Protein ZBED8

Overview
NameProtein ZBED8
Smed IDSMED30005112
Length (bp)1803
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein ZBED8 (SMED30005112) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein ZBED8 (SMED30005112) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein ZBED8 (SMED30005112) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein ZBED8 (SMED30005112) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005112

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neoblastSMED30005112h1SMcG0017054 dd_Smed_v4_5608_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein ZBED8 vs. Ensembl Human
Match: ZBED8 (zinc finger BED-type containing 8 [Source:HGNC Symbol;Acc:HGNC:30804])

HSP 1 Score: 171.4 bits (433), Expect = 2.188e-79
Identity = 83/195 (42.56%), Postives = 127/195 (65.13%), Query Frame = 2
Query: 1178 FLLDVFRNEIKEDFLF*EPLTETTNAVYIMSIMNGFFVANELSWNNVRAICTDGAPAMPWKNSGFIALVKQINPHVFSSHCVLRRHALESKTLPSYFKEVLNIVVKTVNFIKSRALNQSLFKVLCEEVGCAHTVLLLHTGIRWLSRGKVLSRVFELRSQIETFLNDKESTLLLDFTDTSFVLSLAYLADIFSHLN 1762
            F+  +   EI E+FLF EPL  +   + + ++   FF+ ++++ +   ++CTDGA +M  +NS F+A VK+  PH+  +HC+L  HAL  KTLP+  ++ L  VV+ +NFIK RA N  LF+   EE+G  ++VLL HT +RWLSRG++L+ +FE+  +I  FL+ K S L+  F +  F + LAYLAD+F HLN
Sbjct:  191 FVRYIKEREIVEEFLFCEPLQLSMKGIDVFNLFRDFFLKHKIALDVCGSVCTDGASSMLGENSEFVAYVKKEIPHIVVTHCLLNPHALVIKTLPTKLRDALFTVVRVINFIKGRAPNHRLFQAFFEEIGIEYSVLLFHTEMRWLSRGQILTHIFEMYEEINQFLHHKSSNLVDGFENKEFKIHLAYLADLFKHLN 385          

HSP 2 Score: 145.976 bits (367), Expect = 2.188e-79
Identity = 75/195 (38.46%), Postives = 116/195 (59.49%), Query Frame = 1
Query:  610 MSKKRCYQDSDIQFGFTFLVDKNGLHKPQYLLCLKVLSNGFMEPSKLKEHLQAVHPKNVNDPEALFIINRARFETSAKLTNHGFVPEKKPALEASYRVALRIAKDKTSHTIAETLIKLCAMEMAEIICGKDAKLKISQIPLSNHTIHDQIKDMSEDVLKQIVVQIQESSTKIGLQLDESIDVSNCAQLLVFVRCV 1194
            MSKKR + D  +++ FT   + +G  +PQ +LC  V SN  + PSKL +H    H               A  + S  L   G    +   L+ASY+ A   AK+K  HT+AE L+K CA+E+A+I+ G DA+ K+ Q+PLS+  IH +I +MS+D+L+Q++  I+ S  K+G+QL E+ D+ +C+QL+ FVR +
Sbjct:    1 MSKKRKWDDDYVRYWFTCTTEVDGTQRPQCVLCNSVFSNADLRPSKLSDHFNRQHGGVAGHDLNSLKHMPAPSDQSETLKAFGVASHEDTLLQASYQFAYLCAKEKNPHTVAEKLVKPCALEIAQIVLGPDAQKKLQQVPLSDDVIHSRIDEMSQDILQQVLEDIKASPLKVGIQLAETTDMDDCSQLMAFVRYI 195          
BLAST of Protein ZBED8 vs. Ensembl Human
Match: ZBED8 (zinc finger BED-type containing 8 [Source:HGNC Symbol;Acc:HGNC:30804])

HSP 1 Score: 171.4 bits (433), Expect = 2.188e-79
Identity = 83/195 (42.56%), Postives = 127/195 (65.13%), Query Frame = 2
Query: 1178 FLLDVFRNEIKEDFLF*EPLTETTNAVYIMSIMNGFFVANELSWNNVRAICTDGAPAMPWKNSGFIALVKQINPHVFSSHCVLRRHALESKTLPSYFKEVLNIVVKTVNFIKSRALNQSLFKVLCEEVGCAHTVLLLHTGIRWLSRGKVLSRVFELRSQIETFLNDKESTLLLDFTDTSFVLSLAYLADIFSHLN 1762
            F+  +   EI E+FLF EPL  +   + + ++   FF+ ++++ +   ++CTDGA +M  +NS F+A VK+  PH+  +HC+L  HAL  KTLP+  ++ L  VV+ +NFIK RA N  LF+   EE+G  ++VLL HT +RWLSRG++L+ +FE+  +I  FL+ K S L+  F +  F + LAYLAD+F HLN
Sbjct:  191 FVRYIKEREIVEEFLFCEPLQLSMKGIDVFNLFRDFFLKHKIALDVCGSVCTDGASSMLGENSEFVAYVKKEIPHIVVTHCLLNPHALVIKTLPTKLRDALFTVVRVINFIKGRAPNHRLFQAFFEEIGIEYSVLLFHTEMRWLSRGQILTHIFEMYEEINQFLHHKSSNLVDGFENKEFKIHLAYLADLFKHLN 385          

