G_PROTEIN_RECEP_F1_2 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F1_2 domain-containing protein
Smed IDSMED30005123
Length (bp)1507
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30005123) t-SNE clustered cells

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30005123) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30005123) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30005123) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005123

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30005123SMESG000074473.1 SmedASXL_009404SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30005123SMESG000074473.1 dd_Smed_v6_20444_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30005123SMESG000074473.1 OX_Smed_1.0.15109ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A5J4N8C8 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0012780 PE=4 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 1.073e-25
Identity = 97/347 (27.95%), Postives = 169/347 (48.70%), Query Frame = 1
Query:  247 LFVFWHQPKLSMMRVTLILLSISETLFHSFLILNFI-SLEFLSAKYFLNETPSYWHLYIAPRISATTMVILHVFISARNWCNLIISMSRTEAVLYPLKSRRLFRHSMIYFIYFFTTFVAIVFSILR-HLDFAV----TICISSQYYVTESNF------FSSKTTSVFLIIYFILQTGIPWXXXXXXXXXXXXXLGRFHSDQLL-SNPVSQRNQKVAIRTVLLLAIIFSLCELPNLISSFIMNLNNFLNYDFTKRETLEILSNAGNTLVILDSVFNFFVYVTSLPYFRRKLLDLIKCRICIATRNFSLIYENTWRSTVDRTGRPQYTNINNKPDFKQIDHKKCQKNSV 1248
            ++VF    + S+MR +L+LLS +E +FH F  ++++  L F +        P+          +A   +    F+  RNWCN++I+ +RTE ++ PL++RR F    I FIY    F +   S++R   ++A+    ++ IS Q+Y+   +F      F+    +     +FI Q  +P + V++ ++ +   +  +    +L +  + +R+Q  A RTVLL+A+ F  C++P  I   + N  +FL        T+ I     + L++LDSV +  +Y   LP FR  L  L  CR    +R  + + +NT  +  D   R  YTN    P F   + +   KN V
Sbjct:   52 MYVFARHNRRSVMRSSLLLLSATEVVFHLFFSIDYMMRLGFCT-------IPTTQDSLARVMAAAAINLGSDTFLCTRNWCNVLITSARTEVIVVPLRTRRYFTRKSIVFIYALVLFSSFGLSLVRVFYEYALVCQPSVSISKQHYMEIRSFDLLPRHFADHYDAY---CFFIYQVILPVLLVLSMSITIASYVSPWRQSAILEATSIRRRHQMNATRTVLLMALTFLCCQMPTFIFVILDNYTDFLGNRTGTDLTMNIAHVIADVLLLLDSVTSILIYSYKLPGFRNHLFCLRGCR----SRGDNQLVDNTELTVQDGPCRLPYTNSARTPSFPTSNKQITDKNDV 384          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A183VRB0 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS3016 PE=4 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 3.807e-23
Identity = 96/307 (31.27%), Postives = 144/307 (46.91%), Query Frame = 1
