMLNTI L ++   Q +    + D LN+ FT +FT+E +LKL AF  + YF D WNVFDF+IV+GS ID+I   ++                 N +      IS  FFRLFRVMRL+KLLSR EG+RTLLWTF+KSFQALPYVALLIVMLFFIYAVIGMQMFGKI   +     +INRNNNFQTFPQA+L+LFR ATGEAWQ I+L C    +CD  SD    E Y                                            CG+NFAY YFISFYM+C+FLIINLFVAVIMDNFDYLTRDWSILGPHHLDEF  +W+EYDPEAKGRIKHLDVVTLLR+I PPLGFGK+CPHR AC  LV MNMPLNSDGTV FNATLFALVRT LKIKT+G+  +Q NEELR +IKKIWKRTS K+LDQV+PP G+D+VTVGKFYATFLIQE FR++  KR EE  G    +         RT    + P I       +T  E  E+            RRT  +FG +   L+R  S
Sbjct:   10 GLRKKQPKKPLPEVLPRPPRALFCLTLQNPLRKACISIVEWKPFETIILLTIFANCVALAVYLPMPEDDNNSLNLGLEKLEYFFLTVFSIEAAMKIIAYGFLFHQDAYLRSGWNVLDFIIVFLGVFTAILEQVNVIQSNTAPMSSKGAGLDVKALRAFRVLRPLRLVSGVPSLQVVLNSIFKAMLPLFHIALLVLFMVIIYAIIGLELFKGKMHKTCYYIGTDIVATVENEKPSPCA-------------RTGSGRPCTINGSECRGGWPGPNHGITHFDNFGFSMLTVYQCITMEGWTDVLYWVNDAIGNEWPWIYFVTLILLGSFFILNLVLGVLSGEFTKEREKAKSRGTFQKLREKQQLEEDLRGYMSWITQGEVMDVEDLREGKLSLEEGGSDTESLYEIEGLNKIIQFI-------------------RHWRQWNRVFRWKCHD----------------LVKSRVFYWLVILIVALNTLSIASEHHNQPLWLTHLQDIANRVLLSLFTIEMLLKMYGLGLRQYFMSIFNRFDCFVVCSGILELLLVESGAMTPLGISVLRCIRLLRLFKITKYWTSLSNLVASLLNSIRSIASLLLLLFLFIIIFALLGMQLFGGRYDFEDTEVRRSNFDNFPQALISVFQVLTGEDWNSVMYNGIMAYGGPSYPGVLVCIYFIILFVCGNYILLNVFLAIAVDNLAEAESLTSA------------QKAKAEERKRRKMSRGLPDKTEEEKSVMAKKLEQKPKGEGIPTTAKLKVDEFESNVNEVKDPYPSADFPGDDEEDEPEIPVSPRPRPLAELQLKEKAVPIPEASSFFIFSPTNKVRVLCHRIVNATWFTNFILLFILLSSAALAAEDPIRAESVRNQILGYFDIAFTSVFTVEIVLKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLISMGLESSTISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVLVTTLLQFMFACIGVQLFKGKFFSCNDLSKMTEEECRGYYYVYKDGDPTQMELRPRQWIHNDFHFDNVLSAMMSLFTVSTFEGWPQLLYRAIDSNEEDMGPVYNNRVEMAIFFIIYIILIAFFMMNIFVGFVIVTFQEQGETEYKNCELDKNQRQCVQYALKARPLRCYIPKNPYQYQVWYVVTSSYFEYLMFALIMLNTICLGMQHYHQSEEMNHISDILNVAFTIIFTLEMILKLLAFKARGYFGDPWNVFDFLIVIGSIIDVILSEIDTFLASSGGLYCLGGGCGNVDPDESARISSAFFRLFRVMRLIKLLSRAEGVRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIALVDG---TQINRNNNFQTFPQAVLLLFRCATGEAWQEILLACSYGKLCDPESDYAPGEEYT-------------------------------------------CGTNFAYYYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKAIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKFCPHRVACKRLVGMNMPLNSDGTVTFNATLFALVRTALKIKTEGN-FEQANEELRAIIKKIWKRTSMKLLDQVIPPIGDDEVTVGKFYATFLIQEHFRKF-MKRQEEYYGYRPKKDTVQIQAGLRTIEEEAAPEIRRTISGDLTAEEELERAMVEAAMEERIFRRTGGLFGQVDTFLERTNS 1617          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. TrEMBL
Match: G0YP32 (Voltage-dependent L-type calcium channel subunit alpha OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 4135.49 bits (10724), Expect = 0.000e+0
Identity = 2321/2654 (87.45%), Postives = 2460/2654 (92.69%), Query Frame = 1
Query:  223 MLNDRIYPNNMTGGRSGIDNCHPNQYSAPMHQYRQLFHTDQPFYDSHTRNTEYKCVENDYIESRYRFEPRTNYQLNYSPPGQFXXXXXXXXXXXXXXXXXXGVHEYSDGDGDYGDQNQRRPLVSQPAKINIDEIPQLQISSDQNEPNEPKYDLNNNNVFKMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTNPPAIYSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRPLNLAALTLSAQIASGGRKRTPARSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETS-RWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGGAHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSXXXXXXXXXXXXXXXPTNVDGEEAKACNSSNVSPNIDEKTRFTDAERLIKSEEMNGDIADESMRKMSTRIDTXXXXXXXXXXXXXXXXXNGQTSAIRRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNN-HRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRTHGR-GSGPLISLISPTLVTTNECDEKDKDYLPSHLGAERRTHSIFGTMMNVLQRVGSTRRDSNASPSTGSINHSTELPRDRSNSRPMILNQSKSPTNHPPVKLTLAPVIEGQVISNEEYSAEIPPKLPKTVSKQSLNYDKKPLTSKQPRVEYTMRDKLSLRSPPLDIDLPLLRSNVFXXXXXXXXXXXXXXXXXKEEKVVSPVYSSGYSDEEDRISTESLIYVRRKSKDRYKGQSSHNRIGTVRPSNIDSRRYSNKERVTNNQDIRYYKGSPNEYXXXXXXXXXXXXFYPQNIPSNRCSNVXXXXXXXXXXXXXXNXXXXXXXXXXXXAFIYPLSRGDXXXXXXXXXXXHQRYQXXXXXXXXMGQCLGRQSSRESLIDRGLVQPILFAQNQAVLLAGIGDCKQFVNTSLRRRLPDTPQFPAGKESVPFNPYEKSIANQLRNIRKSKIVNVPKLKYHQELIDNSQFPNESDNESYSADIAGLGTFNLEEWRNSXXXXXXXXXXLRYCPQRSNKETFRQEHQKNNFNRYDSLRQPERSSYLLHHQCSLEEEQIDSTEDYDEEIDQLKIQNQYEKDYNRYMLKYAPSNPRSQFVDPRNCCADPRVSRNPMPDLISSTDWLLEKCQNAPAMKNHTY-QKNYKYPQLLTEETFSRRARMDANSXXXXXXXXXXXXSQYVLSQQRESDEMEYLQMSQENIDKSFTNLRTRSKQYSDMGSQTHLEMSEPLLKQSIPNHLLSKSINPVFSPPIRPPYYEHLGGYGLHELKDSNVWSMRDENMSSILSRGATVRPFHPHGT 8172
            MLNDRIYPNN+TGGRSGID+CHP QYSAPMHQYRQL+  D+P+YD+H RNTEYKCVENDY+E+ YR++ R NYQLNYSPPGQFD+EEE+E+D   + + E  VHEYSDGDGDYG++NQ+RPLVSQPAKINIDEIPQLQIS +QNEP++ K+D+NNN+V K+DDD+S SS N++         A   A     TNPPAIYSGFGGLGSGLGGGGLGGILGVAAAAAQQQGRPLNLAALTLSAQIASGGRKR PARSQSGNPRP+RALFCLTLRNPFRKFCI IVEWKPFEYLIL TIFANC ALAANTPYPERDSN +NSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCY K +++ME+PVPCSTS++KGYQCDDFH SG KY CKD KN +S RW GPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKER KAKKRGKYQKAREQMQF+EDVQGYLDWIGAAEDISDDE+N+GKENGKESRFKLCGLCKSS KSDDGDDQLSDK+DLETEGG HHSQQQQYVFCFPLKSRRGRKWNRRCRRI RRLVKSQAFYWVVIVLVFLNTGVLTSEHYRQS+WLDSFQ+TANIIFVVLFTLEMLIKMYSLGMRCYFDFMFNRFDFFVVIFSI EIVMIQT  MPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKSIVSLLVLLFLFIVIF+LLGMQLFGGKFNF+KK KPRSNFDSF QSLLTVFQILTGEDWNEVMYDGIRSY NLG+S+MLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSGNKEEKKEGENEE E  N + EE K C S++VSPN+DEK RFTDAERLIKSEEMNGDI ++SMRKMSTR D E +N+EEY EG EEDEENGQ SAIRRVSEVMAKEKIKPIPNASSFFIFGPNN+FRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAES RN+ILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISVVKILRVLRVLRPLRAINRAKGLKRVVQCVVVAVKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCND+SK+T   C+G +I YNEADIAK  VNKREW NNPLNFDNVPNAMLTLFAVSTFEGWPG+LYKSIDSFKEDYSG YNNRP+VSIFYIAYIIVIAFFMINIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFD QP +YE+VMDYLNMVFTGVFTVEF+LKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVN T+N+ HRGD+LISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKE +EINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDA+CDA SDQIRKEY N+T+ + +        +SM+ WPP N  K KINKYIS +QD+AKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGM YSQ+KRLSLMPFRTHGR GSGPL SLISPTLVTTNECDEKDKDYLP+HLGAERRTHSIFGTMMNVLQRVGSTRRDSNASPSTGSIN S E  RDRSNSRPMIL+QSKSPTNHPPVKLTLAPVIEGQVISN+EYS EIPPK+PKTVSKQSLNYDKK  T+KQ + EY +R+K+S R  PLDIDLPL RSNVFPRPSRSQSSESPESIQRKEEKVVSPVYSSGYSDEEDRISTESLIYVRRKSKDRYKGQSSH RI  V PSNIDSR+Y+NK R + + +  YYKGSPN+YS QSS ESSE+Q+YP+NIPSNRCSNVQIIDLDISLSSS DN +E+EY G E+EAFIYPLSRGDTPSPAPPPPTAHQRYQSSSRTSSS+GQCLGRQSSRESLIDRGLVQPILFAQNQAVLLAGIGDCKQFVNTSLRRRLPDTPQFP+ KE+VPFNPYEKSIANQLRNIR+SKIVN+PK KYHQE+IDNS++ N SDNES S +    G F+LEEWR+SPPPTPAPN N+RY  QR ++E  R E QK N +RYDS RQ ERSSY++ HQCSLEEE I+ST+DY+EEIDQ K  NQYE+DYNRYM+KYA SNPRS ++ PRNC  DPR+SRNPMPDLISSTDWLL+KCQN P + N  + QKNYKYPQ LTEETFSRRARMDANSPPPEPAPRQELP+QYVLSQQRESDE++Y+QMS+ENIDKSF  LRT SKQYSDMGSQT+LEM+EPLLKQSIPNHLLSKSINPVFSPPIRPPYYEHLGGYGLHELKDSNVWSMRDENMS +++RG      HP  T
Sbjct:    1 MLNDRIYPNNLTGGRSGIDHCHPTQYSAPMHQYRQLY-ADRPYYDTHNRNTEYKCVENDYLETGYRYDTRNNYQLNYSPPGQFDEEEEDEDDRNYFDNEER-VHEYSDGDGDYGNKNQKRPLVSQPAKINIDEIPQLQISCEQNEPHDVKFDMNNNSVIKVDDDQSVSSNNIIKSQNDKTPCAKTVA-----TNPPAIYSGFGGLGSGLGGGGLGGILGVAAAAAQQQGRPLNLAALTLSAQIASGGRKRAPARSQSGNPRPKRALFCLTLRNPFRKFCIGIVEWKPFEYLILLTIFANCFALAANTPYPERDSNMVNSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYYKQELVMENPVPCSTSISKGYQCDDFHLSGLKYSCKDFKNVSSIRWEGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKERLKAKKRGKYQKAREQMQFEEDVQGYLDWIGAAEDISDDEDNEGKENGKESRFKLCGLCKSSGKSDDGDDQLSDKMDLETEGGGHHSQQQQYVFCFPLKSRRGRKWNRRCRRIFRRLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSLWLDSFQDTANIIFVVLFTLEMLIKMYSLGMRCYFDFMFNRFDFFVVIFSIGEIVMIQTKLMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKSIVSLLVLLFLFIVIFALLGMQLFGGKFNFEKKGKPRSNFDSFWQSLLTVFQILTGEDWNEVMYDGIRSYSNLGRSAMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSGNKEEKKEGENEEEEGNNAENEEKKVCTSNSVSPNLDEKNRFTDAERLIKSEEMNGDIGEDSMRKMSTRGDKEIDNEEEYGEGGEEDEENGQASAIRRVSEVMAKEKIKPIPNASSFFIFGPNNRFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESPRNKILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISVVKILRVLRVLRPLRAINRAKGLKRVVQCVVVAVKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDLSKSTFNVCKGHFILYNEADIAKAVVNKREWTNNPLNFDNVPNAMLTLFAVSTFEGWPGLLYKSIDSFKEDYSGTYNNRPVVSIFYIAYIIVIAFFMINIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDNQPLQYEKVMDYLNMVFTGVFTVEFVLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNVTSNSPHRGDKLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEFREINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAVCDAYSDQIRKEYINVTLTKGKLDSRNNLTESMITWPP-NVSKYKINKYISQHQDIAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMTYSQNKRLSLMPFRTHGRAGSGPLHSLISPTLVTTNECDEKDKDYLPAHLGAERRTHSIFGTMMNVLQRVGSTRRDSNASPSTGSINQSNESHRDRSNSRPMILSQSKSPTNHPPVKLTLAPVIEGQVISNDEYSTEIPPKIPKTVSKQSLNYDKKIPTNKQSKTEYPIREKVSHRPNPLDIDLPLHRSNVFPRPSRSQSSESPESIQRKEEKVVSPVYSSGYSDEEDRISTESLIYVRRKSKDRYKGQSSHYRISAVHPSNIDSRKYTNKGRPSMSHNNEYYKGSPNDYSGQSSGESSELQYYPKNIPSNRCSNVQIIDLDISLSSSPDNEEEYEYGGAEDEAFIYPLSRGDTPSPAPPPPTAHQRYQSSSRTSSSLGQCLGRQSSRESLIDRGLVQPILFAQNQAVLLAGIGDCKQFVNTSLRRRLPDTPQFPSAKENVPFNPYEKSIANQLRNIRQSKIVNLPKRKYHQEMIDNSRYVNASDNESNSPENIPQGAFDLEEWRDSPPPTPAPNNNIRYSRQRIDQEPLRAEPQK-NMHRYDSPRQSERSSYMMRHQCSLEEEPIESTDDYEEEIDQSKAPNQYEQDYNRYMMKYASSNPRSHYMVPRNCYIDPRMSRNPMPDLISSTDWLLDKCQNIPVLANRMFQQKNYKYPQQLTEETFSRRARMDANSPPPEPAPRQELPTQYVLSQQRESDEIDYMQMSEENIDKSFKTLRTHSKQYSDMGSQTNLEMTEPLLKQSIPNHLLSKSINPVFSPPIRPPYYEHLGGYGLHELKDSNVWSMRDENMSPVVNRGPIKSMRHPTKT 2645          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. TrEMBL
Match: A0A068WA30 (Voltage-dependent L-type calcium channel subunit alpha OS=Echinococcus granulosus OX=6210 GN=EgrG_000960800 PE=3 SV=1)

HSP 1 Score: 2033.84 bits (5268), Expect = 0.000e+0
Identity = 1139/1723 (66.11%), Postives = 1297/1723 (75.28%), Query Frame = 1
Query:  910 RPLNLAALTLSAQIASGGRKRTPARSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKM-SEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYS-KNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETS-----------------------------RWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGGAHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSXXXXXXXXXXXXXXXPTNVDGEEAKACNSSNVSPNIDEKTRFTDAERLIKSEEMNGDIADESMRKMSTRIDTXXXXXXXXXXXXXXXXXNGQTSAIRRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPD-AMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAG-NDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRTHGRGSGPLISLISPTLVTTNECDEKDKDYLPSHLGAERRTHSIFGTMMNVLQRVGSTRR 5979
            +PLNL  L L+AQ  +  RKR  +R+Q+   RPQRALFCL+LRNP RK CI IVEWKPFEYLIL TI  NC AL ++TPYP+ DSN  NS LEK+E VFIVIFT EC+LKI+A GF+MHPGAYLRNGWN+LDF IV +GL+  +L +M    G DVKALRAFRVLRPLRLVSGLPSLQVV+N+I+RAMVPL HIALL +FVI +YAI+GLELFSGKLH+TCY      +M++P PCS    +G+ C       F ++C D +   +                             RW GPN GIT+FDN   +MLTVFQC+TMEGWT ++YW+NDS GM WP++YFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQF EDVQGYLDWIGAAED+SDDE+N  + + KE RF  CGLC+ S+  +D D+  SD+ D         SQQ+QY FCFP++ RR R+ NRRCRR CRR+VKSQ FYW VIVLVFLNTGVLTSEHY Q  WLD FQN AN++FVVLFT+EML+KMYSLG+RCYFD+MFNRFD FVVI SILEIV I T  MPPLGVSV RCARLLRVFKVTRYW+SLRNLVGSLLASM+SI SLLVLLFLFIVIF+LLGMQ+FGG+FNF    KPRSNFD+F Q+L TVFQILTGEDWNE MY GI+SY      S++ CLYYV+LFICGNYILLNVFLAIAVDNLADTG    ++K E        T+ DG++  A      S + D    F  AE   KS  +     +E+   +S                + ++E     S     S    + KIKPIP ASSFFIFGP N FR FCH+ICNHP+F N+VLVCI+VSSAMLAAEDPL A S RN ILNYFDY FTSVFTVEITLKVITYG  FH GAFCRS+NN+LDL+VVLTSIISYPI  D ISVVKILRV RVLRPLRAINRAKGLK VVQCVVVAVKSIGNIMLVTFLLEFMFAVIGVQLF GKF  CND ++     C G +I Y+  D +   + +R WIN PLNFDNVPN +LTLF  STFEGWP +LY+SIDS+ ED+  +YN RP+V IFY+A+I+V+AFFM+NIFVGFVIVTFQQEGE+EYK CELDKNQRKCIEFALKA+PVRRYIPK+ F+YR+WW +TS+PFEY IF+ I++NTI L +KF+ QP  Y   +DYLNM+FTGVFTVEF+LKL A  FKNYF+D WNVFDFIIV+GSF+DI+  H+          + ISINFFRLFRVMRL+KLLSRGEGIRTLLWTFVKSFQALPYVALLI+MLFFIYAVIGMQMFGKI   N      I  N NFQTFPQA+L+LFRSATGEAWQ+IM  C  + A CD  SD+ R                +G  D  V                        CGS FAYP+FISFY+ICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKI+PPLGFGK CPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKT+GST DQLNEELR VIKKIWK TS K+LDQVVPPAG NDDVTVGKFYATFLIQEWFRRWK K+ EE K + Y Q KR S+MPFR  GR      SL+ P        +EK      S    ++R  S+ G+MM+ LQRVGS RR
Sbjct:  106 KPLNLTNLALAAQ--TNARKRPASRAQAAGSRPQRALFCLSLRNPLRKMCIGIVEWKPFEYLILITILGNCFALGSHTPYPDGDSNGTNSILEKVENVFIVIFTIECLLKIVALGFVMHPGAYLRNGWNILDFTIVCLGLLQPLLQRMLDRSGVDVKALRAFRVLRPLRLVSGLPSLQVVLNAIIRAMVPLLHIALLVIFVITMYAIVGLELFSGKLHATCYDIYTGEIMDNPTPCSLG-RQGHICK------FPFVCHDFRPNMTKAAIAERRVIVANMSADPYAFTGFIKLPERWPGPNYGITNFDNLAASMLTVFQCVTMEGWTNVLYWMNDSQGMEWPFLYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFAEDVQGYLDWIGAAEDLSDDEDNVNRLDVKEKRFNFCGLCRRSQGGEDEDEDDSDRDDCGYR--TQSSQQKQYFFCFPIRGRRSRRLNRRCRRSCRRMVKSQTFYWTVIVLVFLNTGVLTSEHYGQPKWLDIFQNDANVVFVVLFTIEMLLKMYSLGVRCYFDYMFNRFDCFVVICSILEIVFIMTKLMPPLGVSVFRCARLLRVFKVTRYWNSLRNLVGSLLASMRSIASLLVLLFLFIVIFALLGMQIFGGRFNFLSLRKPRSNFDNFYQALTTVFQILTGEDWNEAMYMGIKSYSTQPFGSLV-CLYYVVLFICGNYILLNVFLAIAVDNLADTGQSKGKQKSEA-------TSEDGDDNTAGMDIVKSADGDS---FNSAEEDGKSTFLTNSKNNENEEYVSIE--------------ERDNESESVYSDEHHGSAENLQPKIKPIPEASSFFIFGPRNPFRVFCHYICNHPYFNNVVLVCILVSSAMLAAEDPLKANSYRNIILNYFDYFFTSVFTVEITLKVITYGFAFHKGAFCRSANNLLDLMVVLTSIISYPIALDTISVVKILRVSRVLRPLRAINRAKGLKHVVQCVVVAVKSIGNIMLVTFLLEFMFAVIGVQLFAGKFHYCNDEARFYKEECAGPFIKYDSEDPSLPELVERRWINYPLNFDNVPNGLLTLFVASTFEGWPALLYQSIDSYAEDHGKVYNCRPVVVIFYVAFIVVVAFFMVNIFVGFVIVTFQQEGEQEYKGCELDKNQRKCIEFALKARPVRRYIPKERFQYRIWWFVTSQPFEYCIFIFILINTICLGMKFEGQPPVYADALDYLNMIFTGVFTVEFILKLTALSFKNYFNDLWNVFDFIIVVGSFVDIVLSHIA------ENSKFISINFFRLFRVMRLIKLLSRGEGIRTLLWTFVKSFQALPYVALLILMLFFIYAVIGMQMFGKIALNNPD--SAITVNANFQTFPQAVLILFRSATGEAWQDIMFSCAGETAYCDKQSDESRTA--------------VGATDRTV------------------------CGSAFAYPFFISFYIICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKISPPLGFGKLCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTEGSTPDQLNEELRAVIKKIWKHTSPKLLDQVVPPAGSNDDVTVGKFYATFLIQEWFRRWKLKKAEEHKHLPYGQHKRHSIMPFR--GR------SLMHPE-------EEKGGG---SSASDDKRQMSLLGSMMHALQRVGSYRR 1728          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. TrEMBL
Match: W6UN84 (Voltage-dependent L-type calcium channel subunit alpha OS=Echinococcus granulosus OX=6210 GN=EGR_02129 PE=3 SV=1)

HSP 1 Score: 1963.73 bits (5086), Expect = 0.000e+0
Identity = 1126/1804 (62.42%), Postives = 1294/1804 (71.73%), Query Frame = 1
Query:  910 RPLNLAALTLSAQIASGGRKRTPARSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKM-SEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCY------------------SKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETS-----------------------------RWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGGAHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSXXXXXXXXXXXXXXXPTNVDGEEAKACNSSNVSPNIDEKTRFTDAERLIKSEEMNGDIADESMRKMSTRIDTXXXXXXXXXXXXXXXXXNGQTSAIRRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALK----------------------------------FDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFK-----------NYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPP-HNFVKVKINK---------YISHYQDVAK----------CGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAG-NDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRTHGRGSGPLISLISPTLVTTNECDEKDKDYLPSHLGAERRTHSIFGTMMNVLQRVGSTRR 5979
            +PLNL  L L+AQ  +  RKR  +R+Q+   RPQRALFCL+LRNP RK CI IVEWKPFEYLIL TI  NC AL ++TPYP+ DSN  NS LEK+E VFIVIFT EC+LKI+A GF+MHPGAYLRNGWN+LDF IV +GL+  +L +M    G DVKALRAFRVLRPLRLVSGLPSLQVV+N+I+RAMVPL HIALL +FVI +YAI+GLELFSGKLH+TCY                  S    +M++P PCS    +G+ C       F ++C D +   +                             RW GPN GIT+FDN   +MLTVFQC+TMEGWT ++YW+NDS GM WP++YFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQF EDVQGYLDWIGAAED+SDDE+N  + + KE RF  CGLC+ S+  +D D+  SD+ D         SQQ+QY FCFP++ RR R+ NRRCRR CRR+VKSQ FYW VIVLVFLNTGVLTSEHY Q  WLD FQN AN++FVVLFT+EML+KMYSLG+RCYFD+MFNRFD FVVI SILEIV I T  MPPLGVSV RCARLLRVFKVTRYW+SLRNLVGSLLASM+SI SLLVLLFLFIVIF+LLGMQ+FGG+FNF    KPRSNFD+F Q+L TVFQILTGEDWNE MY GI+SY      S++ CLYYV+LFIC   ILLNVFLAIAVDNLADTG                     G++     S   S + D+ T   D   ++KS + +   + E   K    +    EN+E  +  + ++E     S     S    + KIKPIP ASSFFIFGP N FR FCH+ICNHP+F N+VLVCI+VSSAMLAAEDPL A S RN ILNYFDY FTSVFTVEITLKVITYG  FH GAFCRS+NN+LDL+VVLTSIISYPI  D ISVVKILRV RVLRPLRAINRAKGLK VVQCVVVAVKSIGNIMLVTFLLEFMFAVIGVQLF GKF  CND ++     C G +I Y+  D +   + +R WIN PLNFDNVPN +LTLF  STFEGWP +LY+SIDS+ ED+  +YN RP+V IFY+A+I+V+AFFM+NIFVGFVIVTFQQEGE+EYK CELDKNQRKCIEFALKA+PVRRYIPK+ F+YR+WW +TS+PFEY IF+ I++NTI L +K                                  F+ QP  Y   +DYLNM+FTGVFTVEF+LKL A  FK           NYF+D WNVFDFIIV+GSF+DI+  H+          + ISINFFRLFRVMRL+KLLSRGEGIRTLLWTFVKSFQALPYVALLI+MLFFIYAVIGMQMFGKI   N      I  N NFQTFPQA+L+LFRSATGEAWQ+IM  C     CD L                       +  S+ ++PP  ++ ++ ++          Y     D ++          CGS FAYP+FISFY+ICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKI+PPLGFGK CPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKT+GST DQLNEELR VIKKIWK TS K+LDQVVPPAG NDDVTVGKFYATFLIQEWFRRWK K+ EE K + Y Q + L + P    G GS              +  D+K             R  S+ G+MM+ LQRVGS RR
Sbjct:  163 KPLNLTNLALAAQ--TNARKRPASRAQAAGSRPQRALFCLSLRNPLRKMCIGIVEWKPFEYLILITILGNCFALGSHTPYPDGDSNGTNSILEKVENVFIVIFTIECLLKIVALGFVMHPGAYLRNGWNILDFTIVCLGLLQPLLQRMLDRSGVDVKALRAFRVLRPLRLVSGLPSLQVVLNAIIRAMVPLLHIALLVIFVITMYAIVGLELFSGKLHATCYDIYTGESFVCNFRYLPIFSFFGEIMDNPTPCSLG-RQGHICK------FPFVCHDFRPNMTKAAIAERRVIVANMSADPYAFTGFIKLPERWPGPNYGITNFDNLAASMLTVFQCVTMEGWTNVLYWMNDSQGMEWPFLYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFAEDVQGYLDWIGAAEDLSDDEDNVNRLDVKEKRFNFCGLCRRSQGGEDEDEDDSDRDDCGYR--TQSSQQKQYFFCFPIRGRRSRRLNRRCRRSCRRMVKSQTFYWTVIVLVFLNTGVLTSEHYGQPKWLDIFQNDANVVFVVLFTIEMLLKMYSLGVRCYFDYMFNRFDCFVVICSILEIVFIMTKLMPPLGVSVFRCARLLRVFKVTRYWNSLRNLVGSLLASMRSIASLLVLLFLFIVIFALLGMQIFGGRFNFLSLRKPRSNFDNFYQALTTVFQILTGEDWNEAMYMGIKSYSTQPFGSLV-CLYYVVLFICD--ILLNVFLAIAVDNLADTGQS------------------KGKQ----KSEATSEDGDDNTAGMD---IVKSADGDSFNSAEEDGKSKVLLLENNENEEYVSIEERDNESESVYSDEHHGSAENLQPKIKPIPEASSFFIFGPRNPFRVFCHYICNHPYFNNVVLVCILVSSAMLAAEDPLKANSYRNIILNYFDYFFTSVFTVEITLKVITYGFAFHKGAFCRSANNLLDLMVVLTSIISYPIALDTISVVKILRVSRVLRPLRAINRAKGLKHVVQCVVVAVKSIGNIMLVTFLLEFMFAVIGVQLFAGKFHYCNDEARFYKEECAGPFIKYDSEDPSLPELVERRWINYPLNFDNVPNGLLTLFVASTFEGWPALLYQSIDSYAEDHGKVYNCRPVVVIFYVAFIVVVAFFMVNIFVGFVIVTFQQEGEQEYKGCELDKNQRKCIEFALKARPVRRYIPKERFQYRIWWFVTSQPFEYCIFIFILINTICLGMKNTAFLHKVKSIVVINALCVRVLVTILQDLCSHFQFEGQPPVYADALDYLNMIFTGVFTVEFILKLTALSFKASPHSYLIRFGNYFNDLWNVFDFIIVVGSFVDIVLSHIA------ENSKFISINFFRLFRVMRLIKLLSRGEGIRTLLWTFVKSFQALPYVALLILMLFFIYAVIGMQMFGKIALNNPDS--AITVNANFQTFPQAVLILFRSATGEAWQDIMFSC-AGVSCDLL-----------------HVIAPCYPHSLALFPPFSHYRQIDVSSRGWCATETAYCDKQSDESRTAVGATDRTVCGSAFAYPFFISFYIICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKISPPLGFGKLCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTEGSTPDQLNEELRAVIKKIWKHTSPKLLDQVVPPAGSNDDVTVGKFYATFLIQEWFRRWKLKKAEEHKHLPYGQGRSL-MHPEEEKGGGS--------------SASDDK-------------RQMSLLGSMMHALQRVGSYRR 1873          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. TrEMBL
Match: A0A068YHX8 (Voltage-dependent L-type calcium channel subunit alpha OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000961000 PE=3 SV=2)

HSP 1 Score: 1948.71 bits (5047), Expect = 0.000e+0
Identity = 1096/1757 (62.38%), Postives = 1267/1757 (72.11%), Query Frame = 1
Query:  910 RPLNLAALTLSAQIASGGRKRTPARSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKM-SEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYS-KNDVMMESPVPCSTSVNKG-----YQCDDFHSSGFKYMCKDNKNETS-----------------RWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGGAHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSXXXXXXXXXXXXXXXPTNVDGEEAKACNSSNVSPNIDEKTRFTDAERLIKSEEMNGDIADESMRKMSTRIDTXXXXXXXXXXXXXXXXXNGQTSAI---RRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPD-AMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAG-NDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRTHGRGSGPLISLISPTLVTTNECDEKDKDYLPSHLGAERRTHSIFGTMMNVLQRVGSTRRDSNASPSTGSINHS--TELPRDRSNSRPMILNQSKSPT 6087
            +PLNL +L L+AQ  +  RKR  +R+Q+   RPQRALFCL+LRNP RK CI IVEWKPFEYLIL TI  NC AL ++TPYP+ DSN  NS LEK+E VFIVIFT EC+LKI+A GF+MHPGAYLRNGWN+LDF IV +GL+  +L +M    G DVKALRAFRVLRPLRLVSGLPSLQVV+N+I+RAMVPL HIALL +FVI +YAI+GLELFSGKLH+TCY      +M++P PCS S         + C DF  +  K    + ++  +                 RW GPN GIT+FDN   +MLTVFQC+TMEGWT ++YW+NDS GM WP++YFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQF EDVQGYLDWIGAAED+SDDE+N  + + KE RF LCGLC+ S+  ++ D+  SD+ D         SQQ+QY FCFP++ RR R+ NRRCRR CRR+VKSQ FYW VIVLVFLNTGVLTSEHY Q  WLD FQN AN++FVVLFT+EML+KMYSLG+RCYFD+MFNRFD FVVI SILEIV I T  MPPLGVSV RCARLLRVFKVTRYW+SLRNLVGSLLASM+SI SLLVLLFLFIVIF+LLGMQ+FGG+FNF    KPRSNFD+F Q+L TVFQILTGEDWNE MY GI+SY      S++ CLYYV+LFICGNYILLNVFLAIAVDNLADTG                     G++     S   S + D+ T   D   ++KSE+  GD  + +     +   T  +N+E       E+ +N   S        S    + KIKPIP AS+FFIFGP N FR FCH+ICNHP+F N+VLVCI+VSSAMLAAEDPL A S RN ILNYFDY FTSVFTVEITLK       F +   C+   N   L    T                                A   ++  +  VVAVKSIGNIMLVTFLLEFMFAVIGVQLF GKF  CND ++     C G +I Y+  D +   + +R WIN PLNFDNVPN +LTLF  STFEGWP +LY+SIDS+ ED+  +YN RP+V IFY+A+I+V+AFFM+NIFVGFVIVTFQQEGE+EYK CELDKNQRKCIEFALKA+PVRRYIPK+ F+YR+WW +TS+PFEY IF+ I++NTI L +KF+ QP  Y   +DYLNM+FTGVFTVEF+LKL A GFKNYF+D WNVFDFIIVLGSF+DI+  H+          + ISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLI+MLFFIYAVIGMQMFGKI   N      I  N NFQTFPQA+L+LFRSATGEAWQ+IM  C  + A CD  SD+ R                +G  D  V                        CGS FAYP+FISFY+ICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKI+PPLGFGK CPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKT+GST DQLNEELR VIKKIWK TS K+LDQVVPPAG NDDVTVGKFYATFLIQEWFRRWK K+ EE K + Y Q KR S+MPFR  GR      SL+ P        +EK      S    ++R  S+ G+MM+ LQRVGS RR S++  S+ +   +     P   S S+P ++  S +PT
Sbjct:  109 KPLNLTSLALAAQ--TNARKRPASRAQAAGSRPQRALFCLSLRNPLRKMCIGIVEWKPFEYLILITILGNCFALGSHTPYPDGDSNGTNSILEKVENVFIVIFTIECLLKIVALGFVMHPGAYLRNGWNILDFTIVCLGLLQPLLQRMLDRSGVDVKALRAFRVLRPLRLVSGLPSLQVVLNAIIRAMVPLLHIALLVIFVITMYAIVGLELFSGKLHATCYDIYTGEIMDNPTPCSLSRQGHICKFPFVCHDFRPNMTKAAIAERRSIVANMSADPYAFTGFIKLPERWPGPNYGITNFDNLAASMLTVFQCVTMEGWTNVLYWMNDSQGMEWPFLYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFAEDVQGYLDWIGAAEDLSDDEDNANRLDVKEKRFNLCGLCRRSQGGEEEDEDDSDRDDCGYR--TQSSQQKQYFFCFPIRGRRSRRLNRRCRRSCRRMVKSQTFYWTVIVLVFLNTGVLTSEHYGQPKWLDIFQNDANVVFVVLFTIEMLLKMYSLGVRCYFDYMFNRFDCFVVICSILEIVFIMTKLMPPLGVSVFRCARLLRVFKVTRYWNSLRNLVGSLLASMRSIASLLVLLFLFIVIFALLGMQIFGGRFNFLSLRKPRSNFDNFYQALTTVFQILTGEDWNEAMYMGIKSYSTQPFGSLV-CLYYVVLFICGNYILLNVFLAIAVDNLADTGQS------------------KGKQ----KSEATSEDGDDNTAGMD---IVKSED--GDSFNPAEEDGKSTFVTNSKNNENEEYVSIEERDNESESVYSDEHHGSGENFQPKIKPIPEASAFFIFGPRNPFRVFCHYICNHPYFNNVVLVCILVSSAMLAAEDPLKANSYRNIILNYFDYFFTSVFTVEITLK-------FGHHLCCK---NFASLSCSST--------------------------------ATSYQQSQRSQVVAVKSIGNIMLVTFLLEFMFAVIGVQLFAGKFHYCNDEARFYKEECAGPFIKYDSEDPSLPELVERRWINYPLNFDNVPNGLLTLFVASTFEGWPALLYQSIDSYAEDHGKVYNCRPVVVIFYVAFIVVVAFFMVNIFVGFVIVTFQQEGEQEYKGCELDKNQRKCIEFALKARPVRRYIPKERFQYRIWWFVTSQPFEYCIFIFILINTICLGMKFEGQPPVYADALDYLNMIFTGVFTVEFILKLTALGFKNYFNDLWNVFDFIIVLGSFVDIVLSHI------AENSKFISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLILMLFFIYAVIGMQMFGKIALNNPD--SAITVNANFQTFPQAVLILFRSATGEAWQDIMFSCAGETAYCDKQSDESRTA--------------VGATDRTV------------------------CGSAFAYPFFISFYIICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKISPPLGFGKLCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTEGSTPDQLNEELRAVIKKIWKHTSPKLLDQVVPPAGSNDDVTVGKFYATFLIQEWFRRWKLKKAEEHKHLPYGQHKRHSIMPFR--GR------SLMQPE-------EEKGGG---SSASDDKRQISLLGSMMHALQRVGSYRRSSSSPQSSPAPAEANGANTPAPPSPSKPTVIGSSGTPT 1727          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. TrEMBL
Match: A0A182J4Y3 (Voltage-dependent L-type calcium channel subunit alpha OS=Anopheles atroparvus OX=41427 PE=3 SV=1)