HSP 2 Score: 145.976 bits (367), Expect = 2.188e-79
Identity = 75/195 (38.46%), Postives = 116/195 (59.49%), Query Frame = 1
Query:  610 MSKKRCYQDSDIQFGFTFLVDKNGLHKPQYLLCLKVLSNGFMEPSKLKEHLQAVHPKNVNDPEALFIINRARFETSAKLTNHGFVPEKKPALEASYRVALRIAKDKTSHTIAETLIKLCAMEMAEIICGKDAKLKISQIPLSNHTIHDQIKDMSEDVLKQIVVQIQESSTKIGLQLDESIDVSNCAQLLVFVRCV 1194
            MSKKR + D  +++ FT   + +G  +PQ +LC  V SN  + PSKL +H    H               A  + S  L   G    +   L+ASY+ A   AK+K  HT+AE L+K CA+E+A+I+ G DA+ K+ Q+PLS+  IH +I +MS+D+L+Q++  I+ S  K+G+QL E+ D+ +C+QL+ FVR +
Sbjct:    1 MSKKRKWDDDYVRYWFTCTTEVDGTQRPQCVLCNSVFSNADLRPSKLSDHFNRQHGGVAGHDLNSLKHMPAPSDQSETLKAFGVASHEDTLLQASYQFAYLCAKEKNPHTVAEKLVKPCALEIAQIVLGPDAQKKLQQVPLSDDVIHSRIDEMSQDILQQVLEDIKASPLKVGIQLAETTDMDDCSQLMAFVRYI 195          
BLAST of Protein ZBED8 vs. Ensembl Human
Match: ZBED5 (zinc finger BED-type containing 5 [Source:HGNC Symbol;Acc:HGNC:30803])

HSP 1 Score: 157.147 bits (396), Expect = 3.733e-64
Identity = 82/197 (41.62%), Postives = 118/197 (59.90%), Query Frame = 2
Query: 1172 FLFLLDVFRNEIKEDFLF*EPLTETTNAVYIMSIMNGFFVANELSWNNVRAICTDGAPAMPWKNSGFIALVKQINPHVFSSHCVLRRHALESKTLPSYFKEVLNIVVKTVNFIKSRALNQSLFKVLCEEVGCAHTVLLLHTGIRWLSRGKVLSRVFELRSQIETFLNDKESTLLLDFTDTSFVLSLAYLADIFSHLN 1762
             +F+   F   I+ED L  E L        I + +N F   +E+ W     +C+D + A+  K +  + L+K + P   SSHC+L RHAL  K +P+  K VL+  V+ +N+IK+R     L K+LCEE+G  HT LLL+T +RWLSRGKVL R+FELR ++  F+ D    L    T++S++L LAYLADIF+ LN
Sbjct:  290 LVFVRYRFNKSIEEDLLLCESLQSNATGEEIFNCINSFMQKHEIEWEKCVDVCSDASRAVDGKIAEAVTLIKYVAPESTSSHCLLYRHALAVKIMPTSLKNVLDQAVQIINYIKARPHQSRLLKILCEEMGAQHTALLLNTEVRWLSRGKVLVRLFELRRELLVFM-DSAFRLSDCLTNSSWLLRLAYLADIFTKLN 485          

HSP 2 Score: 109.383 bits (272), Expect = 3.733e-64
Identity = 70/191 (36.65%), Postives = 106/191 (55.50%), Query Frame = 1
Query:  616 KKRCYQDSDIQFGFTFLVDKNGLHKPQYLLCLKVLSNGFMEPSKLKEHLQAVHPKNVNDPEALFIINRARFETSAKLTNHGFVPEKKPALEASYRVALRIAKDKTSHTIAETLIKLCAMEMAEIICGKDAKLKISQIPLSNHTIHDQIKDMSEDVLKQIVVQIQESSTKIGLQLDESIDVSNCAQLLVFVR 1188
            K+R Y +S + FGFT+  +++  H  Q +LC K+LSN  + PSKL+ HL+  H    +   + F  +    E +   T      + + A EASY V+  IA    +HTI E LIK CA ++   +  +    KI  + LSN T+  +IKD++ D+ +++V +++       LQLDES DVS  A LLVFVR
Sbjct:  106 KRRKYDESYLSFGFTYFGNRDAPH-AQCVLCKKILSNSSLAPSKLRRHLETKHAAYKDKDISFFKQHLDSPENNKPPTPKIVNTDNESATEASYNVSYHIALSGEAHTIGELLIKPCAKDVVMRMFDEQYSKKIDAVQLSNSTVARRIKDLAADIEEELVCRLK-ICDGFSLQLDESADVSGLAVLLVFVR 294          
BLAST of Protein ZBED8 vs. Ensembl Human
Match: ZBED5 (zinc finger BED-type containing 5 [Source:HGNC Symbol;Acc:HGNC:30803])

HSP 1 Score: 157.147 bits (396), Expect = 3.733e-64
Identity = 82/197 (41.62%), Postives = 118/197 (59.90%), Query Frame = 2
Query: 1172 FLFLLDVFRNEIKEDFLF*EPLTETTNAVYIMSIMNGFFVANELSWNNVRAICTDGAPAMPWKNSGFIALVKQINPHVFSSHCVLRRHALESKTLPSYFKEVLNIVVKTVNFIKSRALNQSLFKVLCEEVGCAHTVLLLHTGIRWLSRGKVLSRVFELRSQIETFLNDKESTLLLDFTDTSFVLSLAYLADIFSHLN 1762
             +F+   F   I+ED L  E L        I + +N F   +E+ W     +C+D + A+  K +  + L+K + P   SSHC+L RHAL  K +P+  K VL+  V+ +N+IK+R     L K+LCEE+G  HT LLL+T +RWLSRGKVL R+FELR ++  F+ D    L    T++S++L LAYLADIF+ LN
Sbjct:  290 LVFVRYRFNKSIEEDLLLCESLQSNATGEEIFNCINSFMQKHEIEWEKCVDVCSDASRAVDGKIAEAVTLIKYVAPESTSSHCLLYRHALAVKIMPTSLKNVLDQAVQIINYIKARPHQSRLLKILCEEMGAQHTALLLNTEVRWLSRGKVLVRLFELRRELLVFM-DSAFRLSDCLTNSSWLLRLAYLADIFTKLN 485          