Query:  205 LCLSIIALILNSFSLFVFWHQPKLSMMRVTLILLSISETLFHSFLILNFISLEFLSAKYFLNETPSYWHLYIAPRISATTMVILHVFIS--------ARNWCNLIISMSRTEAVLYPLKSRRLFRHSMIYFIYFFTTFVAIVFSILRHL-DFAVTICISSQYYVTESNFFSSKTTSVFLIIYFILQTGI-PWXXXXXXXXXXXXXLGRFHSDQLLSNPVSQRNQKVAIRTVLLLAIIFSLCELPNLISSFIMNLNNFLNYDFTKRETLEILSNAGNTLVILDSVFNFFVYVTSLPYFRRKLLDLIKC 1095
            L LSIIALILN+  + VF  Q + S+MR +L++LS +E LFHSF+ + + +       + ++ +P        PR+   T  I    I+         RNWCN++I+ +RTE V+YP++ RRL  HS I  IY F   ++    I+R   D+A+ IC  +  Y+          T + LI+ FI+   + PW                  S  +    V +RNQ  A RT+L LAI F   + P+ I   I +    +  DF       +     + L+  DSV N  +Y   LP FR  L  +  C
Sbjct:   33 LVLSIIALILNTLCISVFTRQHRKSVMRTSLLVLSATEVLFHSFVCIEYTT-------HLISSSP-------GPRMITVTEFIFFALINWGSDCSLCTRNWCNVLITSARTEVVVYPMRKRRLLSHSSIKIIYGFLWILSGFLGIVRAFYDYAI-ICAPTNDYMDS----VIAPTLIVLIMSFIISFYVSPWR----------------DSKIIEVTNVRRRNQMKATRTILFLAISFLCFQTPSFILVIIQHYTTVM-IDF------HLAKLVADLLLTFDSVINIMIYAIGLPGFRIYLNRMFTC 297          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A4Z2DL27 (Rhodopsin-like orphan GPCR OS=Schistosoma japonicum OX=6182 GN=EWB00_011285 PE=4 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 4.821e-21
Identity = 100/337 (29.67%), Postives = 158/337 (46.88%), Query Frame = 1
Query:  205 LCLSIIALILNSFSLFVFWHQPKLSMMRVTLILLSISETLFHSFLILNFISLEFLSAKYFLNETPSYWHLYIAPRISATTMVILHVFIS--------ARNWCNLIISMSRTEAVLYPLKSRRLFRHSMIYFIYFFTTFVAIVFSILRHL-DFAVTICISSQYYVTE---------------SNFFSSKTTSV---------FLII------YFILQTGIPWXXXXXXXXXXXXXLGRFHSDQLLS-NPVSQRNQKVAIRTVLLLAIIFSLCELPNLISSFIMNLNNFLNYDFTKRETLEILSNAGNTLVILDSVFNFFVYVTSLPYFRRKLLDLIKC 1095
            L LSIIALILN+  + VF  Q + S+MR +L++LS +E LFH F+ + + +    S+                PR+ + T  IL   I+         RNWCN++I+ +RTE V+YP++ RR+  HS I FIY F   ++    I+R   D+A+ +C     YV +               SN F   T +V         ++II      +FI Q   P + V+  + I+   +  +   +++    V +R+Q  A RT+L LAI F   + P+ I   I +  N L  +F      ++     + L+  DS+ N  +Y   LP FR  L  +  C
Sbjct:   33 LVLSIIALILNAICISVFSRQHRKSVMRTSLLVLSATEVLFHLFVCIEYTTQLICSSN---------------PRMISATEFILFALINWGSDCSLCTRNWCNVLITSARTEVVVYPMRKRRILSHSSIKFIYGFLWILSGFLGIVRAFYDYAI-VCNQKNDYVNDMSISSVNTPLLSLPISNDFIDSTKTVTYIDALLDQYVIINYEAYCFFIFQVIAPTLIVLIMSFIISFYVSPWRDTKIIEVTNVRRRHQMKATRTILFLAISFLCFQSPSFILVIIQHYTN-LKIEF------QLAKLVADLLLTFDSIINILIYAIGLPGFRDYLNRMFIC 346          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A448XC23 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS26552 PE=4 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 6.837e-20
Identity = 87/320 (27.19%), Postives = 157/320 (49.06%), Query Frame = 1