HSP 1 Score: 1820.05 bits (4713), Expect = 0.000e+0
Identity = 1020/1687 (60.46%), Postives = 1225/1687 (72.61%), Query Frame = 1
Query:  970 RTPARSQSGNP---RPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCY-SKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGGAHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKA-KPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSXXXXXXXXXXXXXXXPTNVDGEEAKACNSSNVSPNIDEKTRFTDAERLIKSEEMNGDIA---------DESMRKMSTRIDTXXXXXXXXXXXXXXXXXNGQTSAIRRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLP---DAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDD-VTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLM---PFRTHGRGSGPLISLISPTLVTTNECDEKDKDYLPSHLGAERRTHSIFGTMMNVLQRVG 5967
            + P R     P   RP R LFCLT  NP RK CI IVEWKPFEYLIL TIFANC ALA  TP+P  DSN+ N+ALEKIE +F+VIFT EC++K++A+GFI+HPG+YLRNGWN+LDF IV+IG+IST LS + + G DVKALRAFRVLRPLRLVSG+PSLQVV+NSI+RAMVPL HIALL LFVIIIYAIIGLELFSGKLH +C+ ++   +M+ P PC      G+ CD       + +C+        W GPN GIT+FDNFGL+MLTVFQC+T+EGWT ++Y+I D++G SW W+YF+S++I+G+FFVMNL+LGVLSGEFSKER KAK RG +QK RE+ Q DED  GYLDWI  AEDI  D E  G + GK                              T+      + +Q  +C   K +   + NRR RR CR+ VKSQAFYW++I+LVFLNTGVL +EHYRQ  WLD FQ   N+ FV LFT+EML+KMYSLG + YF  +FNRFD FVVI SI E+V+  T  MPPLGVSVLRC RLLRVFKVT+YW SL NLV SLL S++SI SLL+LLFLFIVIF+LLGMQ+FGGKFNF+    KPRSNFDSFVQSLLTVFQILTGEDWN VMYDGI++YG +    +++ +Y++ILFICGNYILLNVFLAIAVDNLAD  S    EK EGEN E     +  E     +  +     D+    +D + +  S+E  G  +         DE   +  T+ +T  E                 ++  RR+SE+  K+  KPIP A+S  IF P N+FR FCH++CNH  FGNI+LVCIM SSAMLAAEDPL+A S RN+ILNYFDY FTSVFT+E+ LK+++YG +FH+GAFCRS+ N+LDLLVV  S+IS   ++ AISV+KILRVLRVLRPLRAINRAKGLK VVQCV+VAVK+IGNI+LVT LL+FMFAVIGVQL+ GKF SC+D SK     C G Y+ Y + ++ K    +R W  N  +FD+V  AMLTLF VSTFEGWPG+LY SIDS +ED   I+N RPIV+ +YI YII+IAFFM+NIFVGFVIVTFQ EGE+EYKNC+LDKNQR CIEFALKAKP+RRYIPK   +Y+VWW +TS+PFEY+IF+LIM+NTI+L++KF +QP+ Y +V+D LN++FT VF +EF+ KLAAF FKNYF DAWNVFDFIIVLGSFIDI+Y  VN +     G  +ISINFFRLFRVMRLVKLL+RGEGIRTLLWTF+KSFQALPYVALLIVMLFFIYAVIGMQ+FGKI  ++E     I+RNNNFQTFPQA+LVLFRSATGEAWQ+IML C     +  CDA SD                AG+           P                    CGS+ A+PYFISFY++CSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDP+AKGRIKHLDVVTLLRKI+PPLGFGK CPHR AC  LV MNMPLNSDGTV+FNATLFA+VRT+LKIKT+G+ +D  N ELR  IK+IWKRT+ K+LDQVVPP G DD VTVGKFYATFLIQ++FRR+K KR E    ++  Q+KR ++      RT       L   IS  L         D +  PSH    RR H++FG + + ++R G
Sbjct:  182 KKPTRRAGVKPQPDRPLRVLFCLTRTNPLRKLCIAIVEWKPFEYLILLTIFANCVALAVYTPFPNSDSNSTNAALEKIEYIFLVIFTAECMMKLIAYGFILHPGSYLRNGWNILDFTIVVIGMISTALSNLMKEGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSILRAMVPLLHIALLVLFVIIIYAIIGLELFSGKLHKSCFHNETGEIMDDPHPCG---EDGFHCDTISP---EMVCR------YYWEGPNFGITNFDNFGLSMLTVFQCVTLEGWTDMLYYIEDAMGSSWQWVYFISMVILGAFFVMNLILGVLSGEFSKERTKAKNRGDFQKLREKQQNDEDFCGYLDWITQAEDIDPDNEASGLQEGKTKN---------------------TIELDSTDNLGEDGEVRQESWC-ARKRKSFERVNRRLRRACRKAVKSQAFYWLIIILVFLNTGVLATEHYRQPPWLDDFQENTNMFFVALFTMEMLLKMYSLGFQVYFASLFNRFDCFVVIGSIGEMVLTSTQIMPPLGVSVLRCVRLLRVFKVTKYWQSLSNLVASLLNSIQSIASLLLLLFLFIVIFALLGMQVFGGKFNFNSSVDKPRSNFDSFVQSLLTVFQILTGEDWNMVMYDGIQAYGGVASMGIIASIYFIILFICGNYILLNVFLAIAVDNLADADSLTTVEKDEGENPEEGDEKLSHEPTPTEHGDDGFMEHDKDNLDSDNDPMNMSDEYEGHDSESKIPVADDDEGYEEQDTQGETFDEPPTA-------------SARPRRLSELSVKKSKKPIPKANSLLIFSPTNRFRIFCHWLCNHSTFGNIILVCIMFSSAMLAAEDPLNANSERNQILNYFDYFFTSVFTIELLLKLVSYGFLFHDGAFCRSAFNLLDLLVVCVSLISMFFSSGAISVIKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIVLVTCLLQFMFAVIGVQLYKGKFFSCSDGSKMQESECHGTYLVYEDGNVDKPVSKERYWSRNRFHFDDVSKAMLTLFTVSTFEGWPGLLYVSIDSHEEDSGPIHNFRPIVAAYYIIYIIIIAFFMVNIFVGFVIVTFQNEGEQEYKNCDLDKNQRNCIEFALKAKPIRRYIPKHRIQYKVWWFVTSQPFEYMIFILIMINTITLSMKFYRQPEIYTEVLDLLNLIFTAVFALEFVFKLAAFRFKNYFGDAWNVFDFIIVLGSFIDIVYSEVNVSKGMKGGSSIISINFFRLFRVMRLVKLLARGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIAMDDE---TSIHRNNNFQTFPQAVLVLFRSATGEAWQDIMLDCSSRPGEVNCDAKSD---------------DAGS-----------PEG------------------CGSSIAFPYFISFYVLCSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPDAKGRIKHLDVVTLLRKISPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVLFNATLFAVVRTSLKIKTEGN-IDDANAELRTTIKQIWKRTNPKLLDQVVPPPGVDDEVTVGKFYATFLIQDYFRRFK-KRKENDNKLSSDQNKRRTMTLQAGLRTLHEAGPELKRAISGNLEEIG-----DDNPEPSH----RRNHTLFGNVWSSIRRPG 1763          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Cavefish
Match: cacna1db (calcium channel, voltage-dependent, L type, alpha 1D subunit, b [Source:ZFIN;Acc:ZDB-GENE-040525-3])

HSP 1 Score: 1612.43 bits (4174), Expect = 0.000e+0
Identity = 923/1608 (57.40%), Postives = 1107/1608 (68.84%), Query Frame = 1
Query:  934 TLSAQIASGG--------RKR-----TPARSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSE-----------GGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMM--ESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGGAHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSXXXXXXXXXXXXXXXPTNVDGEEAKACNSSNVSPNIDEKTRFT-DAERLIKSEEMNGDIADESMRKMSTRIDTXXXXXXXXXXXXXXXXXNGQTSAIRRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVN------GTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAG 5658
            T+S Q  +G         RKR     +  +  S N RP RALFCLTL NP R+ CI +VEWKPF+  IL +IFANC ALA   P+PE DSN+ N  LE +E  F++IFT E  LKI+A+G +MH  +Y+RNGWN+LDF+IVI+GL S VL  +++           GG DVKALRAFRVLRPLRLVSG+PSLQVV+NSI++AMVPL HIALL LFVIIIYAIIGLELF GK+H+TCY      +  E   PCS S   G  C    +     +CKD       W GPN GIT+FDNF  AMLTVFQCITMEGWT+++YW+ND++G   PW+YFVSL+I GSFFV+NLVLGVLSGEFSKEREKAK RG +QK RE+ Q +ED++GYLDWI  AEDI  + + +G + GK +      +  S  +S + D+   +       G    S ++   FC               RR CR  VKS  FYW+VI+LVFLNT  ++SEHY Q  WL   Q+ AN + + +FT EMLIKMYSLG++ YF  +FNRFD FVV   I+E ++++ + M PLG+SV RC RLLR+FKVTR+W+SL NLV SLL SMKSI SLL+LLFLFI+IFSLLGMQLFGGKFNFD+    RS FD+F Q+LLTVFQILTGEDWN VMYDGI +YG    S M+ C+Y++ILFICGNYILLNVFLAIAVDNLAD  S                 N   +E +  N      +I +  R + +   +      + D  DE       R                           +R+SE+  KEK  PIP  S+FFIF   N  R  CH + NH  F N++LV IM+SS  LAAEDP+ + S+RN IL YFDY FT++FTVEI LK+  +G   H GAFCR+  N+LDLLVV  S++S+ I + AISVVKILRVLRVLRPLRAINRAKGLK VVQCV VA+++IGNIM+VT LL+FMFA IGVQLF GKF  C D +K++   C+G YI YN  D A   V +R W N+  NFDNV  AM+ LF VSTFEGWP +LYK+IDS +E+   IYN R  +SIF+I YII+IAFFM+NIFVGFVIVTFQ++GE+EYKNCELDKNQR+C+E+ALKA+P+RRYIPK  ++Y+ W+++ S  FEY++FVLI+LNT+ LA++   Q   +   MD LNMVFTGVFTVE +LKL AF  + YF DAWNVFD ++V+GS +DII   V+       T  N      ISI FFRLFRVMRLVKLLSRGEGIRTLLWTF+KSFQALPYVALLI MLFFIYAVIGMQ+FGKI   +      INRNNNFQTFPQA+L+LFR ATGEAWQ IML CLP  +CD+ SD      YN                     P                     CGSNFA  YFISFYM+C+FLIINLFVAVIMDNFDYLTRDWSILGPHHLDEF R+WSEYDPEAKGRIKHLDVVTLLR+I PPLGFGK CPHR AC  LV MNMPLNSDGTVMFNATLFALVRT LKIKT+G+ ++Q NEELR VIKKIWKRTS K+LDQVV   G
Sbjct:   52 TMSGQSVAGSAPVGSLSQRKRQQYAKSKKQGSSTNSRPPRALFCLTLNNPIRRACISLVEWKPFDIFILLSIFANCVALAVYVPFPEDDSNSTNHDLETVEYAFLIIFTIETFLKIIAYGLVMHQNSYVRNGWNMLDFVIVIVGLFSVVLEFLTKEGDSSQSGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHATCYMNGSRTLADEESAPCSLS-GHGRHCTVNGT-----LCKDG------WQGPNNGITNFDNFLFAMLTVFQCITMEGWTEVLYWMNDAMGFELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENDEEGDQEGKRNP----SMPTSETESVNTDNPNGEDDKARCCGPICRSWRRWNRFC---------------RRKCRAAVKSTTFYWLVILLVFLNTLTISSEHYNQPDWLTEVQDVANKVLLAMFTCEMLIKMYSLGLQAYFVSLFNRFDCFVVCGGIVETILVELEIMSPLGISVFRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETVTKRSTFDNFPQALLTVFQILTGEDWNTVMYDGIMAYGGPSSSGMVVCIYFIILFICGNYILLNVFLAIAVDNLADAESL----------------NTAQKEEEEQNKRRKKQSIKQADRNSHEVHDVAHHRHGSEDDEDEPEVPPGPRP--------------------------QRLSELTIKEKTPPIPEGSAFFIFSNTNPIRVSCHRLINHQIFTNLILVFIMLSSVSLAAEDPIRSYSARNIILGYFDYAFTAIFTVEILLKMTAFGAFLHKGAFCRNYFNLLDLLVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYRCTDEAKSSPEECKGTYILYNIGDNALPQVRERIWFNSDFNFDNVLMAMMALFTVSTFEGWPALLYKAIDSNRENMGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYALKARPLRRYIPKNRYQYKFWYVVNSAGFEYVMFVLIILNTLCLAIQHHGQSHLFNYAMDILNMVFTGVFTVEMILKLVAFKPRGYFGDAWNVFDALVVIGSVVDIILSQVDVIESWTATAGNTEDSARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQVFGKIAMVDG---TSINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPGKLCDSESD------YN---------------------PGEE----------------KTCGSNFAIIYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTALKIKTEGN-LEQANEELRAVIKKIWKRTSTKLLDQVVSRNG 1539          

HSP 2 Score: 119.783 bits (299), Expect = 3.282e-26
Identity = 115/370 (31.08%), Postives = 172/370 (46.49%), Query Frame = 1
Query:  910 RPLNLAALTLSAQIASGGRKRTPARSQSGNPRPQ-RALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSR---WSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIY---------FVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQ 1980
            RP  L+ LT+        +++TP       P P+  A F  +  NP R  C +++  + F  LIL  I  +  +LAA  P   R  +  N  L   +  F  IFT E +LK+ AFG  +H GA+ RN +NLLD L+V + L+S      S     VK LR  RVLRPLR ++    L+ V+  +  A+  + +I ++   +  ++A IG++LF GK     Y   D    SP  C     KG        +   Y   DN     R   W   +    +FDN  +AM+ +F   T EGW  ++Y   DS   +   IY         F+  III +FF+MN+ +G +   F ++ EK  K  +  K + Q
Sbjct:  791 RPQRLSELTI--------KEKTP-------PIPEGSAFFIFSNTNPIRVSCHRLINHQIFTNLILVFIMLSSVSLAAEDPI--RSYSARNIILGYFDYAFTAIFTVEILLKMTAFGAFLHKGAFCRNYFNLLDLLVVGVSLVS--FGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKF----YRCTDEAKSSPEEC-----KG--------TYILYNIGDNALPQVRERIWFNSDF---NFDNVLMAMMALFTVSTFEGWPALLYKAIDSNRENMGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQ 1121          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Cavefish
Match: cacna1sb (calcium channel, voltage-dependent, L type, alpha 1S subunit, b [Source:ZFIN;Acc:ZDB-GENE-051227-1])

HSP 1 Score: 1457.2 bits (3771), Expect = 0.000e+0
Identity = 843/1728 (48.78%), Postives = 1101/1728 (63.72%), Query Frame = 1
Query:  982 RSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSE---------GGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSK-NDVMM----ESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDG----KENGKESR--FKLCGLCKSSEXXXXXXXXXXXXXXXETEGGAHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFV--QSLLTVF-QILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSXXXXXXXXXXXXXXXPTNVDGEEAKACNSSNVSPNIDEKTRFTDAERLIKSEEMNGDIADESMRKMSTRIDTXXXXXXXXXXXXXXXXXNGQTSAIRRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRG-----------DRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMP-FRTHGRGSGP-LISLISPTLVTTNECDEKDKDYLPSHLGAERRTHSIFGTMMNVLQRVGSTRRDSNASPSTGSINHSTELPRDRSNSRP 6057
            ++  GNPRP R+LF  TL+NPFRK C KIVEWKPFE +IL TIFANC ALA   P PE D+N  N+ LE +E +F+VIFT EC LKI+A+G + H GAYLRN WN+LDF+IV +GL +  +  ++          GG D+KALRAFRVLRPLRLVSG+PSLQVVMNSI++AM+PLF + LL  F++ ++AI+GLEL+  K+H TCY +  D++     E P PC+ + N G +C    +      C+        W GPN GIT FDNFG AMLTVFQCITME WT ++YW+ND+VG  W WIYFV++I++GSFFV+NLVLGVLSGEFSKEREK + RG+YQK RE+ Q DED++GY++WI  AE +  D+E  G    K++  ES   F + GL + +                      ++   +++   F LK                  VKS+ FYW+VI++VFLNT V+  EH+ QS     FQ+ AN I +  F  EM  KMY+ G+R YF  +FNRFDFFVV   ILEI+++  D M PLG+SV+RC RLLR                                                    F K  K R  F+ F     L  +F Q++TGE+W+ +MY+GI ++G      +L  +Y++IL++ GN+ILLNVFLAIAVDNL +  S +  +K++ E +  + T    EE KA    +       KT        +K +E   ++ +         +       +   + +EE+ E   +   R ++++  KE + P+P ASSFFIFGP NKFRK CH   N   F N +L+ I++SS  LAAED +D +S RN+IL Y D +FT+VFT+EI LK+  YG + H G+FCR++ NILDL+VV+ S++S  + + AISV+KILRVLRVLRPLRA+NRAKGLK VVQCV VA+++IGNI+LVT LL FMFA IGVQL+ GKF SC D  K T   C+G ++ +    +    + +R+W+N+  NFDNVPNAML LF VSTFEGWP +LYK+IDS  ED   ++NNR   S+F++ Y+I+IAFFM+NIFVGFVIVTF+++GE+E+KNCELDKNQR+C+++ALKA+P+R YIPK  ++YRVW+L+TS  FEY++F+LI+LNT SL L+   Q     ++ D LN++FT +FT E ++KL AF  K YF D WNVFDF+IV+GS +D++   V+    +  G           +  +SI FFRLFRV+RL+KLL+R EGIR LLWTF+KSFQA P+VALLIVMLFFIYAVIGMQ+FGKI   +     EINRN NFQTFPQAIL+L+R+ TGE WQ +ML C+   +CD  SD    E Y                                            CG+NFA  YF+SF MIC FLIINLFVAVIMDNFDYLTRDWSILGPHHLDEF ++W+EYDPEA GRIKHLDVVTLLR+I PPLGFGK+CPHR+AC  L+ MNMPLNSDGTV FNATLFALVRT+L IKT+G+  +Q NEELR++IK IWKRTS K+LDQV+PP G D+VTVGKFYATFLIQE FR++  KR EE  G   ++     +    RT    + P L   IS  L+     DE D+       G  RRT  +FG         G      ++ P++ +   ++  P   S SRP
Sbjct:   27 QATGGNPRPARSLFFFTLKNPFRKACTKIVEWKPFEIIILLTIFANCVALAVFLPMPEEDTNYTNTTLESLEYIFLVIFTLECFLKIIAYGLLFHEGAYLRNCWNILDFVIVFMGLFTLAVDTINAIAGTPTEKGGGFDMKALRAFRVLRPLRLVSGVPSLQVVMNSILKAMIPLFQVVLLVFFLVTLFAIMGLELYKCKMHKTCYYEGTDIIALRENEVPSPCAQAGN-GRRCTINGTE-----CRGG------WPGPNFGITHFDNFGFAMLTVFQCITMESWTNVLYWVNDAVGNEWAWIYFVTMILLGSFFVLNLVLGVLSGEFSKEREKCRSRGEYQKLRERQQMDEDLKGYMEWITHAEVLDADQEGQGLLPLKDSDSESEILFAIEGLNRIA---------------------YYYRLARRWNRVFRLKCAV--------------WVKSRMFYWLVILVVFLNTLVIACEHHPQSESATRFQDVANDILLTCFAFEMFAKMYAFGLRAYFMSVFNRFDFFVVTVGILEIILVAADVMTPLGISVMRCIRLLR----------------------------------------------------FVKITKLRFFFNRFCVYNRLYHIFIQVITGEEWDTIMYNGIMAHGGPQSPGILVSIYFIILYVVGNFILLNVFLAIAVDNLTEAESLSSAQKEKEEEKARKKTAPPHEEEKAKLVKS-----KHKTEGMPTTAKLKVDEFESNVKE---------VKDPFPPADFPGDDEEEEPEIPISPRPRPMADLQLKETVVPMPEASSFFIFGPENKFRKLCHRAINATPFTNFILLLILLSSISLAAEDAIDPKSFRNKILAYADIVFTTVFTIEIVLKMTVYGAILHTGSFCRNAFNILDLIVVVVSLLSMGLESSAISVIKILRVLRVLRPLRALNRAKGLKHVVQCVFVAIQTIGNIILVTMLLNFMFACIGVQLYKGKFYSCTDPLKLTEEECQGTFVKHVRNSLHDKEIGQRQWVNSDFNFDNVPNAMLALFTVSTFEGWPELLYKAIDSDAEDRGPVFNNRMDTSLFFVIYLIIIAFFMMNIFVGFVIVTFREQGEQEFKNCELDKNQRQCVQYALKARPLRCYIPKNPYQYRVWYLVTSCYFEYLMFLLIILNTCSLGLQHCNQSDHITKLADTLNVIFTVLFTFEMIVKLIAFKAKGYFGDPWNVFDFLIVIGSIVDVVLSQVDAALESSGGLYCLHGCTYEENARVSITFFRLFRVLRLIKLLNRSEGIRNLLWTFIKSFQAFPHVALLIVMLFFIYAVIGMQVFGKIALVDG---TEINRNANFQTFPQAILILYRTVTGEGWQKLMLACMSGKLCDPRSDYAPGEEYT-------------------------------------------CGTNFAVFYFLSFNMICGFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKKIWAEYDPEATGRIKHLDVVTLLRRIQPPLGFGKFCPHRSACRRLISMNMPLNSDGTVTFNATLFALVRTDLSIKTEGN-FEQANEELRLIIKSIWKRTSMKLLDQVIPPIGEDEVTVGKFYATFLIQEHFRKF-MKRQEEYYGYRPTKKSAAEIQAGLRTIEEEAAPELHRAISGDLIAE---DEMDRALEGGEDGIYRRTGGLFG---------GLNSDPFSSEPNSPTAAQTSNRPLQFSESRP 1581          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Cavefish
Match: cacna1da (calcium channel, voltage-dependent, L type, alpha 1D subunit, a [Source:ZFIN;Acc:ZDB-GENE-030616-135])

HSP 1 Score: 988.408 bits (2554), Expect = 0.000e+0
Identity = 546/900 (60.67%), Postives = 658/900 (73.11%), Query Frame = 1
Query: 3301 VSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRTHGRGSGPLISLISPTLVTTNECDEKDK---DYLPSH-LGAERRTHSIFGTMMNVLQRVGSTRRDSN 5988
            +SE++ KEKI PIP  S+FFIF   N  R  CH + NH  F N++LV IM+SSA LAAEDP+   S+RN IL YFDY FT++FTVEI LK+ TYG   H GAFCR+  N+LDLLVV  S++S+ I + AISVVKILRVLRVLRPLRAINRAKGLK VVQCV VA+++IGNIM+VT LL+FMFA IGVQLF GKF  CND +K++   C+G YI Y + D+ +  + KR W N+  NFDNV  AM+ LF VSTFEGWP +LYK+IDS KE++  IYN R  +SIF+I YII+IAFFM+NIFVGFVIVTFQ++GE+EYKNCELDKNQR+C+E+ALKA+P+RRYIPK  ++Y+ W+++ S  FEYI+FVLIMLNT+ LA++   Q Q +  VMD LNM FT VFTVE +LKL AF  ++YF+DAWN FD +IV+GS +DI    VN T ++ R    ISI FFRLFRVMRLVKLLSRGEGIRTLLWTF+KSFQALPYVALLI MLFFIYAVIGMQ+FGK+   +     +INRNNNFQTFPQA+L+LFR ATGEAWQ IML C+   +CD  SD      YN                     P                     CGS+FA  YFI+FYM+C+FLIINLFVAVIMDNFDYLTRDWSILGPHHLDEF R+WSEYDPEAKGRIKHLDVVTLLR+I PPLGFGK CPHR AC  LV MNMPLNSDGTVMFNATLFALVRT LKIKT+G+ ++Q NEELR VIKKIWKRTS K+LDQVVPPAG+D+VTVGKFYATFLIQ++FR++K+++ E   G+  +Q+     +      +     +  I P +     CD +D+   D++P       RR   +FG  MN +   G  RR S 
Sbjct:  760 ISELVKKEKITPIPEGSAFFIFSNTNPIRVACHKLINHHIFTNLILVFIMLSSASLAAEDPIRNFSARNIILGYFDYAFTAIFTVEIVLKMTTYGAFLHKGAFCRNYFNLLDLLVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYRCNDEAKSSPEECKGTYILYKDGDVNQPTLQKRHWHNSDFNFDNVLMAMMALFTVSTFEGWPALLYKAIDSNKENFGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKFWYVVNSTGFEYIMFVLIMLNTLCLAVQHYGQSQTFNYVMDILNMAFTAVFTVEMVLKLIAFKPRHYFTDAWNTFDALIVVGSVVDIAITEVNNTEDSAR----ISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQIFGKVAMVDG---TQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACMAGKLCDPESD------YN---------------------PGEEMT----------------CGSSFAIVYFITFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTALKIKTEGN-LEQANEELRAVIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQDYFRKFKKRKEEGLVGVHPAQNNTAIAL------QAGLRTLHDIGPEIRRAISCDLQDEELVDFMPEEDEEIYRRNGGLFGNHMNHIN--GDHRRGSG 1600          

HSP 2 Score: 710.679 bits (1833), Expect = 0.000e+0
Identity = 403/720 (55.97%), Postives = 496/720 (68.89%), Query Frame = 1
Query:  970 RTPARSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSE------------------------GGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSR-WSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGL-----------CKSSEXXXXXXXXXXXXXXXETEGGAHHSQQQQYVFCFPLKSXXXXXXXXXX--------XXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLAD 2997
            ++  +  S N RPQRALFCL L NP R+ CI +VEWKPF+  IL  IFANC ALA   P+PE DSN+ N  LE +E  F++IFT E  LKI+A+G +MH  AY+RNGWN+LDF+IV+IGL S VL  +++                        GG DVKALRAFRVLRPLRLVSG+PSLQVV+NSI++AMVPL HIALL LFVIIIYAIIGLELF GK+H+TC+    +  + P PC+ +             G    C  N  E    W GPN GIT+FDNF  AMLTVFQCITMEGWT ++YW+ND++GM  PW+YFVSL+I GSFFV+NLVLGVLSGEFSKEREKAK RG +QK RE+ Q +ED++GYLDWI  AEDI  D E + +++ K +R  L  L            +SSE         ++ ++ E E G    + ++   C PL  +  +    R         RR CR  VKS  FYW+VI+LVFLNT  ++SEHY Q +WL   Q+ AN + + LFT EML+KMYSLG++ YF  +FNRFD FVV   I E ++++ + M PLG+SV RC RLLR+FKVTR+W+SL NLV SLL SMKSI SLL+LLFLFI+IFSLLGMQ+FGGKFNFD+    RS FD+F Q+LLTVFQILTGEDWN VMYDGI +YG    S M+ C+Y++ILFICGNYILLNVFLAIAVDNLAD
Sbjct:   44 KSKKQGSSANTRPQRALFCLNLNNPIRRACISLVEWKPFDIFILIAIFANCMALAVYIPFPEDDSNSTNHDLETVEYAFLIIFTIETFLKIIAYGLVMHQNAYVRNGWNMLDFVIVVIGLFSVVLEVLTKDGGQEDEGVEIPLAAATHAHGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHATCFLVEMISEDEPAPCAVN-------------GHGRTCTINGTECREGWHGPNGGITNFDNFMFAMLTVFQCITMEGWTDVLYWMNDAMGMELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPDNEEEEEDS-KRNRVTLADLMDKKKKGFSFFSQSSETHASVPASETESVNTENEKG----EDEKATCCGPLCQKISKSKFSRRWRRWNRFCRRKCRLAVKSVPFYWLVIILVFLNTLTISSEHYNQPMWLTQVQDVANKVLLALFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVELEIMSPLGISVFRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQVFGGKFNFDETQTKRSTFDNFPQALLTVFQILTGEDWNVVMYDGIMAYGGPSSSGMIVCIYFIILFICGNYILLNVFLAIAVDNLAD 745          

HSP 3 Score: 124.79 bits (312), Expect = 1.244e-27
Identity = 111/366 (30.33%), Postives = 170/366 (46.45%), Query Frame = 1
Query:  919 NLAALTLSAQIASGGRKRTP--ARSQSGNPRPQ-RALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIY---------FVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQ 1980
            NLA      ++ SG R       + +   P P+  A F  +  NP R  C K++    F  LIL  I  +  +LAA  P   R+ +  N  L   +  F  IFT E VLK+  +G  +H GA+ RN +NLLD L+V + L+S      S     VK LR  RVLRPLR ++    L+ V+  +  A+  + +I ++   +  ++A IG++LF GK     Y  ND    SP  C  +    Y+  D +             +   W   +    +FDN  +AM+ +F   T EGW  ++Y   DS   ++  IY         F+  III +FF+MN+ +G +   F ++ EK  K  +  K + Q
Sbjct:  742 NLADEEDEPEVPSGPRPAISELVKKEKITPIPEGSAFFIFSNTNPIRVACHKLINHHIFTNLILVFIMLSSASLAAEDPI--RNFSARNIILGYFDYAFTAIFTVEIVLKMTTYGAFLHKGAFCRNYFNLLDLLVVGVSLVS--FGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKF----YRCNDEAKSSPEECKGTYIL-YKDGDVNQPTL---------QKRHWHNSDF---NFDNVLMAMMALFTVSTFEGWPALLYKAIDSNKENFGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQ 1086          

HSP 4 Score: 95.9005 bits (237), Expect = 7.409e-19
Identity = 72/256 (28.12%), Postives = 126/256 (49.22%), Query Frame = 1
Query: 4237 EEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSF--RYRVW---------WLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIM 4971
            E E  N E +K +    E A    P+ + I K  F  R+R W           + S PF +++ +L+ LNT++++ +   QP    QV D  N V   +FT E L+K+ + G + YF   +N FD  +V G   + I   +   +        + I+ FR  R++R+ K+      +  L+ + + S +++  + LL+ +   I++++GMQ+FG     +E + K     + F  FPQA+L +F+  TGE W  +M
Sbjct:  458 ETESVNTENEKGED---EKATCCGPLCQKISKSKFSRRWRRWNRFCRRKCRLAVKSVPFYWLVIILVFLNTLTISSEHYNQPMWLTQVQDVANKVLLALFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVELEIMSP-------LGISVFRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQVFGGKFNFDETQTKR----STFDNFPQALLTVFQILTGEDWNVVM 699          

HSP 5 Score: 91.6633 bits (226), Expect = 1.258e-17
Identity = 68/252 (26.98%), Postives = 138/252 (54.76%), Query Frame = 1
Query: 2281 LVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQ---TDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPR-SNFDSFVQSLLTVFQILTGEDWNEVMYDGI-------RSYGNLGK----SSMLSCLYYVILFICGNYILLNVFLAIAVDNL 2991
            +V S  F +++ VL+ LNT  L  +HY QS   +   +  N+ F  +FT+EM++K+ +   R YF   +N FD  +V+ S+++I + +   T+    + ++  R  R++R+ K+      +R L+ + + S +++  + +L+ +   I++++GMQ+FG     D     R +NF +F Q++L +F+  TGE W E+M   +        S  N G+     S  + +Y++  ++   ++++N+F+A+ +DN 
Sbjct: 1113 VVNSTGFEYIMFVLIMLNTLCLAVQHYGQSQTFNYVMDILNMAFTAVFTVEMVLKLIAFKPRHYFTDAWNTFDALIVVGSVVDIAITEVNNTEDSARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQIFGKVAMVDGTQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACMAGKLCDPESDYNPGEEMTCGSSFAIVYFITFYMLCAFLIINLFVAVIMDNF 1364          

HSP 6 Score: 89.3521 bits (220), Expect = 6.582e-17
Identity = 74/316 (23.42%), Postives = 137/316 (43.35%), Query Frame = 1
Query: 1036 RNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKA----LRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWI----------------NDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEF 1923
            +NP++     +V    FEY++   I  N   LA         S T N  ++ + + F  +FT E VLK++AF     P  Y  + WN  D LIV+  ++   +++++      +      R FRV+R ++L+S    ++ ++ + +++   L ++ALL   +  IYA+IG+++F GK+          M++      T +N+                  N N              F  F  A+L +F+C T E W +IM                     + G S+  +YF++  ++ +F ++NL + V+   F
Sbjct: 1103 KNPYQYKFWYVVNSTGFEYIMFVLIMLNTLCLAVQH---YGQSQTFNYVMDILNMAFTAVFTVEMVLKLIAF----KPRHYFTDAWNTFDALIVVGSVVDIAITEVNNTEDSARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQIF-GKV---------AMVD-----GTQINR------------------NNN--------------FQTFPQAVLLLFRCATGEAWQEIMLACMAGKLCDPESDYNPGEEMTCGSSFAIVYFITFYMLCAFLIINLFVAVIMDNF 1364          

HSP 7 Score: 78.1814 bits (191), Expect = 1.534e-13
Identity = 63/269 (23.42%), Postives = 117/269 (43.49%), Query Frame = 1
Query: 4360 LITSRPFEYIIFVLIMLNTISLALKF---DKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGF----KNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINF------------------FRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMF---------------------------GKITTENEKEMKEINRN-----NNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAM 4995
            L+  +PF+  I + I  N ++LA+     +         ++ +   F  +FT+E  LK+ A+G       Y  + WN+ DF+IV+     ++ + +  T +  + D  + I                     R FRV+R ++L+S    ++ +L + +K+   L ++ALL++ +  IYA+IG+++F                           G+  T N  E +E          NF  F  A+L +F+  T E W ++ L+ + DAM
Sbjct:   76 LVEWKPFDIFILIAIFANCMALAVYIPFPEDDSNSTNHDLETVEYAFLIIFTIETFLKIIAYGLVMHQNAYVRNGWNMLDFVIVVIGLFSVVLEVL--TKDGGQEDEGVEIPLAAATHAHGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHATCFLVEMISEDEPAPCAVNGHGRTCTINGTECREGWHGPNGGITNFDNFMFAMLTVFQCITMEGWTDV-LYWMNDAM 341          

HSP 8 Score: 78.1814 bits (191), Expect = 1.755e-13
Identity = 86/370 (23.24%), Postives = 157/370 (42.43%), Query Frame = 1
Query: 4009 FDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQS----------FRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQR----YEQVMDYLNMVFTGVFTVEFLLKLAAFG--------FKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMF---------------------------GKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIM 4971
            FDN P A+LT+F + T E W  V+Y  I +    Y G  ++  IV I++I   I   + ++N+F+   +     E +E     E+    R  I   +K + +   IP+ S           R     LI    F  +I V IML++ SLA    + P R       ++ Y +  FT +FTVE +LK+  +G         +NYF    N+ D ++V  S +              +   +  +   R+ RV+R ++ ++R +G++ ++     + + +  + ++  +L F++A IG+Q+F                           G +     ++    N + NF     A++ LF  +T E W  ++
Sbjct:  676 FDNFPQALLTVFQILTGEDWNVVMYDGIMA----YGGPSSSGMIVCIYFIILFICGNYILLNVFLAIAVDNLADEEDEP----EVPSGPRPAISELVKKEKITP-IPEGSAFFIFSNTNPIRVACHKLINHHIFTNLILVFIMLSSASLAA---EDPIRNFSARNIILGYFDYAFTAIFTVEIVLKMTTYGAFLHKGAFCRNYF----NLLDLLVVGVSLVSF----------GIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYRCNDEAKSSPEECKGTYILYKDGDVNQPTLQKRHWHNSDFNFDNVLMAMMALFTVSTFEGWPALL 1019          

HSP 9 Score: 77.7962 bits (190), Expect = 2.129e-13
Identity = 78/300 (26.00%), Postives = 125/300 (41.67%), Query Frame = 1
Query: 3352 SFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPL--DAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKG----------------------------LKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQS----CNDVSKNTHISC----RGQYIYYNEADIAKVFVNKREWINNP----LNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIY 4125
            + F    NN  R+ C  +     F   +L+ I  +   LA   P   D  +S N  L   +Y F  +FT+E  LK+I YGLV H  A+ R+  N+LD ++V+  + S  +  + ++         V  PL A   A G                            L+ V+  ++ A+  + +I L+   +  ++A+IG++LF GK  +       +S++    C     G+    N  +        RE  + P     NFDN   AMLT+F   T EGW  VLY   D+   +   +Y
Sbjct:   59 ALFCLNLNNPIRRACISLVEWKPFDIFILIAIFANCMALAVYIPFPEDDSNSTNHDLETVEYAFLIIFTIETFLKIIAYGLVMHQNAYVRNGWNMLDFVIVVIGLFSVVL--EVLTKDGGQEDEGVEIPLAAATHAHGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHATCFLVEMISEDEPAPCAVNGHGRTCTINGTEC-------REGWHGPNGGITNFDNFMFAMLTVFQCITMEGWTDVLYWMNDAMGMELPWVY 349          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Cavefish
Match: cacna1da (calcium channel, voltage-dependent, L type, alpha 1D subunit, a [Source:ZFIN;Acc:ZDB-GENE-030616-135])

HSP 1 Score: 987.252 bits (2551), Expect = 0.000e+0
Identity = 544/899 (60.51%), Postives = 658/899 (73.19%), Query Frame = 1
Query: 3301 VSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRTHGRGSGPLISLISPTLVTTNECDEKDK---DYLPSH-LGAERRTHSIFGTMMNVLQRVGSTRRDS 5985
            +SE++ KEKI PIP  S+FFIF   N  R  CH + NH  F N++LV IM+SSA LAAEDP+   S+RN IL YFDY FT++FTVEI LK+ TYG   H GAFCR+  N+LDLLVV  S++S+ I + AISVVKILRVLRVLRPLRAINRAKGLK VVQCV VA+++IGNIM+VT LL+FMFA IGVQLF GKF  CND +K++   C+G YI Y + D+ +  + KR W N+  NFDNV  AM+ LF VSTFEGWP +LYK+IDS KE++  IYN R  +SIF+I YII+IAFFM+NIFVGFVIVTFQ++GE+EYKNCELDKNQR+C+E+ALKA+P+RRYIPK  ++Y+ W+++ S  FEYI+FVLIMLNT+ LA++   Q Q +  VMD LNM FT VFTVE +LKL AF  + YF DAWNVFD ++V+GS +DI+   ++ T ++ R    ISI FFRLFRVMRLVKLLSRGEGIRTLLWTF+KSFQALPYVALLI MLFFIYAVIGMQ+FGK+   +     +INRNNNFQTFPQA+L+LFR ATGEAWQ IML C+   +CD  SD      YN                     P                     CGS+FA  YFI+FYM+C+FLIINLFVAVIMDNFDYLTRDWSILGPHHLDEF R+WSEYDPEAKGRIKHLDVVTLLR+I PPLGFGK CPHR AC  LV MNMPLNSDGTVMFNATLFALVRT LKIKT+G+ ++Q NEELR VIKKIWKRTS K+LDQVVPPAG+D+VTVGKFYATFLIQ++FR++K+++ E   G+  +Q+     +      +     +  I P +     CD +D+   D++P       RR   +FG  MN +   G  RR S
Sbjct:  723 ISELVKKEKITPIPEGSAFFIFSNTNPIRVACHKLINHHIFTNLILVFIMLSSASLAAEDPIRNFSARNIILGYFDYAFTAIFTVEIVLKMTTYGAFLHKGAFCRNYFNLLDLLVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYRCNDEAKSSPEECKGTYILYKDGDVNQPTLQKRHWHNSDFNFDNVLMAMMALFTVSTFEGWPALLYKAIDSNKENFGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKFWYVVNSTGFEYIMFVLIMLNTLCLAVQHYGQSQTFNYVMDILNMAFTAVFTVEMVLKLIAFKPRGYFGDAWNVFDALVVIGSIVDIVLSEIDNTEDSAR----ISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQIFGKVAMVDG---TQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACMAGKLCDPESD------YN---------------------PGEEMT----------------CGSSFAIVYFITFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTALKIKTEGN-LEQANEELRAVIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQDYFRKFKKRKEEGLVGVHPAQNNTAIAL------QAGLRTLHDIGPEIRRAISCDLQDEELVDFMPEEDEEIYRRNGGLFGNHMNHIN--GDHRRGS 1562          

HSP 2 Score: 701.049 bits (1808), Expect = 0.000e+0
Identity = 393/703 (55.90%), Postives = 478/703 (67.99%), Query Frame = 1
Query:  970 RTPARSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMM--ESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSR-WSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIG-----------------------AAEDISDDEENDGKENGKESRFKLCG-LCKSSEXXXXXXXXXXXXXXXETEGGAHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLAD 2997
            ++  +  S N RPQRALFCL L NP R+ CI +VEWKPF+  IL  IFANC ALA   P+PE DSN+ N  LE +E  F++IFT E  LKI+A+G +MH  AY+RNGWN+LDF+IVI    +T       GG DVKALRAFRVLRPLRLVSG+PSLQVV+NSI++AMVPL HIALL LFVIIIYAIIGLELF GK+H+TC+     M+  + P PC+              +G    C  N  E    W GPN GIT+FDNF  AMLTVFQCITMEGWT ++YW+ND++GM  PW+YFVSL+I GSFFV+NLVLGVLSGEFSKEREKAK RG +QK RE+ Q +ED++GYLDWI                        A+E  S + EN   E G++ +   CG LC+                   ++       ++   FC               RR CR  VKS  FYW+VI+LVFLNT  ++SEHY Q +WL   Q+ AN + + LFT EML+KMYSLG++ YF  +FNRFD FVV   I E ++++ + M PLG+SV RC RLLR+FKVTR+W+SL NLV SLL SMKSI SLL+LLFLFI+IFSLLGMQ+FGGKFNFD+    RS FD+F Q+LLTVFQILTGEDWN VMYDGI +YG    S M+ C+Y++ILFICGNYILLNVFLAIAVDNLAD
Sbjct:   54 KSKKQGSSANTRPQRALFCLNLNNPIRRACISLVEWKPFDIFILIAIFANCMALAVYIPFPEDDSNSTNHDLETVEYAFLIIFTIETFLKIIAYGLVMHQNAYVRNGWNMLDFVIVIPLAAATHAHGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHATCFLVGSEMISEDEPAPCAV-------------NGHGRTCTINGTECREGWHGPNGGITNFDNFMFAMLTVFQCITMEGWTDVLYWMNDAMGMELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPDNEEEEEDSKRNPSVPASETESVNTEN---EKGEDEKATCCGPLCQKI-----------------SKSKFSRRWRRWNRFC---------------RRKCRLAVKSVPFYWLVIILVFLNTLTISSEHYNQPMWLTQVQDVANKVLLALFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVELEIMSPLGISVFRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQVFGGKFNFDETQTKRSTFDNFPQALLTVFQILTGEDWNVVMYDGIMAYGGPSSSGMIVCIYFIILFICGNYILLNVFLAIAVDNLAD 708          