HSP 2 Score: 109.383 bits (272), Expect = 3.733e-64
Identity = 70/191 (36.65%), Postives = 106/191 (55.50%), Query Frame = 1
Query:  616 KKRCYQDSDIQFGFTFLVDKNGLHKPQYLLCLKVLSNGFMEPSKLKEHLQAVHPKNVNDPEALFIINRARFETSAKLTNHGFVPEKKPALEASYRVALRIAKDKTSHTIAETLIKLCAMEMAEIICGKDAKLKISQIPLSNHTIHDQIKDMSEDVLKQIVVQIQESSTKIGLQLDESIDVSNCAQLLVFVR 1188
            K+R Y +S + FGFT+  +++  H  Q +LC K+LSN  + PSKL+ HL+  H    +   + F  +    E +   T      + + A EASY V+  IA    +HTI E LIK CA ++   +  +    KI  + LSN T+  +IKD++ D+ +++V +++       LQLDES DVS  A LLVFVR
Sbjct:  106 KRRKYDESYLSFGFTYFGNRDAPH-AQCVLCKKILSNSSLAPSKLRRHLETKHAAYKDKDISFFKQHLDSPENNKPPTPKIVNTDNESATEASYNVSYHIALSGEAHTIGELLIKPCAKDVVMRMFDEQYSKKIDAVQLSNSTVARRIKDLAADIEEELVCRLK-ICDGFSLQLDESADVSGLAVLLVFVR 294          
BLAST of Protein ZBED8 vs. Ensembl Human
Match: ZMYM6 (zinc finger MYM-type containing 6 [Source:HGNC Symbol;Acc:HGNC:13050])

HSP 1 Score: 137.502 bits (345), Expect = 5.909e-53
Identity = 73/202 (36.14%), Postives = 116/202 (57.43%), Query Frame = 2
Query: 1163 VLNFLFLLDVFRNEIKEDFLF*EPLTETTNAVYIMSIMNGFFVANELSWNNVRAICTDGAPAMPWKNSGFIALVKQI--NPHVFSSHCVLRRHALESKTLPSYFKEVLNIVVKTVNFIKSRALNQSLFKVLCEEVGCAHTVLLLHTGIRWLSRGKVLSRVFELRSQIETFLNDKESTLLLDFTDTSFVLSLAYLADIFSHLN 1762
            +L ++  +D    ++KE+ LF   +        I  ++N +  +  L+W +   +CTDGA +M  + SG  A ++++  N   F+ HC + R  L ++ L     ++L    + ++FIKS ALN  +  +LCEE+G  H  L LH  +RW+SRG++L R+FELR +IE FL+ K S L   F D  +V  LAYL+DIFS +N
Sbjct:  924 LLCYIRFIDYDCRDVKEELLFCIEMPTQITGFEIFELINKYIDSKSLNWKHCVGLCTDGAASMTGRYSGLKAKIQEVAMNTAAFT-HCFIHRERLVAEKLSPCLHKILLQSAQILSFIKSNALNSRMLTILCEEMGSEHVSLPLHAEVRWISRGRMLKRLFELRHEIEIFLSQKHSDLAKYFHDEEWVGKLAYLSDIFSLIN 1124          

HSP 2 Score: 91.6633 bits (226), Expect = 5.909e-53
Identity = 66/200 (33.00%), Postives = 102/200 (51.00%), Query Frame = 1
Query:  607 PMSKKRC--YQDSDIQF---GFTFLV-DKNGLHKPQYLLCLKVLSNGFMEPSKLKEHLQAVHPKNVNDPEALFIINRARFETSAKLTNHGFVPEKKPALEASYRVALRIAKDKTSHTIAETLIKLCAMEMAEIICGKDAKLKISQIPLSNHTIHDQIKDMSEDVLKQIVVQIQESSTKIGLQLDESIDVSNCAQLLVFVR 1188
            P  KKR   +Q  D ++   GF      K    +PQ ++C ++LS+  M+P+ L  HL+  H +  N P   F       E          + EK   ++ASY +A + A  K   +IAE LIK   +EM   + G  A  K+  IPLSN TI  +I ++S D+  Q++ +++ES     LQ+DES ++SN   LL ++R
Sbjct:  732 PSKKKRLGFFQTYDTEYLKVGFIICPGSKESSPRPQCVICGEILSSENMKPANLSHHLKTKHSELENKPVDFFEQKSLEMECQNSSLKKCLLVEKS-LVKASYLIAFQTAASKKPFSIAEELIKPYLVEMCSEVLGSSAGDKMKTIPLSNVTIQHRIDELSADIEDQLIQKVRESKW-FALQIDESSEISNITLLLCYIR 929          
BLAST of Protein ZBED8 vs. Ensembl Zebrafish
Match: AL928808.1 (pep chromosome:GRCz11:20:17257101:17259573:-1 gene:ENSDARG00000101333.2 transcript:ENSDART00000166397.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL928808.1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.606e-31
Identity = 62/189 (32.80%), Postives = 98/189 (51.85%), Query Frame = 2
Query: 1205 IKEDFLF*EPLTETTNAVYIMSIMNGFFVANELSWNNVRAICTDGAPAMPWKNSGFIALVKQIN--PHVFSSHCVLRRHALESKTLPSYFKEVLNIVVKTVNFIKSRALNQSLFKVLCEEVGCA-HTVLLLHTGIRWLSRGKVLSRVFELRSQIETFLNDKESTLLLDFTDTSFVLSLAYLADIFSHLN 1762
            I+E+ L   PL + T  + +   +        L  + + AI TDGAPAM     G + L K  +  P  ++ HC++ +    SK L      ++  V++ VNF+++ ALN   FK L +E+     + LL H  +RWLSRG VLSR FEL + ++ FL +K      +  D  ++  LA+L D+  +LN
Sbjct:  214 IREELLDIVPLKDRTRGIDLKETLMTVVEKANLQLSKLTAIVTDGAPAMLGSERGLVGLCKADDRFPAFWTFHCIIHQEHWVSKKL--NLDHIMKPVLEIVNFVRTHALNHRQFKNLIDELDEDLPSDLLFHCAVRWLSRGHVLSRFFELLNPVKLFLAEKHKE-YPELHDPQWISDLAFLVDVLHYLN 399          