Query:  181 LNAIQINFLCLSIIALILNSFSLFVFWHQPKLSMMRVTLILLSISETLFHSFLILNFISLEFLSAKYFLNETPSYWHLYIAPRISATTMVILHV--FISARNWCNLIISMSRTEAVLYPLKSRRLFRHSMIYFIYFFTTFVAIVFSILR---------HLDFAVTICISSQYYVTESNFFSSKTTSVF-LIIYFILQTGIPWXXXXXXXXXXXXXLGRFHSDQLL-SNPVSQRNQKVAIRTVLLLAIIFSLCELPNLISSFIMNLNNFLNYDFTKRETLEILSNAGNTLVILDSVFNFFVYVTSLPYFRRKLLDLIKCRI 1101
            L A ++  L  S++ALI N+F + VF  Q + S+MR  L+LLS +E  FH  L ++++ ++F+ +   + E P+   L  A R     +++      +  RNWCN++I+ +R+E V++PL++R+ F  + I   Y +  F++ + S++R         HL     I +    +    N        ++    +FI QT +P + V T + ++   +  +   ++  +N   +R+Q  A +T+LLLA +F L + PN I  F+    N L  ++       +     + L+  DS+ N  VY   L  FR  L     CR+
Sbjct:   37 LPASKVLALTFSLLALITNAFCMNVFLQQRRKSVMRTNLLLLSFTEVCFHLCLSMDYV-VQFVVSSVEI-EKPNAMKLGPAHRYIFYALIVFGSDFTLCTRNWCNVLITSARSEVVVFPLRARKCFARNRILTYYLYLIFISCLASLVRVFYERIIVCHLRPEQIIVLGGTTWTELGNLMREDIIGLYEKYGFFIYQTMVPLLVVTTLSGMIACYISPWRKPEIATANVARRRHQMKATKTILLLASLFCLFQTPNFIFVFLSYHTNLLESNW-HNNVRTMWVTVADLLLTCDSICNIIVYAQGLTDFRHHL----HCRL 349          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: H2KR47 (Rhodopsin-like orphan GPCR OS=Clonorchis sinensis OX=79923 GN=CLF_105432 PE=4 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 7.202e-20
Identity = 94/364 (25.82%), Postives = 164/364 (45.05%), Query Frame = 1
Query:  235 NSFSLFVFWHQPKLSMMRVTLILLSISETLFHSFLILNFISLEFLSAKYFLNETPSYWHLYIAPRISATTMVIL-----HVFISARNWCNLIISMSRTEAVLYPLKSRRLFRHSMIYFIYFFTTFVAIVFSILRHLDFAVTICISSQYYVTESNFFSSKTTSVFLII----------------YFILQTGIPWXXXXXXXXXXXXXLGRFHSDQLL-SNPVSQRNQKVAIRTVLLLAIIFSLCELPNLISSFIMNLNNFLNYDFTKRETLEILSNAGNTLVILDSVFNFFVYVTSLPYFRRKLLDLIKCRICIATRNFSLIYENTWRSTVDRTGRPQYTNINNKPDFKQIDHKK-CQKNSVHEI 1257
            N+  + +F  Q + S+MR++L+LLS +E +FH F  L++      + +  +   P        P I  T M  L       FI ARNWCN++I+ +RTE +++PL+SRR F       IY F   +A + + +R       IC              + T S+ L I                YFI Q  +P + V+T + I+   +  +   ++L ++ + +R+Q  A RTVL++A+ F   ++P+ +   + N    ++ +       +I     +TL++LDSV N  +Y   +P FR +L        C   R     +  T  + +D   +   T +   P F+    K+ C +   HE+
Sbjct:   47 NATCMSIFAQQNRQSVMRISLLLLSATEVVFHLFFCLDY------AMRIAVCSIPIE-----KPTIMTTVMSALINFGGDAFICARNWCNVLITAARTEVIVFPLRSRRYFTRRSTVLIYVFLLTLACMLASVRAFFDQAGIC-----------HVGNNTESLNLEILPLMPSHVIKHYEAYGYFIYQIILPILLVLTMSTIICTYVSPWCQAEILEASTIRRRHQMNATRTVLIIALTFLSFQMPSFVFVILHNYTGIISQETDSVFRFKIAQALADTLIVLDSVINILIYSFKIPGFRNQL--------CCFQRG----HAATDETRLDFITKDGVTRLTYTPSFRSTQKKRTCSEVDHHEL 376          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000074473.1 (SMESG000074473.1)