HSP 3 Score: 124.405 bits (311), Expect = 1.573e-27
Identity = 111/366 (30.33%), Postives = 170/366 (46.45%), Query Frame = 1
Query:  919 NLAALTLSAQIASGGRKRTP--ARSQSGNPRPQ-RALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIY---------FVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQ 1980
            NLA      ++ SG R       + +   P P+  A F  +  NP R  C K++    F  LIL  I  +  +LAA  P   R+ +  N  L   +  F  IFT E VLK+  +G  +H GA+ RN +NLLD L+V + L+S      S     VK LR  RVLRPLR ++    L+ V+  +  A+  + +I ++   +  ++A IG++LF GK     Y  ND    SP  C  +    Y+  D +             +   W   +    +FDN  +AM+ +F   T EGW  ++Y   DS   ++  IY         F+  III +FF+MN+ +G +   F ++ EK  K  +  K + Q
Sbjct:  705 NLADEEDEPEVPSGPRPAISELVKKEKITPIPEGSAFFIFSNTNPIRVACHKLINHHIFTNLILVFIMLSSASLAAEDPI--RNFSARNIILGYFDYAFTAIFTVEIVLKMTTYGAFLHKGAFCRNYFNLLDLLVVGVSLVS--FGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKF----YRCNDEAKSSPEECKGTYIL-YKDGDVNQPTL---------QKRHWHNSDF---NFDNVLMAMMALFTVSTFEGWPALLYKAIDSNKENFGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQ 1049          

HSP 4 Score: 96.2857 bits (238), Expect = 5.173e-19
Identity = 72/256 (28.12%), Postives = 126/256 (49.22%), Query Frame = 1
Query: 4237 EEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSF--RYRVW---------WLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIM 4971
            E E  N E +K +    E A    P+ + I K  F  R+R W           + S PF +++ +L+ LNT++++ +   QP    QV D  N V   +FT E L+K+ + G + YF   +N FD  +V G   + I   +   +        + I+ FR  R++R+ K+      +  L+ + + S +++  + LL+ +   I++++GMQ+FG     +E + K     + F  FPQA+L +F+  TGE W  +M
Sbjct:  421 ETESVNTENEKGED---EKATCCGPLCQKISKSKFSRRWRRWNRFCRRKCRLAVKSVPFYWLVIILVFLNTLTISSEHYNQPMWLTQVQDVANKVLLALFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVELEIMSP-------LGISVFRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQVFGGKFNFDETQTKR----STFDNFPQALLTVFQILTGEDWNVVM 662          

HSP 5 Score: 93.9745 bits (232), Expect = 2.597e-18
Identity = 77/316 (24.37%), Postives = 138/316 (43.67%), Query Frame = 1
Query: 1036 RNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKA----LRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWI----------------NDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEF 1923
            +NP++     +V    FEY++   I  N   LA         S T N  ++ + + F  +FT E VLK++AF     P  Y  + WN+ D L+VI  ++  VLS++       +      R FRV+R ++L+S    ++ ++ + +++   L ++ALL   +  IYA+IG+++F GK+          M++      T +N+                  N N              F  F  A+L +F+C T E W +IM                     + G S+  +YF++  ++ +F ++NL + V+   F
Sbjct: 1066 KNPYQYKFWYVVNSTGFEYIMFVLIMLNTLCLAVQH---YGQSQTFNYVMDILNMAFTAVFTVEMVLKLIAF----KPRGYFGDAWNVFDALVVIGSIVDIVLSEIDNTEDSARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQIF-GKV---------AMVD-----GTQINR------------------NNN--------------FQTFPQAVLLLFRCATGEAWQEIMLACMAGKLCDPESDYNPGEEMTCGSSFAIVYFITFYMLCAFLIINLFVAVIMDNF 1327          

HSP 6 Score: 93.2041 bits (230), Expect = 4.193e-18
Identity = 72/252 (28.57%), Postives = 139/252 (55.16%), Query Frame = 1
Query: 2281 LVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQ---TDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPR-SNFDSFVQSLLTVFQILTGEDWNEVMYDGI-------RSYGNLGK----SSMLSCLYYVILFICGNYILLNVFLAIAVDNL 2991
            +V S  F +++ VL+ LNT  L  +HY QS   +   +  N+ F  +FT+EM++K+ +   R YF   +N FD  VVI SI++IV+ +   T+    + ++  R  R++R+ K+      +R L+ + + S +++  + +L+ +   I++++GMQ+FG     D     R +NF +F Q++L +F+  TGE W E+M   +        S  N G+     S  + +Y++  ++   ++++N+F+A+ +DN 
Sbjct: 1076 VVNSTGFEYIMFVLIMLNTLCLAVQHYGQSQTFNYVMDILNMAFTAVFTVEMVLKLIAFKPRGYFGDAWNVFDALVVIGSIVDIVLSEIDNTEDSARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQIFGKVAMVDGTQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACMAGKLCDPESDYNPGEEMTCGSSFAIVYFITFYMLCAFLIINLFVAVIMDNF 1327          

HSP 7 Score: 80.4925 bits (197), Expect = 3.042e-14
Identity = 77/279 (27.60%), Postives = 124/279 (44.44%), Query Frame = 1
Query: 3352 SFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPL--DAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEF---MFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNK------------REWINNP----LNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIY 4125
            + F    NN  R+ C  +     F   +L+ I  +   LA   P   D  +S N  L   +Y F  +FT+E  LK+I YGLV H  A+ R+  N+LD ++V+  + +    +        ++ LR  R LR +    G+  +   +   +K++  ++ +  L+ F   ++A+IG++LF GK  +   +  +  IS         E + A   VN             RE  + P     NFDN   AMLT+F   T EGW  VLY   D+   +   +Y
Sbjct:   69 ALFCLNLNNPIRRACISLVEWKPFDIFILIAIFANCMALAVYIPFPEDDSNSTNHDLETVEYAFLIIFTIETFLKIIAYGLVMHQNAYVRNGWNMLDFVIVI-PLAAATHAHGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHATCFLVGSEMIS---------EDEPAPCAVNGHGRTCTINGTECREGWHGPNGGITNFDNFMFAMLTVFQCITMEGWTDVLYWMNDAMGMELPWVY 337          

HSP 8 Score: 79.337 bits (194), Expect = 8.338e-14
Identity = 62/254 (24.41%), Postives = 112/254 (44.09%), Query Frame = 1
Query: 4360 LITSRPFEYIIFVLIMLNTISLALKF---DKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGF----KNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGD-RLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMF-----------------------------GKITTENEKEMKEINRN-----NNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAM 4995
            L+  +PF+  I + I  N ++LA+     +         ++ +   F  +FT+E  LK+ A+G       Y  + WN+ DF+IV+          +    + H G      +   R FRV+R ++L+S    ++ +L + +K+   L ++ALL++ +  IYA+IG+++F                             G+  T N  E +E          NF  F  A+L +F+  T E W ++ L+ + DAM
Sbjct:   86 LVEWKPFDIFILIAIFANCMALAVYIPFPEDDSNSTNHDLETVEYAFLIIFTIETFLKIIAYGLVMHQNAYVRNGWNMLDFVIVIP---------LAAATHAHGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHATCFLVGSEMISEDEPAPCAVNGHGRTCTINGTECREGWHGPNGGITNFDNFMFAMLTVFQCITMEGWTDV-LYWMNDAM 329          

HSP 9 Score: 78.5666 bits (192), Expect = 1.269e-13
Identity = 86/370 (23.24%), Postives = 157/370 (42.43%), Query Frame = 1
Query: 4009 FDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQS----------FRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQR----YEQVMDYLNMVFTGVFTVEFLLKLAAFG--------FKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMF---------------------------GKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIM 4971
            FDN P A+LT+F + T E W  V+Y  I +    Y G  ++  IV I++I   I   + ++N+F+   +     E +E     E+    R  I   +K + +   IP+ S           R     LI    F  +I V IML++ SLA    + P R       ++ Y +  FT +FTVE +LK+  +G         +NYF    N+ D ++V  S +              +   +  +   R+ RV+R ++ ++R +G++ ++     + + +  + ++  +L F++A IG+Q+F                           G +     ++    N + NF     A++ LF  +T E W  ++
Sbjct:  639 FDNFPQALLTVFQILTGEDWNVVMYDGIMA----YGGPSSSGMIVCIYFIILFICGNYILLNVFLAIAVDNLADEEDEP----EVPSGPRPAISELVKKEKITP-IPEGSAFFIFSNTNPIRVACHKLINHHIFTNLILVFIMLSSASLAA---EDPIRNFSARNIILGYFDYAFTAIFTVEIVLKMTTYGAFLHKGAFCRNYF----NLLDLLVVGVSLVSF----------GIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYRCNDEAKSSPEECKGTYILYKDGDVNQPTLQKRHWHNSDFNFDNVLMAMMALFTVSTFEGWPALL 982          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Cavefish
Match: cacna1da (calcium channel, voltage-dependent, L type, alpha 1D subunit, a [Source:ZFIN;Acc:ZDB-GENE-030616-135])

HSP 1 Score: 983.786 bits (2542), Expect = 0.000e+0
Identity = 544/899 (60.51%), Postives = 657/899 (73.08%), Query Frame = 1
Query: 3301 VSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRTHGRGSGPLISLISPTLVTTNECDEKDK---DYLPSH-LGAERRTHSIFGTMMNVLQRVGSTRRDS 5985
            +SE++ KEKI PIP  S+FFIF   N  R  CH + NH  F N++LV IM+SSA LAAEDP+   S+RN +L Y DY+FTS+FT EI LK+ TYG   H GAFCR+  N+LDLLVV  S++S+ I + AISVVKILRVLRVLRPLRAINRAKGLK VVQCV VA+++IGNIM+VT LL+FMFA IGVQLF GKF  CND +K++   C+G YI Y + D+ +  + KR W N+  NFDNV  AM+ LF VSTFEGWP +LYK+IDS KE++  IYN R  +SIF+I YII+IAFFM+NIFVGFVIVTFQ++GE+EYKNCELDKNQR+C+E+ALKA+P+RRYIPK  ++Y+ W+++ S  FEYI+FVLIMLNT+ LA++   Q Q +  VMD LNM FT VFTVE +LKL AF  ++YF+DAWN FD +IV+GS +DI    VN T ++ R    ISI FFRLFRVMRLVKLLSRGEGIRTLLWTF+KSFQALPYVALLI MLFFIYAVIGMQ+FGK+   +     +INRNNNFQTFPQA+L+LFR ATGEAWQ IML C+   +CD  SD      YN                     P                     CGS+FA  YFI+FYM+C+FLIINLFVAVIMDNFDYLTRDWSILGPHHLDEF R+WSEYDPEAKGRIKHLDVVTLLR+I PPLGFGK CPHR AC  LV MNMPLNSDGTVMFNATLFALVRT LKIKT+G+ ++Q NEELR VIKKIWKRTS K+LDQVVPPAG+D+VTVGKFYATFLIQ++FR++K+++ E   G+  +Q+     +      +     +  I P +     CD +D+   D++P       RR   +FG  MN +   G  RR S
Sbjct:  737 ISELVKKEKITPIPEGSAFFIFSNTNPIRVACHKLINHHIFTNLILVFIMLSSASLAAEDPIRNFSARNIVLGYADYVFTSMFTFEIVLKMTTYGAFLHKGAFCRNYFNLLDLLVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYRCNDEAKSSPEECKGTYILYKDGDVNQPTLQKRHWHNSDFNFDNVLMAMMALFTVSTFEGWPALLYKAIDSNKENFGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKFWYVVNSTGFEYIMFVLIMLNTLCLAVQHYGQSQTFNYVMDILNMAFTAVFTVEMVLKLIAFKPRHYFTDAWNTFDALIVVGSVVDIAITEVNNTEDSAR----ISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQIFGKVAMVDG---TQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACMAGKLCDPESD------YN---------------------PGEEMT----------------CGSSFAIVYFITFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTALKIKTEGN-LEQANEELRAVIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQDYFRKFKKRKEEGLVGVHPAQNNTAIAL------QAGLRTLHDIGPEIRRAISCDLQDEELVDFMPEEDEEIYRRNGGLFGNHMNHIN--GDHRRGS 1576          

HSP 2 Score: 696.812 bits (1797), Expect = 0.000e+0
Identity = 405/712 (56.88%), Postives = 498/712 (69.94%), Query Frame = 1
Query:  970 RTPARSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTIN---------SALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSE------------------------GGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMM--ESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSR-WSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGGAHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLAD 2997
            ++  +  S N RPQRALFCL L NP R+ CI +VEWKPF+  IL  IFANC ALA   P+PE DSN+ N         S +E +E  F++IFT E  LKI+A+G +MH  AY+RNGWN+LDF+IV+IGL S VL  +++                        GG DVKALRAFRVLRPLRLVSG+PSLQVV+NSI++AMVPL HIALL LFVIIIYAIIGLELF GK+H+TC+     M+  + P PC+ +             G    C  N  E    W GPN GIT+FDNF  AMLTVFQCITMEGWT ++YW+ND++GM  PW+YFVSL+I GSFFV+NLVLGVLSGEFSKEREKAK RG +QK RE+ Q +ED++GYLDWI  AEDI  D E + +++ +           +SE         ++ ++ E E G    + ++   C PL  RR R+WNR CRR CR  VKS  FYW+VI+LVFLNT  ++SEHY Q +WL   Q+ AN + + LFT EML+KMYSLG++ YF  +FNRFD FVV   I E ++++ + M PLG+SV RC RLLR+FKVTR+W+SL NLV SLL SMKSI SLL+LLFLFI+IFSLLGMQ+FGGKFNFD+    RS FD+F Q+LLTVFQILTGEDWN VMYDGI +YG    S M+ C+Y++ILFICGNYILLNVFLAIAVDNLAD
Sbjct:   44 KSKKQGSSANTRPQRALFCLNLNNPIRRACISLVEWKPFDIFILIAIFANCMALAVYIPFPEDDSNSTNHDLNCPSPQSIIETVEYAFLIIFTIETFLKIIAYGLVMHQNAYVRNGWNMLDFVIVVIGLFSVVLEVLTKDGGQEDEGVEIPLAAATHAHGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHATCFLVGSEMISEDEPAPCAVN-------------GHGRTCTINGTECREGWHGPNGGITNFDNFMFAMLTVFQCITMEGWTDVLYWMNDAMGMELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPDNEEEEEDSKRNPS------VPASE---------TESVNTENEKG----EDEKATCCGPL-CRRWRRWNRFCRRKCRLAVKSVPFYWLVIILVFLNTLTISSEHYNQPMWLTQVQDVANKVLLALFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVELEIMSPLGISVFRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQVFGGKFNFDETQTKRSTFDNFPQALLTVFQILTGEDWNVVMYDGIMAYGGPSSSGMIVCIYFIILFICGNYILLNVFLAIAVDNLAD 722          

HSP 3 Score: 123.635 bits (309), Expect = 2.566e-27
Identity = 111/366 (30.33%), Postives = 171/366 (46.72%), Query Frame = 1
Query:  919 NLAALTLSAQIASGGRKRTP--ARSQSGNPRPQ-RALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIY---------FVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQ 1980
            NLA      ++ SG R       + +   P P+  A F  +  NP R  C K++    F  LIL  I  +  +LAA  P   R+ +  N  L   + VF  +FT E VLK+  +G  +H GA+ RN +NLLD L+V + L+S      S     VK LR  RVLRPLR ++    L+ V+  +  A+  + +I ++   +  ++A IG++LF GK     Y  ND    SP  C  +    Y+  D +             +   W   +    +FDN  +AM+ +F   T EGW  ++Y   DS   ++  IY         F+  III +FF+MN+ +G +   F ++ EK  K  +  K + Q
Sbjct:  719 NLADEEDEPEVPSGPRPAISELVKKEKITPIPEGSAFFIFSNTNPIRVACHKLINHHIFTNLILVFIMLSSASLAAEDPI--RNFSARNIVLGYADYVFTSMFTFEIVLKMTTYGAFLHKGAFCRNYFNLLDLLVVGVSLVS--FGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKF----YRCNDEAKSSPEECKGTYIL-YKDGDVNQPTL---------QKRHWHNSDF---NFDNVLMAMMALFTVSTFEGWPALLYKAIDSNKENFGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQ 1063          

HSP 4 Score: 92.8189 bits (229), Expect = 6.161e-18
Identity = 66/251 (26.29%), Postives = 122/251 (48.61%), Query Frame = 1
Query: 4219 TFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIM 4971
            T  ++GE+E   C        C     + +   R+      R +    + S PF +++ +L+ LNT++++ +   QP    QV D  N V   +FT E L+K+ + G + YF   +N FD  +V G   + I   +   +        + I+ FR  R++R+ K+      +  L+ + + S +++  + LL+ +   I++++GMQ+FG     +E + K     + F  FPQA+L +F+  TGE W  +M
Sbjct:  450 TENEKGEDEKATC--------CGPLCRRWRRWNRFC-----RRKCRLAVKSVPFYWLVIILVFLNTLTISSEHYNQPMWLTQVQDVANKVLLALFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVELEIMSP-------LGISVFRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQVFGGKFNFDETQTKR----STFDNFPQALLTVFQILTGEDWNVVM 676          

HSP 5 Score: 92.0485 bits (227), Expect = 1.157e-17
Identity = 68/252 (26.98%), Postives = 138/252 (54.76%), Query Frame = 1
Query: 2281 LVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQ---TDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPR-SNFDSFVQSLLTVFQILTGEDWNEVMYDGI-------RSYGNLGK----SSMLSCLYYVILFICGNYILLNVFLAIAVDNL 2991
            +V S  F +++ VL+ LNT  L  +HY QS   +   +  N+ F  +FT+EM++K+ +   R YF   +N FD  +V+ S+++I + +   T+    + ++  R  R++R+ K+      +R L+ + + S +++  + +L+ +   I++++GMQ+FG     D     R +NF +F Q++L +F+  TGE W E+M   +        S  N G+     S  + +Y++  ++   ++++N+F+A+ +DN 
Sbjct: 1090 VVNSTGFEYIMFVLIMLNTLCLAVQHYGQSQTFNYVMDILNMAFTAVFTVEMVLKLIAFKPRHYFTDAWNTFDALIVVGSVVDIAITEVNNTEDSARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQIFGKVAMVDGTQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACMAGKLCDPESDYNPGEEMTCGSSFAIVYFITFYMLCAFLIINLFVAVIMDNF 1341          

HSP 6 Score: 89.3521 bits (220), Expect = 6.642e-17
Identity = 74/316 (23.42%), Postives = 137/316 (43.35%), Query Frame = 1
Query: 1036 RNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKA----LRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWI----------------NDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEF 1923
            +NP++     +V    FEY++   I  N   LA         S T N  ++ + + F  +FT E VLK++AF     P  Y  + WN  D LIV+  ++   +++++      +      R FRV+R ++L+S    ++ ++ + +++   L ++ALL   +  IYA+IG+++F GK+          M++      T +N+                  N N              F  F  A+L +F+C T E W +IM                     + G S+  +YF++  ++ +F ++NL + V+   F
Sbjct: 1080 KNPYQYKFWYVVNSTGFEYIMFVLIMLNTLCLAVQH---YGQSQTFNYVMDILNMAFTAVFTVEMVLKLIAF----KPRHYFTDAWNTFDALIVVGSVVDIAITEVNNTEDSARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQIF-GKV---------AMVD-----GTQINR------------------NNN--------------FQTFPQAVLLLFRCATGEAWQEIMLACMAGKLCDPESDYNPGEEMTCGSSFAIVYFITFYMLCAFLIINLFVAVIMDNF 1341          

HSP 7 Score: 77.0258 bits (188), Expect = 3.966e-13
Identity = 87/370 (23.51%), Postives = 157/370 (42.43%), Query Frame = 1
Query: 4009 FDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQS----------FRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQR----YEQVMDYLNMVFTGVFTVEFLLKLAAFG--------FKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMF---------------------------GKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIM 4971
            FDN P A+LT+F + T E W  V+Y  I +    Y G  ++  IV I++I   I   + ++N+F+   +     E +E     E+    R  I   +K + +   IP+ S           R     LI    F  +I V IML++ SLA    + P R       V+ Y + VFT +FT E +LK+  +G         +NYF    N+ D ++V  S +              +   +  +   R+ RV+R ++ ++R +G++ ++     + + +  + ++  +L F++A IG+Q+F                           G +     ++    N + NF     A++ LF  +T E W  ++
Sbjct:  653 FDNFPQALLTVFQILTGEDWNVVMYDGIMA----YGGPSSSGMIVCIYFIILFICGNYILLNVFLAIAVDNLADEEDEP----EVPSGPRPAISELVKKEKITP-IPEGSAFFIFSNTNPIRVACHKLINHHIFTNLILVFIMLSSASLAA---EDPIRNFSARNIVLGYADYVFTSMFTFEIVLKMTTYGAFLHKGAFCRNYF----NLLDLLVVGVSLVSF----------GIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYRCNDEAKSSPEECKGTYILYKDGDVNQPTLQKRHWHNSDFNFDNVLMAMMALFTVSTFEGWPALL 996          

HSP 8 Score: 76.6406 bits (187), Expect = 4.975e-13
Identity = 64/280 (22.86%), Postives = 119/280 (42.50%), Query Frame = 1
Query: 4360 LITSRPFEYIIFVLIMLNTISLAL------------KFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGF----KNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINF------------------FRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMF-----------------------------GKITTENEKEMKEINRN-----NNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAM 4995
            L+  +PF+  I + I  N ++LA+              D      + +++ +   F  +FT+E  LK+ A+G       Y  + WN+ DF+IV+     ++ + +  T +  + D  + I                     R FRV+R ++L+S    ++ +L + +K+   L ++ALL++ +  IYA+IG+++F                             G+  T N  E +E          NF  F  A+L +F+  T E W ++ L+ + DAM
Sbjct:   76 LVEWKPFDIFILIAIFANCMALAVYIPFPEDDSNSTNHDLNCPSPQSIIETVEYAFLIIFTIETFLKIIAYGLVMHQNAYVRNGWNMLDFVIVVIGLFSVVLEVL--TKDGGQEDEGVEIPLAAATHAHGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHATCFLVGSEMISEDEPAPCAVNGHGRTCTINGTECREGWHGPNGGITNFDNFMFAMLTVFQCITMEGWTDV-LYWMNDAM 352          

HSP 9 Score: 72.0182 bits (175), Expect = 1.339e-11
Identity = 81/313 (25.88%), Postives = 126/313 (40.26%), Query Frame = 1
Query: 3352 SFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPL--DAESSRNRILN---------YFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKG----------------------------LKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNK------------REWINNP----LNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIY 4125
            + F    NN  R+ C  +     F   +L+ I  +   LA   P   D  +S N  LN           +Y F  +FT+E  LK+I YGLV H  A+ R+  N+LD ++V+  + S  +  + ++         V  PL A   A G                            L+ V+  ++ A+  + +I L+   +  ++A+IG++LF GK  +   +  +  IS         E + A   VN             RE  + P     NFDN   AMLT+F   T EGW  VLY   D+   +   +Y
Sbjct:   59 ALFCLNLNNPIRRACISLVEWKPFDIFILIAIFANCMALAVYIPFPEDDSNSTNHDLNCPSPQSIIETVEYAFLIIFTIETFLKIIAYGLVMHQNAYVRNGWNMLDFVIVVIGLFSVVL--EVLTKDGGQEDEGVEIPLAAATHAHGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHATCFLVGSEMIS---------EDEPAPCAVNGHGRTCTINGTECREGWHGPNGGITNFDNFMFAMLTVFQCITMEGWTDVLYWMNDAMGMELPWVY 360          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005302.1 (pep scaffold:Pmarinus_7.0:GL483978:134:5921:-1 gene:ENSPMAG00000004828.1 transcript:ENSPMAT00000005302.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 463.766 bits (1192), Expect = 6.590e-149
Identity = 233/346 (67.34%), Postives = 262/346 (75.72%), Query Frame = 1
Query: 4627 NGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGND 5664
            +   +N+R    ISI FFRLFRV+RLVKLLSRGEGIRTLLWTF+KSFQALPYVALLIVMLFFIYAVIGMQMFGKI  ++  +   INRNNNFQTFPQA+L+LFR ATGEAWQ+IML C+P   CD  +D    E ++                                           CGS+FA  YF+SFYM+C+FLIINLFVAVIMDNFDYLTRDWSILGPHHLDEF R+W+EYDPEAKGRIKH+DVVTLLR+I PPLGFGK CPHR AC  LV MNMPLNSDGTVMFNATLFALVRT+LKIKTDG+ ++Q NEELR VIKKIWKRT+ K+LDQVVPPAG D
Sbjct:    9 SAAEDNNR----ISITFFRLFRVLRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIAMQDGSQ---INRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGRRCDPDADASVGEEFS-------------------------------------------CGSSFAIFYFVSFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHVDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTSLKIKTDGN-LEQANEELRAVIKKIWKRTNMKLLDQVVPPAGGD 303          

HSP 2 Score: 52.7582 bits (125), Expect = 6.145e-7
Identity = 39/154 (25.32%), Postives = 81/154 (52.60%), Query Frame = 1
Query: 2563 LGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSN-FDSFVQSLLTVFQILTGEDWNEVMY----------DGIRSYG-NLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDN 2988
            + ++  R  R+LR+ K+      +R L+ + + S +++  + +L+ +   I++++GMQ+FG     D     R+N F +F Q++L +F+  TGE W ++M           D   S G      S  +  Y+V  ++   ++++N+F+A+ +DN
Sbjct:   17 ISITFFRLFRVLRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIAMQDGSQINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGRRCDPDADASVGEEFSCGSSFAIFYFVSFYMLCAFLIINLFVAVIMDN 170          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007697.1 (pep scaffold:Pmarinus_7.0:GL478030:18311:55165:1 gene:ENSPMAG00000006953.1 transcript:ENSPMAT00000007697.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 301.597 bits (771), Expect = 9.738e-89
Identity = 201/358 (56.15%), Postives = 246/358 (68.72%), Query Frame = 1
Query: 1963 QKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGK-ESRFKLCGLCK---------SSEXXXXXXXXXXXXXXXETEGGAHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGS 3006
            QK RE+ Q +ED++GYLDWI  AEDI  + E++   +GK  SR  L  L           S           SD   + TE   H ++    + C    +RR R+WNR CRR  R  VKS  FYWVVI+LVFLNT  + SEHY Q  WL   Q+ AN + + +FT+EML KMYSLG++ YF  +FNRFD FVV   I+E ++++   M PLG+SVLRC RLLR+FKVT+YW++L NLV SLL SM+SI SLL+LLFLFI+IFSLLGMQLFGGKFNFD+    RS FD+F QSLLTVFQILTGEDWN VMYDGI +YG    + ML C+Y++ILFICGN IL+NVFLAIAVDNLAD  S
Sbjct:    1 QKLREKQQLEEDLKGYLDWIMQAEDIDPENEDETGGDGKPRSRITLADLTDKKKGRFAWFSHSNETHASIPASDADSVNTENTGHEAES---LCCCVRLARRWRRWNRFCRRKTRLTVKSTGFYWVVIILVFLNTLTIASEHYNQPDWLTQVQDIANKVLLAMFTVEMLTKMYSLGLQAYFVSLFNRFDCFVVFGGIIETILVEFGVMSPLGISVLRCVRLLRIFKVTKYWAALSNLVASLLNSMRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETQTKRSTFDNFPQSLLTVFQILTGEDWNAVMYDGIMAYGGPSSTGMLVCIYFIILFICGNCILVNVFLAIAVDNLADAES 355          

HSP 2 Score: 154.451 bits (389), Expect = 8.304e-39
Identity = 94/157 (59.87%), Postives = 116/157 (73.89%), Query Frame = 1
Query: 3295 RRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLK 3765
            RR+S++  KEK+ PIP  S+FFIF   N  R  CH + +H  F N++L  IM+SS  LAAEDP+   S RN IL YFDY FT++FTVEI LK+ +YG   H G+FCR+  N+LDLLVV  S++S+ I + AISVVKILRVLRVLRPLRAINRAKGLK
Sbjct:  424 RRLSDLNLKEKVVPIPEGSAFFIFSSTNPVRVCCHRLIHHHIFTNLILAMIMLSSVSLAAEDPIRNHSFRNNILGYFDYAFTAIFTVEILLKMTSYGAFLHKGSFCRNYFNLLDLLVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGLK 580          

HSP 3 Score: 90.8929 bits (224), Expect = 1.764e-18
Identity = 62/230 (26.96%), Postives = 114/230 (49.57%), Query Frame = 1
Query: 4282 CIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIM 4971
            C+  A + +   R+      R +    + S  F +++ +L+ LNT+++A +   QP    QV D  N V   +FTVE L K+ + G + YF   +N FD  +V G  I+ I       +        + I+  R  R++R+ K+      +  L+ + + S +++  + LL+ +   I++++GMQ+FG     +E + K     + F  FPQ++L +F+  TGE W  +M
Sbjct:   93 CVRLARRWRRWNRFC-----RRKTRLTVKSTGFYWVVIILVFLNTLTIASEHYNQPDWLTQVQDIANKVLLAMFTVEMLTKMYSLGLQAYFVSLFNRFDCFVVFGGIIETILVEFGVMSP-------LGISVLRCVRLLRIFKVTKYWAALSNLVASLLNSMRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETQTKR----STFDNFPQSLLTVFQILTGEDWNAVM 306          

HSP 4 Score: 83.1889 bits (204), Expect = 4.540e-16
Identity = 54/149 (36.24%), Postives = 79/149 (53.02%), Query Frame = 1
Query: 1000 PRPQ-RALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQV 1443
            P P+  A F  +  NP R  C +++    F  LIL  I  +  +LAA  P   R+ +  N+ L   +  F  IFT E +LK+ ++G  +H G++ RN +NLLD L+V + L+S      S     VK LR  RVLRPLR ++    L+V
Sbjct:  437 PIPEGSAFFIFSSTNPVRVCCHRLIHHHIFTNLILAMIMLSSVSLAAEDPI--RNHSFRNNILGYFDYAFTAIFTVEILLKMTSYGAFLHKGSFCRNYFNLLDLLVVGVSLVS--FGIQSSAISVVKILRVLRVLRPLRAINRAKGLKV 581          

HSP 5 Score: 55.0694 bits (131), Expect = 2.589e-7
Identity = 73/309 (23.62%), Postives = 133/309 (43.04%), Query Frame = 1
Query: 1024 CLTLRNPFRK---FCIK----IVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGP-DVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIM------YWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGV 1908
            C+ L   +R+   FC +     V+   F ++++  +F N   +A+   Y + D   +    +    V + +FT E + K+ + G      AY  + +N  D  +V  G+I T+L +     P  +  LR  R+LR  ++     +L  ++ S++ +M  +  + LL    III++++G++LF GK +                                         ++ +T R        ++FDNF  ++LTVFQ +T E W  +M      Y    S GM    IYF+ L I G+  ++N+ L +
Sbjct:   93 CVRLARRWRRWNRFCRRKTRLTVKSTGFYWVVIILVFLNTLTIASEH-YNQPD--WLTQVQDIANKVLLAMFTVEMLTKMYSLGL----QAYFVSLFNRFDCFVVFGGIIETILVEFGVMSPLGISVLRCVRLLRIFKVTKYWAALSNLVASLLNSMRSIASLLLLLFLFIIIFSLLGMQLFGGKFNF----------------------------------------DETQTKR--------STFDNFPQSLLTVFQILTGEDWNAVMYDGIMAYGGPSSTGM-LVCIYFIILFICGNCILVNVFLAI 345          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010500.1 (pep scaffold:Pmarinus_7.0:GL477503:21958:35427:1 gene:ENSPMAG00000009511.1 transcript:ENSPMAT00000010500.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 283.108 bits (723), Expect = 1.479e-86
Identity = 153/308 (49.68%), Postives = 186/308 (60.39%), Query Frame = 1
Query: 4762 SFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVD--QLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVG 5679
            S QALPYV LLI MLFFIYA++GMQ+FG +  ++E  + E   +NNFQTF QA+++LFRSATGEAWQ IML CL    C+  S                       N   V                        CGS+FAY YF+SF  +CSFL++NLFVAVIMDNF+YLTRD SILGPHHLDEFVR+W +YDP A GRI +  +  LLR ++PPLG GK CP R A   LVRM+MP+  D TV F  TL AL+RT L IK   +  D  + + ELR  +  IW   SQK LD +VPP    D+TVG
Sbjct:    1 SLQALPYVCLLIAMLFFIYAIVGMQVFGNVKLDDEGGITE---HNNFQTFFQALMLLFRSATGEAWQEIMLSCLSKKPCEQHS----------------------LNGENV------------------------CGSDFAYFYFVSFIFLCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFVRIWGDYDPAATGRITYTKMYELLRHMSPPLGLGKKCPVRIAYKRLVRMDMPIAEDNTVHFTTTLMALIRTALDIKIAKAGADKFECDSELRKEMMAIWPTLSQKTLDILVPPHRAVDLTVG 259          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007700.1 (pep scaffold:Pmarinus_7.0:GL478030:35286:55231:1 gene:ENSPMAG00000006953.1 transcript:ENSPMAT00000007700.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 277.33 bits (708), Expect = 1.515e-81
Identity = 162/241 (67.22%), Postives = 192/241 (79.67%), Query Frame = 1
Query: 2284 VKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGS 3006
            VKS  FYWVVI+LVFLNT  + SEHY Q  WL   Q+ AN + + +FT+EML KMYSLG++ YF  +FNRFD FVV   I+E ++++   M PLG+SVLRC RLLR+FKVT+YW++L NLV SLL SM+SI SLL+LLFLFI+IFSLLGMQLFGGKFNFD+    RS FD+F QSLLTVFQILTGEDWN VMYDGI +YG    + ML C+Y++ILFICGNYILLNVFLAIAVDNLAD  S
Sbjct:   15 VKSTGFYWVVIILVFLNTLTIASEHYNQPDWLTQVQDIANKVLLAMFTVEMLTKMYSLGLQAYFVSLFNRFDCFVVFGGIIETILVEFGVMSPLGISVLRCVRLLRIFKVTKYWAALSNLVASLLNSMRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETQTKRSTFDNFPQSLLTVFQILTGEDWNAVMYDGIMAYGGPSSTGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAES 255          

HSP 2 Score: 154.836 bits (390), Expect = 1.358e-39
Identity = 94/157 (59.87%), Postives = 116/157 (73.89%), Query Frame = 1
Query: 3295 RRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLK 3765
            RR+S++  KEK+ PIP  S+FFIF   N  R  CH + +H  F N++L  IM+SS  LAAEDP+   S RN IL YFDY FT++FTVEI LK+ +YG   H G+FCR+  N+LDLLVV  S++S+ I + AISVVKILRVLRVLRPLRAINRAKGLK
Sbjct:  305 RRLSDLNLKEKVVPIPEGSAFFIFSSTNPVRVCCHRLIHHHIFTNLILAMIMLSSVSLAAEDPIRNHSFRNNILGYFDYAFTAIFTVEILLKMTSYGAFLHKGSFCRNYFNLLDLLVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGLK 461          

HSP 3 Score: 88.1965 bits (217), Expect = 1.000e-17
Identity = 59/210 (28.10%), Postives = 107/210 (50.95%), Query Frame = 1
Query: 4342 RYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIM 4971
            R +    + S  F +++ +L+ LNT+++A +   QP    QV D  N V   +FTVE L K+ + G + YF   +N FD  +V G  I+ I       +        + I+  R  R++R+ K+      +  L+ + + S +++  + LL+ +   I++++GMQ+FG     +E + K     + F  FPQ++L +F+  TGE W  +M
Sbjct:    8 RRKTRLTVKSTGFYWVVIILVFLNTLTIASEHYNQPDWLTQVQDIANKVLLAMFTVEMLTKMYSLGLQAYFVSLFNRFDCFVVFGGIIETILVEFGVMSP-------LGISVLRCVRLLRIFKVTKYWAALSNLVASLLNSMRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETQTKR----STFDNFPQSLLTVFQILTGEDWNAVM 206          

HSP 4 Score: 82.4185 bits (202), Expect = 5.556e-16
Identity = 54/149 (36.24%), Postives = 79/149 (53.02%), Query Frame = 1
Query: 1000 PRPQ-RALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQV 1443
            P P+  A F  +  NP R  C +++    F  LIL  I  +  +LAA  P   R+ +  N+ L   +  F  IFT E +LK+ ++G  +H G++ RN +NLLD L+V + L+S      S     VK LR  RVLRPLR ++    L+V
Sbjct:  318 PIPEGSAFFIFSSTNPVRVCCHRLIHHHIFTNLILAMIMLSSVSLAAEDPI--RNHSFRNNILGYFDYAFTAIFTVEILLKMTSYGAFLHKGSFCRNYFNLLDLLVVGVSLVS--FGIQSSAISVVKILRVLRVLRPLRAINRAKGLKV 462          

HSP 5 Score: 54.299 bits (129), Expect = 3.238e-7
Identity = 70/297 (23.57%), Postives = 129/297 (43.43%), Query Frame = 1
Query: 1051 KFCIK----IVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGP-DVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIM------YWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGV 1908
            +FC +     V+   F ++++  +F N   +A+   Y + D   +    +    V + +FT E + K+ + G      AY  + +N  D  +V  G+I T+L +     P  +  LR  R+LR  ++     +L  ++ S++ +M  +  + LL    III++++G++LF GK +                                         ++ +T R        ++FDNF  ++LTVFQ +T E W  +M      Y    S GM    IYF+ L I G++ ++N+ L +
Sbjct:    5 RFCRRKTRLTVKSTGFYWVVIILVFLNTLTIASEH-YNQPD--WLTQVQDIANKVLLAMFTVEMLTKMYSLGL----QAYFVSLFNRFDCFVVFGGIIETILVEFGVMSPLGISVLRCVRLLRIFKVTKYWAALSNLVASLLNSMRSIASLLLLLFLFIIIFSLLGMQLFGGKFNF----------------------------------------DETQTKR--------STFDNFPQSLLTVFQILTGEDWNAVMYDGIMAYGGPSSTGM-LVCIYFIILFICGNYILLNVFLAI 245          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008632.1 (pep scaffold:Pmarinus_7.0:GL481395:151307:166184:-1 gene:ENSPMAG00000007818.1 transcript:ENSPMAT00000008632.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 274.633 bits (701), Expect = 6.382e-80
Identity = 165/242 (68.18%), Postives = 194/242 (80.17%), Query Frame = 1
Query: 2284 VKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVF-QILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGS 3006
            VKS AFYW+VIVLVFLNT  + SEHY Q  WL   Q+TAN + + LFTLEML+K+YSLG++ YF  +FNRFD FVV   I+E ++++   M PLG+SVLRC RLLR+FK TRYW+SL NLV SLL SM+SI SLL+LLFLFI+IFSLLGMQLFGGKFNFD+    RS+FD+F  +LLTVF QILTGEDWN VMYDGIR+YG      ML C+Y++ILFICGNYILLNVFLAIAVDNLAD  S
Sbjct:   57 VKSTAFYWMVIVLVFLNTLTIASEHYDQMQWLTHVQDTANKVLLALFTLEMLVKIYSLGLQAYFVSLFNRFDCFVVCGGIVETILVELKVMSPLGISVLRCVRLLRIFKATRYWNSLSNLVASLLNSMRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETQVRRSSFDNFPTALLTVFQQILTGEDWNSVMYDGIRAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAES 298          