HSP 2 Score: 60.4622 bits (145), Expect = 1.606e-31
Identity = 57/208 (27.40%), Postives = 93/208 (44.71%), Query Frame = 1
Query:  613 SKKRCYQDSDIQF-----GFTFLVDKNGLHKPQYLLCLKVLSNGFMEPSKLKEHLQAVH-------PKNVNDPEALFIINRARFETSAKLTNHGFVPEKKPALEASYRVALRIAKDKTSHTIAETLIKLCAMEMAEIICGKDAKLK--ISQIPLSNHTIHDQIKDMSEDVLKQIVVQIQESSTKIGLQLDESIDVSNCAQLLVFVRCV 1194
            + KR Y+D    F        F V++NG  KP  L+C   LS+   + S L+ H  ++H       PK     +      + + E   +L    F    +    ASY++A  IA+ K  +   E  +K C  +   I+C ++  LK  +  + LS HT+  +I D+   V   ++  +Q+      + LDES DV +  Q  +FVR V
Sbjct:    8 TAKRKYEDERRTFLSEWEDLYFFVERNG--KPFCLICQTSLSH--FKASNLERHFTSLHSAVAREFPKGSELRKHKVKTLKGQAEKQTQLFR-KFSKHSETVTLASYQLAWNIARAKKPYLEGE-FVKKCLSDAVAILCPENENLKRSVKDLQLSRHTVEQRISDIDNSVETHLLSDLQKCQY-FSIALDESCDVQDKPQFAIFVRFV 208          
BLAST of Protein ZBED8 vs. Ensembl Zebrafish
Match: CR392001.3 (pep chromosome:GRCz11:8:38963323:38965260:-1 gene:ENSDARG00000117159.1 transcript:ENSDART00000181495.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR392001.3)

HSP 1 Score: 105.531 bits (262), Expect = 2.588e-23
Identity = 60/178 (33.71%), Postives = 101/178 (56.74%), Query Frame = 2
Query: 1232 PLTETTNAVYIMSIMNGFFVANELSWNNVRAICTDGAPAMPWKNSGFIALV-KQINPHVFSSHCVLRRHALESKTLPSYFKEVLNIVVKTVNFIKSRALNQSLFKVLCEEVGCAHTVLLLHTGIRWLSRGKVLSRVFELRSQIETFLNDKESTLLLDFTDTSFVLSLAYLADIFSHLN 1762
            PL   T    I   +      N ++ N++ ++ TDGAP+M     GF+ L+ K ++ ++ + HC+L + AL ++T PS    V+N+V++ VN I ++ALN   F+ L +EV   ++ LLLH  +RWLS+ +VL R       ++TFL  K+  +     DT ++  L ++ D+ SHLN
Sbjct:  216 PLKGQTRGEDICEAVLKCLNENGINTNHLISVATDGAPSMRGSKRGFVTLLQKALDRNLLAFHCILHQEALCAQTFPSECMVVMNLVIEMVNKIIAKALNHRQFRALLDEVDSEYSDLLLHNKVRWLSKDEVLRRFVACLEHVKTFLKSKD-LIYPQLEDTEWLEKLHFMVDMTSHLN 392          
BLAST of Protein ZBED8 vs. Ensembl Xenopus
Match: spag1 (sperm associated antigen 1 [Source:Xenbase;Acc:XB-GENE-853609])

HSP 1 Score: 99.7525 bits (247), Expect = 6.379e-32
Identity = 68/193 (35.23%), Postives = 103/193 (53.37%), Query Frame = 2
Query: 1205 IKEDFLF*EPLTETTNAVYIMSIMNGFFVANELSWNNVRAICTDGAPAMPWKNSGFIALVKQ--INPHVFSSHCVLRRHALESKTLPSYFKEVLNIVVKTVNFIKS--RALNQSLFKVLCEEVGCAHTVLLLHTGIRWLSRGKVLSRVFELRSQIETFLND--KESTLLLDFTDTSFVLSLAYLADIFSHLNT 1765
            I E+ L   PL  +T    I + +    V     +++   I TDGA AM  +N G    +++  I+ H+F  HC++ +  L   +L     +++++V K  N I+   R+L    FK   EE+  A+  LLLHT +RWLS GK L R F LR +I  +L+D   +S LL   TD SF+ +LA+L DI   LN+
Sbjct:  217 ISEELLEIVPLHGSTKGEDIYNAVKAT-VTKYGGFSSCTCIVTDGARAMVGRNQGLAGRLRKEGIDCHMF--HCIVHQEVLCGTSLK--MADIMDVVTKVTNLIRGGNRSLTHRRFKNFLEELDAAYGDLLLHTNVRWLSAGKCLVRFFALRKEIHLYLSDIKCDSYLLEHLTDVSFLTALAFLTDITQFLNS 404          

HSP 2 Score: 58.9214 bits (141), Expect = 6.379e-32
Identity = 50/173 (28.90%), Postives = 84/173 (48.55%), Query Frame = 1
Query:  688 KPQYLLCLKVLSNGFMEPSKLKEHLQAVHPKNV--NDPEALFIINRARFETSAKLTN--HGFVPEKKPALEASYRVALRIAKDKTSHTIAETLIKLCAMEMAEIICGKDAKLKISQIPLSNHTIHDQIKDMSEDVLKQIVVQIQESSTKIGLQLDESIDVSNCAQLLVFVRCV 1194
            KPQ L+C + +S+   +   +K H   +H         EA   I +       K  N        +K A++AS+ VA  IAK K   + + TL+K CA++MAE    +     +  I LS+ T+   I  +++ +  ++   I  S+    + LDES D+++  QL++FVR V
Sbjct:   43 KPQCLVCAQTISS--CKEYNVKRHYTTLHGAKYAKYTGEARLTIIKDLKSKLCKQKNIFSAVTTTQKAAVKASFLVAEEIAKRKYPFS-SGTLVKTCALKMAEAFGNETMAKTVESISLSHQTVARHICTINQHLTDKLQ-NILRSAPYFSIALDESTDITDTCQLVIFVRSV 211          
BLAST of Protein ZBED8 vs. Ensembl Xenopus
Match: ENSXETT00000016563.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:37379994:37381838:-1 gene:ENSXETG00000009412.1 transcript:ENSXETT00000016563.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.7525 bits (247), Expect = 7.097e-32
Identity = 68/193 (35.23%), Postives = 103/193 (53.37%), Query Frame = 2
Query: 1205 IKEDFLF*EPLTETTNAVYIMSIMNGFFVANELSWNNVRAICTDGAPAMPWKNSGFIALVKQ--INPHVFSSHCVLRRHALESKTLPSYFKEVLNIVVKTVNFIKS--RALNQSLFKVLCEEVGCAHTVLLLHTGIRWLSRGKVLSRVFELRSQIETFLND--KESTLLLDFTDTSFVLSLAYLADIFSHLNT 1765
            I E+ L   PL  +T    I + +    V     +++   I TDGA AM  +N G    +++  I+ H+F  HC++ +  L   +L     +++++V K  N I+   R+L    FK   EE+  A+  LLLHT +RWLS GK L R F LR +I  +L+D   +S LL   TD SF+ +LA+L DI   LN+
Sbjct:  217 ISEELLEIVPLHGSTKGEDIYNAVKAT-VTKYGGFSSCTCIVTDGARAMVGRNQGLAGRLRKEGIDCHMF--HCIVHQEVLCGTSLK--MADIMDVVTKVTNLIRGGNRSLTHRRFKNFLEELDAAYGDLLLHTNVRWLSAGKCLVRFFALRKEIHLYLSDIKCDSYLLEHLTDVSFLTALAFLTDITQFLNS 404          