HSP 1 Score: 780.785 bits (2015), Expect = 0.000e+0
Identity = 401/404 (99.26%), Postives = 401/404 (99.26%), Query Frame = 1
Query:   76 MKTNLTEYIFTLKEVIVIYSDRNCSKPQISQEKPVLNAIQINFLCLSIIALILNSFSLFVFWHQPKLSMMRVTLILLSISETLFHSFLILNFISLEFLSAKYFLNETPSYWHLYIAPRISATTMVILHVFISARNWCNLIISMSRTEAVLYPLKSRRLFRHSMIYFIYFFTTFVAIVFSILRHLDFAVTICISSQYYVTESNFFSSKTTSVFLIIYFILQTGIPWXXXXXXXXXXXXXLGRFHSDQLLSNPVSQRNQKVAIRTVLLLAIIFSLCELPNLISSFIMNLNNFLNYDFTKRETLEILSNAGNTLVILDSVFNFFVYVTSLPYFRRKLLDLIKCRICIATRNFSLIYENTWRSTVDRTGRPQYTNINNKPDFKQIDHKKCQKNSVHEILCQENFITQV 1287
            MKTNLTEYIFTLKEVIVIYSDRNCSKPQISQEKPVLNAIQINFLCLSIIALILNSFSLFVFWHQPKLSMMRVTLILLSISETLFHSFLILNFISLEFLSAKYFLNETPSYWHLYIAPRISA TMVILHVFISARNWCNLIISMSRTEAVLYPLKSRRLFRHSMIYFIYFFTTFVAIVFSILRHLDFAVTICISSQYYVTESNFFSSKTTSVFLIIYFILQTGIPWVSVITSTVIMIIVLGRFHSDQLLSNPVSQRNQKVAIRTVLLLAIIFSLCELPNLISSFIMNLNNFLNYDFTKRETLEILSNAGNTLVILDSVFNFFVYVTSLPYFRRKLLDLIKCRICI TRNFSLIYENTWRSTVDRTGR QYTNINNKPDFKQIDHKKCQKNSVHEILCQENFITQV
Sbjct:    1 MKTNLTEYIFTLKEVIVIYSDRNCSKPQISQEKPVLNAIQINFLCLSIIALILNSFSLFVFWHQPKLSMMRVTLILLSISETLFHSFLILNFISLEFLSAKYFLNETPSYWHLYIAPRISAATMVILHVFISARNWCNLIISMSRTEAVLYPLKSRRLFRHSMIYFIYFFTTFVAIVFSILRHLDFAVTICISSQYYVTESNFFSSKTTSVFLIIYFILQTGIPWVSVITSTVIMIIVLGRFHSDQLLSNPVSQRNQKVAIRTVLLLAIIFSLCELPNLISSFIMNLNNFLNYDFTKRETLEILSNAGNTLVILDSVFNFFVYVTSLPYFRRKLLDLIKCRICITTRNFSLIYENTWRSTVDRTGRSQYTNINNKPDFKQIDHKKCQKNSVHEILCQENFITQV 404          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000003710.1 (SMESG000003710.1)

HSP 1 Score: 184.882 bits (468), Expect = 1.640e-53
Identity = 132/376 (35.11%), Postives = 210/376 (55.85%), Query Frame = 1
Query:  118 VIVIYSDRNCSKPQISQEKPVLNAIQINFLCLSIIALILNSFSLFVFWHQPKLSMMRVTLILLSISETLFHSFLILNFISLEFLSAKYFLNETPSYWHLYIAPRISATTMVILHVFISARNWCNLIISMSRTEAVLYPLKSRRLFRHSMIYFIYFFTTFVAIVFSILRHLDFAVTICISSQYYVTESNFFSSKTTSVFLIIYFILQTGIPWXXXXXXXXXXXXXLGRFHSDQLLSNPVSQ--RNQKVAIRTVLLLAIIFSLCELPNLISSFIMNLNNFLNYDFTKRETLEILSNAGNTLVILDSVFNFFVYVTSLPYFRRKLLDLIKCRICIATRNFSLIYENTWRSTVDRTGRPQYTNINNKPDFKQIDHKKCQK 1239
            V ++ S  NC+   + +E P     + + + +S IAL+LN FSL +F+ Q   S+MR +LILLS++E +FH+   +N+  L ++++ +   +    W   I         +++ VF+S+RNWCNL+IS SR EA+ +PLK+R+LF  S I  + FF   +A V S +R+LD+ + +C   +       F +  T     I+YF LQ+GIP   VI+ T I+I VL    S+  L N   Q  RNQ  AIRTVL LA++FSL ELPN    F++ +++         E     ++ GNT+V+LDS+FNF VY  SLPYFR  +  L++C+     R    ++   ++    ++   Q   IN+ P F+  +H+  ++