HSP 2 Score: 160.229 bits (404), Expect = 5.477e-41
Identity = 98/158 (62.03%), Postives = 119/158 (75.32%), Query Frame = 1
Query: 3295 RRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPIN-NDAISXXXXXXXXXXXXXXXAINRAKGLK 3765
            RR+SE+  KEK+ P+P +S+FF+F   N FR  CH I NH  F N++LV IM+SS  LAAEDP+ + S RN IL YFDY FT++FT+EI LK+  YG   H G+FCRS  N+LDLLVV  S+IS+ I  + AISVVKILRVLRVLRPLRAINRAKGLK
Sbjct:  387 RRLSELQIKEKVVPMPESSAFFLFSHTNPFRILCHHIINHTIFTNLILVFIMLSSVSLAAEDPIRSTSFRNEILGYFDYAFTTIFTIEIMLKMTAYGAFVHKGSFCRSYFNLLDLLVVGVSLISFGIQWSSAISVVKILRVLRVLRPLRAINRAKGLK 544          

HSP 3 Score: 84.3445 bits (207), Expect = 1.973e-16
Identity = 60/169 (35.50%), Postives = 86/169 (50.89%), Query Frame = 1
Query:  946 QIASGGRKRTPARSQSGN---PRPQR-ALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQ 1440
            ++  G R R  +  Q      P P+  A F  +  NPFR  C  I+    F  LIL  I  +  +LAA  P   R ++  N  L   +  F  IFT E +LK+ A+G  +H G++ R+ +NLLD L+V + LIS  + + S     VK LR  RVLRPLR ++    L+
Sbjct:  379 EVPMGPRPRRLSELQIKEKVVPMPESSAFFLFSHTNPFRILCHHIINHTIFTNLILVFIMLSSVSLAAEDPI--RSTSFRNEILGYFDYAFTTIFTIEIMLKMTAYGAFVHKGSFCRSYFNLLDLLVVGVSLISFGI-QWSSAISVVKILRVLRVLRPLRAINRAKGLK 544          

HSP 4 Score: 81.2629 bits (199), Expect = 1.595e-15
Identity = 56/204 (27.45%), Postives = 107/204 (52.45%), Query Frame = 1
Query: 4363 ITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSA-TGEAWQNIM 4971
            + S  F +++ VL+ LNT+++A +   Q Q    V D  N V   +FT+E L+K+ + G + YF   +N FD  +V G  ++ I   +   +        + I+  R  R++R+ K       +  L+ + + S +++  + LL+ +   I++++GMQ+FG     +E ++    R ++F  FP A+L +F+   TGE W ++M
Sbjct:   57 VKSTAFYWMVIVLVFLNTLTIASEHYDQMQWLTHVQDTANKVLLALFTLEMLVKIYSLGLQAYFVSLFNRFDCFVVCGGIVETILVELKVMSP-------LGISVLRCVRLLRIFKATRYWNSLSNLVASLLNSMRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETQV----RRSSFDNFPTALLTVFQQILTGEDWNSVM 249          

HSP 5 Score: 58.9214 bits (141), Expect = 1.374e-8
Identity = 74/291 (25.43%), Postives = 126/291 (43.30%), Query Frame = 1
Query: 1057 CIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGP-DVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCI-TMEGWTQIMY-WINDSVGMSWP----WIYFVSLIIIGSFFVMNLVLGV 1908
            C   V+   F ++++  +F N   +A+      +    +     K   V + +FT E ++KI + G      AY  + +N  D  +V  G++ T+L ++    P  +  LR  R+LR  +      SL  ++ S++ +M  +  + LL    III++++G++LF GK                                           N +ET       +  +SFDNF  A+LTVFQ I T E W  +MY  I    G S+P     IYF+ L I G++ ++N+ L +
Sbjct:   53 CRAAVKSTAFYWMVIVLVFLNTLTIASEHYDQMQWLTHVQDTANK---VLLALFTLEMLVKIYSLGL----QAYFVSLFNRFDCFVVCGGIVETILVELKVMSPLGISVLRCVRLLRIFKATRYWNSLSNLVASLLNSMRSIASLLLLLFLFIIIFSLLGMQLFGGKF------------------------------------------NFDET------QVRRSSFDNFPTALLTVFQQILTGEDWNSVMYDGIRAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAI 288          

HSP 6 Score: 51.2174 bits (121), Expect = 3.435e-6
Identity = 43/184 (23.37%), Postives = 83/184 (45.11%), Query Frame = 1
Query: 4231 EGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQS----------FRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYE-QVMDYLNMVFTGVFTVEFLLKLAAFG---FKNYFSDAW-NVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIR 4737
            + +E      +    R+  E  +K K V   +P+ S          FR     +I    F  +I V IML+++SLA +   +   +  +++ Y +  FT +FT+E +LK+ A+G    K  F  ++ N+ D ++V  S I                  +  +   R+ RV+R ++ ++R +G++
Sbjct:  372 DDDESEPEVPMGPRPRRLSELQIKEKVVP--MPESSAFFLFSHTNPFRILCHHIINHTIFTNLILVFIMLSSVSLAAEDPIRSTSFRNEILGYFDYAFTTIFTIEIMLKMTAYGAFVHKGSFCRSYFNLLDLLVVGVSLISF---------GIQWSSAISVVKILRVLRVLRPLRAINRAKGLK 544          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Yeast
Match: CCH1 (Voltage-gated high-affinity calcium channel; involved in calcium influx in response to some environmental stresses as well as exposure to mating pheromones; interacts and partially co-localizes with Mid1p; however, evidence suggests CCH1 is not required for Mid1p function [Source:SGD;Acc:S000003449])

HSP 1 Score: 105.531 bits (262), Expect = 1.016e-22
Identity = 161/764 (21.07%), Postives = 305/764 (39.92%), Query Frame = 1
Query: 3352 SFFIFGPNNKFRKFCHFIC----------------------NHPHFGNI---VLVCIMVSSAML-----AAEDPLDAESSRNRILNY---FDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLT---SIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPK-------QSFRYRVWWLITSRPFEYIIFVLIMLNT-ISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFI-DIIYDHVNGTN---NNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGS-NFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDW---SILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSD 5487
            S++ F P ++FR+FC  +                          +F +I   V V I   + +L         PL     +    N+    D  F   F++E  +K +  G ++   A+ R+  N +D  V+++   ++I+Y  NN  +S +              I+     +     +   +  I    L++  L F F V G+ +F G+  +CND S      C  +Y   + +      ++ R +    L+ D+  +A  +L+ + + EGW  +L   ++S               ++F + +  +   F++N+FV F++    +     Y   E +K   +  +   +AKP  + IP        + F Y++   +  + F Y  F+ ++L   I + L     P           M  T VF ++  L +   G + YF   WN     I++ +FI + +  HV  ++   +N +G  L+ I  F          ++ + + +  LL T + S   +  +     +LF +YA+   Q+FG       +       N NF+T  ++++VLFR + GE W  IM                     +LTV     + +                        S Y D   CGS  +AY   +S+ +I  ++ +N+FV++I+ NF Y+ R     S +    + +++  WS++D +  G ++   +  ++   + PL F K    R    +LV   M +N D
Sbjct: 1155 SYYFFSPQHRFRRFCQRLVPPSTGKRTDGSRFFEDSTDLYNKRSYFHHIERDVFVFIFALATILLIVCSCYVTPLYRMHHKMGTWNWSSALDCAFIGAFSIEFIVKTVADGFIYSPNAYLRNPWNFIDFCVLISMWINLIAYLKNNGNLSRIFKGLTALRALRCLTISNT-ARQTFNLVMFDGLNKIFEAGLISLSLLFPFTVWGLSIFKGRLGTCNDGSLG-RADCYNEY---SNSVFQWDIMSPRVYQQPYLHLDSFASAFSSLYQIISLEGWVDLLENMMNSSGIGTPATVMGSAGNALFLVLFNFLSMVFILNLFVSFIVNNQARTTGSAYFTIE-EKAWLESQKLLSQAKP--KAIPNLIELSRVRQFFYQL--AVEKKNFYYASFLQVVLYLHIIMLLSRSYNPGNLIGYQGVYFMFSTSVFLIQEALHMCGEGPRLYFRQKWNSIRLSIIIIAFIMNAVAFHVPASHYWFHNIKGFFLLVIFLF----------IIPQNDTLTELLETAMASLPPILSLTYTWGVLFLVYAIALNQIFGLT-----RLGSNTTDNINFRTVIKSMIVLFRCSFGEGWNYIMA--------------------DLTVSEPYCSSDDN----------------------STYTD---CGSETYAYLLLMSWNIISMYIFVNMFVSLIIGNFSYVYRSGGSRSGINRSEIKKYIEAWSKFDTDGTGELELSYLPRIMHSFDGPLSF-KIWEGRLTIKSLVENYMEVNPD 1847          

HSP 2 Score: 74.7146 bits (182), Expect = 2.570e-13
Identity = 55/218 (25.23%), Postives = 108/218 (49.54%), Query Frame = 1
Query: 1192 IELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIM-RAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWP 1842
            ++  FI  F+ E ++K +A GFI  P AYLRN WN +DF  V+I +   +++ +   G   +  +    LR LR ++   + +   N +M   +  +F   L++L ++  + + GL +F G+L  TC   ND           S+ +    +++ +S F++     +     +  P + +   D+F  A  +++Q I++EGW  ++  + +S G+  P
Sbjct: 1245 LDCAFIGAFSIEFIVKTVADGFIYSPNAYLRNPWNFIDF-CVLISMWINLIAYLKNNGNLSRIFKGLTALRALRCLTISNTARQTFNLVMFDGLNKIFEAGLISLSLLFPFTVWGLSIFKGRL-GTC---ND----------GSLGRADCYNEYSNSVFQWDIMSPR----VYQQPYLHL---DSFASAFSSLYQIISLEGWVDLLENMMNSSGIGTP 1440          

HSP 3 Score: 70.0922 bits (170), Expect = 6.689e-12
Identity = 65/280 (23.21%), Postives = 122/280 (43.57%), Query Frame = 1
Query: 1267 PGAYLRNGWNLLDFLIVI---IGLISTVLSKMSEGGPDV-KALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPV---------------PCST-------------SVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGY 2010
            P A+ R+ WN +D +  +   +G+  ++ S  ++ G  + K L   R+LR + + +G+PS   ++  +   +  L +++ + ++  I + I+G+++F G     C   N    E P                P +              SV+KG+ C  +        C  N N       P  G  SFDN   +M  VF  ++   +T +MY+  DS  M+   ++F+  I + + +++NL++ VL   F    E+ KK+     +R+       V GY
Sbjct:  486 PRAFARSSWNRIDLVSSVSFWLGMFLSIKSYDTKTGIRIFKPLAILRILRLVNVDTGMPS---ILRGLKYGIPQLVNVSSMLVYFWIFFGILGVQIFQGSFRRQCVWFNP---EDPTDTYQYDMQFCGGYLDPVTKRKQNYIYEDGSEGSVSKGFLCPQYSK------CVSNAN-------PYNGRISFDNIVNSMELVFVIMSANTFTDLMYYTMDSDEMA-ACLFFIVCIFVLTIWLLNLLIAVLVSSFEIANEEYKKKKFIYGSRKTGYVARIVTGY 745          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Nematostella
Match: EDO46991 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNU9])

HSP 1 Score: 1522.29 bits (3940), Expect = 0.000e+0
Identity = 920/1787 (51.48%), Postives = 1173/1787 (65.64%), Query Frame = 1
Query:  937 LSAQIASGGRKRTPARSQ--SGNPRPQRALFCLTLRNPFRKFCIKI-------VEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSK--NDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGGAHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKS-SMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSXXXXXXXXXXXXXXXPTNVDGEEAKACNSSNVSPNIDEKTRFTDAERLIKSEEMN------GDIADESMRKMSTRIDTXXXXXXXXXXXXXXXXXNGQTSAIRRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDA--ISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHC--LPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIK--TDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVV-PPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRT-HGRGSGPLISLISPTL--VTTNECDEKDKD-YLPSHLGAERRTHSIFGTMMNVL------QRVGSTRRDSNASPSTGSINHSTELPRDRSNSRPMILNQSKSPTNHPPVKLTLAPVIEGQVISNE---EYSAEIPPKLP 6183
            L+ Q   G     P R +  +   RP+RALFCLTL NP R   I +       V   PF+ +IL TIFANC ALAA  P PE+DS+ IN  LE  E VF+ IFT E VLKI+A+GF+MHPGAYLRNGWN+LDF+IV++GL + ++   +    DVKALRAFRVLRPLRLVSG+PSLQVV+NSI++A++PLFHIALL +FV+IIYAIIG+ELF GKLHSTCY         + P PCST  ++GY C +   +G   +C        +W GPN GIT+FDN GLA LTVFQCIT+EGWT +MY IND++G SWPW+YFV+LII GSFFV+NLVLGVLSGEF+KE+ +A+K G++QK RE+   D+   GYLDWI  AEDI  D      E GK  R       K S +    +D +S   + + +  A     Q ++     K +  ++++ R RR CR+ VK+Q FYW VIV VFLN+  L  EHY Q  +L  F + AN +F+ LFTLEM++KMY LG   YF  +FNRFD  VVI S+LE+ + +     P+G+S+LRC RLLR+FKVTRYWSSL NLV SLL SM+SI+ LL+LL LF+VIFSLLGMQ+FGGKFN   +  PRSNFDSF ++L+TVFQILTGEDWN VMY GI+S+G + +S S +  LY++ L + GNYILLNVFLAIAVDNLAD  S  + E+++ +  E E       E K  +S+    N    T    + RLIK  + N      G I    +RK      T+ E+     +       + ++      +EVM  E   P+P  SS FIF   N FR  CH I  + +F N +L+ I+VSS MLAAEDPL++ S RN++LNYFDY FT+VFT+EIT+K+I YG++ H G+FCRS+ N+LD LVV  SI+S  + + +  ISVV+ILRVLRVLRPLRAINRAKGLK VVQCV VAVK+IGNIMLVT L  F+FAVIGVQLF G F SC D  K T   C+GQYI +    +    V  REW     NF++VP AMLTLF V TFEGWPG+L  S+DS   D     NNRP V+I+Y+ YII+IAFFMINIFVGFVIVTFQ EGEEE+K+CELDKNQRKC+EFALKA+P RRYIP    ++ VW ++TS+PFEY+IF  I  NTI L +++  +P+ Y +V+D  N+ FT VF +E +LKL AF  KNYF D WN+FDF++V+GS +DI       T N    +++ +  FFRLFR +RLVKLL++G GI+TLLWTF+KSFQALPYV LLI+M FFIYAV+GMQMFG+I  + E    +INRNNNFQTFPQ+++VLFRSATGE WQ IML C   P+A CD                                           N Y      +  CG++FAY YF SFY ICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVR+WSEYDPEA G +KH+D+VT+L++I PPLGFGK+CPHR AC  LV MNMPLN DGTV FNATLF LVRT+L IK      ++++ NEE+R +I K+W +TSQ+ LD+++ PP G+D+VTVGKFYAT+LIQE+FRR+K ++  E      + S +      RT HG G         P L    +   D+ D++ +L   +  + +    + ++ N +       R  S RR  +   S      ++     R +S P  L  S  P      +L L P  +  V +N+   + SA +P K P
Sbjct:   18 LNGQPKYGKPPPQPKRQKKPTNAVRPKRALFCLTLGNPIRSTAISLFTVFFLDVFRTPFDVMILITIFANCAALAAFQPLPEQDSSLINEELEVAEFVFLGIFTMESVLKIIAYGFVMHPGAYLRNGWNILDFVIVVVGLATIIVKLYTPDSFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKALIPLFHIALLVVFVVIIYAIIGVELFMGKLHSTCYDNVTGQPTFDEPHPCSTE-SEGYSCSN---AGPGQVC------LKKWEGPNYGITNFDNIGLACLTVFQCITLEGWTDVMYSINDAIGNSWPWLYFVTLIIWGSFFVLNLVLGVLSGEFAKEKARAQKSGEFQKLREKQLVDDAYHGYLDWISQAEDIEGDSSAGEDEEGKADR-------KPSFRRRKENDDISKNKENQEDSAA---SDQGWI---DRKKKILKRFHHRLRRSCRKAVKTQWFYWTVIVFVFLNSLTLALEHYNQPEFLTQFLDKANKLFLALFTLEMVVKMYCLGFHGYFASLFNRFDCLVVISSLLELGLTEAMDQRPIGISMLRCVRLLRIFKVTRYWSSLSNLVASLLNSMRSIMGLLLLLSLFMVIFSLLGMQIFGGKFNLGDEDVPRSNFDSFWRALVTVFQILTGEDWNAVMYTGIQSWGGITESLSAIPILYFIFLVVVGNYILLNVFLAIAVDNLADAESLTEMEEEKKKEREEELEMKLRMEEKESSSNKDLENKRASTSSGKSHRLIKIWKTNELLHLAGKIRVSRLRKHPI---TDAESPSLAEDSKATLNRDHESVRSATSTEVMDHE---PMPPESSLFIFSNTNCFRVVCHRIATNSYFVNFILLLIIVSSCMLAAEDPLNSNSKRNQVLNYFDYFFTAVFTIEITIKIIAYGVILHKGSFCRSAFNLLDFLVVAVSIVSIALRDSSSQISVVRILRVLRVLRPLRAINRAKGLKHVVQCVFVAVKTIGNIMLVTVLFNFLFAVIGVQLFKGTFFSCTDAEKITKRECQGQYIEFKGPGLTNPVVKDREWQPQTFNFNDVPQAMLTLFTVMTFEGWPGILESSMDSTDVDEGPFLNNRPWVAIYYVIYIIIIAFFMINIFVGFVIVTFQNEGEEEFKDCELDKNQRKCVEFALKARPTRRYIPTNRLQFHVWRVVTSQPFEYLIFAFITGNTILLMMQYYNEPKLYTRVLDGFNIGFTSVFLLECILKLFAFKPKNYFLDRWNLFDFVVVVGSVVDI-------TMNEVSSEQMFAFGFFRLFRALRLVKLLNQGSGIKTLLWTFIKSFQALPYVGLLIIMTFFIYAVVGMQMFGRIAIDPE---TQINRNNNFQTFPQSLMVLFRSATGENWQLIMLACTDTPNAKCDP------------------------------------------NAYPQDTDGL--CGTDFAYAYFCSFYAICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRVWSEYDPEASGCVKHVDIVTVLKRIAPPLGFGKFCPHREACKRLVSMNMPLNRDGTVNFNATLFGLVRTSLSIKRPEGKGSLEKANEEMRAIIMKVWPKTSQEFLDEIIQPPGGDDEVTVGKFYATYLIQEYFRRFKARQRAENAQYQDAHSTQALQAGLRTLHGLG---------PQLRRAISGHLDDDDEELFLKEDIQQKSQHKRFWESLKNAVTPSPRHSRPSSLRRPGSIRLSAFIKKGNSTPEAQRKSSLPATLTFSHGPLLTSDRQL-LVPPQQSDVNANDKESKQSAHVPSKPP 1711          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Nematostella
Match: EDO36844 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHI0])

HSP 1 Score: 226.868 bits (577), Expect = 3.485e-59
Identity = 180/573 (31.41%), Postives = 296/573 (51.66%), Query Frame = 1
Query: 3352 SFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDP-LDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTS----IISYPIN--NDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCND--VSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQ--------EGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDH------VNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEK-EMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMC 4998
            S ++F P+N+FR     +  +  F   VL+ I+++  ++A E P +   S   R+++   Y+F  +FT+E+ +KVI  GL     A+ RS  N++D  +V+ S    I++   N  N  + V+++ R LR LRPLR I+RA GLK VV+ ++ ++K IGNI+L+      +F ++GVQLF GKF  C D  V   T   C                 N   W+N   NFDN+  A+LTLF  ST +GW  ++Y  ID+   D   I N+     I+++ ++++  F ++N+ VG V+  FQ+        +  +E K  + ++  R+  E A        Y   + F + V    T   F+  I  +I LN + +AL+  +QP      +   N VFT VF +E +LK+ A G K Y  D WN  D +IV+ S + I  +       +N T           I   R+ R+ R++KLL   EGIR LL T  ++   +  + +L +++FFI++ +G+++FGKI  E      + ++ + NF++F  A+L LFR +TG+ W  I+   +   +C
Sbjct:  910 SLYVFAPDNRFRMLNKELYQNKWFDRTVLLFILLNCVVMALEGPSVLPGSLERRVIDICMYVFLGIFTIEMMVKVIALGLWIGPDAYLRSGWNVMDGFLVVISWVDVIVTATTNGQNSILGVLRVFRALRTLRPLRVISRAPGLKIVVETLISSLKPIGNIVLIAATFFIIFGILGVQLFKGKFHYCTDATVPVTTKTEC---------------LENGGSWVNREYNFDNLAKALLTLFVFSTKDGWVNIMYDGIDAVGIDKQPIRNHARYNVIYFVGFLLLAGFVVLNMLVGVVVENFQKCRTLIEMEKKIDEEKKNKKEEKMRR--EIAEDEALSEHYPRPRKFIHAV---CTHGYFDLGIAAVIALNVLCMALEHYQQPDGLTAFLKCANYVFTAVFILEAILKIFALGIKRYIKDRWNQLDMLIVILSIVGIALEEMTMELPINPT----------IIRVMRVLRIARVLKLLKTAEGIRKLLDTVAQALPQVGNLGMLFLLMFFIFSALGIELFGKIDCEKPGITCQGMDEHANFRSFGIAMLTLFRISTGDNWNGILKDTISPDVC 1452          

HSP 2 Score: 144.05 bits (362), Expect = 6.034e-34
Identity = 102/352 (28.98%), Postives = 171/352 (48.58%), Query Frame = 1
Query:  973 TPARSQSGNP-------------RPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEK--IEL---VFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDV----KALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMS---------WPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKER 1935
            TP  S + NP             R   +L+     N FR    ++ + K F+  +L  I  NC  +A   P      + +  +LE+  I++   VF+ IFT E ++K++A G  + P AYLR+GWN++D  +V+I  +  +++  + G   +    +  RA R LRPLR++S  P L++V+ +++ ++ P+ +I L+A    II+ I+G++LF GK H           ++ VP +T                K  C +N      W        +FDN   A+LT+F   T +GW  IMY   D+VG+          +  IYFV  +++  F V+N+++GV+   F K R
Sbjct:  883 TPCMSPTDNPTVDIKVPTSCCSKRADWSLYVFAPDNRFRMLNKELYQNKWFDRTVLLFILLNCVVMALEGP------SVLPGSLERRVIDICMYVFLGIFTIEMMVKVIALGLWIGPDAYLRSGWNVMDGFLVVISWVDVIVTATTNGQNSILGVLRVFRALRTLRPLRVISRAPGLKIVVETLISSLKPIGNIVLIAATFFIIFGILGVQLFKGKFH--------YCTDATVPVTT----------------KTECLENGGS---WVNREY---NFDNLAKALLTLFVFSTKDGWVNIMYDGIDAVGIDKQPIRNHARYNVIYFVGFLLLAGFVVLNMLVGVVVENFQKCR 1198          

HSP 3 Score: 128.257 bits (321), Expect = 3.973e-29
Identity = 92/241 (38.17%), Postives = 141/241 (58.51%), Query Frame = 1
Query: 2284 VKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKA----KPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLA 2994
            V S+ F +V++  +F+NT  +  E+Y Q   +       N IF  +F +EM++K+  LG   Y    FN FD  +VI S++E+           G+SVLR  RLLRVFK+ R+  +LR  +  ++ +M ++++ L LL +F+   S+LGM LFGGK+ F          R+NFD    +++TVFQ+LT EDWN VMYDG+R+      +S  + LY+++L   GNYIL N+ +AI V+  A
Sbjct:  408 VDSKWFMYVIMGAIFVNTLTMGIEYYGQPQKMTDVLEIFNYIFTAIFGIEMIMKLIGLGFYGYIKDAFNIFDGTIVIISVVELFGDDDS-----GISVLRSFRLLRVFKLVRFLPALRRQLLVMIHTMDNVMTFLALLVIFMFTASILGMNLFGGKYRFPNDEGVMETSRANFDDLFWAIVTVFQVLTQEDWNIVMYDGMRA------TSKWAGLYFILLMTIGNYILFNLLVAILVEGFA 637          

HSP 4 Score: 105.916 bits (263), Expect = 2.137e-22
Identity = 75/249 (30.12%), Postives = 126/249 (50.60%), Query Frame = 1
Query: 1372 VKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSK---------------------NDVMMESP------------VPCSTSVNKGYQCDDFHSSGFKYMCKDNK----NETSRWSG-----PNMGI------TSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEF--SKEREKAKKRGKYQK 1968
            + A+RA RVLRPLR ++ +PS+++++  ++  +  L ++  +   +  I+ I+G++++ G L S C ++                     +D++   P            +P ST+   G +C      G  Y    N+    N  + W+       +MGI       SFDN  +A + +FQ IT+EGWT IMY+I D+ G  W +IYFV LI+IGS+F+ NL L V++ +F  +K+RE    R   +K
Sbjct:    1 MTAVRAIRVLRPLRAINRVPSIRILVTLLLDTLPMLGNVLAMCSLIFSIFGIVGVQMWQGVLRSRCVAQLPGNLSANQLNISAFYQPGGSSDLVCSLPENSGDKHCTSAFIPASTA--HGREC------GLTYEQYSNRSNYTNVCANWNQYYTLCADMGINPLYDAVSFDNILIAWVAIFQVITLEGWTDIMYYIQDAHGF-WNFIYFVVLIVIGSYFMTNLCLVVITTQFQETKQRENDLMRQSRRK 240          

HSP 5 Score: 103.605 bits (257), Expect = 1.111e-21
Identity = 60/204 (29.41%), Postives = 108/204 (52.94%), Query Frame = 1
Query: 4363 ITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMF-GKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIM 4971
            + S+ F Y+I   I +NT+++ +++  QPQ+   V++  N +FT +F +E ++KL   GF  Y  DA+N+FD  IV+ S +++  D  +G            I+  R FR++R+ KL+     +R  L   + +   +     L+V+  F  +++GM +F GK    N++ + E +R  NF     AI+ +F+  T E W  +M
Sbjct:  408 VDSKWFMYVIMGAIFVNTLTMGIEYYGQPQKMTDVLEIFNYIFTAIFGIEMIMKLIGLGFYGYIKDAFNIFDGTIVIISVVELFGDDDSG------------ISVLRSFRLLRVFKLVRFLPALRRQLLVMIHTMDNVMTFLALLVIFMFTASILGMNLFGGKYRFPNDEGVMETSR-ANFDDLFWAIVTVFQVLTQEDWNIVM 598          

HSP 6 Score: 94.7449 bits (234), Expect = 5.024e-19
Identity = 82/316 (25.95%), Postives = 139/316 (43.99%), Query Frame = 1
Query: 1045 FRKFCIKIVEWKPFEYLILFTIFANCCALAANT-PYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFH-----IALLALFVIIIY--AIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMS--WPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKY 1962
            FR  C   V+ K F Y+I+  IF N   +       P++    +   LE    +F  IF  E ++K++  GF      Y+++ +N+ D  IVII    +V+    +    +  LR+FR+LR  +LV  LP+L+       R ++ + H     +  LAL VI ++  +I+G+ LF GK                                    +++   +   ETSR         +FD+   A++TVFQ +T E W  +MY   D +  +  W  +YF+ L+ IG++ + NL++ +L   F+         G Y
Sbjct:  400 FRDGCASSVDSKWFMYVIMGAIFVNTLTMGIEYYGQPQK----MTDVLEIFNYIFTAIFGIEMIMKLIGLGFY----GYIKDAFNIFDGTIVII----SVVELFGDDDSGISVLRSFRLLRVFKLVRFLPALR-------RQLLVMIHTMDNVMTFLALLVIFMFTASILGMNLFGGK------------------------------------YRFPNDEGVMETSR--------ANFDDLFWAIVTVFQVLTQEDWNIVMY---DGMRATSKWAGLYFILLMTIGNYILFNLLVAILVEGFASAPAGYDSEGNY 649          

HSP 7 Score: 76.6406 bits (187), Expect = 1.652e-13
Identity = 63/196 (32.14%), Postives = 112/196 (57.14%), Query Frame = 1
Query: 2311 VIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQ-TDAMP--PLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKA------KPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGI 2871
            +  ++ LN   +  EHY+Q   L +F   AN +F  +F LE ++K+++LG++ Y    +N+ D  +VI SI+ I + + T  +P  P  + V+R  R+ RV K+ +    +R L+ ++  ++  + +L +L  L   IFS LG++LFG K + +K           +NF SF  ++LT+F+I TG++WN ++ D I
Sbjct: 1253 IAAVIALNVLCMALEHYQQPDGLTAFLKCANYVFTAVFILEAILKIFALGIKRYIKDRWNQLDMLIVILSIVGIALEEMTMELPINPTIIRVMRVLRIARVLKLLKTAEGIRKLLDTVAQALPQVGNLGMLFLLMFFIFSALGIELFG-KIDCEKPGITCQGMDEHANFRSFGIAMLTLFRISTGDNWNGILKDTI 1447          

HSP 8 Score: 70.8626 bits (172), Expect = 1.123e-11
Identity = 64/259 (24.71%), Postives = 114/259 (44.02%), Query Frame = 1
Query: 1048 RKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGP----DVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCD--DFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIM 1806
            RKF   +     F+  I   I  N   +A    Y + D   + + L+    VF  +F  E +LKI A G       Y+++ WN LD LIVI+ ++   L +M+   P     ++ +R  R+ R L+L+     ++ +++++ +A+  + ++ +L L +  I++ +G+ELF GK+            E P         G  C   D H+                         +F +FG+AMLT+F+  T + W  I+
Sbjct: 1237 RKFIHAVCTHGYFDLGIAAVIALNVLCMALEH-YQQPDG--LTAFLKCANYVFTAVFILEAILKIFALGI----KRYIKDRWNQLDMLIVILSIVGIALEEMTMELPINPTIIRVMRVLRIARVLKLLKTAEGIRKLLDTVAQALPQVGNLGMLFLLMFFIFSALGIELF-GKIDC----------EKP---------GITCQGMDEHA-------------------------NFRSFGIAMLTLFRISTGDNWNGIL 1443          

HSP 9 Score: 66.2402 bits (160), Expect = 2.238e-10
Identity = 73/269 (27.14%), Postives = 138/269 (51.30%), Query Frame = 1
Query: 2281 LVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQ----NTANIIFVVLFTLEMLIKMYSLGM----RCYXXXXXXXXXXXXXXXSILEIVMIQT--DAMPPLGV-SVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAK-PRS-----------------NFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYG----NLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDN 2988
            L +++ F   V++ + LN  V+  E    S+   S +    +    +F+ +FT+EM++K+ +LG+      Y    +N  D F+V+ S +++++  T       LGV  V R  R LR  +V      L+ +V +L++S+K I +++++   F +IF +LG+QLF GKF++   A  P +                 NFD+  ++LLT+F   T + W  +MYDGI + G     +   +  + +Y+V   +   +++LN+ + + V+N
Sbjct:  927 LYQNKWFDRTVLLFILLNCVVMALEG--PSVLPGSLERRVIDICMYVFLGIFTIEMMVKVIALGLWIGPDAYLRSGWNVMDGFLVVISWVDVIVTATTNGQNSILGVLRVFRALRTLRPLRVISRAPGLKIVVETLISSLKPIGNIVLIAATFFIIFGILGVQLFKGKFHYCTDATVPVTTKTECLENGGSWVNREYNFDNLAKALLTLFVFSTKDGWVNIMYDGIDAVGIDKQPIRNHARYNVIYFVGFLLLAGFVVLNMLVGVVVEN 1193          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Nematostella
Match: EDO35497 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLD1])

HSP 1 Score: 213.772 bits (543), Expect = 6.964e-59
Identity = 169/538 (31.41%), Postives = 294/538 (54.65%), Query Frame = 1
Query: 3379 KFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNR-ILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTS----IISYP--INNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIM 4971
            +FR+    +C+H  F  ++LV I+ S A+LA E P  AE    R I++    +FT +FT+E+ +K++  GLV   G + R   ++LD  +V+ S    I++Y   ++ + +  +++ R LR LRPLR I RA GLK VVQ ++ ++K IGN +L+  +   MF ++GVQLF GKF  C     ++H+  + +                 +W+N   NFD++  A+++LF VST +GW  +++  ID+   D   I N      +++I ++++  F ++N+ VG V+  FQ+   E     E  +  RK  +   + +    Y      R ++ ++ T R ++  I  +I +N I ++L+  K PQ + +  +Y    FT VF +E ++K+ A GF  Y  D WN+ D  IVL S   I+ + +   ++      + ++   R+ RV++LVKL    +G+R+LL T  ++   +P + LL  +LFFIY+ +G+Q+FG +   ++   +  NR+ +F+ F  A+L LFR ATG+ W  I+
Sbjct:    7 RFRQRMRAVCSHRAFDYVILVFIIFSCAVLAIEAPDIAEQGLKRQIIDISMLVFTIIFTIEMLIKLVAMGLVLGPGTYLRDGWDVLDGFLVMVSWIDIIVTYTSHVSPEVLGTLRVFRALRTLRPLRVIRRAPGLKLVVQTLLYSLKPIGNTVLIAAIFFVMFGILGVQLFKGKFYYCEG---DSHVISKQECANSTRG----------QWVNRRYNFDDLLQALISLFVVSTKDGWVEIMHHGIDAVDVDVQPIVNYAEWRLVYFIPFLLLGGFLVLNMIVGVVVENFQR-CRERMDEEEQARPHRKGKKARNQMQDSLYYESYGPLRLKIHFICTHRNWDITIAAIICINVICMSLEHYKMPQVFVETTNYF---FTSVFVIEVVVKVIALGFVRYPKDRWNLIDLAIVLLSVTGIVLELLVKVDHLFNPTVIRTLRVLRITRVLKLVKL---AKGVRSLLDTLFEALPQVPNLGLLFFLLFFIYSCLGIQLFGSLECSHDYPCQGFNRHAHFRDFGTAMLTLFRIATGDNWNGIL 524          

HSP 2 Score: 139.428 bits (350), Expect = 5.567e-34
Identity = 94/338 (27.81%), Postives = 170/338 (50.30%), Query Frame = 1
Query: 1045 FRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDV----KALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTS-----VNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGM---------SWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSK------EREKAKKRGKYQKAREQMQ 1986
            FR+    +   + F+Y+IL  I  +C  LA   P    +       ++   LVF +IFT E ++K++A G ++ PG YLR+GW++LD  +V++  I  +++  S   P+V    +  RA R LRPLR++   P L++V+ +++ ++ P+ +  L+A    +++ I+G++LF GK +   Y + D  + S   C+ S     VN+ Y                                +FD+   A++++F   T +GW +IM+   D+V +          W  +YF+  +++G F V+N+++GV+   F +      E E+A+   K +KAR QMQ
Sbjct:    8 FRQRMRAVCSHRAFDYVILVFIIFSCAVLAIEAP-DIAEQGLKRQIIDISMLVFTIIFTIEMLIKLVAMGLVLGPGTYLRDGWDVLDGFLVMVSWIDIIVTYTSHVSPEVLGTLRVFRALRTLRPLRVIRRAPGLKLVVQTLLYSLKPIGNTVLIAAIFFVMFGILGVQLFKGKFY---YCEGDSHVISKQECANSTRGQWVNRRY--------------------------------NFDDLLQALISLFVVSTKDGWVEIMHHGIDAVDVDVQPIVNYAEWRLVYFIPFLLLGGFLVLNMIVGVVVENFQRCRERMDEEEQARPHRKGKKARNQMQ 309          

HSP 3 Score: 103.99 bits (258), Expect = 2.196e-22
Identity = 64/233 (27.47%), Postives = 116/233 (49.79%), Query Frame = 1
Query: 4339 FRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQR--YEQVMDYLNMVFTGVFTVEFLLKLAAFGF----KNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMF--------------GKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLH 4977
            FR R+  + + R F+Y+I V I+ +   LA++     ++    Q++D   +VFT +FT+E L+KL A G       Y  D W+V D  +V+ S+IDII  + +  +    G    ++  FR  R +R ++++ R  G++ ++ T + S + +    L+  + F ++ ++G+Q+F               K    N    + +NR  NF    QA++ LF  +T + W  IM H
Sbjct:    8 FRQRMRAVCSHRAFDYVILVFIIFSCAVLAIEAPDIAEQGLKRQIIDISMLVFTIIFTIEMLIKLVAMGLVLGPGTYLRDGWDVLDGFLVMVSWIDIIVTYTSHVSPEVLG----TLRVFRALRTLRPLRVIRRAPGLKLVVQTLLYSLKPIGNTVLIAAIFFVMFGILGVQLFKGKFYYCEGDSHVISKQECANSTRGQWVNRRYNFDDLLQALISLFVVSTKDGWVEIMHH 236          

HSP 4 Score: 67.0106 bits (162), Expect = 9.382e-11
Identity = 67/226 (29.65%), Postives = 118/226 (52.21%), Query Frame = 1
Query: 2293 QAFYWVVIVLVFLNTGVLTSEH--------YRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGM----RCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPP--LG-VSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNF------------------DKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGI 2871
            +AF +V++V +  +  VL  E          RQ I      + + ++F ++FT+EMLIK+ ++G+      Y    ++  D F+V+ S ++I++  T  + P  LG + V R  R LR  +V R    L+ +V +LL S+K I + +++  +F V+F +LG+QLF GKF +                   +    R NFD  +Q+L+++F + T + W E+M+ GI
Sbjct:   19 RAFDYVILVFIIFSCAVLAIEAPDIAEQGLKRQII------DISMLVFTIIFTIEMLIKLVAMGLVLGPGTYLRDGWDVLDGFLVMVSWIDIIVTYTSHVSPEVLGTLRVFRALRTLRPLRVIRRAPGLKLVVQTLLYSLKPIGNTVLIAAIFFVMFGILGVQLFKGKFYYCEGDSHVISKQECANSTRGQWVNRRYNFDDLLQALISLFVVSTKDGWVEIMHHGI 238          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Nematostella
Match: EDO46797 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP56])