HSP 2 Score: 58.9214 bits (141), Expect = 7.097e-32
Identity = 50/173 (28.90%), Postives = 84/173 (48.55%), Query Frame = 1
Query:  688 KPQYLLCLKVLSNGFMEPSKLKEHLQAVHPKNV--NDPEALFIINRARFETSAKLTN--HGFVPEKKPALEASYRVALRIAKDKTSHTIAETLIKLCAMEMAEIICGKDAKLKISQIPLSNHTIHDQIKDMSEDVLKQIVVQIQESSTKIGLQLDESIDVSNCAQLLVFVRCV 1194
            KPQ L+C + +S+   +   +K H   +H         EA   I +       K  N        +K A++AS+ VA  IAK K   + + TL+K CA++MAE    +     +  I LS+ T+   I  +++ +  ++   I  S+    + LDES D+++  QL++FVR V
Sbjct:   43 KPQCLVCAQTISS--CKEYNVKRHYTTLHGAKYAKYTGEARLTIIKDLKSKLCKQKNIFSAVTTTQKAAVKASFLVAEEIAKRKYPFS-SGTLVKTCALKMAEAFGNETMAKTVESISLSHQTVARHICTINQHLTDKLQ-NILRSAPYFSIALDESTDITDTCQLVIFVRSV 211          
BLAST of Protein ZBED8 vs. Ensembl Xenopus
Match: ENSXETT00000028445.1 (general transcription factor II-I repeat domain-containing protein 2-like [Source:NCBI gene;Acc:101734469])

HSP 1 Score: 68.9366 bits (167), Expect = 6.841e-19
Identity = 48/173 (27.75%), Postives = 83/173 (47.98%), Query Frame = 2
Query: 1304 SWNNVRAICTDGAPAMPWKNSGFIALVKQINPHVFSSHCVLRRHALESKTLPSYFKEVLNIVVKTVNFIKSR-----ALNQSLFKVLCEEVGCAHTVLLLHTGIRWLSRGKVLSRVFELRSQIETFLNDK--ESTLLLDFTDTSFVLSLAYLADIFSHLNT*EKVTSFKDKLV 1801
             ++   ++ T+G+ +M  K+ G  AL+++        HC++    L    L     +V+ +VVK  NFI  +     A+ +  FK   +E+  A+     H    W S G+ L R F LR +I  FL D   +  L     +  F+ SLA+L D+  +L++ +K    KD+L+
Sbjct:  238 GFDKCTSVMTNGSKSMTAKSLGLSALLRKEGADCVVLHCIMHEEMLIGTLLK--MSDVMEVVVKISNFILEKRGFITAVTKKKFKTFLDELSAAYGDFDSHKNAYWSSAGQCLFRFFSLRKEIYLFLKDTNYDPILTESLCNEDFLSSLAFLTDLTHYLHSLKKNIEAKDQLI 408          

HSP 2 Score: 45.8246 bits (107), Expect = 6.841e-19
Identity = 44/182 (24.18%), Postives = 83/182 (45.60%), Query Frame = 1
Query:  661 FLVDKNGLHKPQYLLCLKVLSNGFMEPSKLKEHLQAVHPKNVNDPEA---LFIINRARFETSAKLTNHGF-VPEKKPALEASYRVALRIAKDKTSHTIAETLIKLCAMEMAEIICGKDAKLKISQIPLSNHTIHDQIKDMSEDVLKQIVVQIQESSTKIGLQLDESIDVSNCAQLLVFVRCV 1194
            F V  NG  KP  LLC ++L     +   +K H  ++H K  +       + I+N  R + + + T           AL+AS+ +   I K K +    + ++K CA++MA +   ++   K   I L   T+  ++  M + + +++   I ++     L LDE+ D      L++F+R +
Sbjct:   25 FFVKCNG--KPLCLLCSQIL--AVCKEYNVKRHYISLHEKTYSQYTGDHRMAILNELRSKLNKQETVTSIETATDTAALKASFIICEEIVKRKQAFDSVD-VVKECAVKMARVFGNEEMAAKFDSISLQPQTVARRVSAMHQQITQKLHA-ILKNCCYFSLALDETTDSCGTDLLVIFIRAI 200          
BLAST of Protein ZBED8 vs. Ensembl Mouse
Match: Zbed5 (zinc finger, BED type containing 5 [Source:MGI Symbol;Acc:MGI:1919220])

HSP 1 Score: 152.525 bits (384), Expect = 5.694e-67
Identity = 79/189 (41.80%), Postives = 112/189 (59.26%), Query Frame = 2
Query: 1199 NEIKEDFLF*EPLTETTNAVYIMSIMNGFFVANELSWNNVRAICTDGAPAMPWKNSGFIALVKQINPHVFSSHCVLRRHALESKTLPSYFKEVLNIVVKTVNFIKSRALNQSLFKVLCEEVGCAHTVLLLHTGIRWLSRGKVLSRVFELRSQIETFLNDKE-STLLLDFTDTSFVLSLAYLADIFSHLN 1762
             + K++FL  +PL  T  A+ +   ++ F   +E+SW ++  +CTDGAPA     SGF  LV   +P    +HC+L    L  KTLP  F+EV+  V+ +VNF+K+ +LN  LF  LC ++      LLLHT  RWLSRGKVL R+FELR +++ F N K        F+D S +  +AYL DIF+ LN
Sbjct:  360 GDFKDEFLCCKPLERTATALDVFEAVDSFLRQHEISWKSICGVCTDGAPATLGCQSGFQRLVLNESPKAIGAHCMLHLQTLAMKTLPQDFQEVMKSVLSSVNFVKASSLNSRLFLQLCSDLDEPSKTLLLHTEGRWLSRGKVLKRIFELRDELKMFFNQKAIRQFEALFSDNSALQKVAYLVDIFTILN 548          