Sbjct:    9 VFIVKSFLNCTDGFV-EEAPARFTAETHEIVMSFIALVLNIFSLIIFYFQKNKSIMRTSLILLSVTEIMFHTCNQVNYFFL-YVNSLFVPRKN---WEKIIVAEFFGVLSLLIDVFVSSRNWCNLVISASRAEAIAFPLKTRKLFNQSRIVMMIFFAGSMASVISFMRYLDYKLAVCQYPRLQTKLETFLTMSTKRKIDIVYFTLQSGIPCFIVISCTGIIITVLCT-KSNNNLPNFCQQRRRNQYFAIRTVLSLAVLFSLFELPN----FVITVSSM--------EQDSKTTSIGNTMVVLDSIFNFIVYTFSLPYFRMNMKLLLQCK---KFREPLRMHSTNYK----KSEMSQKKFINHSPCFESSNHEHSKQ 359          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000037130.1 (SMESG000037130.1)

HSP 1 Score: 77.0258 bits (188), Expect = 4.039e-15
Identity = 85/306 (27.78%), Postives = 151/306 (49.35%), Query Frame = 1
Query:  211 LSIIALILNSFSLFVFWHQP-KLSMMRVTLILLSISETLFHSFLILN----FISLEFLSAKY-FLNETPSYWHLYIAPRISATTMVILHVFISARNWCNLIISMSRTEAVLYPL--KSRRLFRH--SMIYFIYFFTTFVAIVFSILRHLDFAVTICISSQYYVTESNFFSSKTTSVFLIIY--FILQTGIPWXXXXXXXXXXXXXLGRFHSDQLLSNPVSQRNQKVAIRT-----VLLLAIIFSLCELPNLISSFIMNLNNFLNYDFTKRETLEILSNAGNTLVILDSVFNFFVYVTSLPYFRRKL 1077
            + ++ ++ NS S ++FWHQ      +R  L+ +S++E L   F+I+     FI +E +  ++ FL ++ ++W +              + FI  RNW  +++++SR E V+ PL  ++R +F H  ++I+ I F T+  ++ F  L +L F + IC + Q  V    F +      +  IY  F+ Q+ IP +  + +TVI+ + L +  S     + +       ++RT     VL+ +I+F L ++P  I++ I    +   Y        +I SN   T  IL S+ NFFVY  S   FR  L
Sbjct:    8 VCVLGVLANSLSFWIFWHQSFDNKAVRFNLLSISVAEILTQLFIIIEACLVFIGVEDVKFRWSFLMKSLTHWGI--------------NSFICMRNWTVVLLTLSRCEVVINPLSTRNRMIFSHYRTVIFEISFVTSSFSLSF--LNNLRFLIKICENLQGIVLTEKFLAKYRFFHYFQIYGIFMFQSCIPVLVTVIATVIIWVCLQQASSIGRGGSNMEIHKHSHSVRTNTTGLVLVFSIVFCLLQIPTFIATCITTFRSSHLYTIHP----DIFSN---TFCILGSLLNFFVYAASSKRFRSSL 290          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000061638.1 (SMESG000061638.1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.857e-12
Identity = 57/221 (25.79%), Postives = 112/221 (50.68%), Query Frame = 1
Query:  472 ARNWCNLIISMSRTEAVLYPLKSRRLFRHSMIYFIYFFTTFVAIVFSILRHLDFAVTICISSQYYVTESN--FFSSKTTSVFLIIYFILQTGIPWXXXXXXXXXXXXXLGRFHS--DQLLSNP--VSQRNQKVAI-------------RTVLLLAIIFSLCELPNLISSFIMNLNNFLNYDFTKRETLEILSNAGNTLVILDSVFNFFVYVTSLPYFRRKL 1077
            ARNW   +++  R  A+ +PL +++   +  I  I F   F+ I+FSI R  + +  +C    Y +T +N  +++    +++  +YF L + +P + +I  ++ M+IVL +     + L S P   S+  QK ++             +TV++L   F++CELP  I+  ++N++     D +  + L         L  +DS+ +FF+Y  S+ +FR+ +
Sbjct:   91 ARNWITAVVAWQRYRAISHPLSTKQYETYKSISMILFIMYFLVILFSIPRAFEKSYYLCEKDVYIITMNNSIYYTDLYKNIYNPLYFFLSSPLPLLVIIVCSLSMLIVLKKRQENLNNLTSQPSRFSKYKQKSSLGNNSSNSRGQSINKTVIILCAAFTICELPACIAGIMLNVST----DMSIWKILSYFVGIAMVLTSVDSLLDFFIYFYSIVHFRQAI 307          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000073939.1 (SMESG000073939.1)