HSP 1 Score: 220.32 bits (560), Expect = 2.556e-57
Identity = 197/652 (30.21%), Postives = 318/652 (48.77%), Query Frame = 1
Query: 3379 KFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAED-PLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSI-ISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKR--------EWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQ--QEGEEEYKNCE--LDKNQRKCIEFALKAK----PVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPH---NFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLII-NLFVAVIMDNFD 5268
            KFR        H +F   +L  +MVSS  L  ED  L  +    R LN+ ++LF ++F++E  LKVI +G V    ++  S  N LD L+V   + ++    N  +SV +  R +R LRPLRAI+R  G+K V+  +  A+  IG++++V+ L   MF++ GVQLF GKF  C +                +E     V  NK          W+N  +NFDNV N  L L  V+T+EGW  V+  ++DS K D    Y    I   +++ +IIV +FF++N+FVG +I  F   ++  EE  +    L ++QRK ++  + A     P  R  P   FR +++ L++S  FE  I  +IM N   + ++   QP     + +Y   V  G+F +E ++K+ A    +YF  AW++FDF++V+ S + +       +     G     +   R+FRV RL++++   + IR LL   + S  AL  +  L+ ++ FIYA+IGM  FG I     K+   +N   NF+TF  +I+++FR  TG  W +I+                                     D++V+ PPH   NF  +              CG      +++  Y++  FLII N+++AV++DN +
Sbjct:  781 KFRCRVRCFVEHRYFEWFILFTVMVSSFTLVFEDIHLHQKPDLERALNFLNFLFAAIFSLEFILKVIGFGFV----SYFTSVWNCLDALIVSVCVSVACLFENPNLSVFRSFRTVRGLRPLRAISRLGGMKVVINALFAAIPGIGSVLVVSMLFWLMFSISGVQLFAGKFYKCVNAE--------------DEKLSPSVIPNKTACLDHPDYRWVNANVNFDNVINGFLALLQVATYEGWMEVMADAVDSTKIDQQPSYEANLIAYAYFVVFIIVGSFFVLNLFVGVIIDNFNTLKKKYEEINSMGMLLTESQRKWVQILMAAAKRKPPSNRLRPTDCFRGKLFDLVSSNQFEVFILTVIMCNMGMMMVQHYDQPPLTTVIGNY---VLVGIFLLEAIIKIIAMRL-HYFKKAWSIFDFVVVVSSIVGMYLGMSTESAVVSPG----LLRVLRVFRVARLLRVVQFAKRIRQLLVAIIISMPALFNIGTLLFLVMFIYAIIGMSSFGNI-----KKQGALNDLVNFETFSSSIILIFRLGTGTGWNDIL-------------------------------------DALVVQPPHCDPNFGGLP----------NGNCGFPIGAVFYLVTYIVSVFLIIVNMYIAVLLDNVN 1354          

HSP 2 Score: 146.747 bits (369), Expect = 8.335e-35
Identity = 98/312 (31.41%), Postives = 158/312 (50.64%), Query Frame = 1
Query: 1015 ALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKAL---RAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCY--SKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWS-GPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKE 1932
            +L CL   +P R FCI ++    FE ++   I  NC  L  N P PE           + E +F  I+T E + KI++ GF+    AYLR+ WN LD L+V +  +S          PD+ +L   R  RVLR  R +S L  L+ ++NS++R++  L  + +L LF + + A+IGL+LF+G+L + C   + N   + +P        +   C    ++G    C  N    +     P+ G T+FD+ G +++  FQ +TM+ W  +   +  S+G  W  +YFV  I   SF+++NLVL V+   +  E
Sbjct:   40 SLLCLGPVHPLRMFCILLITHPYFEIIVTLVILVNCIILGLNDP-PE-----------EAEYIFTAIYTLEMICKIISRGFVKDSYAYLRDTWNWLDSLVVFLSYLSL--------APDIASLSGIRTLRVLRAFRTISALKGLRAMVNSLLRSLKLLTDVLVLFLFSLCVLALIGLQLFTGELRNKCVLETANATTINNPSSWYHREGEPLLCGFSSTAG---RCPANYTCVAHVGPNPDHGFTNFDDIGWSLVMAFQILTMDFWENLYDRVLRSMG-EWYMMYFVVGIFSCSFYLLNLVLAVVYMSYHHE 327          

HSP 3 Score: 118.242 bits (295), Expect = 3.501e-26
Identity = 92/323 (28.48%), Postives = 161/323 (49.85%), Query Frame = 1
Query: 1021 FC-LTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRV---LRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSW---------PWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKK 1950
            FC L  R   R F    VE + FE+ ILFT+  +   L     +  +  + +  AL  +  +F  IF+ E +LK++ FGF+    +Y  + WN LD LIV + +    L +     P++   R+FR    LRPLR +S L  ++VV+N++  A+  +  + ++++   ++++I G++LF+GK +    ++++ +  S +P  T+                  C D+ +   RW   N+   +FDN     L + Q  T EGW ++M    DS  +            + YFV  II+GSFFV+NL +GV+   F+  ++K ++
Sbjct:  777 FCWLKFRCRVRCF----VEHRYFEWFILFTVMVSSFTLVFEDIHLHQKPD-LERALNFLNFLFAAIFSLEFILKVIGFGFV----SYFTSVWNCLDALIVSVCVSVACLFE----NPNLSVFRSFRTVRGLRPLRAISRLGGMKVVINALFAAIPGIGSVLVVSMLFWLMFSISGVQLFAGKFYKCVNAEDEKLSPSVIPNKTA------------------CLDHPDY--RWVNANV---NFDNVINGFLALLQVATYEGWMEVMADAVDSTKIDQQPSYEANLIAYAYFVVFIIVGSFFVLNLFVGVIIDNFNTLKKKYEE 1063          

HSP 4 Score: 92.8189 bits (229), Expect = 2.001e-18
Identity = 59/205 (28.78%), Postives = 107/205 (52.20%), Query Frame = 1
Query: 4372 RP-FEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCL 4983
            RP F+ II  LI+LNT+ L + +   P     V+D LN +FTG+F +E ++K+ AFG   Y  + WN+FD +I++ S +     +  GT+          ++ FR+ R++R++ L    E +  L+     S   +  +  ++ ++ +++AV+GM++FG   T      + I R  NF  F  + +++FR    E W   +  C+
Sbjct:  479 RPLFDGIIAGLILLNTVVLTMYYHGMPDDLTFVLDILNAIFTGLFILEMIVKIFAFGLVKYICNKWNLFDSVIIITSAV----AYFLGTSTG--------VSIFRILRLLRVLYLAQSWETMAKLIRAIAHSVDPIFNITCILGVIIYVFAVVGMRVFGPHYTAEAFGSRGIPR-WNFTDFTHSFMMVFRILCSE-WVEPLWDCM 669          

HSP 5 Score: 87.4261 bits (215), Expect = 1.004e-16
Identity = 70/245 (28.57%), Postives = 130/245 (53.06%), Query Frame = 1
Query: 2284 VKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMP-----PLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFN---FDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLA 2994
            ++   F  ++  L+ LNT VLT  ++     L    +  N IF  LF LEM++K+++ G+  Y              +++ + V+I T A+        GVS+ R  RLLRV  + + W ++  L+ ++  S+  I ++  +L + I +F+++GM++FG  +    F  +  PR NF  F  S + VF+IL  E W E ++D +R       ++  + L+++   I GN+I+LN+F+A+ +++ A
Sbjct:  477 IQRPLFDGIIAGLILLNTVVLTMYYHGMPDDLTFVLDILNAIFTGLFILEMIVKIFAFGLVKY----------ICNKWNLFDSVIIITSAVAYFLGTSTGVSIFRILRLLRVLYLAQSWETMAKLIRAIAHSVDPIFNITCILGVIIYVFAVVGMRVFGPHYTAEAFGSRGIPRWNFTDFTHSFMMVFRILCSE-WVEPLWDCMRV------TNTAALLFFLPALIVGNFIVLNLFVALLLNSFA 704          

HSP 6 Score: 73.559 bits (179), Expect = 1.553e-12
Identity = 71/276 (25.72%), Postives = 132/276 (47.83%), Query Frame = 1
Query: 3346 ASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQS-CNDVSKNTHISCRGQYIYYNEAD-------------------IAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDY 4113
             +S    GP +  R FC  +  HP+F  IV + I+V+  +L   DP +            +Y+FT+++T+E+  K+I+ G V  + A+ R + N LD LVV  S +S   +  ++S ++ LRVLR  R + A+   KGL+ +V  ++ ++K + +++++      + A+IG+QLF G+ ++ C   + N          Y+ E +                   +A V  N         NFD++  +++  F + T + W  +  + + S  E Y
Sbjct:   38 TASLLCLGPVHPLRMFCILLITHPYFEIIVTLVILVNCIILGLNDPPEEA----------EYIFTAIYTLEMICKIISRGFVKDSYAYLRDTWNWLDSLVVFLSYLSLAPDIASLSGIRTLRVLRAFRTISAL---KGLRAMVNSLLRSLKLLTDVLVLFLFSLCVLALIGLQLFTGELRNKCVLETANATTINNPSSWYHREGEPLLCGFSSTAGRCPANYTCVAHVGPNPDHGFT---NFDDIGWSLVMAFQILTMDFWENLYDRVLRSMGEWY 297          

HSP 7 Score: 71.633 bits (174), Expect = 5.002e-12
Identity = 72/306 (23.53%), Postives = 131/306 (42.81%), Query Frame = 1
Query: 1057 CIKIVEW--KP-FEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQ 1965
            C  +VE+  +P F+ +I   I  N   L   T Y     + +   L+ +  +F  +F  E ++KI AFG +     Y+ N WNL D +I+I   ++  L   S G   V   R  R+LR L L     ++  ++ +I  ++ P+F+I  +   +I ++A++G+ +F                             Y  + F S G             RW        +F +F  + + VF+ +  E W + + W    V  +   ++F+  +I+G+F V+NL + +L   F+K+ E   +    Q
Sbjct:  470 CSALVEFIQRPLFDGIIAGLILLNTVVL---TMYYHGMPDDLTFVLDILNAIFTGLFILEMIVKIFAFGLV----KYICNKWNLFDSVIIITSAVAYFLGT-STG---VSIFRILRLLRVLYLAQSWETMAKLIRAIAHSVDPIFNITCILGVIIYVFAVVGMRVFGPH--------------------------YTAEAFGSRGIP-----------RW--------NFTDFTHSFMMVFRILCSE-WVEPL-WDCMRVTNTAALLFFLPALIVGNFIVLNLFVALLLNSFAKKEEDLHREASEQ 717          

HSP 8 Score: 66.2402 bits (160), Expect = 2.723e-10
Identity = 76/327 (23.24%), Postives = 140/327 (42.81%), Query Frame = 1
Query: 4327 PKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKN----YFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMF-GKITTENEKEMKEINRNNN----FQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFND---SMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDY 5271
            P    R     LIT   FE I+ ++I++N I L L  +  P+  E +       FT ++T+E + K+ + GF      Y  D WN  D ++V  S++ +  D             + S++  R  RV+R  + +S  +G+R ++ + ++S + L  V +L +    + A+IG+Q+F G++  +   E       NN    +    + +L  F S  G         C  +  C A             V      G   F+D   S+V+     F  + ++ + + Y  V +    +   YF+     CSF ++NL +AV+  ++ +
Sbjct:   46 PVHPLRMFCILLITHPYFEIIVTLVILVNCIILGL--NDPPEEAEYI-------FTAIYTLEMICKIISRGFVKDSYAYLRDTWNWLDSLVVFLSYLSLAPD-------------IASLSGIRTLRVLRAFRTISALKGLRAMVNSLLRSLKLLTDVLVLFLFSLCVLALIGLQLFTGELRNKCVLETANATTINNPSSWYHREGEPLLCGFSSTAGR--------CPANYTCVA------------HVGPNPDHGFTNFDDIGWSLVM----AFQILTMDFWENLYDRVLRSMGEWYMMYFVVGIFSCSFYLLNLVLAVVYMSYHH 326          

HSP 9 Score: 65.0846 bits (157), Expect = 4.907e-10
Identity = 72/267 (26.97%), Postives = 125/267 (46.82%), Query Frame = 1
Query: 2284 VKSQAFYWVVIVLVFLNTGVLTSE--HYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGV-SVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKF-----NFDKKAKPRS--------------------NFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSS----MLSCLYYVILFICGNYILLNVFLAIAVDN 2988
            V+ + F W ++  V +++  L  E  H  Q   L+   N  N +F  +F+LE ++K+   G   YF  ++N  D  +V   +    + +    P L V    R  R LR  +       ++ ++ +L A++  I S+LV+  LF ++FS+ G+QLF GKF       D+K  P                      NFD+ +   L + Q+ T E W EVM D + S     + S    +++  Y+V+  I G++ +LN+F+ + +DN
Sbjct:  790 VEHRYFEWFILFTVMVSSFTLVFEDIHLHQKPDLERALNFLNFLFAAIFSLEFILKVIGFGFVSYFTSVWNCLDALIVSVCVSVACLFEN---PNLSVFRSFRTVRGLRPLRAISRLGGMKVVINALFAAIPGIGSVLVVSMLFWLMFSISGVQLFAGKFYKCVNAEDEKLSPSVIPNKTACLDHPDYRWVNANVNFDNVINGFLALLQVATYEGWMEVMADAVDSTKIDQQPSYEANLIAYAYFVVFIIVGSFFVLNLFVGVIIDN 1053          

HSP 10 Score: 62.3882 bits (150), Expect = 3.954e-9
Identity = 57/205 (27.80%), Postives = 90/205 (43.90%), Query Frame = 1
Query:  943 AQIASGGRKRTPARSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGG---PDV-KALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELF 1545
             QI     KR P    S   RP          + FR     +V    FE  IL  I  N   +         D   + + +     V + IF  E ++KI+A    +H   Y +  W++ DF++V+  ++   L   +E     P + + LR FRV R LR+V     ++ ++ +I+ +M  LF+I  L   V+ IYAIIG+  F
Sbjct: 1079 VQILMAAAKRKPP---SNRLRPT---------DCFRGKLFDLVSSNQFEVFILTVIMCNMGMMMVQ----HYDQPPLTTVIGN--YVLVGIFLLEAIIKIIAMR--LH---YFKKAWSIFDFVVVVSSIVGMYLGMSTESAVVSPGLLRVLRVFRVARLLRVVQFAKRIRQLLVAIIISMPALFNIGTLLFLVMFIYAIIGMSSF 1260          

HSP 11 Score: 60.4622 bits (145), Expect = 1.231e-8
Identity = 67/256 (26.17%), Postives = 139/256 (54.30%), Query Frame = 1
Query: 2281 LVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVM---IQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRS--NFDSFVQSLLTVFQILTGEDWNEVM-------------YDGIRSYGNLGKSSMLSCLYYVILFICGNY-ILLNVFLAIAVDNL 2991
            LV S  F   ++ ++  N G++  +HY Q           N + V +F LE +IK+ ++ +  YF   ++ FDF VV+ SI+ + +    ++  + P  + VLR  R+ R+ +V ++   +R L+ +++ SM ++ ++  LLFL + I++++GM  FG   N  K+       NF++F  S++ +F++ TG  WN+++             + G+ + GN G    +  ++Y++ +I   + I++N+++A+ +DN+
Sbjct: 1108 LVSSNQFEVFILTVIMCNMGMMMVQHYDQPPLTTVI---GNYVLVGIFLLEAIIKIIAMRLH-YFKKAWSIFDFVVVVSSIVGMYLGMSTESAVVSPGLLRVLRVFRVARLLRVVQFAKRIRQLLVAIIISMPALFNIGTLLFLVMFIYAIIGMSSFG---NIKKQGALNDLVNFETFSSSIILIFRLGTGTGWNDILDALVVQPPHCDPNFGGLPN-GNCGFP--IGAVFYLVTYIVSVFLIIVNMYIAVLLDNV 1353          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Nematostella
Match: EDO35661 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKR1])

HSP 1 Score: 219.935 bits (559), Expect = 3.853e-57
Identity = 218/761 (28.65%), Postives = 370/761 (48.62%), Query Frame = 1
Query: 3403 ICNHPHFGNIVLVCIMVSSAMLAAEDP-LDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSI---ISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELD-------KNQRKCIEFALKAKPVRRYI-PKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALK-FDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGT-----NNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNI---MLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLI-INLFVAVIMDNFDYLTRDWSI-LGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKR 5616
            +  H  F  I+L  I  SS  LA ED  LD++ +  ++L   + LF  +FTVE+ LK I  G       +  +  NILD ++V+ SI   ++    ND I+ ++ LR LR  RPLRAI+R +G+K V+  ++ A+  IGN++LV  +   +F+++GVQ+F GKF  C D        C    +      ++    N   W N+ +NFD V    L L  V+TFEGW  ++  ++D+ K D   I  N     +F++ +II+  FF +N+F+G +I  F Q  ++      +D       +N    ++ A   KP +R   P+  F+  ++ ++ SR FE  I + I +N + + ++ +D      +Q+   LN++FT VF +E +L++ A   K YF + WNVFDF+IV+ S I II +++  +     +              R F   R         GIR LL++ V S  AL  +  L+ ++ FIYA+IGM +FG +     K+ + +N   NF+TF  + ++LFR  T   W +I   ++   PD  CD         Y      R   +GN                                CG+ +  P ++  +++  FLI IN+++AVI++N++ +     I +    ++ F ++W  +DP A   I + D+   + ++   L   K  P++ AC  L   N+PL     +     L ALV+   +I +    VD  +E  ++V++++ +R
Sbjct:  823 LVEHKVFEGIILFLIAASSISLAFEDVYLDSKPTLKQVLQILNILFAVIFTVEMLLKWIGLGF----KTYFTNPWNILDFVIVIVSIMVSLATIFGNDQIAFIRSLRTLRAFRPLRAISRFEGMKVVITSLLHAIPGIGNVLLVCLMFWLIFSIMGVQIFGGKFGKCVDEGGE---KCPASVVPNKTVCLS----NGYRWENSNINFDTVDQGFLALLQVATFEGWMEIMEDAVDATKIDEQPIEENNVSAYLFFVVFIILGTFFTLNLFIGVIIDNFNQLKQQMEAVGSMDVFLTSTQRNWMNALKSAATKKPKKRIRRPQNKFQGELYDMVQSRKFEVFIMLFITINMVVMMVQHYDHLAVWSKQI---LNLIFTSVFILEAILRIIALR-KGYFLNPWNVFDFVIVISSIIGIIVENLQTSLVINPSLLRVVRVFRVGRLLRFFEAAR---------GIRRLLFSLVISTPALFNIGALLFLIIFIYAIIGMSIFGHV-----KKTEALNDVVNFETFGSSFVLLFRLMTSAGWNDILDPLMISEPD--CDP-------NY------RGLPSGN--------------------------------CGNKYMAPIYLGSFVVIIFLILINMYIAVILENYNQVMEQEKIGITNEDIELFYQMWELFDPNATQYIPYADLSDFVHQMEGNLRIPK--PNKAACALL---NIPLVKGDKIHCLDLLQALVK---RIVSGFEDVD--SEGFKIVMQRMEER 1497          

HSP 2 Score: 161.384 bits (407), Expect = 3.206e-39
Identity = 115/371 (31.00%), Postives = 184/371 (49.60%), Query Frame = 1
Query: 1012 RALFCLTLRNPFRKFCIKIVEWK-PFEY-----LILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRA---FRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDD------FHSSGFKYMCKDNKNETSRWSG-PNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPW--IYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAK---KRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEEND 2061
            ++L+     NP R+F +K++  + P +       +L TI  NC  LA   P PE+            E VF  I+T E   KI+A GF +H  AYLR+ WN LDF++VI+G ++          PDV  L     FRV R LR +S +  L+ ++N+++ +M  L+ + +L LF I I+A+IG++LF G+L + C       +  P     S +  +  +D       +++G +  C  N        G PN G TSFD+FG A+LT FQ IT++ W  +    N+ +    PW  +YF  +I  G FF++NLVL V++  +  E + +K   +  + ++ R    +       L  +    D+  DE N 
Sbjct:   22 KSLYLFGPENPIRQFSLKLITNQYPLQLHNRHMFVLLTILVNCVFLAMTNP-PEQP-----------EYVFAAIYTIEMFCKIIAKGFALHRYAYLRDKWNWLDFIVVILGNVTI--------SPDVANLSGIPTFRVFRALRTISAVKGLKAMVNTLLVSMKMLWDVMVLTLFFICIFALIGMQLFIGELRNKCALPVPENLSVPYRTYASNSSIWYLEDNEPILCGNTTGSR-TCPTNYTCLPHAGGNPNFGYTSFDHFGWALLTGFQLITLDFWENVY---NNVIYTMGPWYVVYFAVVIFFGPFFLVNLVLAVVAASYENEVKASKMETEEERKEQKRVASSYSVRRASILSIVYGQGDVIPDEPNS 368          

HSP 3 Score: 127.102 bits (318), Expect = 8.069e-29
Identity = 92/312 (29.49%), Postives = 155/312 (49.68%), Query Frame = 1
Query: 1063 KIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPD----VKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCST-SVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSW---------PWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRG 1956
            ++VE K FE +ILF I A+  +LA    Y +    T+   L+ + ++F VIFT E +LK +  GF      Y  N WN+LDF+IVI+   S ++S  +  G D    +++LR  R  RPLR +S    ++VV+ S++ A+  + ++ L+ L   +I++I+G+++F GK         +    S VP  T  ++ GY                      RW   N+   +FD      L + Q  T EGW +IM    D+  +            +++FV  II+G+FF +NL +GV+   F++ +++ +  G
Sbjct:  822 RLVEHKVFEGIILFLIAASSISLAFEDVYLDSKP-TLKQVLQILNILFAVIFTVEMLLKWIGLGF----KTYFTNPWNILDFVIVIV---SIMVSLATIFGNDQIAFIRSLRTLRAFRPLRAISRFEGMKVVITSLLHAIPGIGNVLLVCLMFWLIFSIMGVQIFGGKFGKCVDEGGEKCPASVVPNKTVCLSNGY----------------------RWENSNI---NFDTVDQGFLALLQVATFEGWMEIMEDAVDATKIDEQPIEENNVSAYLFFVVFIILGTFFTLNLFIGVIIDNFNQLKQQMEAVG 1100          

HSP 4 Score: 117.472 bits (293), Expect = 6.721e-26
Identity = 95/342 (27.78%), Postives = 154/342 (45.03%), Query Frame = 1
Query: 4342 RYRVWWLITSRPFEYIIFVLIMLNTISLALK---FDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGK-----ITTENEKEMKEI---------------NRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILG 5298
            RY+V  L+  + FE II  LI  ++ISLA +    D +P   +QV+  LN++F  +FTVE LLK    GFK YF++ WN+ DF+IV+ S I +    + G       D++  I   R  R  R ++ +SR EG++ ++ + + +   +  V L+ +M + I++++G+Q+FG      +    EK    +               N N NF T  Q  L L + AT E W  IM     DA+     D+   E  N++                                              AY +F+ F ++ +F  +NLF+ VI+DNF+ L +    +G
Sbjct:  817 RYKVRRLVEHKVFEGIILFLIAASSISLAFEDVYLDSKPT-LKQVLQILNILFAVIFTVEMLLKWIGLGFKTYFTNPWNILDFVIVIVS-IMVSLATIFGN------DQIAFIRSLRTLRAFRPLRAISRFEGMKVVITSLLHAIPGIGNVLLVCLMFWLIFSIMGVQIFGGKFGKCVDEGGEKCPASVVPNKTVCLSNGYRWENSNINFDTVDQGFLALLQVATFEGWMEIM----EDAVDATKIDEQPIEENNVS----------------------------------------------AYLFFVVFIILGTFFTLNLFIGVIIDNFNQLKQQMEAVG 1100          

HSP 5 Score: 102.064 bits (253), Expect = 3.549e-21
Identity = 72/209 (34.45%), Postives = 114/209 (54.55%), Query Frame = 1
Query: 4381 EYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCL----PDAM 4995
            E  I V I+LNT+ ++++  +       V++  N VFT +F +E +LKL A GF  Y   AWN+FD I+V+ S +D I   VN    +  G     I+  R FR++R++KL      + +LL T  KS  AL  + +++ ++ +I+AV+GMQ+ G   T  +K    I R  NF+ FP + +++FR   GE W   +  C+    P AM
Sbjct:  506 EIFIIVCILLNTLVMSIEHPRLEDPLLTVVNISNEVFTFIFLLEMILKLIALGFLGYIRVAWNIFDGIVVIISIVDFI---VNKFVPDAGGT---GISVLRTFRLLRVLKLAKSWSTMNSLLATIGKSLGALGNLTVILAIIVYIFAVMGMQLLGNSYTP-DKFGGSIPR-WNFKDFPHSFMMIFRVLCGE-WIEPLWDCMLATGPVAM 705          

HSP 6 Score: 99.7525 bits (247), Expect = 1.758e-20
Identity = 81/221 (36.65%), Postives = 132/221 (59.73%), Query Frame = 1
Query: 2311 VIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVM--IQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDK--KAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLN 2961
            +IV + LNT V++ EH R    L +  N +N +F  +F LEM++K+ +LG   Y    +N FD  VVI SI++ ++     DA    G+SVLR  RLLRV K+ + WS++ +L+ ++  S+ ++ +L V+L + + IF+++GMQL G  +  DK   + PR NF  F  S + +F++L GE W E ++D + + G       ++ L +V  FI GN+I+LN
Sbjct:  509 IIVCILLNTLVMSIEHPRLEDPLLTVVNISNEVFTFIFLLEMILKLIALGFLGYIRVAWNIFDGIVVIISIVDFIVNKFVPDA-GGTGISVLRTFRLLRVLKLAKSWSTMNSLLATIGKSLGALGNLTVILAIIVYIFAVMGMQLLGNSYTPDKFGGSIPRWNFKDFPHSFMMIFRVLCGE-WIEPLWDCMLATGP------VAMLLFVPAFILGNFIILN 721          

HSP 7 Score: 73.559 bits (179), Expect = 1.303e-12
Identity = 44/165 (26.67%), Postives = 86/165 (52.12%), Query Frame = 1
Query: 1060 IKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKM--SEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFS 1548
            +K    K  E  I+  I  N   ++   P  E    T+ +   +   VF  IF  E +LK++A GF+     Y+R  WN+ D ++VII ++  +++K     GG  +  LR FR+LR L+L     ++  ++ +I +++  L ++ ++   ++ I+A++G++L  
Sbjct:  497 LKFTNGKVMEIFIIVCILLNTLVMSIEHPRLEDPLLTVVNISNE---VFTFIFLLEMILKLIALGFL----GYIRVAWNIFDGIVVIISIVDFIVNKFVPDAGGTGISVLRTFRLLRVLKLAKSWSTMNSLLATIGKSLGALGNLTVILAIIVYIFAVMGMQLLG 654          

HSP 8 Score: 69.707 bits (169), Expect = 2.058e-11
Identity = 75/280 (26.79%), Postives = 137/280 (48.93%), Query Frame = 1
Query: 2281 LVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDS------FQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLG-------VSVLRCARLLRVFKVTRYWS---SLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFN--FDKKAK--PRS--------------------NFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYG----NLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDN 2988
            LV+ + F  +++ L+  ++  L  E     ++LDS           NI+F V+FT+EML+K   LG + Y          F   ++IL+ V++    M  L        ++ +R  R LR F+  R  S    ++ ++ SLL ++  I ++L++  +F +IFS++G+Q+FGGKF    D+  +  P S                    NFD+  Q  L + Q+ T E W E+M D + +       + ++++ + L++V+  I G +  LN+F+ + +DN
Sbjct:  823 LVEHKVFEGIILFLIAASSISLAFE----DVYLDSKPTLKQVLQILNILFAVIFTVEMLLKWIGLGFKTY----------FTNPWNILDFVIVIVSIMVSLATIFGNDQIAFIRSLRTLRAFRPLRAISRFEGMKVVITSLLHAIPGIGNVLLVCLMFWLIFSIMGVQIFGGKFGKCVDEGGEKCPASVVPNKTVCLSNGYRWENSNINFDTVDQGFLALLQVATFEGWMEIMEDAVDATKIDEQPIEENNVSAYLFFVVFIILGTFFTLNLFIGVIIDN 1088          

HSP 9 Score: 66.2402 bits (160), Expect = 2.282e-10
Identity = 89/341 (26.10%), Postives = 167/341 (48.97%), Query Frame = 1
Query: 3316 AKEKIKPIPNASSFFIFGPNNKFRKFC-HFICN-HP-HFGN---IVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQS-CN-DVSKNTHISCR----GQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTL-FAVSTFE--GWP---GVLYKSIDSFKEDYSG-IYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRK 4281
             K ++     + S ++FGP N  R+F    I N +P    N    VL+ I+V+   LA  +P +            +Y+F +++T+E+  K+I  G   H  A+ R   N LD +VV+   ++  I+ D ++ +  +   RV R LR I+  KGLK +V  ++V++K + ++M++T     +FA+IG+QLF G+ ++ C   V +N  +  R       I+Y E +   +  N       P N+  +P+A     F  ++F+  GW    G    ++D ++  Y+  IY   P   +++   I    FF++N+ +  V  +++ E +      E ++ ++K
Sbjct:   11 GKTQVYRFNRSKSLYLFGPENPIRQFSLKLITNQYPLQLHNRHMFVLLTILVNCVFLAMTNPPEQP----------EYVFAAIYTIEMFCKIIAKGFALHRYAYLRDKWNWLDFIVVILGNVT--ISPD-VANLSGIPTFRVFRALRTISAVKGLKAMVNTLLVSMKMLWDVMVLTLFFICIFALIGMQLFIGELRNKCALPVPENLSVPYRTYASNSSIWYLEDNEPILCGNTTGSRTCPTNYTCLPHAGGNPNFGYTSFDHFGWALLTGFQLITLDFWENVYNNVIYTMGPWYVVYFAVVIFFGPFFLVNLVLAVVAASYENEVKASKMETEEERKEQK 338          

HSP 10 Score: 58.151 bits (139), Expect = 7.072e-8
Identity = 45/155 (29.03%), Postives = 74/155 (47.74%), Query Frame = 1
Query: 4390 IFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFK----NYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMF 4842
            + + I++N + LA+    +   Y         VF  ++T+E   K+ A GF      Y  D WN  DFI+V+   + I  D  N          L  I  FR+FR +R +   S  +G++ ++ T + S + L  V +L +    I+A+IGMQ+F
Sbjct:   56 VLLTILVNCVFLAMTNPPEQPEY---------VFAAIYTIEMFCKIIAKGFALHRYAYLRDKWNWLDFIVVILGNVTISPDVAN----------LSGIPTFRVFRALRTI---SAVKGLKAMVNTLLVSMKMLWDVMVLTLFFICIFALIGMQLF 188          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Medaka
Match: cacna1c (voltage-dependent L-type calcium channel subunit alpha-1C [Source:NCBI gene;Acc:101173517])

HSP 1 Score: 1638.62 bits (4242), Expect = 0.000e+0
Identity = 954/1748 (54.58%), Postives = 1181/1748 (67.56%), Query Frame = 1
Query: 1018 LFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEG-----------GPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVM--MESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGG------AHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSXXXXXXXXXXXXXXXPTNVDGEEAKACNSSNVSPNIDEKTRFTDAERL-IKSEEMNGDIADESMRKMSTRIDTXXXXXXXXXXXXXXXXXNGQTSAI------RRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVN----------------------------GTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRTHGRGSGPLI-SLISPTLVTTNECDEKDKDYLPSHLGAE----RRTHSIFGTMMNVLQRVGSTRRDSNASPSTGSINHSTELPRDRSNSRPMILNQSKSP 6084
            L CLTL+NP R+ CI IVEWKPFE +IL TIFANC ALA   P+PE DSN  NS LE++E +F++IFT E  LK++A+G + HP AYLRNGWNLLDF+IV++GL S +L + ++G           G DVKALRAFRVLRPLRLVSG+PSLQVV+NSI++AMVPL HIALL LFVIIIYAIIGLELF GK+H TC   +  +   E P PC+     G  C            ++       W GPN GIT+FDNF  AMLTVFQCITMEGWT ++YW+ D++G   PW+YFVSL+I GSFFV+NLVLGVLSGEFSKEREKAK RG +QK RE+ Q +ED++GYLDWI  AEDI  + E +G ++ K     +     +SE      D        + EG       A +S++   +F    ++                 VKSQ FYW+VI LVFLNT  + SEH+RQ  WL   Q+ AN + + LFT EML+KMYSLG++ YF  +FNRFD FVV   ILE ++++T  M PLG+SVLRC RLLR+FK+TRYW+SL NLV SLL S++SI SLL+LLFLFI+IFSLLGMQLFGGKFNFD+    RS FD+F QSLLTVFQILTGEDWN VMYDGI +YG      ML C+Y++ILFICGNYILLNVFLAIAVDNLAD  S    +K+E E +E +         K  +  N  P ++EK     +E++ +KS   +G+    +   M      E E    Y   D   +++ +   +      R +S++  KEK  P+P A +FF+F   NKFR  CH I NH  F N++L  I++SS  LAAEDP+  +S RN+IL Y D++FT +FT+EI LK+  YG   H G+FCR+  NILDL+VV  S+IS  I + AI+VVKILRVLRVLRPLRAINRAKGLK VVQCV VA+++IGNI++VT LL+FMFA IGVQLF GKF  C D SK T   CRG YI Y + D+ K   + R W N+  NFD+V   M+ LFAVSTFEGWPG+LY++IDS  ED   IYN R ++SIF+I YII+IAFFM+NIFVGFVIVTFQ++GE+EYKNCELDKNQR+C+E+ALKA+P+RRYIPK  ++Y+VW+++ S  FEY++F LI+LNTI LA++   Q + +   M+ LNM+FTG+FTVE +LKL AF  + YFSD WNVFDF+IV+GS ID+I   +N                            G  N+    R ISI FFRLFRVMRLVKLLSRGEGIRTLLWTF+KSFQALPYVALLIVMLFFIYAVIGMQMFGKI     +++ +INRNNNFQTFPQA+L+LFR ATGEAWQ IML C P+  C                    + G+   N +                         +CGS FA  YF+SFYM+C+FLIINLFVAVIMDNFDYLTRDWSILGPHHLDEF R+W+EYDPEAKGRIKHLDVVTLLR+I PPLGFGK CPHR AC  LV MNMPLNSDGTVMFNATLFALVRT L+IKTDG+ ++Q NEELR ++KKIWKRTS K+LDQVVPPAG+D+VTVGKFYATFLIQE+FR++K+++ +   G    ++  LSL          GP I   IS  L    E D+  K+  P    +E    RR+  +FG  +N   +  S  R S               P+  +  RP+ ++Q  SP
Sbjct:  143 LLCLTLKNPIRRACISIVEWKPFEIIILMTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKGDGATPIGGKAAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCVHNHTGLNAEEKPAPCAPDGAYGRHC-----------TQNGTQCRVGWEGPNDGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEGLDDDKPRNLSM----PASENESVNTDNPPGG---DVEGETCCTRLARYSRRWNRLFRRKCRAA----------------VKSQVFYWLVIFLVFLNTLTIASEHHRQPQWLTDVQDIANKVLLALFTGEMLLKMYSLGLQAYFVSLFNRFDSFVVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETR--RSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEAKERKKLARLASPKK--HEENEKPPLEEK----KSEKIELKSITSDGETNPATKISMDDCCGDENEEKNPYPANDYIGDDDEEEPEMPVGPRPRPLSDIHLKEKAVPMPEARAFFVFSHTNKFRVLCHKIVNHNIFTNLILFFILLSSISLAAEDPVKNDSFRNQILGYADHVFTGLFTIEIILKMTAYGAFLHKGSFCRNYFNILDLVVVSVSLISSGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKFFYCTDSSKQTQAECRGSYIMYKDGDVGKPGRSPRVWENSDFNFDDVLQGMMALFAVSTFEGWPGLLYRAIDSHSEDVGPIYNYRVVISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKVWYVVNSTYFEYLMFTLILLNTICLAMQHHGQTKNFNDAMNILNMLFTGLFTVEMILKLIAFKPRGYFSDPWNVFDFLIVIGSIIDVILSEINPADSSSSSSSSSSSSSSSTSHPPVVRPMGLQNSEENAR-ISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIAL---RDLSQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACSPNRPC--------------------EKGSTNENSTA----------------------SEECGSQFAIIYFVSFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTDGN-LEQANEELRAIVKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKVPPKTA-LSLQAGLRTLHDIGPEIRRAISGDLNVEEEMDKGMKE--PVSAASEDDIFRRSGGLFGNHVNYYNQ--SDGRSS--------------FPQSFTTQRPLHISQKGSP 1782          

HSP 2 Score: 104.375 bits (259), Expect = 2.149e-21
Identity = 96/342 (28.07%), Postives = 158/342 (46.20%), Query Frame = 1
Query: 1000 PRPQ-RALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLD-----FLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLI---------IIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQ 1980
            P P+ RA F  +  N FR  C KIV    F  LILF I  +  +LAA  P   ++ +  N  L   + VF  +FT E +LK+ A+G  +H G++ RN +N+LD       ++  G+ S+ ++        VK LR  RVLRPLR ++    L+ V+  +  A+  + +I ++   +  ++A IG++LF GK     +   D   ++   C  S    Y+  D    G      +N +             +FD+    M+ +F   T EGW  ++Y   DS       IY   ++         II +FF+MN+ +G +   F ++ E+  K  +  K + Q
Sbjct:  899 PMPEARAFFVFSHTNKFRVLCHKIVNHNIFTNLILFFILLSSISLAAEDPV--KNDSFRNQILGYADHVFTGLFTIEIILKMTAYGAFLHKGSFCRNYFNILDLVVVSVSLISSGIQSSAINV-------VKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKF----FYCTDSSKQTQAECRGSYIM-YKDGDVGKPGRSPRVWENSD------------FNFDDVLQGMMALFAVSTFEGWPGLLYRAIDSHSEDVGPIYNYRVVISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQ 1214          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Medaka
Match: cacna1c (voltage-dependent L-type calcium channel subunit alpha-1C [Source:NCBI gene;Acc:101173517])