HSP 2 Score: 123.25 bits (308), Expect = 5.694e-67
Identity = 76/209 (36.36%), Postives = 115/209 (55.02%), Query Frame = 1
Query:  586 RQLTHTIPMSKKRCYQDSDIQFGFTFLVDKNGLHKPQYLLCLKVLSNGFMEPSKLKEHLQAVHPKNVNDPEALFI-----INRARFETSAKLTNHGFVPEKKPALEASYRVALRIAKDKTSHTIAETLIKLCAMEMAEIICGKDAKLKISQIPLSNHTIHDQIKDMSEDVLKQIVVQIQESSTKI-GLQLDESIDVSNCAQLLVFVRCV 1194
            R + H     K+R Y +  +Q+GFT  +   G+ +PQ ++C  VLS   M+P+KLK H ++ H          F      + +AR +T +K            A+E SY VALRIA+D   HT AE L+   A +   ++ G +   K+S + LSN T+  +I DMS D+L Q+V +I+ +   I  +QLDES DV+NC QL+V+VR +
Sbjct:  155 RPVDHGERNVKRRKYNEGFLQYGFTSTITV-GIERPQCVICGVVLSAESMKPNKLKRHFESKHSSFAGKDTNYFRSKADGLKKARPDTGSKSNKQNVA-----AVETSYLVALRIARDMKPHTFAEHLLFPVAKDRVRVMIGDEFVTKLSAVSLSNDTVRRRIHDMSADILDQVVQEIKSAPLPICSIQLDESTDVANCLQLMVYVRYI 357          
BLAST of Protein ZBED8 vs. Ensembl Mouse
Match: Zmym6 (zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI:106505])

HSP 1 Score: 134.035 bits (336), Expect = 4.715e-48
Identity = 69/201 (34.33%), Postives = 117/201 (58.21%), Query Frame = 2
Query: 1163 VLNFLFLLDVFRNEIKEDFLF*EPLTETTNAVYIMSIMNGFFVANELSWNNVRAICTDGAPAMPWKNSGFIALVKQINPHVFS-SHCVLRRHALESKTLPSYFKEVLNIVVKTVNFIKSRALNQSLFKVLCEEVGCAHTVLLLHTGIRWLSRGKVLSRVFELRSQIETFLNDKESTLLLDFTDTSFVLSLAYLADIFSHLN 1762
            +L ++  +D  R ++KE+ LF   +   +  + +  ++N +  +  L+WN+    CTDGA +M  +     + +++I  +  + +HC + R  L +K L     E+L    + ++F+K+ A +  +  +LCEE+G  H  L L+  +RWLSRG++L+R+FELR +IE FLN K S L   F D  ++  LAYLADIFS +N
Sbjct:  756 LLCYVRFIDYDRGDVKEELLFCTEMPSPSTDLEVFELINKYIDSRSLNWNHCVGFCTDGAASMTDRYFRLRSKIQEIAKNTVTFTHCFIHREHLAAKKLSPCLHEILLQSSQILSFVKNSASDSQMLTILCEEMGSEHVNLPLNAEVRWLSRGRILTRLFELRHEIEIFLNQKHSDLARYFHDEEWIAKLAYLADIFSLIN 956          

HSP 2 Score: 78.1814 bits (191), Expect = 4.715e-48
Identity = 60/188 (31.91%), Postives = 90/188 (47.87%), Query Frame = 1
Query:  628 YQDSDIQFGFTFLVDKNGLHKP-QYLLCLKVLSNGFMEPSKLKEHLQAVHPKNVNDPEALFIINRARFETSAKLTNHGFVPEKKPALEASYRVALRIAKDKTSHTIAETLIKLCAMEMAEIICGKDAKLKISQIPLSNHTIHDQIKDMSEDVLKQIVVQIQESSTKIGLQLDESIDVSNCAQLLVFVR 1188
            Y    I+FGF             Q ++C +VL +  + P  L  HL+A H    N P   F       E          + E+   ++ASY +A +IA      +IAE LIK   +EM   + G  A  K+  IPLSN TI  +IK +S+D+  Q++ +++ES     LQ+DES + +    LL +VR
Sbjct:  576 YNAEYIRFGFIICSGSEESSPSPQCVICGEVLPSESVMPVSLSNHLKAKHSDLENKPVDFFEEKSLEMECQNSSLKKCLLVEES-LVKASYLIAFQIAARNKPFSIAEELIKPYLVEMCSEVLGSSAGEKMKTIPLSNSTIGCRIKKLSDDIEDQLLQKVRESRW-FALQVDESSEATEVPLLLCYVR 761          
BLAST of Protein ZBED8 vs. Ensembl Mouse
Match: Zmym6 (zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI:106505])

HSP 1 Score: 133.65 bits (335), Expect = 5.204e-48
Identity = 69/201 (34.33%), Postives = 117/201 (58.21%), Query Frame = 2
Query: 1163 VLNFLFLLDVFRNEIKEDFLF*EPLTETTNAVYIMSIMNGFFVANELSWNNVRAICTDGAPAMPWKNSGFIALVKQINPHVFS-SHCVLRRHALESKTLPSYFKEVLNIVVKTVNFIKSRALNQSLFKVLCEEVGCAHTVLLLHTGIRWLSRGKVLSRVFELRSQIETFLNDKESTLLLDFTDTSFVLSLAYLADIFSHLN 1762
            +L ++  +D  R ++KE+ LF   +   +  + +  ++N +  +  L+WN+    CTDGA +M  +     + +++I  +  + +HC + R  L +K L     E+L    + ++F+K+ A +  +  +LCEE+G  H  L L+  +RWLSRG++L+R+FELR +IE FLN K S L   F D  ++  LAYLADIFS +N
Sbjct:  848 LLCYVRFIDYDRGDVKEELLFCTEMPSPSTDLEVFELINKYIDSRSLNWNHCVGFCTDGAASMTDRYFRLRSKIQEIAKNTVTFTHCFIHREHLAAKKLSPCLHEILLQSSQILSFVKNSASDSQMLTILCEEMGSEHVNLPLNAEVRWLSRGRILTRLFELRHEIEIFLNQKHSDLARYFHDEEWIAKLAYLADIFSLIN 1048          