HSP 1 Score: 64.6994 bits (156), Expect = 4.775e-11
Identity = 91/335 (27.16%), Postives = 157/335 (46.87%), Query Frame = 1
Query:  169 EKPVLNAIQINFLCLSIIALILNSFSLFVF---WHQPKLSMMRVTLILLSISETLFHSFLILNFISLEFLSAKYFLNETPSYWH-----LYIAPRISATTMVILHVFISARNWCNLIISMSRTEAVLYPLKSRR--LFRHSMIYFIYFFTTFVAIVFSILRHLDFAVTIC-----ISSQYYVTESNFFSSKTTSVFLIIYFILQTGIPWXXXXXXXXXXXXXLGRFHSDQLLSNPVSQRNQKVAIRTVLLLAIIFSLCELP----------NLISSF-IMNLNNFLNYDFTKRETLEILSNAGNTLVILDSVFNFFVYVTSLPYFRRKLLDLIKC 1095
            E  VL  + I+F   S I  I +  S+FVF   W++   S+M+  L+ LS +E +F      N  +  F+     L  T S+++     + I       +   ++ F++ RNWC +II+ SR EA+  PL+ RR  +F      FI      ++I F+ +R  ++   IC     I     + +S++F +K   +  +I+F  QT +P + +  ST+++   +   ++  + +N   +RNQ    +TV  L + F   ELP           LIS F I+NL+ ++                GN L+  DS  NF +Y+ ++  +R+  L LI C
Sbjct:   30 ENSVLLFVVISF---SFINFITSFLSIFVFKKLWYK---SIMQKNLLFLSSAEFVF------NLCNFSFVITLLMLPSTNSHFNNNTIRVKILINFLTISFYFINCFLTVRNWCIVIIAASRCEAISRPLQVRRRKIFNFFNTIFILMIVLVISITFATIRLFEYTFIICKHSGVIQKMKLILDSSWFYNKFYKI--VIFFGFQTVLPIIVISISTIVITKSI---NASTMTNN---RRNQIKVTKTVNFLLLTFIAFELPMVLLYTIRVIGLISDFNIINLSIWI----------------GNVLITFDSTANFVIYMATMANYRQS-LKLIFC 327          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4N8C81.073e-2527.95G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A183VRB03.807e-2331.27G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A4Z2DL274.821e-2129.67Rhodopsin-like orphan GPCR OS=Schistosoma japonicu... [more]
A0A448XC236.837e-2027.19G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
H2KR477.202e-2025.82Rhodopsin-like orphan GPCR OS=Clonorchis sinensis ... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074473.10.000e+099.26SMESG000074473.1[more]
SMESG000003710.11.640e-5335.11SMESG000003710.1[more]
SMESG000037130.14.039e-1527.78SMESG000037130.1[more]
SMESG000061638.11.857e-1225.79SMESG000061638.1[more]
SMESG000073939.14.775e-1127.16SMESG000073939.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005123 ID=SMED30005123|Name=G_PROTEIN_RECEP_F1_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1507bp
TTTACTAAATTTTCACAAAAAACTCATCGGCAAATTTGCATTTCTTTTTT
GGTGAATAGTCCATAGAGTATTTTAATGAAAACCAATTTAACTGAGTACA
TTTTCACTCTCAAAGAAGTCATTGTGATTTATTCCGATAGGAATTGTTCA
AAACCCCAAATCTCTCAAGAGAAACCGGTTCTGAATGCGATTCAGATAAA
CTTTTTATGCTTATCCATAATTGCACTGATTCTAAATTCGTTTTCACTGT
TCGTATTCTGGCATCAACCAAAACTTTCAATGATGCGGGTGACTTTGATT
CTGCTGTCGATTTCGGAAACTTTGTTTCACAGTTTTCTCATATTGAATTT