HSP 1 Score: 1624.76 bits (4206), Expect = 0.000e+0
Identity = 959/1742 (55.05%), Postives = 1188/1742 (68.20%), Query Frame = 1
Query: 1018 LFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEG-----------GPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVM--MESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGGAHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSXXXXXXXXXXXXXXXPTNVDGEEAKACNSSNVSPNIDEKTRFTDAERL-IKSEEMNGDIADESMRKMSTRIDTXXXXXXXXXXXXXXXXXNGQTSAI------RRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVN----------------------------GTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRTHGRGSGPLI-SLISPTLVTTNECDEKDKDYLPSHLGAE----RRTHSIFGTMMNVLQRVGSTRRDSNASPSTGSINHSTELPRDRSNSRPMILNQSKSP 6084
            L CLTL+NP R+ CI IVEWKPFE +IL TIFANC ALA   P+PE DSN  NS LE++E +F++IFT E  LK++A+G + HP AYLRNGWNLLDF+IV++GL S +L + ++G           G DVKALRAFRVLRPLRLVSG+PSLQVV+NSI++AMVPL HIALL LFVIIIYAIIGLELF GK+H TC   +  +   E P PC+     G  C            ++       W GPN GIT+FDNF  AMLTVFQCITMEGWT ++YW+ D++G   PW+YFVSL+I GSFFV+NLVLGVLSGEFSKEREKAK RG +QK RE+ Q +ED++GYLDWI  AE   D +  + +E   + + +   +  S  +S + D+     ++ ET       +  +  F     SR  R+WNR  RR CR  VKSQ FYW+VI LVFLNT  + SEH+RQ  WL   Q+ AN + + LFT EML+KMYSLG++ YF  +FNRFD FVV   ILE ++++T  M PLG+SVLRC RLLR+FK+TRYW+SL NLV SLL S++SI SLL+LLFLFI+IFSLLGMQLFGGKFNFD+    RS FD+F QSLLTVFQILTGEDWN VMYDGI +YG      ML C+Y++ILFICGNYILLNVFLAIAVDNLAD  S    +K+E E +E +         K  +  N  P ++EK     +E++ +KS   +G+    +   M      E E    Y   D   +++ +   +      R +S++  KEK  P+P A +FF+F   NKFR  CH I NH  F N++L  I++SS  LAAEDP+  +S RN+IL Y D++FT +FT+EI LK+  YG   H G+FCR+  NILDL+VV  S+IS  I + AI+VVKILRVLRVLRPLRAINRAKGLK VVQCV VA+++IGNI++VT LL+FMFA IGVQLF GKF  C D SK T   CRG YI Y + D+ K   + R W N+  NFD+V   M+ LFAVSTFEGWPG+LY++IDS  ED   IYN R ++SIF+I YII+IAFFM+NIFVGFVIVTFQ++GE+EYKNCELDKNQR+C+E+ALKA+P+RRYIPK  ++Y+VW+++ S  FEY++F LI+LNTI LA++   Q + +   M+ LNM+FTG+FTVE +LKL AF  + YFSD WNVFDF+IV+GS ID+I   +N                            G  N+    R ISI FFRLFRVMRLVKLLSRGEGIRTLLWTF+KSFQALPYVALLIVMLFFIYAVIGMQMFGKI     +++ +INRNNNFQTFPQA+L+LFR ATGEAWQ IML C P+  C                    + G+   N +                         +CGS FA  YF+SFYM+C+FLIINLFVAVIMDNFDYLTRDWSILGPHHLDEF R+W+EYDPEAKGRIKHLDVVTLLR+I PPLGFGK CPHR AC  LV MNMPLNSDGTVMFNATLFALVRT L+IKTDG+ ++Q NEELR ++KKIWKRTS K+LDQVVPPAG+D+VTVGKFYATFLIQE+FR++K+++ +   G    ++  LSL          GP I   IS  L    E D+  K+  P    +E    RR+  +FG  +N   +  S  R S               P+  +  RP+ ++Q  SP
Sbjct:  143 LLCLTLKNPIRRACISIVEWKPFEIIILMTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKGDGATPIGGKAAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCVHNHTGLNAEEKPAPCAPDGAYGRHC-----------TQNGTQCRVGWEGPNDGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAE---DIDPENEEEGLDDDKPRNLSMPASENESVNTDNPPGGDVEGETCCTRLAIRISKSKF-----SRYSRRWNRLFRRKCRAAVKSQVFYWLVIFLVFLNTLTIASEHHRQPQWLTDVQDIANKVLLALFTGEMLLKMYSLGLQAYFVSLFNRFDSFVVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETR--RSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEAKERKKLARLASPKK--HEENEKPPLEEK----KSEKIELKSITSDGETNPATKISMDDCCGDENEEKNPYPANDYIGDDDEEEPEMPVGPRPRPLSDIHLKEKAVPMPEARAFFVFSHTNKFRVLCHKIVNHNIFTNLILFFILLSSISLAAEDPVKNDSFRNQILGYADHVFTGLFTIEIILKMTAYGAFLHKGSFCRNYFNILDLVVVSVSLISSGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKFFYCTDSSKQTQAECRGSYIMYKDGDVGKPGRSPRVWENSDFNFDDVLQGMMALFAVSTFEGWPGLLYRAIDSHSEDVGPIYNYRVVISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKVWYVVNSTYFEYLMFTLILLNTICLAMQHHGQTKNFNDAMNILNMLFTGLFTVEMILKLIAFKPRGYFSDPWNVFDFLIVIGSIIDVILSEINPADSSSSSSSSSSSSSSSTSHPPVVRPMGLQNSEENAR-ISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIAL---RDLSQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACSPNRPC--------------------EKGSTNENSTA----------------------SEECGSQFAIIYFVSFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTDGN-LEQANEELRAIVKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKVPPKTA-LSLQAGLRTLHDIGPEIRRAISGDLNVEEEMDKGMKE--PVSAASEDDIFRRSGGLFGNHVNYYNQ--SDGRSS--------------FPQSFTTQRPLHISQKGSP 1791          

HSP 2 Score: 103.99 bits (258), Expect = 2.897e-21
Identity = 96/342 (28.07%), Postives = 158/342 (46.20%), Query Frame = 1
Query: 1000 PRPQ-RALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLD-----FLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLI---------IIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQ 1980
            P P+ RA F  +  N FR  C KIV    F  LILF I  +  +LAA  P   ++ +  N  L   + VF  +FT E +LK+ A+G  +H G++ RN +N+LD       ++  G+ S+ ++        VK LR  RVLRPLR ++    L+ V+  +  A+  + +I ++   +  ++A IG++LF GK     +   D   ++   C  S    Y+  D    G      +N +             +FD+    M+ +F   T EGW  ++Y   DS       IY   ++         II +FF+MN+ +G +   F ++ E+  K  +  K + Q
Sbjct:  908 PMPEARAFFVFSHTNKFRVLCHKIVNHNIFTNLILFFILLSSISLAAEDPV--KNDSFRNQILGYADHVFTGLFTIEIILKMTAYGAFLHKGSFCRNYFNILDLVVVSVSLISSGIQSSAINV-------VKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKF----FYCTDSSKQTQAECRGSYIM-YKDGDVGKPGRSPRVWENSD------------FNFDDVLQGMMALFAVSTFEGWPGLLYRAIDSHSEDVGPIYNYRVVISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQ 1223          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Medaka
Match: CACNA1D (calcium voltage-gated channel subunit alpha1 D [Source:NCBI gene;Acc:101171831])

HSP 1 Score: 1226.85 bits (3173), Expect = 0.000e+0
Identity = 706/1168 (60.45%), Postives = 843/1168 (72.17%), Query Frame = 1
Query: 2284 VKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSXXXXXXXXXXXXXXXPTNVDGEEAKACNSSNVSPNID-----EKTRFTDAERLIKSEEMNGDIADESMRKMSTRIDTXXXXXXXXXXXXXXXXXNGQTSAIRRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQS 5772
            VKS  FYW+VI+LVFLNT  + SEHY Q  WL   Q+ AN + + LFTLEML+KMYSLG++ YF  +FNRFD FVV   I+E ++++   M PLG+SV RC RLLR+FKVTR+W+SL NLV SLL SMKSI SLL+LLFLFI+IFSLLGMQLFGGKFNFD+    RS FD+F Q+LLTVFQILTGEDWN VMYDGI +YG    S M+ C+Y++ILFICGNYILLNVFLAIAVDNLAD  S N  +++            + E  K  NS+NV P +      E     D E    +E    D+ DE    +   + T                        +R+SE+  KEK  PIP  S+FFIF   N FR  CH + NH  F N++LV IM+SS  LAAEDP+   S+RN IL YFDY FT++FTVEI LK+  +G   H GAFCR+  N+LDLLVV  S++S+ I + AISVVKILRVLRVLRPLRAINRAKGLK VVQCV VA+++IGNIM+VT LL+FMFA IGVQLF GKF  C D +K++   C+G YI Y+  D A   + +R W N+  NFDNV  AM+ LF VSTFEGWP +LYK+IDS +E+   IYN R  +SIF+I YII+IAFFM+NIFVGFVIVTFQ++GE+EYKNCELDKNQR+C+E+ALKA+P+RRYIPK  ++Y+ W+++ S  FEY++FVLI+LNT+ LA++   Q   +   MD LNMVFTGVFTVE +LKL AF  + Y  DAWNVFD ++V+GS +DII   V     N      ISI FFRLFRVMRLVKLLSRGEGIRTLLWTF+KSFQALPYVALLI MLFFIYAVIGMQ+FGKI   +     +INRNNNFQTFPQA+L+LFR ATGEAWQ IML CLP  +CD+ SD      YN    R                                      CGS FA  YFISFYM+C+FLIINLFVAVIMDNFDYLTRDWSILGPHHLDEF R+WSEYDPEAKGRIKHLDVVTLLR+I PPLGFGK CPHR AC  LV MNMPLNSDGTVMFNATLFALVRT LKIKT+G+ +DQ NEELRVVIKKIWKRTS K+LDQVVPPAG+D+VTVGKFYATFLIQ++FR++K+++   ++GM + Q+
Sbjct:  403 VKSVTFYWLVIILVFLNTLTIASEHYNQPDWLTEVQDVANKVLLALFTLEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGIVETILVELAIMSPLGISVFRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETVTKRSTFDNFPQALLTVFQILTGEDWNTVMYDGIMAYGGPASSGMVVCIYFIILFICGNYILLNVFLAIAVDNLADAESLNTAQRE------------EEEAKKRRNSTNVHPLLTVQLPTETLLEADKEPYAAAESPGDDVDDEDNNDILPEVPTGPRP--------------------QRLSELTIKEKTPPIPQGSAFFIFSSTNPFRVLCHKLINHQIFTNLILVFIMLSSVSLAAEDPIRNFSARNIILGYFDYAFTAIFTVEILLKMTAFGAFLHKGAFCRNYFNLLDLLVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYRCTDDAKSSPEECKGTYILYSNGDTALPMIKERIWYNSDFNFDNVLMAMMALFTVSTFEGWPTLLYKAIDSNRENMGPIYNYRIEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKFWYVVNSTGFEYVMFVLIILNTLCLAIQHYGQSHLFNYAMDILNMVFTGVFTVEMILKLIAFKPRGYVGDAWNVFDALVVIGSVVDIILSQVIVEPGNTEDSARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQVFGKIAMVDG---TQINRNNNFQTFPQAVLMLFRCATGEAWQEIMLACLPGKLCDSESD------YNPGEERT-------------------------------------CGSGFAIIYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTALKIKTEGN-LDQANEELRVVIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQDYFRKFKRRK---EQGMRFLQA 1488          

HSP 2 Score: 453.751 bits (1166), Expect = 5.318e-131
Identity = 222/371 (59.84%), Postives = 271/371 (73.05%), Query Frame = 1
Query:  970 RTPARSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGP------------DVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCY--SKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDI 2040
            R   +  S N RP RALFCLTL NP R+ CI +VEWKPF+  IL +IFANC ALA   P+P  DSN+ N  LEK+E  F++IFT E  +KI+A+G +MH  +Y+RNGWN+LDF+IVI+GL S VL  +++               DVKALRAFRVLRPLRLVSG+PSLQVV+NSI++AMVPL HIALL LFVIIIYAIIGLELF GK+H+TCY      +  E P PC+ S   G  C  F+ +    +C++       W GPN GIT+FDNF  AMLTVFQCITMEGWT ++YW+ND++G   PW+YFVSL+I GSFFV+NLVLGVLSGEFSKEREKAK RG +QK RE+ Q +ED++GYLDWI  AEDI
Sbjct:    9 RFKKQGGSTNSRPPRALFCLTLNNPIRRACISLVEWKPFDIFILLSIFANCVALAIYIPFPGDDSNSTNQELEKVEYAFLIIFTIETFMKIIAYGLVMHQNSYVRNGWNMLDFVIVIVGLFSVVLEMITKDADHGGQSGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHATCYVIQTGALAEEEPAPCAVS-GHGRHCL-FNGT----ICREG------WQGPNNGITNFDNFLFAMLTVFQCITMEGWTDVLYWMNDAMGFELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDI 367          

HSP 3 Score: 146.362 bits (368), Expect = 2.713e-34
Identity = 147/597 (24.62%), Postives = 278/597 (46.57%), Query Frame = 1
Query: 3352 SFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPL--DAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVV---LTSIISYPINNDA--------ISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEF---MFAVIGVQLFNGKFQSCNDVSKN----------THISCRGQYIYYNEADIAKVFVNKREWI---NNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEE---------YKNCELDKNQRKCIEFALKAKPV-------RRYIPKQSFRYRVW--W----------LITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIM 4971
            + F    NN  R+ C  +     F   +L+ I  +   LA   P   D  +S N+ L   +Y F  +FT+E  +K+I YGLV H  ++ R+  N+LD ++V   L S++   I  DA              ++ LR  R LR +    G+  +   +   +K++  ++ +  L+ F   ++A+IG++LF GK  +   V +             +S  G++  +N        + +  W    N   NFDN   AMLT+F   T EGW  VLY   D+   +   +Y         +++ +I  +FF++N+ +G +   F +E E+           +  +L+++ +  +++  +A+ +            K++ ++R W  W           + S  F +++ +L+ LNT+++A +   QP    +V D  N V   +FT+E L+K+ + G + YF   +N FD  +V G  ++ I   +   +        + I+ FR  R++R+ K+      +  L+ + + S +++  + LL+ +   I++++GMQ+FG     +E     + + + F  FPQA+L +F+  TGE W  +M
Sbjct:   24 ALFCLTLNNPIRRACISLVEWKPFDIFILLSIFANCVALAIYIPFPGDDSNSTNQELEKVEYAFLIIFTIETFMKIIAYGLVMHQNSYVRNGWNMLDFVIVIVGLFSVVLEMITKDADHGGQSGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHATCYVIQTGALAEEEPAPCAVSGHGRHCLFNGT------ICREGWQGPNNGITNFDNFLFAMLTVFQCITMEGWTDVLYWMNDAMGFELPWVY---------FVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENDEEGDEEGKRNRKFRQWRRWNRLCRRKCRAAVKSVTFYWLVIILVFLNTLTIASEHYNQPDWLTEVQDVANKVLLALFTLEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGIVETILVELAIMSP-------LGISVFRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDET----VTKRSTFDNFPQALLTVFQILTGEDWNTVM 594          

HSP 4 Score: 122.479 bits (306), Expect = 5.531e-27
Identity = 116/367 (31.61%), Postives = 173/367 (47.14%), Query Frame = 1
Query:  910 RPLNLAALTLSAQIASGGRKRTPARSQSGNPRPQ-RALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIY---------FVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQ 1980
            RP  L+ LT+        +++TP       P PQ  A F  +  NPFR  C K++  + F  LIL  I  +  +LAA  P   R+ +  N  L   +  F  IFT E +LK+ AFG  +H GA+ RN +NLLD L+V + L+S      S     VK LR  RVLRPLR ++    L+ V+  +  A+  + +I ++   +  ++A IG++LF GK     Y   D    SP  C     KG      +      M K+       W   +    +FDN  +AM+ +F   T EGW  ++Y   DS   +   IY         F+  III +FF+MN+ +G +   F ++ EK  K  +  K + Q
Sbjct:  711 RPQRLSELTI--------KEKTP-------PIPQGSAFFIFSSTNPFRVLCHKLINHQIFTNLILVFIMLSSVSLAAEDPI--RNFSARNIILGYFDYAFTAIFTVEILLKMTAFGAFLHKGAFCRNYFNLLDLLVVGVSLVS--FGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKF----YRCTDDAKSSPEEC-----KGTYILYSNGDTALPMIKERI-----WYNSDF---NFDNVLMAMMALFTVSTFEGWPTLLYKAIDSNRENMGPIYNYRIEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQ 1041          

HSP 5 Score: 89.7373 bits (221), Expect = 5.490e-17
Identity = 71/255 (27.84%), Postives = 138/255 (54.12%), Query Frame = 1
Query: 2281 LVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPP-------LGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPR-SNFDSFVQSLLTVFQILTGEDWNEVMYDGI-------RSYGNLGK----SSMLSCLYYVILFICGNYILLNVFLAIAVDN 2988
            +V S  F +V+ VL+ LNT  L  +HY QS   +   +  N++F  +FT+EM++K+ +   R Y    +N FD  VVI S+++I++ Q    P        + ++  R  R++R+ K+      +R L+ + + S +++  + +L+ +   I++++GMQ+FG     D     R +NF +F Q++L +F+  TGE W E+M   +        S  N G+     S  + +Y++  ++   ++++N+F+A+ +DN
Sbjct: 1068 VVNSTGFEYVMFVLIILNTLCLAIQHYGQSHLFNYAMDILNMVFTGVFTVEMILKLIAFKPRGYVGDAWNVFDALVVIGSVVDIILSQVIVEPGNTEDSARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQVFGKIAMVDGTQINRNNNFQTFPQAVLMLFRCATGEAWQEIMLACLPGKLCDSESDYNPGEERTCGSGFAIIYFISFYMLCAFLIINLFVAVIMDN 1322          

HSP 6 Score: 86.6557 bits (213), Expect = 4.354e-16
Identity = 78/320 (24.38%), Postives = 142/320 (44.38%), Query Frame = 1
Query: 1036 RNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKM--------SEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWI----------------NDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEF 1923
            +NP++     +V    FEY++   I  N   LA    Y +  S+  N A++ + +VF  +FT E +LK++AF     P  Y+ + WN+ D L+VI  ++  +LS++              +   R FRV+R ++L+S    ++ ++ + +++   L ++ALL   +  IYA+IG+++F GK+          M++      T +N+                  N N              F  F  A+L +F+C T E W +IM                     + G  +  IYF+S  ++ +F ++NL + V+   F
Sbjct: 1058 KNPYQYKFWYVVNSTGFEYVMFVLIILNTLCLAIQH-YGQ--SHLFNYAMDILNMVFTGVFTVEMILKLIAF----KPRGYVGDAWNVFDALVVIGSVVDIILSQVIVEPGNTEDSARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQVF-GKI---------AMVD-----GTQINR------------------NNN--------------FQTFPQAVLMLFRCATGEAWQEIMLACLPGKLCDSESDYNPGEERTCGSGFAIIYFISFYMLCAFLIINLFVAVIMDNF 1323          

HSP 7 Score: 77.0258 bits (188), Expect = 3.811e-13
Identity = 61/257 (23.74%), Postives = 114/257 (44.36%), Query Frame = 1
Query: 4360 LITSRPFEYIIFVLIMLNTISLALKF---DKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGF----KNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINF----FRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMF-GKI---------------------------------TTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAM 4995
            L+  +PF+  I + I  N ++LA+             Q ++ +   F  +FT+E  +K+ A+G      +Y  + WN+ DF+IV+     ++ + +    ++          F     R FRV+R ++L+S    ++ +L + +K+   L ++ALL++ +  IYA+IG+++F GK+                                 T   E      N   NF  F  A+L +F+  T E W ++ L+ + DAM
Sbjct:   41 LVEWKPFDIFILLSIFANCVALAIYIPFPGDDSNSTNQELEKVEYAFLIIFTIETFMKIIAYGLVMHQNSYVRNGWNMLDFVIVIVGLFSVVLEMITKDADHGGQSGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHATCYVIQTGALAEEEPAPCAVSGHGRHCLFNGTICREGWQGPNNGITNFDNFLFAMLTVFQCITMEGWTDV-LYWMNDAM 296          

HSP 8 Score: 63.929 bits (154), Expect = 2.967e-9
Identity = 77/320 (24.06%), Postives = 139/320 (43.44%), Query Frame = 1
Query: 1048 RKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNT-INSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGP-DVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWP-------WIYFVSLIIIGSFFVMNLVLGVLSGEFS---------KEREKAKKR 1953
            R+ C   V+   F +L++  +F N   +A+   Y + D  T +     K   V + +FT E ++K+ + G      AY  + +N  D  +V  G++ T+L +++   P  +   R  R+LR  ++     SL  ++ S++ +M  +  + LL    III++++G++LF GK +                                         ++  T R        ++FDNF  A+LTVFQ +T E W  +MY  +  +    P        IYF+ L I G++ ++N+ L +     +         +E E+AKKR
Sbjct:  396 RRKCRAAVKSVTFYWLVIILVFLNTLTIASEH-YNQPDWLTEVQDVANK---VLLALFTLEMLVKMYSLGL----QAYFVSLFNRFDCFVVCGGIVETILVELAIMSPLGISVFRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKFNF----------------------------------------DETVTKR--------STFDNFPQALLTVFQILTGEDWNTVMY--DGIMAYGGPASSGMVVCIYFIILFICGNYILLNVFLAIAVDNLADAESLNTAQREEEEAKKR 657          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Medaka
Match: cacna1c (voltage-dependent L-type calcium channel subunit alpha-1C [Source:NCBI gene;Acc:101173517])

HSP 1 Score: 1218.37 bits (3151), Expect = 0.000e+0
Identity = 727/1279 (56.84%), Postives = 897/1279 (70.13%), Query Frame = 1
Query: 2284 VKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSXXXXXXXXXXXXXXXPTNVDGEEAKACNSSNVSPNIDEKTRFTDAERL-IKSEEMNGDIADESMRKMSTRIDTXXXXXXXXXXXXXXXXXNGQTSAI------RRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRTHGRGSGPLI-SLISPTLVTTNECDEKDKDYLPSHLGAE----RRTHSIFGTMMNVLQRVGSTRRDSNASPSTGSINHSTELPRDRSNSRPMILNQSKSP 6084
            VKSQ FYW+VI LVFLNT  + SEH+RQ  WL   Q+ AN + + LFT EML+KMYSLG++ YF  +FNRFD FVV   ILE ++++T  M PLG+SVLRC RLLR+FK+TRYW+SL NLV SLL S++SI SLL+LLFLFI+IFSLLGMQLFGGKFNFD+    RS FD+F QSLLTVFQILTGEDWN VMYDGI +YG      ML C+Y++ILFICGNYILLNVFLAIAVDNLAD  S    +K+E E +E +         K  +  N  P ++EK     +E++ +KS   +G+    +   M      E E    Y   D   +++ +   +      R +S++  KEK  P+P A +FF+F   NKFR  CH I NH  F N++L  I++SS  LAAEDP+  +S RN+IL Y D++FT +FT+EI LK+  YG   H G+FCR+  NILDL+VV  S+IS  I + AI+VVKILRVLRVLRPLRAINRAKGLK VVQCV VA+++IGNI++VT LL+FMFA IGVQLF GKF  C D SK T   CRG YI Y + D+ K   + R W N+  NFD+V   M+ LFAVSTFEGWPG+LY++IDS  ED   IYN R ++SIF+I YII+IAFFM+NIFVGFVIVTFQ++GE+EYKNCELDKNQR+C+E+ALKA+P+RRYIPK  ++Y+VW+++ S  FEY++F LI+LNTI LA++   Q + +   M+ LNM+FTG+FTVE +LKL AF  + YFSD WNVFDF+IV+GS ID+I   +NG  N+    R ISI FFRLFRVMRLVKLLSRGEGIRTLLWTF+KSFQALPYVALLIVMLFFIYAVIGMQMFGKI     +++ +INRNNNFQTFPQA+L+LFR ATGEAWQ IML C P+  C                    + G+   N +                         +CGS FA  YF+SFYM+C+FLIINLFVAVIMDNFDYLTRDWSILGPHHLDEF R+W+EYDPEAKGRIKHLDVVTLLR+I PPLGFGK CPHR AC  LV MNMPLNSDGTVMFNATLFALVRT L+IKTDG+ ++Q NEELR ++KKIWKRTS K+LDQVVPPAG+D+VTVGKFYATFLIQE+FR++K+++ +   G    ++  LSL          GP I   IS  L    E D+  K+  P    +E    RR+  +FG  +N   +  S  R S               P+  +  RP+ ++Q  SP
Sbjct:  559 VKSQVFYWLVIFLVFLNTLTIASEHHRQPQWLTDVQDIANKVLLALFTGEMLLKMYSLGLQAYFVSLFNRFDSFVVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETR--RSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEAKERKKLARLASPKK--HEENEKPPLEEK----KSEKIELKSITSDGETNPATKISMDDCCGDENEEKNPYPANDYIGDDDEEEPEMPVGPRPRPLSDIHLKEKAVPMPEARAFFVFSHTNKFRVLCHKIVNHNIFTNLILFFILLSSISLAAEDPVKNDSFRNQILGYADHVFTGLFTIEIILKMTAYGAFLHKGSFCRNYFNILDLVVVSVSLISSGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKFFYCTDSSKQTQAECRGSYIMYKDGDVGKPGRSPRVWENSDFNFDDVLQGMMALFAVSTFEGWPGLLYRAIDSHSEDVGPIYNYRVVISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKVWYVVNSTYFEYLMFTLILLNTICLAMQHHGQTKNFNDAMNILNMLFTGLFTVEMILKLIAFKPRGYFSDPWNVFDFLIVIGSIIDVILSEINGLQNSEENAR-ISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIAL---RDLSQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACSPNRPC--------------------EKGSTNENSTA----------------------SEECGSQFAIIYFVSFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTDGN-LEQANEELRAIVKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKVPPKTA-LSLQAGLRTLHDIGPEIRRAISGDLNVEEEMDKGMKE--PVSAASEDDIFRRSGGLFGNHVNYYNQ--SDGRSS--------------FPQSFTTQRPLHISQKGSP 1763          

HSP 2 Score: 468.003 bits (1203), Expect = 1.363e-132
Identity = 222/367 (60.49%), Postives = 269/367 (73.30%), Query Frame = 1
Query: 1018 LFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEG-----------GPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVM--MESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGK 2079
            L CLTL+NP R+ CI IVEWKPFE +IL TIFANC ALA   P+PE DSN  NS LE++E +F++IFT E  LK++A+G + HP AYLRNGWNLLDF+IV++GL S +L + ++G           G DVKALRAFRVLRPLRLVSG+PSLQVV+NSI++AMVPL HIALL LFVIIIYAIIGLELF GK+H TC   +  +   E P PC+     G  C            ++       W GPN GIT+FDNF  AMLTVFQCITMEGWT ++YW+ND+V   WPW+YFV+LIIIGSFFV+NLVLGVLSGEFSKEREKAK RG +QK RE+ Q +ED++GYLDWI  AEDI  + E +G ++ K
Sbjct:  143 LLCLTLKNPIRRACISIVEWKPFEIIILMTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKGDGATPIGGKAAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCVHNHTGLNAEEKPAPCAPDGAYGRHC-----------TQNGTQCRVGWEGPNDGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVDYRWPWVYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEGLDDDK 498          

HSP 3 Score: 104.375 bits (259), Expect = 2.218e-21
Identity = 96/342 (28.07%), Postives = 158/342 (46.20%), Query Frame = 1
Query: 1000 PRPQ-RALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLD-----FLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLI---------IIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQ 1980
            P P+ RA F  +  N FR  C KIV    F  LILF I  +  +LAA  P   ++ +  N  L   + VF  +FT E +LK+ A+G  +H G++ RN +N+LD       ++  G+ S+ ++        VK LR  RVLRPLR ++    L+ V+  +  A+  + +I ++   +  ++A IG++LF GK     +   D   ++   C  S    Y+  D    G      +N +             +FD+    M+ +F   T EGW  ++Y   DS       IY   ++         II +FF+MN+ +G +   F ++ E+  K  +  K + Q
Sbjct:  908 PMPEARAFFVFSHTNKFRVLCHKIVNHNIFTNLILFFILLSSISLAAEDPV--KNDSFRNQILGYADHVFTGLFTIEIILKMTAYGAFLHKGSFCRNYFNILDLVVVSVSLISSGIQSSAINV-------VKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKF----FYCTDSSKQTQAECRGSYIM-YKDGDVGKPGRSPRVWENSD------------FNFDDVLQGMMALFAVSTFEGWPGLLYRAIDSHSEDVGPIYNYRVVISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQ 1223          

HSP 4 Score: 97.4413 bits (241), Expect = 2.661e-19
Identity = 79/320 (24.69%), Postives = 140/320 (43.75%), Query Frame = 1
Query: 1036 RNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKM-----SEGGPDVKA--LRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWI-----------------NDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEF 1923
            +NP++     +V    FEYL+   I  N   LA         +   N A+  + ++F  +FT E +LK++AF     P  Y  + WN+ DFLIVI  +I  +LS++     SE    +     R FRV+R ++L+S    ++ ++ + +++   L ++ALL + +  IYA+IG+++F GK+                                    + + + N+N             +F  F  A+L +F+C T E W +IM                    ++  G  +  IYFVS  ++ +F ++NL + V+   F
Sbjct: 1240 KNPYQYKVWYVVNSTYFEYLMFTLILLNTICLAMQH---HGQTKNFNDAMNILNMLFTGLFTVEMILKLIAF----KPRGYFSDPWNVFDFLIVIGSIIDVILSEINGLQNSEENARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMF-GKI----------------------------------ALRDLSQINRN------------NNFQTFPQAVLLLFRCATGEAWQEIMLACSPNRPCEKGSTNENSTASEECGSQFAIIYFVSFYMLCAFLIINLFVAVIMDNF 1505          

HSP 5 Score: 92.4337 bits (228), Expect = 7.657e-18
Identity = 59/211 (27.96%), Postives = 109/211 (51.66%), Query Frame = 1
Query: 4339 FRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIM 4971
            FR +    + S+ F +++  L+ LNT+++A +  +QPQ    V D  N V   +FT E LLK+ + G + YF   +N FD  +V G  ++ I       +        + I+  R  R++R+ K+      +  L+ + + S +++  + LL+ +   I++++GMQ+FG     +E       R + F  FPQ++L +F+  TGE W ++M
Sbjct:  551 FRRKCRAAVKSQVFYWLVIFLVFLNTLTIASEHHRQPQWLTDVQDIANKVLLALFTGEMLLKMYSLGLQAYFVSLFNRFDSFVVCGGILETILVETKIMSP-------LGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDE------TRRSTFDNFPQSLLTVFQILTGEDWNSVM 748          

HSP 6 Score: 85.1149 bits (209), Expect = 1.242e-15
Identity = 76/273 (27.84%), Postives = 125/273 (45.79%), Query Frame = 1
Query: 3376 NKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPL--DAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVL----TSIISYPINNDAISXXXXXXXXXXXXXXXA------INRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEF---MFAVIGVQLFNGKF-QSC-------NDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIY 4125
            N  R+ C  I     F  I+L+ I  +   LA   P   D  ++ N  L   +YLF  +FTVE  LKVI YGL+FH  A+ R+  N+LD ++V+    ++I+      D  + +        ++ LRA      +    G+  +   +   +K++  ++ +  L+ F   ++A+IG++LF GK  ++C       N   K    +  G Y  +   +  +  V      +   NFDN   AMLT+F   T EGW  VLY   D+    +  +Y
Sbjct:  150 NPIRRACISIVEWKPFEIIILMTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKGDGATPIGGKAAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCVHNHTGLNAEEKPAPCAPDGAYGRHCTQNGTQCRVGWEGPNDGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVDYRWPWVY 422          

HSP 7 Score: 85.1149 bits (209), Expect = 1.374e-15
Identity = 64/259 (24.71%), Postives = 115/259 (44.40%), Query Frame = 1
Query: 4330 KQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKF---DKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGF----KNYFSDAWNVFDFIIVL-GSFIDIIYDHVNGTNNNHRGDRL--ISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMF------------------------------GKITTENEKEMK-----EINRNNNFQTFPQAILVLFRSATGEAWQNIM 4971
            K   R     ++  +PFE II + I  N ++LA+     +         ++ +  +F  +FTVE  LK+ A+G       Y  + WN+ DFIIV+ G F  I+     G      G +     +   R FRV+R ++L+S    ++ +L + +K+   L ++ALL++ +  IYA+IG+++F                              G+  T+N  + +       +   NF  F  A+L +F+  T E W +++
Sbjct:  149 KNPIRRACISIVEWKPFEIIILMTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKGDGATPIGGKAAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCVHNHTGLNAEEKPAPCAPDGAYGRHCTQNGTQCRVGWEGPNDGITNFDNFAFAMLTVFQCITMEGWTDVL 407          

HSP 8 Score: 83.9593 bits (206), Expect = 3.262e-15
Identity = 67/256 (26.17%), Postives = 137/256 (53.52%), Query Frame = 1
Query: 2281 LVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAM------PPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPR-SNFDSFVQSLLTVFQILTGEDWNEVMY------------DGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNL 2991
            +V S  F +++  L+ LNT  L  +H+ Q+   +   N  N++F  LFT+EM++K+ +   R YF   +N FDF +VI SI+++++ + + +        + ++  R  R++R+ K+      +R L+ + + S +++  + +L+ +   I++++GMQ+FG     D     R +NF +F Q++L +F+  TGE W E+M                 S  +    S  + +Y+V  ++   ++++N+F+A+ +DN 
Sbjct: 1250 VVNSTYFEYLMFTLILLNTICLAMQHHGQTKNFNDAMNILNMLFTGLFTVEMILKLIAFKPRGYFSDPWNVFDFLIVIGSIIDVILSEINGLQNSEENARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIALRDLSQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACSPNRPCEKGSTNENSTASEECGSQFAIIYFVSFYMLCAFLIINLFVAVIMDNF 1505          

HSP 9 Score: 75.0998 bits (183), Expect = 1.366e-12
Identity = 75/294 (25.51%), Postives = 131/294 (44.56%), Query Frame = 1
Query: 1045 FRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGP-DVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMY-WINDSVGMSWP----WIYFVSLIIIGSFFVMNLVLGV 1908
            FR+ C   V+ + F +L++F +F N   +A+      R    +    +    V + +FT E +LK+ + G      AY  + +N  D  +V  G++ T+L +     P  +  LR  R+LR  ++     SL  ++ S++ ++  +  + LL    III++++G++LF GK                                           N +ET R        ++FDNF  ++LTVFQ +T E W  +MY  I    G S+P     IYF+ L I G++ ++N+ L +
Sbjct:  551 FRRKCRAAVKSQVFYWLVIFLVFLNTLTIASEH---HRQPQWLTDVQDIANKVLLALFTGEMLLKMYSLGL----QAYFVSLFNRFDSFVVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKF------------------------------------------NFDETRR--------STFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAI 787          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Medaka
Match: cacna1c (voltage-dependent L-type calcium channel subunit alpha-1C [Source:NCBI gene;Acc:101173517])

HSP 1 Score: 1213.75 bits (3139), Expect = 0.000e+0
Identity = 725/1279 (56.68%), Postives = 895/1279 (69.98%), Query Frame = 1
Query: 2284 VKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSXXXXXXXXXXXXXXXPTNVDGEEAKACNSSNVSPNIDEKTRFTDAERL-IKSEEMNGDIADESMRKMSTRIDTXXXXXXXXXXXXXXXXXNGQTSAI------RRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRTHGRGSGPLI-SLISPTLVTTNECDEKDKDYLPSHLGAE----RRTHSIFGTMMNVLQRVGSTRRDSNASPSTGSINHSTELPRDRSNSRPMILNQSKSP 6084
            VKSQ FYW+VI LVFLNT  + SEH+RQ  WL   Q+ AN + + LFT EML+KMYSLG++ YF  +FNRFD FVV   ILE ++++T  M PLG+SVLRC RLLR+FK+TRYW+SL NLV SLL S++SI SLL+LLFLFI+IFSLLGMQLFGGKFNFD+    RS FD+F QSLLTVFQILTGEDWN VMYDGI +YG      ML C+Y++ILFICGNYILLNVFLAIAVDNLAD  S    +K+E E +E +         K  +  N  P ++EK     +E++ +KS   +G+    +   M      E E    Y   D   +++ +   +      R +S++  KEK  P+P A +FF+F   NKFR  CH I NH  F N++L  I++SS  LAAEDP+  +S RN+IL Y D++FT +FT+EI LK+  YG   H G+FCR+  NILDL+VV  S+IS  I + AI+VVKILRVLRVLRPLRAINRAKGLK VVQCV VA+++IGNI++VT LL+FMFA IGVQLF GKF  C D SK T   CRG YI Y + D+ K   + R W N+  NFD+V   M+ LFAVSTFEGWPG+LY++IDS  ED   IYN R ++SIF+I YII+IAFFM+NIFVGFVIVTFQ++GE+EYKNCELDKNQR+C+E+ALKA+P+RRYIPK  ++Y+VW+++ S  FEY++F LI+LNTI LA++   Q + +   M+ LNM+FTG+FTVE +LKL AF  ++YF DAWN FD +IV+GS +DI    VNG  N+    R ISI FFRLFRVMRLVKLLSRGEGIRTLLWTF+KSFQALPYVALLIVMLFFIYAVIGMQMFGKI     +++ +INRNNNFQTFPQA+L+LFR ATGEAWQ IML C P+  C                    + G+   N +                         +CGS FA  YF+SFYM+C+FLIINLFVAVIMDNFDYLTRDWSILGPHHLDEF R+W+EYDPEAKGRIKHLDVVTLLR+I PPLGFGK CPHR AC  LV MNMPLNSDGTVMFNATLFALVRT L+IKTDG+ ++Q NEELR ++KKIWKRTS K+LDQVVPPAG+D+VTVGKFYATFLIQE+FR++K+++ +   G    ++  LSL          GP I   IS  L    E D+  K+  P    +E    RR+  +FG  +N   +  S  R S               P+  +  RP+ ++Q  SP
Sbjct:  604 VKSQVFYWLVIFLVFLNTLTIASEHHRQPQWLTDVQDIANKVLLALFTGEMLLKMYSLGLQAYFVSLFNRFDSFVVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETR--RSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEAKERKKLARLASPKK--HEENEKPPLEEK----KSEKIELKSITSDGETNPATKISMDDCCGDENEEKNPYPANDYIGDDDEEEPEMPVGPRPRPLSDIHLKEKAVPMPEARAFFVFSHTNKFRVLCHKIVNHNIFTNLILFFILLSSISLAAEDPVKNDSFRNQILGYADHVFTGLFTIEIILKMTAYGAFLHKGSFCRNYFNILDLVVVSVSLISSGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKFFYCTDSSKQTQAECRGSYIMYKDGDVGKPGRSPRVWENSDFNFDDVLQGMMALFAVSTFEGWPGLLYRAIDSHSEDVGPIYNYRVVISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKVWYVVNSTYFEYLMFTLILLNTICLAMQHHGQTKNFNDAMNILNMLFTGLFTVEMILKLIAFKPRHYFVDAWNTFDALIVVGSIVDIAITEVNGLQNSEENAR-ISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIAL---RDLSQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACSPNRPC--------------------EKGSTNENSTA----------------------SEECGSQFAIIYFVSFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTDGN-LEQANEELRAIVKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKVPPKTA-LSLQAGLRTLHDIGPEIRRAISGDLNVEEEMDKGMKE--PVSAASEDDIFRRSGGLFGNHVNYYNQ--SDGRSS--------------FPQSFTTQRPLHISQKGSP 1808          

HSP 2 Score: 461.455 bits (1186), Expect = 1.677e-130
Identity = 219/367 (59.67%), Postives = 267/367 (72.75%), Query Frame = 1
Query: 1018 LFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEG-----------GPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVM--MESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGK 2079
            L CLTL+NP R+ CI IVEWKPFE +IL TIFANC ALA   P+PE DSN  NS LE++E +F++IFT E  LK++A+G + HP AYLRNGWNLLDF+IV++GL S +L + ++G           G DVKALRAFRVLRPLRLVSG+PSLQVV+NSI++AMVPL HIALL LFVIIIYAIIGLELF GK+H TC   +  +   E P PC+     G  C            ++       W GPN GIT+FDNF  AMLTVFQCITMEGWT ++YW+ D++G   PW+YFVSL+I GSFFV+NLVLGVLSGEFSKEREKAK RG +QK RE+ Q +ED++GYLDWI  AEDI  + E +G ++ K
Sbjct:  165 LLCLTLKNPIRRACISIVEWKPFEIIILMTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKGDGATPIGGKAAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCVHNHTGLNAEEKPAPCAPDGAYGRHC-----------TQNGTQCRVGWEGPNDGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEGLDDDK 520          

HSP 3 Score: 104.375 bits (259), Expect = 2.136e-21
Identity = 96/342 (28.07%), Postives = 158/342 (46.20%), Query Frame = 1
Query: 1000 PRPQ-RALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLD-----FLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLI---------IIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQ 1980
            P P+ RA F  +  N FR  C KIV    F  LILF I  +  +LAA  P   ++ +  N  L   + VF  +FT E +LK+ A+G  +H G++ RN +N+LD       ++  G+ S+ ++        VK LR  RVLRPLR ++    L+ V+  +  A+  + +I ++   +  ++A IG++LF GK     +   D   ++   C  S    Y+  D    G      +N +             +FD+    M+ +F   T EGW  ++Y   DS       IY   ++         II +FF+MN+ +G +   F ++ E+  K  +  K + Q
Sbjct:  953 PMPEARAFFVFSHTNKFRVLCHKIVNHNIFTNLILFFILLSSISLAAEDPV--KNDSFRNQILGYADHVFTGLFTIEIILKMTAYGAFLHKGSFCRNYFNILDLVVVSVSLISSGIQSSAINV-------VKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKF----FYCTDSSKQTQAECRGSYIM-YKDGDVGKPGRSPRVWENSD------------FNFDDVLQGMMALFAVSTFEGWPGLLYRAIDSHSEDVGPIYNYRVVISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQ 1268          