HSP 2 Score: 78.1814 bits (191), Expect = 5.204e-48
Identity = 60/188 (31.91%), Postives = 90/188 (47.87%), Query Frame = 1
Query:  628 YQDSDIQFGFTFLVDKNGLHKP-QYLLCLKVLSNGFMEPSKLKEHLQAVHPKNVNDPEALFIINRARFETSAKLTNHGFVPEKKPALEASYRVALRIAKDKTSHTIAETLIKLCAMEMAEIICGKDAKLKISQIPLSNHTIHDQIKDMSEDVLKQIVVQIQESSTKIGLQLDESIDVSNCAQLLVFVR 1188
            Y    I+FGF             Q ++C +VL +  + P  L  HL+A H    N P   F       E          + E+   ++ASY +A +IA      +IAE LIK   +EM   + G  A  K+  IPLSN TI  +IK +S+D+  Q++ +++ES     LQ+DES + +    LL +VR
Sbjct:  668 YNAEYIRFGFIICSGSEESSPSPQCVICGEVLPSESVMPVSLSNHLKAKHSDLENKPVDFFEEKSLEMECQNSSLKKCLLVEES-LVKASYLIAFQIAARNKPFSIAEELIKPYLVEMCSEVLGSSAGEKMKTIPLSNSTIGCRIKKLSDDIEDQLLQKVRESRW-FALQVDESSEATEVPLLLCYVR 853          
BLAST of Protein ZBED8 vs. Ensembl Mouse
Match: Gtf2ird2 (GTF2I repeat domain containing 2 [Source:MGI Symbol;Acc:MGI:2149780])

HSP 1 Score: 84.3445 bits (207), Expect = 8.149e-17
Identity = 57/204 (27.94%), Postives = 101/204 (49.51%), Query Frame = 2
Query: 1175 LFLLDVFRN-EIKEDFLF*EPLTETTNAVYIMSIMNGFFVANELSWNNVRAICTDGAPAMPWKNSGFIALVKQ------INPHVFSSHCVLRRHALESKTLPSYFKEVLNIVVKTVNFIKSRALNQSLFKVLCEEVGCAHTVLLLHTGIRWLSRGKVLSRVFELRSQIETFLNDKESTLLLDFTDTSFVLSLAYLADIFSHLNT 1765
            +F+  V  N ++ E+ L   P+T   +   I   +        + W+ + ++ + G PAM   NSG +  ++           + S  C++    L ++ L      V+++VV +VN+I SR LN   F  L  E+   +  LL HT ++WL RG VL R FE   +I++F++ +    +   +   ++L LA+L D+ +HLNT
Sbjct:  559 IFIRGVDDNFDVSEELLDTVPMTGAKSGNEIFLRVEKSLKKFSIDWSKLVSVASTGTPAMMDANSGLVTKLRARAASCCKGADLKSVRCIIHPEWLCAQKL--RMGHVMDVVVDSVNWICSRGLNHGDFTTLLYELDSQYGSLLYHTALKWLGRGLVLRRFFESLEEIDSFMSSR-GKPVPQLSSRDWILDLAFLVDMTTHLNT 759          

HSP 2 Score: 23.0978 bits (48), Expect = 8.149e-17
Identity = 8/22 (36.36%), Postives = 15/22 (68.18%), Query Frame = 1
Query: 1129 LQLDESIDVSNCAQLLVFVRCV 1194
            + +DE  D+++  QL +F+R V
Sbjct:  543 IAIDEITDINDTTQLAIFIRGV 564          
BLAST of Protein ZBED8 vs. Ensembl Mouse
Match: Epm2aip1 (EPM2A (laforin) interacting protein 1 [Source:MGI Symbol;Acc:MGI:1925031])

HSP 1 Score: 52.373 bits (124), Expect = 1.583e-6
Identity = 52/204 (25.49%), Postives = 95/204 (46.57%), Query Frame = 2
Query: 1172 FLFLLDVFRN-EIKEDFLF*EPLTETTNAVYIMSIMNGFFVANELSWNNVRAICTDGAPAMPWKNSGFIALVKQ--INPHVFSSHCVLRRHALESKTLPSY---FKEVLNIVVKTVNFIKSRALNQSLFKVLCEEVGCAHTVLLLHTGIR-WLSRGKVLSRVFELRSQIETFLNDKESTLLLDFTDTSFVLSLAYLADIFSHLN 1762
             +F+  V R+ E++ED L    LT   +   +MS +        LS   +  + T     M  +NSG ++ +++  ++P+ ++   +     L  + L SY     +++N + + V  IK+R + +  F+ L  E    H   +    +  WL RGK L  +F LR +IE FL    +T  + F+D  ++    +L DI  +L 
Sbjct:  193 LVFIRGVGRDLEVQEDLLTIINLTHHFSVGALMSAILEALQTAGLSLQRMVGLTTTHTLRMIGENSGLVSYMREKAVSPNCWN--VIHYSGFLHLELLSSYDVDINQIINTISEWVVMIKTRGVRRPEFQPLLTESESEHGERVNGRCLNNWLRRGKTLKLIFSLRKEIEAFLVSVGAT-TVHFSDKQWLCDFGFLVDIMDYLR 393          
BLAST of Protein ZBED8 vs. UniProt/SwissProt
Match: sp|Q8IZ13|ZBED8_HUMAN (Protein ZBED8 OS=Homo sapiens OX=9606 GN=ZBED8 PE=1 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 9.589e-79
Identity = 83/195 (42.56%), Postives = 127/195 (65.13%), Query Frame = 2
Query: 1178 FLLDVFRNEIKEDFLF*EPLTETTNAVYIMSIMNGFFVANELSWNNVRAICTDGAPAMPWKNSGFIALVKQINPHVFSSHCVLRRHALESKTLPSYFKEVLNIVVKTVNFIKSRALNQSLFKVLCEEVGCAHTVLLLHTGIRWLSRGKVLSRVFELRSQIETFLNDKESTLLLDFTDTSFVLSLAYLADIFSHLN 1762
            F+  +   EI E+FLF EPL  +   + + ++   FF+ ++++ +   ++CTDGA +M  +NS F+A VK+  PH+  +HC+L  HAL  KTLP+  ++ L  VV+ +NFIK RA N  LF+   EE+G  ++VLL HT +RWLSRG++L+ +FE+  +I  FL+ K S L+  F +  F + LAYLAD+F HLN
Sbjct:  191 FVRYIKEREIVEEFLFCEPLQLSMKGIDVFNLFRDFFLKHKIALDVCGSVCTDGASSMLGENSEFVAYVKKEIPHIVVTHCLLNPHALVIKTLPTKLRDALFTVVRVINFIKGRAPNHRLFQAFFEEIGIEYSVLLFHTEMRWLSRGQILTHIFEMYEEINQFLHHKSSNLVDGFENKEFKIHLAYLADLFKHLN 385          