CATATCTCTTGAGTTTTTGTCAGCAAAATATTTCCTAAACGAAACTCCAT
CGTATTGGCATTTATATATTGCGCCGAGAATTTCCGCCACTACAATGGTC
ATTTTACACGTTTTCATTTCCGCCCGAAACTGGTGCAATCTTATCATTTC
AATGTCAAGAACCGAAGCTGTTTTGTATCCATTGAAGAGTCGTCGATTAT
TTCGGCATTCGATGATTTATTTTATTTACTTTTTTACGACATTTGTTGCT
ATAGTCTTTAGTATTTTACGACATTTAGATTTTGCGGTGACAATTTGCAT
CAGTTCCCAATATTATGTGACGGAGAGTAACTTTTTCAGTTCAAAAACTA
CGAGTGTGTTTTTGATAATATATTTCATCTTACAAACCGGTATTCCTTGG
GTGTCCGTCATAACCTCCACCGTGATCATGATAATAGTCCTTGGACGATT
TCATTCCGATCAGCTACTTTCAAACCCGGTTAGTCAACGAAACCAAAAAG
TGGCAATTCGGACCGTGCTATTGTTGGCGATTATTTTTTCTCTATGTGAA
CTGCCAAATTTGATAAGTTCCTTCATAATGAACTTGAACAATTTTCTCAA
TTACGATTTCACTAAACGCGAAACCCTTGAAATACTTTCAAATGCTGGAA
ATACTTTGGTGATATTGGATTCGGTGTTCAATTTTTTTGTCTATGTCACC
AGCCTGCCATATTTTCGGAGAAAGCTGCTGGATTTAATAAAATGTCGAAT
TTGTATAGCAACAAGAAATTTTAGTTTGATCTATGAAAATACATGGCGAT
CAACTGTCGATAGGACGGGGAGGCCCCAATATACCAATATCAACAACAAA
CCAGATTTCAAACAAATTGACCATAAAAAGTGTCAGAAGAATTCAGTTCA
CGAAATTTTATGTCAAGAGAATTTTATAACCCAAGTTTGAGAACAATGAG
AGTTTTACATGTTTTTATTCAATGTTGTCTCGTGTTTTCGGTTTATTATT
TTGCGAATATTTGTCTTCAACTTACGTTTTTGGTTCCTAAAAATCGGAAA
TTAAATACTATCAGAATAGAAAAAGTTTAGTGACAATGTTAGAGATGAGG
CTAATTTTTTTTTATTTATATCTGGATTAGTTTTTGATTGCCCTAATTTA
TATTTCA
back to top

protein sequence of SMED30005123-orf-1

>SMED30005123-orf-1 ID=SMED30005123-orf-1|Name=SMED30005123-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=405bp
MKTNLTEYIFTLKEVIVIYSDRNCSKPQISQEKPVLNAIQINFLCLSIIA
LILNSFSLFVFWHQPKLSMMRVTLILLSISETLFHSFLILNFISLEFLSA
KYFLNETPSYWHLYIAPRISATTMVILHVFISARNWCNLIISMSRTEAVL
YPLKSRRLFRHSMIYFIYFFTTFVAIVFSILRHLDFAVTICISSQYYVTE
SNFFSSKTTSVFLIIYFILQTGIPWVSVITSTVIMIIVLGRFHSDQLLSN
PVSQRNQKVAIRTVLLLAIIFSLCELPNLISSFIMNLNNFLNYDFTKRET
LEILSNAGNTLVILDSVFNFFVYVTSLPYFRRKLLDLIKCRICIATRNFS
LIYENTWRSTVDRTGRPQYTNINNKPDFKQIDHKKCQKNSVHEILCQENF
ITQV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 32..350
e-value: 3.9E-28
score: 100.3
NoneNo IPR availablePANTHERPTHR46641FAMILY NOT NAMEDcoord: 41..373
NoneNo IPR availableCDDcd149787tmA_FMRFamide_R-likecoord: 43..332
e-value: 8.25476E-19
score: 84.2216
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 32..358
NoneNo IPR availableTMHMMTMhelixcoord: 73..95
NoneNo IPR availableTMHMMTMhelixcoord: 39..61
NoneNo IPR availableTMHMMTMhelixcoord: 110..132
NoneNo IPR availableTMHMMTMhelixcoord: 263..285
NoneNo IPR availableTMHMMTMhelixcoord: 164..181
NoneNo IPR availableTMHMMTMhelixcoord: 311..330
NoneNo IPR availableTMHMMTMhelixcoord: 211..242
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 53..323
score: 17.102