HSP 4 Score: 92.4337 bits (228), Expect = 7.814e-18
Identity = 59/211 (27.96%), Postives = 109/211 (51.66%), Query Frame = 1
Query: 4339 FRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIM 4971
            FR +    + S+ F +++  L+ LNT+++A +  +QPQ    V D  N V   +FT E LLK+ + G + YF   +N FD  +V G  ++ I       +        + I+  R  R++R+ K+      +  L+ + + S +++  + LL+ +   I++++GMQ+FG     +E       R + F  FPQ++L +F+  TGE W ++M
Sbjct:  596 FRRKCRAAVKSQVFYWLVIFLVFLNTLTIASEHHRQPQWLTDVQDIANKVLLALFTGEMLLKMYSLGLQAYFVSLFNRFDSFVVCGGILETILVETKIMSP-------LGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDE------TRRSTFDNFPQSLLTVFQILTGEDWNSVM 793          

HSP 5 Score: 88.5817 bits (218), Expect = 1.110e-16
Identity = 74/320 (23.12%), Postives = 137/320 (42.81%), Query Frame = 1
Query: 1036 RNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKM-----SEGGPDVKA--LRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWI-----------------NDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEF 1923
            +NP++     +V    FEYL+   I  N   LA         +   N A+  + ++F  +FT E +LK++AF     P  Y  + WN  D LIV+  ++   ++++     SE    +     R FRV+R ++L+S    ++ ++ + +++   L ++ALL + +  IYA+IG+++F GK+                                    + + + N+N             +F  F  A+L +F+C T E W +IM                    ++  G  +  IYFVS  ++ +F ++NL + V+   F
Sbjct: 1285 KNPYQYKVWYVVNSTYFEYLMFTLILLNTICLAMQH---HGQTKNFNDAMNILNMLFTGLFTVEMILKLIAF----KPRHYFVDAWNTFDALIVVGSIVDIAITEVNGLQNSEENARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMF-GKI----------------------------------ALRDLSQINRN------------NNFQTFPQAVLLLFRCATGEAWQEIMLACSPNRPCEKGSTNENSTASEECGSQFAIIYFVSFYMLCAFLIINLFVAVIMDNF 1550          

HSP 6 Score: 87.4261 bits (215), Expect = 2.964e-16
Identity = 68/267 (25.47%), Postives = 120/267 (44.94%), Query Frame = 1
Query: 4330 KQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKF---DKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGF----KNYFSDAWNVFDFIIVL-GSFIDIIYDHVNGTNNNHRGDRL--ISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMF------------------------------GKITTENEKEMK-----EINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAM 4995
            K   R     ++  +PFE II + I  N ++LA+     +         ++ +  +F  +FTVE  LK+ A+G       Y  + WN+ DFIIV+ G F  I+     G      G +     +   R FRV+R ++L+S    ++ +L + +K+   L ++ALL++ +  IYA+IG+++F                              G+  T+N  + +       +   NF  F  A+L +F+  T E W ++ L+ + DAM
Sbjct:  171 KNPIRRACISIVEWKPFEIIILMTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKGDGATPIGGKAAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCVHNHTGLNAEEKPAPCAPDGAYGRHCTQNGTQCRVGWEGPNDGITNFDNFAFAMLTVFQCITMEGWTDV-LYWMQDAM 436          

HSP 7 Score: 85.8853 bits (211), Expect = 6.922e-16
Identity = 76/273 (27.84%), Postives = 125/273 (45.79%), Query Frame = 1
Query: 3376 NKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPL--DAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVL----TSIISYPINNDAISXXXXXXXXXXXXXXXA------INRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEF---MFAVIGVQLFNGKF-QSC-------NDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIY 4125
            N  R+ C  I     F  I+L+ I  +   LA   P   D  ++ N  L   +YLF  +FTVE  LKVI YGL+FH  A+ R+  N+LD ++V+    ++I+      D  + +        ++ LRA      +    G+  +   +   +K++  ++ +  L+ F   ++A+IG++LF GK  ++C       N   K    +  G Y  +   +  +  V      +   NFDN   AMLT+F   T EGW  VLY   D+   +   +Y
Sbjct:  172 NPIRRACISIVEWKPFEIIILMTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKGDGATPIGGKAAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCVHNHTGLNAEEKPAPCAPDGAYGRHCTQNGTQCRVGWEGPNDGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVY 444          

HSP 8 Score: 84.7297 bits (208), Expect = 1.864e-15
Identity = 66/256 (25.78%), Postives = 135/256 (52.73%), Query Frame = 1
Query: 2281 LVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAM------PPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPR-SNFDSFVQSLLTVFQILTGEDWNEVMY------------DGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNL 2991
            +V S  F +++  L+ LNT  L  +H+ Q+   +   N  N++F  LFT+EM++K+ +   R YF   +N FD  +V+ SI++I + + + +        + ++  R  R++R+ K+      +R L+ + + S +++  + +L+ +   I++++GMQ+FG     D     R +NF +F Q++L +F+  TGE W E+M                 S  +    S  + +Y+V  ++   ++++N+F+A+ +DN 
Sbjct: 1295 VVNSTYFEYLMFTLILLNTICLAMQHHGQTKNFNDAMNILNMLFTGLFTVEMILKLIAFKPRHYFVDAWNTFDALIVVGSIVDIAITEVNGLQNSEENARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIALRDLSQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACSPNRPCEKGSTNENSTASEECGSQFAIIYFVSFYMLCAFLIINLFVAVIMDNF 1550          

HSP 9 Score: 75.485 bits (184), Expect = 1.259e-12
Identity = 75/294 (25.51%), Postives = 131/294 (44.56%), Query Frame = 1
Query: 1045 FRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGP-DVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMY-WINDSVGMSWP----WIYFVSLIIIGSFFVMNLVLGV 1908
            FR+ C   V+ + F +L++F +F N   +A+      R    +    +    V + +FT E +LK+ + G      AY  + +N  D  +V  G++ T+L +     P  +  LR  R+LR  ++     SL  ++ S++ ++  +  + LL    III++++G++LF GK                                           N +ET R        ++FDNF  ++LTVFQ +T E W  +MY  I    G S+P     IYF+ L I G++ ++N+ L +
Sbjct:  596 FRRKCRAAVKSQVFYWLVIFLVFLNTLTIASEH---HRQPQWLTDVQDIANKVLLALFTGEMLLKMYSLGL----QAYFVSLFNRFDSFVVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKF------------------------------------------NFDETRR--------STFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAI 832          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Planmine SMEST
Match: SMESG000000524.1 (SMESG000000524.1)

HSP 1 Score: 4475.23 bits (11606), Expect = 0.000e+0
Identity = 2449/2471 (99.11%), Postives = 2462/2471 (99.64%), Query Frame = 1
Query:  943 AQIASGGRKRTPARSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGGAHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSXXXXXXXXXXXXXXXPTNVDGEEAKACNSSNVSPNIDEKTRFTDAERLIKSEEMNGDIADESMRKMSTRIDTXXXXXXXXXXXXXXXXXNGQTSAIRRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRTHGRGSGPLISLISPTLVTTNECDEKDKDYLPSHLGAERRTHSIFGTMMNVLQRVGSTRRDSNASPSTGSINHSTELPRDRSNSRPMILNQSKSPTNHPPVKLTLAPVIEGQVISNEEYSAEIPPKLPKTVSKQSLNYDKKPLTSKQPRVEYTMRDKLSLRSPPLDIDLPLLRSNVFXXXXXXXXXXXXXXXXXKEEKVVSPVYSSGYSDEEDRISTESLIYVRRKSKDRYKGQSSHNRIGTVRPSNIDSRRYSNKERVTNNQDIRYYKGSPNEYXXXXXXXXXXXXFYPQNIPSNRCSNVXXXXXXXXXXXXXXNXXXXXXXXXXXXAFIYPLSRGDXXXXXXXXXXXHQRYQXXXXXXXXMGQCLGRQSSRESLIDRGLVQPILFAQNQAVLLAGIGDCKQFVNTSLRRRLPDTPQFPAGKESVPFNPYEKSIANQLRNIRKSKIVNVPKLKYHQELIDNSQFPNESDNESYSADIAGLGTFNLEEWRNSXXXXXXXXXXLRYCPQRSNKETFRQEHQKNNFNRYDSLRQPERSSYLLHHQCSLEEEQIDSTEDYDEEIDQLKIQNQYEKDYNRYMLKYAPSNPRSQFVDPRNCCADPRVSRNPMPDLISSTDWLLEKCQNAPAMKNHTYQKNYKYPQLLTEETFSRRARMDANSXXXXXXXXXXXXSQYVLSQQRESDEMEYLQMSQENIDKSFTNLRTRSKQYSDMGSQTHLEMSEPLLKQSIPNHLLSKSINPVFSPPIRPPYYEHLGGYGLHELKDSNVWSMRDENMSSILSRGATVRPFHPHGTKGVMRTHXXXXXXXXXXXXXXXXXXXTIRNQCEMQMKLPPPQDLLTNRKPSEKATYFLSVV 8355
            AQIASGGRKRTPARSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGLCKSSEKSDDGDDQLSDKLDLETEGGAHHSQQQQYVFCFPLKSRRGRKWNRRCRRICRRLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYFDFMFNRFDFFVVIFSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKSIVSLLVLLFLFIVIFSLLGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSGNKEEKKEGENEEGEPTNVDGEEAKACNSSNVSPNIDEKTRFTDAERLIKSEEMNGDIADESMRKMSTRIDTEKENDEEYAEGDEEDEENGQTSAIRRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLK+I+YG++ H  +FCR+ NN++DL V+L + +S+  +NDAISVVKILRVLRVLRPLRAINRAKGLKRVVQCVVVAVKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPIVSIFYIAYIIVIAFFMINIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRTHGRGSGPLISLISPTLVTTNECDEKDKDYLPSHLGAERRTHSIFGTMMNVLQRVGSTRRDSNASPSTGSINHSTELPRDRSNSRPMILNQSKSPTNHPPVKLTLAPVIEGQVISNEEYSAEIPPKLPKTVSKQSLNYDKKPLTSKQPRVEYTMRDKLSLRSPPLDIDLPLLRSNVFPRPSRSQSSESPESIQRKEEKVVSPVYSSGYSDEEDRISTESLIYVRRKSKDRYKGQSSHNRIGTVRPSNIDSRRYSNKERVTNNQDIRYYKGSPNEYSAQSSAESSEIQFYPQNIPSNRCSNVQIIDLDISLSSSQDNGDEFEYEGGEEEAFIYPLSRGDTPSPAPPPPTAHQRYQSSSRTSSSMGQCLGRQSSRESLIDRGLVQPILFAQNQAVLLAGIGDCKQFVNTSLRRRLPDTPQFPAGKESVPFNPYEKSIANQLRNIRKSKIVNVPKLKYHQELIDNSQFPNESDNESYSADIAGLGTFNLEEWRNSPPPTPAPNTNLRYCPQRSNKETFRQEHQKNNFNRYDSLRQPERSSYLLHHQCSLEEEQIDSTEDYDEEIDQLKIQNQYEKDYNRYMLKYAPSNPRSQFVDPRNCCADPRVSRNPMPDLISSTDWLLEKCQNAPAMKNHTYQKNYKYPQLLTEETFSRRARMDANSPPPEPAPRQELPSQYVLSQQRESDEMEYLQMSQENIDKSFTNLRTRSKQYSDMGSQTHLEMSEPLLKQSIPNHLLSKSINPVFSPPIRPPYYEHLGGYGLHELKDSNVWSMRDENMSSILSRGATVRPFHPHGTKGVMRTHNNSSNSSNNNNANNNSNNATIRNQCEMQMKLPPPQDLLTNRKPSEKATYFLSVV
Sbjct:   71 AQIASGGRKRTPARSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGLCKSSEKSDDGDDQLSDKLDLETEGGAHHSQQQQYVFCFPLKSRRGRKWNRRCRRICRRLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYFDFMFNRFDFFVVIFSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKSIVSLLVLLFLFIVIFSLLGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSGNKEEKKEGENEEGEPTNVDGEEAKACNSSNVSPNIDEKTRFTDAERLIKSEEMNGDIADESMRKMSTRIDTEKENDEEYAEGDEEDEENGQTSAIRRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKMISYGVILHRNSFCRNLNNVIDLGVILIASLSHVTDNDAISVVKILRVLRVLRPLRAINRAKGLKRVVQCVVVAVKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPIVSIFYIAYIIVIAFFMINIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRTHGRGSGPLISLISPTLVTTNECDEKDKDYLPSHLGAERRTHSIFGTMMNVLQRVGSTRRDSNASPSTGSINHSTELPRDRSNSRPMILNQSKSPTNHPPVKLTLAPVIEGQVISNEEYSAEIPPKLPKTVSKQSLNYDKKPLTSKQPRVEYTMRDKLSLRSPPLDIDLPLLRSNVFPRPSRSQSSESPESIQRKEEKVVSPVYSSGYSDEEDRISTESLIYVRRKSKDRYKGQSSHNRIGTVRPSNIDSRRYSNKERVTNNQDIRYYKGSPNEYSAQSSAESSEIQFYPQNIPSNRCSNVQIIDLDISLSSSQDNGDEFEYEGGEEEAFIYPLSRGDTPSPAPPPPTAHQRYQSSSRTSSSMGQCLGRQSSRESLIDRGLVQPILFAQNQAVLLAGIGDCKQFVNTSLRRRLPDTPQFPAGKESVPFNPYEKSIANQLRNIRKSKIVNVPKLKYHQELIDNSQFPNESDNESYSADIAGLGTFNLEEWRNSPPPTPAPNTNLRYCPQRSNKETFRQEHQKNNFNRYDSLRQPERSSYLLHHQCSLEEEQIDSTEDYDEEIDQLKIQNQYEKDYNRYMLKYAPSNPRSQFVDPRNCCADPRVSRNPMPDLISSTDWLLEKCQNAPAMKNHTYQKNYKYPQLLTEETFSRRARMDANSPPPEPAPRQELPSQYVLSQQRESDEMEYLQMSQENIDKSFTNLRTRSKQYSDMGSQTHLEMSEPLLKQSIPNHLLSKSINPVFSPPIRPPYYEHLGGYGLHELKDSNVWSMRDENMSSILSRGATVRPFHPHGTKGVMRTHNNSSNSSNNNNANNNSNNATIRNQCEMQMKLPPPQDLLTNRKPSEKATYFLSVV 2541          

HSP 2 Score: 164.851 bits (416), Expect = 6.466e-40
Identity = 71/72 (98.61%), Postives = 71/72 (98.61%), Query Frame = 1
Query:  253 MTGGRSGIDNCHPNQYSAPMHQYRQLFHTDQPFYDSHTRNTEYKCVENDYIESRYRFEPRTNYQLNYSPPGQ 468
            MTGGRSGIDNCHPNQYSAPMHQYRQLFHTDQPFYDSHTRNTEYKCVENDYIESRYRFEPRTNYQLNYSPP Q
Sbjct:    1 MTGGRSGIDNCHPNQYSAPMHQYRQLFHTDQPFYDSHTRNTEYKCVENDYIESRYRFEPRTNYQLNYSPPAQ 72          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Planmine SMEST
Match: SMESG000000524.1 (SMESG000000524.1)

HSP 1 Score: 4474.85 bits (11605), Expect = 0.000e+0
Identity = 2449/2471 (99.11%), Postives = 2462/2471 (99.64%), Query Frame = 1
Query:  943 AQIASGGRKRTPARSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGGAHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSXXXXXXXXXXXXXXXPTNVDGEEAKACNSSNVSPNIDEKTRFTDAERLIKSEEMNGDIADESMRKMSTRIDTXXXXXXXXXXXXXXXXXNGQTSAIRRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRTHGRGSGPLISLISPTLVTTNECDEKDKDYLPSHLGAERRTHSIFGTMMNVLQRVGSTRRDSNASPSTGSINHSTELPRDRSNSRPMILNQSKSPTNHPPVKLTLAPVIEGQVISNEEYSAEIPPKLPKTVSKQSLNYDKKPLTSKQPRVEYTMRDKLSLRSPPLDIDLPLLRSNVFXXXXXXXXXXXXXXXXXKEEKVVSPVYSSGYSDEEDRISTESLIYVRRKSKDRYKGQSSHNRIGTVRPSNIDSRRYSNKERVTNNQDIRYYKGSPNEYXXXXXXXXXXXXFYPQNIPSNRCSNVXXXXXXXXXXXXXXNXXXXXXXXXXXXAFIYPLSRGDXXXXXXXXXXXHQRYQXXXXXXXXMGQCLGRQSSRESLIDRGLVQPILFAQNQAVLLAGIGDCKQFVNTSLRRRLPDTPQFPAGKESVPFNPYEKSIANQLRNIRKSKIVNVPKLKYHQELIDNSQFPNESDNESYSADIAGLGTFNLEEWRNSXXXXXXXXXXLRYCPQRSNKETFRQEHQKNNFNRYDSLRQPERSSYLLHHQCSLEEEQIDSTEDYDEEIDQLKIQNQYEKDYNRYMLKYAPSNPRSQFVDPRNCCADPRVSRNPMPDLISSTDWLLEKCQNAPAMKNHTYQKNYKYPQLLTEETFSRRARMDANSXXXXXXXXXXXXSQYVLSQQRESDEMEYLQMSQENIDKSFTNLRTRSKQYSDMGSQTHLEMSEPLLKQSIPNHLLSKSINPVFSPPIRPPYYEHLGGYGLHELKDSNVWSMRDENMSSILSRGATVRPFHPHGTKGVMRTHXXXXXXXXXXXXXXXXXXXTIRNQCEMQMKLPPPQDLLTNRKPSEKATYFLSVV 8355
            AQIASGGRKRTPARSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGLCKSSEKSDDGDDQLSDKLDLETEGGAHHSQQQQYVFCFPLKSRRGRKWNRRCRRICRRLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYFDFMFNRFDFFVVIFSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKSIVSLLVLLFLFIVIFSLLGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSGNKEEKKEGENEEGEPTNVDGEEAKACNSSNVSPNIDEKTRFTDAERLIKSEEMNGDIADESMRKMSTRIDTEKENDEEYAEGDEEDEENGQTSAIRRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLK+I+YG++ H  +FCR+ NN++DL V+L + +S+  +NDAISVVKILRVLRVLRPLRAINRAKGLKRVVQCVVVAVKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPIVSIFYIAYIIVIAFFMINIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRTHGRGSGPLISLISPTLVTTNECDEKDKDYLPSHLGAERRTHSIFGTMMNVLQRVGSTRRDSNASPSTGSINHSTELPRDRSNSRPMILNQSKSPTNHPPVKLTLAPVIEGQVISNEEYSAEIPPKLPKTVSKQSLNYDKKPLTSKQPRVEYTMRDKLSLRSPPLDIDLPLLRSNVFPRPSRSQSSESPESIQRKEEKVVSPVYSSGYSDEEDRISTESLIYVRRKSKDRYKGQSSHNRIGTVRPSNIDSRRYSNKERVTNNQDIRYYKGSPNEYSAQSSAESSEIQFYPQNIPSNRCSNVQIIDLDISLSSSQDNGDEFEYEGGEEEAFIYPLSRGDTPSPAPPPPTAHQRYQSSSRTSSSMGQCLGRQSSRESLIDRGLVQPILFAQNQAVLLAGIGDCKQFVNTSLRRRLPDTPQFPAGKESVPFNPYEKSIANQLRNIRKSKIVNVPKLKYHQELIDNSQFPNESDNESYSADIAGLGTFNLEEWRNSPPPTPAPNTNLRYCPQRSNKETFRQEHQKNNFNRYDSLRQPERSSYLLHHQCSLEEEQIDSTEDYDEEIDQLKIQNQYEKDYNRYMLKYAPSNPRSQFVDPRNCCADPRVSRNPMPDLISSTDWLLEKCQNAPAMKNHTYQKNYKYPQLLTEETFSRRARMDANSPPPEPAPRQELPSQYVLSQQRESDEMEYLQMSQENIDKSFTNLRTRSKQYSDMGSQTHLEMSEPLLKQSIPNHLLSKSINPVFSPPIRPPYYEHLGGYGLHELKDSNVWSMRDENMSSILSRGATVRPFHPHGTKGVMRTHNNSSNSSNNNNANNNSNNATIRNQCEMQMKLPPPQDLLTNRKPSEKATYFLSVV
Sbjct:   81 AQIASGGRKRTPARSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGLCKSSEKSDDGDDQLSDKLDLETEGGAHHSQQQQYVFCFPLKSRRGRKWNRRCRRICRRLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYFDFMFNRFDFFVVIFSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKSIVSLLVLLFLFIVIFSLLGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSGNKEEKKEGENEEGEPTNVDGEEAKACNSSNVSPNIDEKTRFTDAERLIKSEEMNGDIADESMRKMSTRIDTEKENDEEYAEGDEEDEENGQTSAIRRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKMISYGVILHRNSFCRNLNNVIDLGVILIASLSHVTDNDAISVVKILRVLRVLRPLRAINRAKGLKRVVQCVVVAVKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPIVSIFYIAYIIVIAFFMINIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRTHGRGSGPLISLISPTLVTTNECDEKDKDYLPSHLGAERRTHSIFGTMMNVLQRVGSTRRDSNASPSTGSINHSTELPRDRSNSRPMILNQSKSPTNHPPVKLTLAPVIEGQVISNEEYSAEIPPKLPKTVSKQSLNYDKKPLTSKQPRVEYTMRDKLSLRSPPLDIDLPLLRSNVFPRPSRSQSSESPESIQRKEEKVVSPVYSSGYSDEEDRISTESLIYVRRKSKDRYKGQSSHNRIGTVRPSNIDSRRYSNKERVTNNQDIRYYKGSPNEYSAQSSAESSEIQFYPQNIPSNRCSNVQIIDLDISLSSSQDNGDEFEYEGGEEEAFIYPLSRGDTPSPAPPPPTAHQRYQSSSRTSSSMGQCLGRQSSRESLIDRGLVQPILFAQNQAVLLAGIGDCKQFVNTSLRRRLPDTPQFPAGKESVPFNPYEKSIANQLRNIRKSKIVNVPKLKYHQELIDNSQFPNESDNESYSADIAGLGTFNLEEWRNSPPPTPAPNTNLRYCPQRSNKETFRQEHQKNNFNRYDSLRQPERSSYLLHHQCSLEEEQIDSTEDYDEEIDQLKIQNQYEKDYNRYMLKYAPSNPRSQFVDPRNCCADPRVSRNPMPDLISSTDWLLEKCQNAPAMKNHTYQKNYKYPQLLTEETFSRRARMDANSPPPEPAPRQELPSQYVLSQQRESDEMEYLQMSQENIDKSFTNLRTRSKQYSDMGSQTHLEMSEPLLKQSIPNHLLSKSINPVFSPPIRPPYYEHLGGYGLHELKDSNVWSMRDENMSSILSRGATVRPFHPHGTKGVMRTHNNSSNSSNNNNANNNSNNATIRNQCEMQMKLPPPQDLLTNRKPSEKATYFLSVV 2551          

HSP 2 Score: 186.422 bits (472), Expect = 1.962e-46
Identity = 81/82 (98.78%), Postives = 81/82 (98.78%), Query Frame = 1
Query:  223 MLNDRIYPNNMTGGRSGIDNCHPNQYSAPMHQYRQLFHTDQPFYDSHTRNTEYKCVENDYIESRYRFEPRTNYQLNYSPPGQ 468
            MLNDRIYPNNMTGGRSGIDNCHPNQYSAPMHQYRQLFHTDQPFYDSHTRNTEYKCVENDYIESRYRFEPRTNYQLNYSPP Q
Sbjct:    1 MLNDRIYPNNMTGGRSGIDNCHPNQYSAPMHQYRQLFHTDQPFYDSHTRNTEYKCVENDYIESRYRFEPRTNYQLNYSPPAQ 82          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Planmine SMEST
Match: SMESG000000524.1 (SMESG000000524.1)

HSP 1 Score: 4418.61 bits (11459), Expect = 0.000e+0
Identity = 2417/2471 (97.81%), Postives = 2432/2471 (98.42%), Query Frame = 1
Query:  943 AQIASGGRKRTPARSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGGAHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSXXXXXXXXXXXXXXXPTNVDGEEAKACNSSNVSPNIDEKTRFTDAERLIKSEEMNGDIADESMRKMSTRIDTXXXXXXXXXXXXXXXXXNGQTSAIRRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRTHGRGSGPLISLISPTLVTTNECDEKDKDYLPSHLGAERRTHSIFGTMMNVLQRVGSTRRDSNASPSTGSINHSTELPRDRSNSRPMILNQSKSPTNHPPVKLTLAPVIEGQVISNEEYSAEIPPKLPKTVSKQSLNYDKKPLTSKQPRVEYTMRDKLSLRSPPLDIDLPLLRSNVFXXXXXXXXXXXXXXXXXKEEKVVSPVYSSGYSDEEDRISTESLIYVRRKSKDRYKGQSSHNRIGTVRPSNIDSRRYSNKERVTNNQDIRYYKGSPNEYXXXXXXXXXXXXFYPQNIPSNRCSNVXXXXXXXXXXXXXXNXXXXXXXXXXXXAFIYPLSRGDXXXXXXXXXXXHQRYQXXXXXXXXMGQCLGRQSSRESLIDRGLVQPILFAQNQAVLLAGIGDCKQFVNTSLRRRLPDTPQFPAGKESVPFNPYEKSIANQLRNIRKSKIVNVPKLKYHQELIDNSQFPNESDNESYSADIAGLGTFNLEEWRNSXXXXXXXXXXLRYCPQRSNKETFRQEHQKNNFNRYDSLRQPERSSYLLHHQCSLEEEQIDSTEDYDEEIDQLKIQNQYEKDYNRYMLKYAPSNPRSQFVDPRNCCADPRVSRNPMPDLISSTDWLLEKCQNAPAMKNHTYQKNYKYPQLLTEETFSRRARMDANSXXXXXXXXXXXXSQYVLSQQRESDEMEYLQMSQENIDKSFTNLRTRSKQYSDMGSQTHLEMSEPLLKQSIPNHLLSKSINPVFSPPIRPPYYEHLGGYGLHELKDSNVWSMRDENMSSILSRGATVRPFHPHGTKGVMRTHXXXXXXXXXXXXXXXXXXXTIRNQCEMQMKLPPPQDLLTNRKPSEKATYFLSVV 8355
            AQIASGGRKRTPARSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGLCKSSEKSDDGDDQLSDKLDLETEGGAHHSQQQQYVFCFPLKSRRGRKWNRRCRRICRRLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYFDFMFNRFDFFVVIFSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKSIVSLLVLLFLFIVIFSLLGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSGNKEEKKEGENEEGEPTNVDGEEAKACNSSNVSPNIDEKTRFTDAERLIKSEEMNGDIADESMRKMSTRIDTEKENDEEYAEGDEEDEENGQTSAIRRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLK+I+YG++ H  +FCR+ NN++DL V+L + +S+  +NDAISVVKILRVLRVLRPLRAINRAKGLKRVVQCVVVAVKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPIVSIFYIAYIIVIAFFMINIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRTHGRGSGPLISLISPTLVTTNECDEKDKDYLPSHLGAERRTHSIFGTMMNVLQRVGSTRRDSNASPSTGSINHSTELPRDRSNSRPMILNQSKSPTNHPPVKLTLAPVIEGQVISNEEYSAEIPPKLPKTVSKQSLNYDKKPLTSKQPRVEYTMRDKLSLRSPPLDIDLPLLRSNVFPRPSRS                      S  S E  +   E+LIYVRRKSKDRYKGQSSHNRIGTVRPSNIDSRRYSNKERVTNNQDIRYYKGSPNEYSAQSSAESSEIQFYPQNIPSNRCSNVQIIDLDISLSSSQDNGDEFEYEGGEEEAFIYPLSRGDTPSPAPPPPTAHQRYQSSSRTSSSMGQCLGRQSSRESLIDRGLVQPILFAQNQAVLLAGIGDCKQFVNTSLRRRLPDTPQFPAGKESVPFNPYEKSIANQLRNIRKSKIVNVPKLKYHQELIDNSQFPNESDNESYSADIAGLGTFNLEEWRNSPPPTPAPNTNLRYCPQRSNKETFRQEHQKNNFNRYDSLRQPERSSYLLHHQCSLEEEQIDSTEDYDEEIDQLKIQNQYEKDYNRYMLKYAPSNPRSQFVDPRNCCADPRVSRNPMPDLISSTDWLLEKCQNAPAMKNHTYQKNYKYPQLLTEETFSRRARMDANSPPPEPAPRQELPSQYVLSQQRESDEMEYLQMSQENIDKSFTNLRTRSKQYSDMGSQTHLEMSEPLLKQSIPNHLLSKSINPVFSPPIRPPYYEHLGGYGLHELKDSNVWSMRDENMSSILSRGATVRPFHPHGTKGVMRTHNNSSNSSNNNNANNNSNNATIRNQCEMQMKLPPPQDLLTNRKPSEKATYFLSVV
Sbjct:   81 AQIASGGRKRTPARSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGLCKSSEKSDDGDDQLSDKLDLETEGGAHHSQQQQYVFCFPLKSRRGRKWNRRCRRICRRLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYFDFMFNRFDFFVVIFSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKSIVSLLVLLFLFIVIFSLLGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSGNKEEKKEGENEEGEPTNVDGEEAKACNSSNVSPNIDEKTRFTDAERLIKSEEMNGDIADESMRKMSTRIDTEKENDEEYAEGDEEDEENGQTSAIRRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKMISYGVILHRNSFCRNLNNVIDLGVILIASLSHVTDNDAISVVKILRVLRVLRPLRAINRAKGLKRVVQCVVVAVKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPIVSIFYIAYIIVIAFFMINIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRTHGRGSGPLISLISPTLVTTNECDEKDKDYLPSHLGAERRTHSIFGTMMNVLQRVGSTRRDSNASPSTGSINHSTELPRDRSNSRPMILNQSKSPTNHPPVKLTLAPVIEGQVISNEEYSAEIPPKLPKTVSKQSLNYDKKPLTSKQPRVEYTMRDKLSLRSPPLDIDLPLLRSNVFPRPSRS---------------------QSSESPESIQRKEENLIYVRRKSKDRYKGQSSHNRIGTVRPSNIDSRRYSNKERVTNNQDIRYYKGSPNEYSAQSSAESSEIQFYPQNIPSNRCSNVQIIDLDISLSSSQDNGDEFEYEGGEEEAFIYPLSRGDTPSPAPPPPTAHQRYQSSSRTSSSMGQCLGRQSSRESLIDRGLVQPILFAQNQAVLLAGIGDCKQFVNTSLRRRLPDTPQFPAGKESVPFNPYEKSIANQLRNIRKSKIVNVPKLKYHQELIDNSQFPNESDNESYSADIAGLGTFNLEEWRNSPPPTPAPNTNLRYCPQRSNKETFRQEHQKNNFNRYDSLRQPERSSYLLHHQCSLEEEQIDSTEDYDEEIDQLKIQNQYEKDYNRYMLKYAPSNPRSQFVDPRNCCADPRVSRNPMPDLISSTDWLLEKCQNAPAMKNHTYQKNYKYPQLLTEETFSRRARMDANSPPPEPAPRQELPSQYVLSQQRESDEMEYLQMSQENIDKSFTNLRTRSKQYSDMGSQTHLEMSEPLLKQSIPNHLLSKSINPVFSPPIRPPYYEHLGGYGLHELKDSNVWSMRDENMSSILSRGATVRPFHPHGTKGVMRTHNNSSNSSNNNNANNNSNNATIRNQCEMQMKLPPPQDLLTNRKPSEKATYFLSVV 2530          

HSP 2 Score: 186.422 bits (472), Expect = 2.107e-46
Identity = 81/82 (98.78%), Postives = 81/82 (98.78%), Query Frame = 1
Query:  223 MLNDRIYPNNMTGGRSGIDNCHPNQYSAPMHQYRQLFHTDQPFYDSHTRNTEYKCVENDYIESRYRFEPRTNYQLNYSPPGQ 468
            MLNDRIYPNNMTGGRSGIDNCHPNQYSAPMHQYRQLFHTDQPFYDSHTRNTEYKCVENDYIESRYRFEPRTNYQLNYSPP Q
Sbjct:    1 MLNDRIYPNNMTGGRSGIDNCHPNQYSAPMHQYRQLFHTDQPFYDSHTRNTEYKCVENDYIESRYRFEPRTNYQLNYSPPAQ 82          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Planmine SMEST
Match: SMESG000000524.1 (SMESG000000524.1)

HSP 1 Score: 4418.61 bits (11459), Expect = 0.000e+0
Identity = 2417/2471 (97.81%), Postives = 2432/2471 (98.42%), Query Frame = 1
Query:  943 AQIASGGRKRTPARSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGGAHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSXXXXXXXXXXXXXXXPTNVDGEEAKACNSSNVSPNIDEKTRFTDAERLIKSEEMNGDIADESMRKMSTRIDTXXXXXXXXXXXXXXXXXNGQTSAIRRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRTHGRGSGPLISLISPTLVTTNECDEKDKDYLPSHLGAERRTHSIFGTMMNVLQRVGSTRRDSNASPSTGSINHSTELPRDRSNSRPMILNQSKSPTNHPPVKLTLAPVIEGQVISNEEYSAEIPPKLPKTVSKQSLNYDKKPLTSKQPRVEYTMRDKLSLRSPPLDIDLPLLRSNVFXXXXXXXXXXXXXXXXXKEEKVVSPVYSSGYSDEEDRISTESLIYVRRKSKDRYKGQSSHNRIGTVRPSNIDSRRYSNKERVTNNQDIRYYKGSPNEYXXXXXXXXXXXXFYPQNIPSNRCSNVXXXXXXXXXXXXXXNXXXXXXXXXXXXAFIYPLSRGDXXXXXXXXXXXHQRYQXXXXXXXXMGQCLGRQSSRESLIDRGLVQPILFAQNQAVLLAGIGDCKQFVNTSLRRRLPDTPQFPAGKESVPFNPYEKSIANQLRNIRKSKIVNVPKLKYHQELIDNSQFPNESDNESYSADIAGLGTFNLEEWRNSXXXXXXXXXXLRYCPQRSNKETFRQEHQKNNFNRYDSLRQPERSSYLLHHQCSLEEEQIDSTEDYDEEIDQLKIQNQYEKDYNRYMLKYAPSNPRSQFVDPRNCCADPRVSRNPMPDLISSTDWLLEKCQNAPAMKNHTYQKNYKYPQLLTEETFSRRARMDANSXXXXXXXXXXXXSQYVLSQQRESDEMEYLQMSQENIDKSFTNLRTRSKQYSDMGSQTHLEMSEPLLKQSIPNHLLSKSINPVFSPPIRPPYYEHLGGYGLHELKDSNVWSMRDENMSSILSRGATVRPFHPHGTKGVMRTHXXXXXXXXXXXXXXXXXXXTIRNQCEMQMKLPPPQDLLTNRKPSEKATYFLSVV 8355
            AQIASGGRKRTPARSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGLCKSSEKSDDGDDQLSDKLDLETEGGAHHSQQQQYVFCFPLKSRRGRKWNRRCRRICRRLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYFDFMFNRFDFFVVIFSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKSIVSLLVLLFLFIVIFSLLGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSGNKEEKKEGENEEGEPTNVDGEEAKACNSSNVSPNIDEKTRFTDAERLIKSEEMNGDIADESMRKMSTRIDTEKENDEEYAEGDEEDEENGQTSAIRRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLK+I+YG++ H  +FCR+ NN++DL V+L + +S+  +NDAISVVKILRVLRVLRPLRAINRAKGLKRVVQCVVVAVKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPIVSIFYIAYIIVIAFFMINIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRTHGRGSGPLISLISPTLVTTNECDEKDKDYLPSHLGAERRTHSIFGTMMNVLQRVGSTRRDSNASPSTGSINHSTELPRDRSNSRPMILNQSKSPTNHPPVKLTLAPVIEGQVISNEEYSAEIPPKLPKTVSKQSLNYDKKPLTSKQPRVEYTMRDKLSLRSPPLDIDLPLLRSNVFPRPSRS                      S  S E  +   E+LIYVRRKSKDRYKGQSSHNRIGTVRPSNIDSRRYSNKERVTNNQDIRYYKGSPNEYSAQSSAESSEIQFYPQNIPSNRCSNVQIIDLDISLSSSQDNGDEFEYEGGEEEAFIYPLSRGDTPSPAPPPPTAHQRYQSSSRTSSSMGQCLGRQSSRESLIDRGLVQPILFAQNQAVLLAGIGDCKQFVNTSLRRRLPDTPQFPAGKESVPFNPYEKSIANQLRNIRKSKIVNVPKLKYHQELIDNSQFPNESDNESYSADIAGLGTFNLEEWRNSPPPTPAPNTNLRYCPQRSNKETFRQEHQKNNFNRYDSLRQPERSSYLLHHQCSLEEEQIDSTEDYDEEIDQLKIQNQYEKDYNRYMLKYAPSNPRSQFVDPRNCCADPRVSRNPMPDLISSTDWLLEKCQNAPAMKNHTYQKNYKYPQLLTEETFSRRARMDANSPPPEPAPRQELPSQYVLSQQRESDEMEYLQMSQENIDKSFTNLRTRSKQYSDMGSQTHLEMSEPLLKQSIPNHLLSKSINPVFSPPIRPPYYEHLGGYGLHELKDSNVWSMRDENMSSILSRGATVRPFHPHGTKGVMRTHNNSSNSSNNNNANNNSNNATIRNQCEMQMKLPPPQDLLTNRKPSEKATYFLSVV
Sbjct:   71 AQIASGGRKRTPARSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGLCKSSEKSDDGDDQLSDKLDLETEGGAHHSQQQQYVFCFPLKSRRGRKWNRRCRRICRRLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYFDFMFNRFDFFVVIFSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKSIVSLLVLLFLFIVIFSLLGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSGNKEEKKEGENEEGEPTNVDGEEAKACNSSNVSPNIDEKTRFTDAERLIKSEEMNGDIADESMRKMSTRIDTEKENDEEYAEGDEEDEENGQTSAIRRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKMISYGVILHRNSFCRNLNNVIDLGVILIASLSHVTDNDAISVVKILRVLRVLRPLRAINRAKGLKRVVQCVVVAVKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPIVSIFYIAYIIVIAFFMINIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRTHGRGSGPLISLISPTLVTTNECDEKDKDYLPSHLGAERRTHSIFGTMMNVLQRVGSTRRDSNASPSTGSINHSTELPRDRSNSRPMILNQSKSPTNHPPVKLTLAPVIEGQVISNEEYSAEIPPKLPKTVSKQSLNYDKKPLTSKQPRVEYTMRDKLSLRSPPLDIDLPLLRSNVFPRPSRS---------------------QSSESPESIQRKEENLIYVRRKSKDRYKGQSSHNRIGTVRPSNIDSRRYSNKERVTNNQDIRYYKGSPNEYSAQSSAESSEIQFYPQNIPSNRCSNVQIIDLDISLSSSQDNGDEFEYEGGEEEAFIYPLSRGDTPSPAPPPPTAHQRYQSSSRTSSSMGQCLGRQSSRESLIDRGLVQPILFAQNQAVLLAGIGDCKQFVNTSLRRRLPDTPQFPAGKESVPFNPYEKSIANQLRNIRKSKIVNVPKLKYHQELIDNSQFPNESDNESYSADIAGLGTFNLEEWRNSPPPTPAPNTNLRYCPQRSNKETFRQEHQKNNFNRYDSLRQPERSSYLLHHQCSLEEEQIDSTEDYDEEIDQLKIQNQYEKDYNRYMLKYAPSNPRSQFVDPRNCCADPRVSRNPMPDLISSTDWLLEKCQNAPAMKNHTYQKNYKYPQLLTEETFSRRARMDANSPPPEPAPRQELPSQYVLSQQRESDEMEYLQMSQENIDKSFTNLRTRSKQYSDMGSQTHLEMSEPLLKQSIPNHLLSKSINPVFSPPIRPPYYEHLGGYGLHELKDSNVWSMRDENMSSILSRGATVRPFHPHGTKGVMRTHNNSSNSSNNNNANNNSNNATIRNQCEMQMKLPPPQDLLTNRKPSEKATYFLSVV 2520          

HSP 2 Score: 164.851 bits (416), Expect = 7.067e-40
Identity = 71/72 (98.61%), Postives = 71/72 (98.61%), Query Frame = 1
Query:  253 MTGGRSGIDNCHPNQYSAPMHQYRQLFHTDQPFYDSHTRNTEYKCVENDYIESRYRFEPRTNYQLNYSPPGQ 468
            MTGGRSGIDNCHPNQYSAPMHQYRQLFHTDQPFYDSHTRNTEYKCVENDYIESRYRFEPRTNYQLNYSPP Q
Sbjct:    1 MTGGRSGIDNCHPNQYSAPMHQYRQLFHTDQPFYDSHTRNTEYKCVENDYIESRYRFEPRTNYQLNYSPPAQ 72          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Planmine SMEST
Match: SMESG000000524.1 (SMESG000000524.1)

HSP 1 Score: 3380.88 bits (8765), Expect = 0.000e+0
Identity = 1817/1817 (100.00%), Postives = 1817/1817 (100.00%), Query Frame = 1
Query:  943 AQIASGGRKRTPARSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGLCKSSEXXXXXXXXXXXXXXXETEGGAHHSQQQQYVFCFPLKSXXXXXXXXXXXXXXXXLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYXXXXXXXXXXXXXXXSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKXXXXXXXXXXXXXXXXXXXGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSXXXXXXXXXXXXXXXPTNVDGEEAKACNSSNVSPNIDEKTRFTDAERLIKSEEMNGDIADESMRKMSTRIDTXXXXXXXXXXXXXXXXXNGQTSAIRRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISXXXXXXXXXXXXXXXAINRAKGLKRXXXXXXXXXKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPXXXXXXXXXXXXXXXXXXNIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRTHGRGSGPLISLISPTLVTTNECDEKDKDYLPSHLGAERRTHSIFGTMMNVLQRVGSTRRDSNASPSTGSINHSTELPRDRSNSRPMILNQSKSPTNHPPVKLTLAPVIEGQVISNEEYSAEIPPKLPKTVSKQSLNYDKKPLTSKQPRVEYTMRDKLSLRSPPLDIDLPLLRSNVFXXXXXXXXXXXXXXXXXKEEK 6393
            AQIASGGRKRTPARSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGLCKSSEKSDDGDDQLSDKLDLETEGGAHHSQQQQYVFCFPLKSRRGRKWNRRCRRICRRLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYFDFMFNRFDFFVVIFSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKSIVSLLVLLFLFIVIFSLLGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSGNKEEKKEGENEEGEPTNVDGEEAKACNSSNVSPNIDEKTRFTDAERLIKSEEMNGDIADESMRKMSTRIDTEKENDEEYAEGDEEDEENGQTSAIRRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISVVKILRVLRVLRPLRAINRAKGLKRVVQCVVVAVKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPIVSIFYIAYIIVIAFFMINIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRTHGRGSGPLISLISPTLVTTNECDEKDKDYLPSHLGAERRTHSIFGTMMNVLQRVGSTRRDSNASPSTGSINHSTELPRDRSNSRPMILNQSKSPTNHPPVKLTLAPVIEGQVISNEEYSAEIPPKLPKTVSKQSLNYDKKPLTSKQPRVEYTMRDKLSLRSPPLDIDLPLLRSNVFPRPSRSQSSESPESIQRKEEK
Sbjct:   71 AQIASGGRKRTPARSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANCCALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPGAYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVSGLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCYSKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNMGITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIIIGSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWIGAAEDISDDEENDGKENGKESRFKLCGLCKSSEKSDDGDDQLSDKLDLETEGGAHHSQQQQYVFCFPLKSRRGRKWNRRCRRICRRLVKSQAFYWVVIVLVFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCYFDFMFNRFDFFVVIFSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRYWSSLRNLVGSLLASMKSIVSLLVLLFLFIVIFSLLGMQLFGGKFNFDKKAKPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYYVILFICGNYILLNVFLAIAVDNLADTGSGNKEEKKEGENEEGEPTNVDGEEAKACNSSNVSPNIDEKTRFTDAERLIKSEEMNGDIADESMRKMSTRIDTEKENDEEYAEGDEEDEENGQTSAIRRVSEVMAKEKIKPIPNASSFFIFGPNNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNYFDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYPINNDAISVVKILRVLRVLRPLRAINRAKGLKRVVQCVVVAVKSIGNIMLVTFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVFVNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGIYNNRPIVSIFYIAYIIVIAFFMINIFVGFVIVTFQQEGEEEYKNCELDKNQRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTISLALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNVFDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKEMKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIRKEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCGSNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNMPLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTSQKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQSKRLSLMPFRTHGRGSGPLISLISPTLVTTNECDEKDKDYLPSHLGAERRTHSIFGTMMNVLQRVGSTRRDSNASPSTGSINHSTELPRDRSNSRPMILNQSKSPTNHPPVKLTLAPVIEGQVISNEEYSAEIPPKLPKTVSKQSLNYDKKPLTSKQPRVEYTMRDKLSLRSPPLDIDLPLLRSNVFPRPSRSQSSESPESIQRKEEK 1887          

HSP 2 Score: 166.777 bits (421), Expect = 1.683e-40
Identity = 71/72 (98.61%), Postives = 71/72 (98.61%), Query Frame = 1
Query:  253 MTGGRSGIDNCHPNQYSAPMHQYRQLFHTDQPFYDSHTRNTEYKCVENDYIESRYRFEPRTNYQLNYSPPGQ 468
            MTGGRSGIDNCHPNQYSAPMHQYRQLFHTDQPFYDSHTRNTEYKCVENDYIESRYRFEPRTNYQLNYSPP Q
Sbjct:    1 MTGGRSGIDNCHPNQYSAPMHQYRQLFHTDQPFYDSHTRNTEYKCVENDYIESRYRFEPRTNYQLNYSPPAQ 72          
The following BLAST results are available for this feature:
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CACNA1S0.000e+053.11calcium voltage-gated channel subunit alpha1 S [So... [more]
CACNA1S0.000e+052.66calcium voltage-gated channel subunit alpha1 S [So... [more]
CACNA1D8.423e-2760.09calcium voltage-gated channel subunit alpha1 D [So... [more]
CACNA1D8.892e-2760.09calcium voltage-gated channel subunit alpha1 D [So... [more]
CACNA1D9.382e-2760.09calcium voltage-gated channel subunit alpha1 D [So... [more]
back to top
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egl-195.728e-14558.09Voltage-dependent L-type calcium channel subunit a... [more]
egl-191.438e-14562.31Voltage-dependent L-type calcium channel subunit a... [more]
unc-29.128e-14545.14High voltage activated calcium channel alpha-1 sub... [more]
unc-26.506e-14546.13High voltage activated calcium channel alpha-1 sub... [more]
unc-29.059e-14546.13High voltage activated calcium channel alpha-1 sub... [more]
back to top
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ca-alpha1D1.026e-2558.55gene:FBgn0001991 transcript:FBtr0332020[more]
Ca-alpha1D1.220e-2558.64gene:FBgn0001991 transcript:FBtr0090005[more]
Ca-alpha1D1.874e-2558.64gene:FBgn0001991 transcript:FBtr0332024[more]
Ca-alpha1D0.000e+058.73gene:FBgn0001991 transcript:FBtr0090006[more]
Ca-alpha1D0.000e+058.73gene:FBgn0001991 transcript:FBtr0332023[more]
back to top
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cacna1sb6.353e-1551.68calcium channel, voltage-dependent, L type, alpha ... [more]
cacna1da2.596e-2660.04calcium channel, voltage-dependent, L type, alpha ... [more]
cacna1da6.420e-2659.37calcium channel, voltage-dependent, L type, alpha ... [more]
cacna1c1.411e-2157.17calcium channel, voltage-dependent, L type, alpha ... [more]
cacna1c1.620e-2155.89calcium channel, voltage-dependent, L type, alpha ... [more]
back to top
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CACNA1C0.000e+055.06calcium channel, voltage-dependent, L type, alpha ... [more]
CACNA1C0.000e+054.58calcium channel, voltage-dependent, L type, alpha ... [more]
CACNA1C0.000e+054.53calcium channel, voltage-dependent, L type, alpha ... [more]
CACNA1C0.000e+054.34calcium channel, voltage-dependent, L type, alpha ... [more]
CACNA1C0.000e+053.80calcium channel, voltage-dependent, L type, alpha ... [more]
back to top
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cacna1s0.000e+054.58calcium channel, voltage-dependent, L type, alpha ... [more]
Cacna1s0.000e+054.11calcium channel, voltage-dependent, L type, alpha ... [more]
Cacna1s0.000e+054.11calcium channel, voltage-dependent, L type, alpha ... [more]
Cacna1s1.919e-2754.64calcium channel, voltage-dependent, L type, alpha ... [more]
Cacna1f1.387e-12958.36calcium channel, voltage-dependent, alpha 1F subun... [more]
back to top
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q25452|CAC1M_MUSDO0.000e+057.80Muscle calcium channel subunit alpha-1 OS=Musca do... [more]
sp|Q24270|CAC1D_DROME0.000e+058.73Voltage-dependent calcium channel type D subunit a... [more]
sp|Q02485|CAC1S_RAT0.000e+054.14Voltage-dependent L-type calcium channel subunit a... [more]
sp|Q02789|CAC1S_MOUSE0.000e+054.14Voltage-dependent L-type calcium channel subunit a... [more]
sp|P07293|CAC1S_RABIT0.000e+053.85Voltage-dependent L-type calcium channel subunit a... [more]
back to top
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G0YP320.000e+087.45Voltage-dependent L-type calcium channel subunit a... [more]
A0A068WA300.000e+066.11Voltage-dependent L-type calcium channel subunit a... [more]
W6UN840.000e+062.42Voltage-dependent L-type calcium channel subunit a... [more]
A0A068YHX80.000e+062.38Voltage-dependent L-type calcium channel subunit a... [more]
A0A182J4Y30.000e+060.46Voltage-dependent L-type calcium channel subunit a... [more]
back to top
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cacna1db3.282e-2657.40calcium channel, voltage-dependent, L type, alpha ... [more]
cacna1sb0.000e+048.78calcium channel, voltage-dependent, L type, alpha ... [more]
cacna1da1.244e-2760.67calcium channel, voltage-dependent, L type, alpha ... [more]
cacna1da1.573e-2760.51calcium channel, voltage-dependent, L type, alpha ... [more]
cacna1da2.566e-2760.51calcium channel, voltage-dependent, L type, alpha ... [more]
back to top
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005302.16.590e-14967.34pep scaffold:Pmarinus_7.0:GL483978:134:5921:-1 gen... [more]
ENSPMAT00000007697.19.738e-8956.15pep scaffold:Pmarinus_7.0:GL478030:18311:55165:1 g... [more]
ENSPMAT00000010500.11.479e-8649.68pep scaffold:Pmarinus_7.0:GL477503:21958:35427:1 g... [more]
ENSPMAT00000007700.11.515e-8167.22pep scaffold:Pmarinus_7.0:GL478030:35286:55231:1 g... [more]
ENSPMAT00000008632.16.382e-8068.18pep scaffold:Pmarinus_7.0:GL481395:151307:166184:-... [more]
back to top
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
CCH11.016e-2221.07Voltage-gated high-affinity calcium channel; invol... [more]
back to top
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO469910.000e+051.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO368443.485e-5931.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354976.964e-5931.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO467972.556e-5730.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356613.853e-5728.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cacna1c2.149e-2154.58voltage-dependent L-type calcium channel subunit a... [more]
cacna1c2.897e-2155.05voltage-dependent L-type calcium channel subunit a... [more]
CACNA1D5.318e-13160.45calcium voltage-gated channel subunit alpha1 D [So... [more]
cacna1c1.363e-13256.84voltage-dependent L-type calcium channel subunit a... [more]
cacna1c1.677e-13056.68voltage-dependent L-type calcium channel subunit a... [more]
back to top
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000000524.16.466e-4099.11SMESG000000524.1[more]
SMESG000000524.11.962e-4699.11SMESG000000524.1[more]
SMESG000000524.12.107e-4697.81SMESG000000524.1[more]
SMESG000000524.17.067e-4097.81SMESG000000524.1[more]
SMESG000000524.11.683e-40100.00SMESG000000524.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005127 ID=SMED30005127|Name=Voltage-dependent L-type calcium channel subunit alpha|organism=Schmidtea mediterranea sexual|type=transcript|length=9129bp
AGAGAGAGAAATAATTGTTGTCTTTATTTCTTTAGCTAGCTACAGAAAAA
AGATTTGACTAGCGATTGTCATACAAAGGTAAAAAGCCACCTCTCAAGTT
GCCTAGTACTTATATACATTTATAATGAAGGCATATTAGTATCGATTATT
TGAGCACTATTTCATTCTTTGGAGATCAATAGGATTTTGTTTATTTAATC
AGATGGATATATCAATAAGGTGATGCTAAATGATAGGATTTATCCGAATA
ACATGACGGGTGGTCGTTCTGGAATAGATAATTGTCATCCTAATCAATAC
TCAGCTCCTATGCATCAATATCGGCAATTGTTTCACACAGATCAGCCATT
TTATGATTCACATACCAGAAACACCGAATACAAATGCGTGGAAAACGATT
ATATCGAGTCGAGATATCGATTCGAACCGAGAACTAATTATCAATTGAAT
TATTCCCCTCCAGGTCAGTTTGATGATGAGGAAGAGGAAGAAGAGGATGA
TAGGGATTATTTTGATAATGAGGAAGGGGTGCATGAATATTCTGATGGTG
ACGGTGATTACGGAGATCAAAACCAAAGGAGACCCCTCGTGAGCCAGCCG
GCGAAAATTAATATCGATGAAATACCTCAGTTGCAAATCTCGAGCGATCA
AAATGAACCAAACGAACCGAAATACGATTTGAATAATAATAATGTTTTTA
AAATGGACGATGATAAGTCTGCTTCATCTGTTAATGTCGTCAATAAGTCA
CCGGTTGATAAAGCCGCCGCCGTCGCCGCCGCTCCGAAATCTGTATCAAC
TAATCCGCCGGCAATTTACTCTGGTTTTGGGGGTCTTGGTAGTGGTTTAG
GTGGTGGTGGATTGGGAGGTATTCTTGGGGTTGCTGCTGCTGCGGCACAA
CAACAGGGTAGACCTTTAAATTTAGCAGCACTTACTCTTTCAGCGCAAAT
AGCAAGCGGTGGGCGCAAAAGAACTCCAGCTCGATCTCAGTCAGGCAACC
CGAGACCACAGAGAGCATTGTTCTGTTTGACTCTGAGAAATCCTTTCCGA
AAATTCTGTATAAAAATTGTCGAGTGGAAACCGTTCGAATATTTAATTTT
ATTCACAATTTTCGCCAATTGTTGCGCTTTGGCTGCAAATACTCCCTATC
CAGAAAGAGACTCCAATACAATTAATAGTGCATTAGAAAAGATTGAACTT
GTTTTCATTGTTATTTTTACAACGGAATGCGTTTTGAAAATTTTAGCGTT
CGGTTTCATAATGCACCCGGGTGCATATCTACGCAACGGATGGAATCTGT
TAGATTTTCTAATAGTGATCATCGGTTTAATCAGTACAGTTCTATCAAAA
ATGTCAGAAGGAGGTCCTGATGTAAAAGCTTTAAGAGCCTTTCGTGTTCT
TCGTCCTCTGAGACTGGTATCAGGACTTCCAAGTCTTCAGGTAGTCATGA
ATTCTATTATGCGAGCTATGGTTCCTCTGTTCCATATTGCTTTATTGGCC
TTGTTCGTGATAATCATCTATGCGATTATAGGACTAGAACTATTCTCTGG
GAAACTCCATTCTACATGTTATTCTAAAAACGACGTCATGATGGAAAGCC
CAGTGCCTTGCAGTACCTCAGTCAACAAAGGATATCAATGTGATGATTTT
CACTCATCAGGATTTAAATATATGTGCAAAGATAATAAAAATGAAACCTC
AAGATGGTCAGGACCAAACATGGGAATCACCAGTTTTGATAATTTTGGCC
TAGCAATGTTAACTGTCTTTCAATGTATCACCATGGAAGGTTGGACACAA
ATAATGTACTGGATAAATGATTCAGTTGGAATGAGCTGGCCTTGGATATA
TTTCGTAAGCCTTATCATCATAGGATCGTTTTTTGTGATGAATCTCGTTC
TTGGTGTTTTGAGTGGTGAATTTTCTAAAGAAAGAGAAAAAGCTAAAAAG
CGTGGTAAATACCAAAAAGCGAGAGAACAGATGCAATTTGATGAAGATGT
TCAAGGTTACCTGGACTGGATTGGAGCTGCAGAAGATATTAGTGATGACG
AAGAAAATGATGGAAAAGAAAATGGCAAAGAAAGTAGATTCAAACTTTGT
GGACTTTGCAAGAGTTCAGAAAAAAGCGATGATGGCGATGATCAATTATC
AGACAAATTGGACCTTGAAACCGAAGGTGGTGCACATCATTCACAACAGC
AACAATACGTTTTCTGTTTCCCCCTTAAAAGTCGAAGAGGGAGAAAATGG
AATAGACGTTGCAGGAGGATTTGTAGGCGTTTAGTCAAGTCACAAGCGTT
TTATTGGGTCGTAATAGTTCTTGTTTTTCTAAATACAGGAGTTCTTACCA
GTGAACATTATAGGCAAAGCATTTGGCTAGATTCTTTTCAAAATACTGCA
AATATAATTTTCGTTGTCTTGTTTACTTTGGAAATGCTAATAAAAATGTA
CAGCCTAGGAATGCGGTGTTACTTTGACTTCATGTTCAATAGATTTGACT
TCTTTGTTGTCATCTTCAGTATCCTAGAAATTGTGATGATACAGACGGAT
GCCATGCCTCCTTTGGGCGTATCAGTCTTGCGTTGTGCTAGACTTTTAAG
AGTCTTTAAAGTGACAAGATATTGGTCAAGCTTGAGAAATCTTGTTGGAA
GTCTGCTTGCTAGTATGAAGTCAATTGTCAGTCTGTTGGTGCTCTTATTT
CTGTTTATTGTCATTTTTTCATTACTCGGCATGCAATTATTTGGGGGGAA
ATTCAATTTTGATAAAAAGGCTAAACCCAGATCAAATTTTGATAGCTTCG
TTCAATCATTACTCACAGTGTTTCAGATTCTAACCGGAGAAGACTGGAAT
GAGGTCATGTATGACGGAATAAGAAGTTATGGAAATTTAGGGAAATCTTC
AATGCTGAGTTGCCTATATTATGTCATTCTTTTTATTTGCGGAAATTACA
TTCTACTAAATGTGTTCTTGGCTATCGCTGTTGACAACTTGGCTGACACT
GGGTCTGGAAACAAGGAGGAAAAGAAAGAAGGAGAAAATGAAGAAGGTGA
GCCAACTAATGTTGATGGCGAGGAAGCGAAAGCATGCAACTCAAGTAATG
TTTCTCCAAATATTGATGAGAAAACAAGGTTTACAGACGCAGAACGGCTG
ATTAAATCCGAGGAGATGAATGGAGATATTGCGGATGAATCGATGAGGAA
AATGAGCACAAGAATAGACACAGAAAAGGAAAATGATGAAGAATACGCTG
AAGGTGACGAAGAAGATGAAGAAAATGGGCAGACTAGCGCTATTAGGCGA
GTTTCTGAAGTGATGGCAAAAGAGAAAATTAAACCGATTCCGAACGCATC
TTCATTCTTTATATTCGGTCCAAACAACAAGTTTCGGAAGTTTTGCCATT
TCATTTGTAACCATCCTCATTTTGGCAACATTGTTCTCGTTTGCATCATG
GTCAGCAGTGCCATGTTGGCGGCAGAGGATCCCCTAGACGCCGAATCCTC
AAGGAATAGGATTTTAAACTACTTCGATTATTTATTCACATCAGTTTTCA
CTGTTGAGATCACATTAAAGGTTATTACCTACGGCTTAGTTTTTCACAAT
GGCGCCTTCTGTCGCAGCAGTAATAATATTCTAGACTTATTAGTTGTCCT
TACCTCAATTATCTCCTACCCCATCAATAATGATGCAATATCAGTTGTCA
AGATTCTTCGTGTCTTGCGAGTCCTAAGACCACTAAGAGCTATTAATAGA
GCAAAAGGCCTAAAGCGAGTAGTCCAATGTGTCGTTGTCGCAGTGAAAAG
TATCGGAAACATTATGCTCGTAACATTTCTTCTTGAATTCATGTTTGCGG
TCATTGGAGTTCAGTTGTTCAACGGTAAGTTCCAATCTTGCAATGATGTA
TCGAAAAACACACACATTTCTTGCAGAGGACAGTATATCTACTACAATGA
AGCAGATATAGCAAAAGTATTTGTAAACAAAAGAGAATGGATAAACAACC
CGCTTAATTTTGATAATGTACCAAATGCTATGTTAACCCTTTTTGCAGTT
TCAACATTCGAGGGTTGGCCGGGCGTATTATATAAGTCCATTGATTCATT
CAAAGAAGATTACAGTGGAATATACAACAACAGGCCGATCGTGTCGATAT
TCTACATCGCTTACATAATTGTGATAGCCTTTTTTATGATAAATATATTT
GTTGGTTTTGTCATTGTCACTTTCCAGCAAGAAGGCGAAGAAGAATACAA
AAACTGTGAATTAGATAAGAACCAAAGAAAATGCATAGAATTTGCTTTGA
AAGCTAAACCAGTTCGTCGATACATTCCAAAACAAAGTTTTAGGTATCGA
GTATGGTGGCTGATAACTTCCAGACCTTTTGAGTACATAATCTTTGTACT
GATCATGCTCAACACAATTTCCCTTGCTCTTAAATTCGACAAGCAGCCTC
AAAGATATGAACAGGTCATGGATTATTTAAACATGGTGTTTACTGGAGTC
TTCACGGTGGAGTTTTTATTGAAACTTGCAGCATTTGGGTTCAAGAACTA
CTTCAGTGATGCTTGGAATGTATTCGATTTTATCATTGTGCTCGGTAGTT
TTATCGACATTATTTATGACCATGTCAATGGAACCAACAATAATCATCGA
GGAGACCGACTGATTTCAATTAATTTCTTTCGATTGTTTCGAGTCATGAG
ATTGGTAAAACTGTTGAGTAGAGGAGAAGGCATAAGGACCTTATTATGGA
CATTTGTAAAGTCATTTCAAGCCCTTCCATATGTTGCACTTCTAATCGTA
ATGCTGTTTTTCATTTACGCTGTCATTGGTATGCAAATGTTTGGAAAGAT
CACTACAGAAAATGAAAAGGAAATGAAAGAAATTAATCGAAATAATAATT
TCCAAACCTTTCCCCAAGCTATTTTGGTATTGTTTAGATCTGCAACTGGT
GAAGCGTGGCAAAATATTATGCTTCATTGTCTTCCAGATGCTATGTGTGA
TGCTCTTTCGGATCAAATTAGAAAGGAATACTACAATCTCACAGTCATGA
GAGCTAGACAAGCAGGAAATTTGGGTTTTAATGATTCTATGGTCATTTGG
CCCCCCCACAACTTTGTGAAGGTCAAAATTAATAAATATATATCGCATTA
TCAAGACGTTGCAAAATGCGGCTCGAATTTTGCATATCCTTATTTTATTT
CTTTCTACATGATATGCTCGTTTTTGATAATAAATTTGTTTGTTGCTGTC
ATAATGGACAATTTTGACTATCTGACTCGTGATTGGTCAATTCTTGGACC
GCATCATCTCGACGAATTCGTACGGCTATGGTCCGAATATGATCCAGAAG
CTAAGGGGCGAATTAAGCATCTTGATGTCGTCACTCTACTTAGGAAGATA
AATCCACCATTGGGATTCGGAAAATATTGCCCTCACAGAACGGCTTGCGT
TACATTAGTGAGAATGAATATGCCACTAAACAGCGACGGCACCGTCATGT
TCAATGCCACTCTGTTTGCATTGGTTAGAACAAATCTAAAAATAAAAACA
GATGGTTCAACTGTCGATCAGCTGAATGAAGAATTGCGAGTAGTCATTAA
AAAGATTTGGAAAAGAACCAGCCAAAAGATGCTAGATCAAGTTGTTCCAC
CAGCTGGAAACGATGATGTTACTGTTGGGAAATTCTATGCCACTTTCCTA
ATACAAGAATGGTTTAGAAGGTGGAAACAAAAAAGAAATGAAGAACAGAA
AGGAATGGCCTATTCTCAGAGCAAACGTCTTTCATTAATGCCTTTTAGAA
CTCATGGGAGAGGTAGTGGCCCGTTAATTTCTCTCATTTCTCCAACATTG
GTCACTACAAATGAATGCGACGAGAAAGATAAAGATTATCTTCCTTCTCA
TTTAGGAGCTGAACGGAGAACTCATAGTATATTTGGTACAATGATGAATG
TTCTTCAAAGAGTTGGAAGCACAAGGCGAGACTCAAATGCATCGCCAAGT
ACTGGCAGTATCAATCATTCGACAGAATTACCTCGCGATCGCAGCAACAG
TCGTCCAATGATACTTAATCAATCGAAAAGCCCAACAAATCATCCACCAG
TTAAACTTACCTTGGCACCAGTTATAGAAGGTCAAGTAATATCGAATGAA
GAGTATTCTGCAGAAATACCTCCGAAACTCCCTAAAACCGTATCAAAGCA
ATCATTGAATTATGATAAGAAACCTCTCACCAGTAAACAACCACGAGTGG
AATATACTATGCGAGATAAGCTTTCACTCAGATCTCCGCCCTTAGATATA
GATTTACCATTACTCAGAAGTAATGTCTTCCCAAGGCCTTCAAGAAGTCA
ATCCTCAGAGAGTCCTGAAAGCATTCAACGAAAAGAAGAAAAAGTTGTCA
GTCCGGTGTACAGTTCCGGCTATTCGGATGAGGAAGACCGTATAAGTACA
GAAAGTTTAATCTATGTTCGACGCAAAAGCAAAGACCGCTACAAAGGTCA
ATCATCGCATAATCGAATCGGAACAGTTCGTCCATCAAACATTGATTCGA
GAAGATATAGCAACAAAGAAAGAGTTACCAATAATCAGGATATCAGATAT
TACAAGGGGTCCCCAAATGAATACTCTGCCCAGTCATCTGCTGAATCATC
AGAAATTCAATTCTATCCTCAAAATATTCCATCAAATCGTTGTAGCAATG
TACAAATCATTGATTTGGATATATCTCTTTCGTCTTCGCAGGACAATGGA
GACGAATTTGAATATGAAGGTGGCGAGGAAGAAGCTTTTATCTATCCTCT
AAGCCGAGGTGACACCCCTAGTCCAGCCCCTCCACCACCAACTGCTCATC
AGCGATATCAAAGCTCGTCTAGAACCAGCTCATCAATGGGACAATGTTTA
GGAAGACAATCTTCAAGGGAATCTTTAATTGACAGAGGACTAGTGCAACC
TATTTTATTTGCTCAAAATCAGGCAGTGCTTCTTGCTGGAATTGGCGACT
GTAAACAATTCGTAAACACATCCCTACGAAGACGTTTACCGGACACTCCT
CAATTTCCAGCTGGTAAAGAAAGTGTTCCATTTAACCCCTACGAGAAGTC
AATCGCTAATCAGTTACGAAACATTAGAAAATCGAAAATTGTCAACGTTC
CAAAACTAAAATATCACCAAGAACTAATTGATAACTCTCAATTCCCAAAT
GAATCTGATAATGAGTCCTACAGTGCTGACATTGCTGGCCTTGGTACATT
CAACCTAGAAGAATGGCGAAACAGTCCGCCGCCAACTCCAGCACCTAATA
CGAACCTGCGCTATTGTCCACAACGGTCAAATAAGGAAACATTTAGGCAA
GAGCATCAGAAAAATAATTTTAACCGATACGATTCTCTTAGACAGCCAGA
GAGATCATCTTACTTATTACACCATCAATGCTCTTTGGAAGAGGAACAAA
TTGATTCTACTGAGGATTATGATGAAGAAATTGATCAACTTAAGATTCAG
AATCAATATGAGAAAGATTATAATAGATATATGTTGAAATATGCACCTTC
AAATCCACGATCACAGTTCGTGGATCCAAGAAATTGCTGTGCTGATCCAC
GCGTGTCTCGGAATCCAATGCCTGATTTGATATCCAGCACTGATTGGTTA
CTTGAGAAATGTCAAAATGCGCCCGCAATGAAAAATCATACGTATCAGAA
GAATTACAAATATCCTCAACTACTAACTGAAGAAACATTTTCACGGAGAG
CTCGAATGGATGCTAATTCACCTCCTCCTGAGCCTGCTCCTCGACAAGAG
CTTCCATCCCAATACGTATTATCCCAGCAAAGAGAATCTGACGAAATGGA
ATATCTACAAATGTCACAAGAAAATATCGACAAGTCTTTCACAAACCTAC
GCACTCGCAGCAAGCAATACAGTGATATGGGTTCTCAAACTCATCTTGAA
ATGAGCGAACCTCTATTAAAACAGTCCATTCCTAACCACCTGTTGTCCAA
GTCTATCAATCCGGTGTTCAGTCCACCTATTCGACCTCCATATTATGAAC
ATTTGGGCGGTTATGGTCTTCACGAATTGAAGGATTCAAACGTTTGGAGT
ATGAGAGATGAAAACATGTCATCAATTCTCAGTCGAGGCGCGACAGTAAG
ACCCTTTCACCCGCATGGCACTAAAGGCGTTATGCGAACTCATAACAATA
GTAGTAATAGTAGTAATAATAATAATGCTAATAACAATAGTAACAATGCC
ACCATTCGAAACCAGTGTGAAATGCAAATGAAATTGCCCCCACCTCAAGA
TTTATTAACAAACAGAAAACCATCAGAAAAAGCTACATATTTTCTTTCAG
TTGTTTAAATGAAATGAACATTTATCCTAGATCTCTCATAAAGTTTGCAA
TTACTCCTAAATCTAGTCTGTTTTTAGAAAGTATTGTTTTTTACAATGCA
TATGTATATATATATATCATATTTATATTATTATTATTATTATAAATGAA
CACCAAATGCAATAACAGAATAATAAATTTATTTGCATACTAAAATCAAA
GAGCAAGTCTAACACTTTCTAATCGCCGTATTAGAGAATGTTTATTATAC
TAGTCAACTTGGAATCCTTGGATCTTTATTTTGGCATACCAGTTGTCATT
CTACTTGAACATAATTTCTTGAAAAGCATCATAAAATCTATCTTGAAAAA
CACTGTTAAAGTCACTGGGATATTGTTATTTATTTTCATAAACATCTTTA
GAACCTCAATATCTTCTGTTTACAAAGTTGCCATTAGATGTGGATAAGGA
GTTTTACATTGGATCTTCTGAAATACATTTTGAAAAATGGAAAAGTTGCT
CTGATTGTAGATTAACCGGTTTTTTGCAATTTTGTTTTCACTTATTTTCT
TTGTCATTTTGAAATTATAAAGAAAAAAAAGAAAATCAACTTATATGGAG
CCCCCTCCCAATTTTAGTCGGGAAAAAGAGTTCACAAAAATCGCATGAGA
AAGTGACGTCAATATCTTTTCCCTGGTTTGTGAGAGAATTGCAGAAGATG
ACAATCACTCTCTCTCGTGATAATTGCCATCTGTTATTAATAATTTAAGT
ATCGCACAGCCTCAGCTATTAAAGTACTC
back to top

protein sequence of SMED30005127-orf-1

>SMED30005127-orf-1 ID=SMED30005127-orf-1|Name=SMED30005127-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2712bp
MLNDRIYPNNMTGGRSGIDNCHPNQYSAPMHQYRQLFHTDQPFYDSHTRN
TEYKCVENDYIESRYRFEPRTNYQLNYSPPGQFDDEEEEEEDDRDYFDNE
EGVHEYSDGDGDYGDQNQRRPLVSQPAKINIDEIPQLQISSDQNEPNEPK
YDLNNNNVFKMDDDKSASSVNVVNKSPVDKAAAVAAAPKSVSTNPPAIYS
GFGGLGSGLGGGGLGGILGVAAAAAQQQGRPLNLAALTLSAQIASGGRKR
TPARSQSGNPRPQRALFCLTLRNPFRKFCIKIVEWKPFEYLILFTIFANC
CALAANTPYPERDSNTINSALEKIELVFIVIFTTECVLKILAFGFIMHPG
AYLRNGWNLLDFLIVIIGLISTVLSKMSEGGPDVKALRAFRVLRPLRLVS
GLPSLQVVMNSIMRAMVPLFHIALLALFVIIIYAIIGLELFSGKLHSTCY
SKNDVMMESPVPCSTSVNKGYQCDDFHSSGFKYMCKDNKNETSRWSGPNM
GITSFDNFGLAMLTVFQCITMEGWTQIMYWINDSVGMSWPWIYFVSLIII
GSFFVMNLVLGVLSGEFSKEREKAKKRGKYQKAREQMQFDEDVQGYLDWI
GAAEDISDDEENDGKENGKESRFKLCGLCKSSEKSDDGDDQLSDKLDLET
EGGAHHSQQQQYVFCFPLKSRRGRKWNRRCRRICRRLVKSQAFYWVVIVL
VFLNTGVLTSEHYRQSIWLDSFQNTANIIFVVLFTLEMLIKMYSLGMRCY
FDFMFNRFDFFVVIFSILEIVMIQTDAMPPLGVSVLRCARLLRVFKVTRY
WSSLRNLVGSLLASMKSIVSLLVLLFLFIVIFSLLGMQLFGGKFNFDKKA
KPRSNFDSFVQSLLTVFQILTGEDWNEVMYDGIRSYGNLGKSSMLSCLYY
VILFICGNYILLNVFLAIAVDNLADTGSGNKEEKKEGENEEGEPTNVDGE
EAKACNSSNVSPNIDEKTRFTDAERLIKSEEMNGDIADESMRKMSTRIDT
EKENDEEYAEGDEEDEENGQTSAIRRVSEVMAKEKIKPIPNASSFFIFGP
NNKFRKFCHFICNHPHFGNIVLVCIMVSSAMLAAEDPLDAESSRNRILNY
FDYLFTSVFTVEITLKVITYGLVFHNGAFCRSSNNILDLLVVLTSIISYP
INNDAISVVKILRVLRVLRPLRAINRAKGLKRVVQCVVVAVKSIGNIMLV
TFLLEFMFAVIGVQLFNGKFQSCNDVSKNTHISCRGQYIYYNEADIAKVF
VNKREWINNPLNFDNVPNAMLTLFAVSTFEGWPGVLYKSIDSFKEDYSGI
YNNRPIVSIFYIAYIIVIAFFMINIFVGFVIVTFQQEGEEEYKNCELDKN
QRKCIEFALKAKPVRRYIPKQSFRYRVWWLITSRPFEYIIFVLIMLNTIS
LALKFDKQPQRYEQVMDYLNMVFTGVFTVEFLLKLAAFGFKNYFSDAWNV
FDFIIVLGSFIDIIYDHVNGTNNNHRGDRLISINFFRLFRVMRLVKLLSR
GEGIRTLLWTFVKSFQALPYVALLIVMLFFIYAVIGMQMFGKITTENEKE
MKEINRNNNFQTFPQAILVLFRSATGEAWQNIMLHCLPDAMCDALSDQIR
KEYYNLTVMRARQAGNLGFNDSMVIWPPHNFVKVKINKYISHYQDVAKCG
SNFAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFV
RLWSEYDPEAKGRIKHLDVVTLLRKINPPLGFGKYCPHRTACVTLVRMNM
PLNSDGTVMFNATLFALVRTNLKIKTDGSTVDQLNEELRVVIKKIWKRTS
QKMLDQVVPPAGNDDVTVGKFYATFLIQEWFRRWKQKRNEEQKGMAYSQS
KRLSLMPFRTHGRGSGPLISLISPTLVTTNECDEKDKDYLPSHLGAERRT
HSIFGTMMNVLQRVGSTRRDSNASPSTGSINHSTELPRDRSNSRPMILNQ
SKSPTNHPPVKLTLAPVIEGQVISNEEYSAEIPPKLPKTVSKQSLNYDKK
PLTSKQPRVEYTMRDKLSLRSPPLDIDLPLLRSNVFPRPSRSQSSESPES
IQRKEEKVVSPVYSSGYSDEEDRISTESLIYVRRKSKDRYKGQSSHNRIG
TVRPSNIDSRRYSNKERVTNNQDIRYYKGSPNEYSAQSSAESSEIQFYPQ
NIPSNRCSNVQIIDLDISLSSSQDNGDEFEYEGGEEEAFIYPLSRGDTPS
PAPPPPTAHQRYQSSSRTSSSMGQCLGRQSSRESLIDRGLVQPILFAQNQ
AVLLAGIGDCKQFVNTSLRRRLPDTPQFPAGKESVPFNPYEKSIANQLRN
IRKSKIVNVPKLKYHQELIDNSQFPNESDNESYSADIAGLGTFNLEEWRN
SPPPTPAPNTNLRYCPQRSNKETFRQEHQKNNFNRYDSLRQPERSSYLLH
HQCSLEEEQIDSTEDYDEEIDQLKIQNQYEKDYNRYMLKYAPSNPRSQFV
DPRNCCADPRVSRNPMPDLISSTDWLLEKCQNAPAMKNHTYQKNYKYPQL
LTEETFSRRARMDANSPPPEPAPRQELPSQYVLSQQRESDEMEYLQMSQE
NIDKSFTNLRTRSKQYSDMGSQTHLEMSEPLLKQSIPNHLLSKSINPVFS
PPIRPPYYEHLGGYGLHELKDSNVWSMRDENMSSILSRGATVRPFHPHGT
KGVMRTHNNSSNSSNNNNANNNSNNATIRNQCEMQMKLPPPQDLLTNRKP
SEKATYFLSVV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000099neuron
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR005446VDCC_L_a1su
IPR002077VDCCAlpha1
IPR014873VDCC_a1su_IQ
IPR031649GPHH_dom
IPR005821Ion_trans_dom
IPR027359Volt_channel_dom_sf
Vocabulary: biological process
TermDefinition
GO:0070588calcium ion transmembrane transport
GO:0006811ion transport
GO:0055085transmembrane transport
GO:0006816calcium ion transport
GO:0034765regulation of ion transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0005245voltage-gated calcium channel activity
GO:0005216ion channel activity
GO:0005244voltage-gated ion channel activity
GO:0005262calcium channel activity
Vocabulary: cellular component
TermDefinition
GO:0005891voltage-gated calcium channel complex
GO:0016020membrane
GO:0016021integral component of membrane