HSP 2 Score: 145.976 bits (367), Expect = 9.589e-79
Identity = 75/195 (38.46%), Postives = 116/195 (59.49%), Query Frame = 1
Query:  610 MSKKRCYQDSDIQFGFTFLVDKNGLHKPQYLLCLKVLSNGFMEPSKLKEHLQAVHPKNVNDPEALFIINRARFETSAKLTNHGFVPEKKPALEASYRVALRIAKDKTSHTIAETLIKLCAMEMAEIICGKDAKLKISQIPLSNHTIHDQIKDMSEDVLKQIVVQIQESSTKIGLQLDESIDVSNCAQLLVFVRCV 1194
            MSKKR + D  +++ FT   + +G  +PQ +LC  V SN  + PSKL +H    H               A  + S  L   G    +   L+ASY+ A   AK+K  HT+AE L+K CA+E+A+I+ G DA+ K+ Q+PLS+  IH +I +MS+D+L+Q++  I+ S  K+G+QL E+ D+ +C+QL+ FVR +
Sbjct:    1 MSKKRKWDDDYVRYWFTCTTEVDGTQRPQCVLCNSVFSNADLRPSKLSDHFNRQHGGVAGHDLNSLKHMPAPSDQSETLKAFGVASHEDTLLQASYQFAYLCAKEKNPHTVAEKLVKPCALEIAQIVLGPDAQKKLQQVPLSDDVIHSRIDEMSQDILQQVLEDIKASPLKVGIQLAETTDMDDCSQLMAFVRYI 195          
BLAST of Protein ZBED8 vs. UniProt/SwissProt
Match: sp|A4Z945|ZBED8_BOVIN (Protein ZBED8 OS=Bos taurus OX=9913 GN=ZBED8 PE=2 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 9.720e-78
Identity = 80/195 (41.03%), Postives = 125/195 (64.10%), Query Frame = 2
Query: 1178 FLLDVFRNEIKEDFLF*EPLTETTNAVYIMSIMNGFFVANELSWNNVRAICTDGAPAMPWKNSGFIALVKQINPHVFSSHCVLRRHALESKTLPSYFKEVLNIVVKTVNFIKSRALNQSLFKVLCEEVGCAHTVLLLHTGIRWLSRGKVLSRVFELRSQIETFLNDKESTLLLDFTDTSFVLSLAYLADIFSHLN 1762
            F+  +   EI E+FLF EPL  T     + ++   FF+ ++++ +   ++CTDGA +M  +NS F+  VK+  PH+  +HC++  H L +KTLP+  ++ L  VV+ +NFIK RA N  LF+   EE+G  ++VLL HT +RWLSRG++L+ +FE+  +I  FL+ + S L+  F +  F + LAYLAD+F HLN
Sbjct:  191 FVRYIREREIVEEFLFCEPLQLTMKGKDVFNLFRDFFLKHKIALDVCGSVCTDGASSMLGENSEFVCCVKKEVPHIVITHCLVNPHTLVTKTLPTKLRDALFTVVRVINFIKGRAPNHRLFQAFFEEIGIEYSVLLFHTEMRWLSRGQILTHIFEMHEEINQFLHHQSSNLVDGFENKEFKIHLAYLADLFKHLN 385          

HSP 2 Score: 147.132 bits (370), Expect = 9.720e-78
Identity = 77/196 (39.29%), Postives = 122/196 (62.24%), Query Frame = 1
Query:  610 MSKKRCYQDSDIQFGFTFLVDKNGLHKPQYLLCLKVLSNGFMEPSKLKEHLQAVHPK-NVNDPEALFIINRARFETSAKLTNHGFVPEKKPALEASYRVALRIAKDKTSHTIAETLIKLCAMEMAEIICGKDAKLKISQIPLSNHTIHDQIKDMSEDVLKQIVVQIQESSTKIGLQLDESIDVSNCAQLLVFVRCV 1194
            MSKKR + D  +++ FT + + +G  +PQ +LC  V SN  + PSKL +H    H     +D  +L  +     + S  L   G   ++   L+ASY+ A   AK+K  HTIAE L+K CA+E+A+I+ G DA+ K+ Q+PLS+  IH +I +MS+D+L+Q++  I+ S  K+G+QL E+ D+ +C+QL+ FVR +
Sbjct:    1 MSKKRKWDDDYVRYWFTCVTEIDGTQRPQCVLCNSVFSNADLRPSKLSDHFNRQHGGIGGHDLSSLKHVPVPA-DQSETLKTFGVASQEDALLQASYQFAYLCAKEKNPHTIAEKLVKPCALEIAQIVLGPDAQKKLQQVPLSDDVIHSRIDEMSQDILQQVLEDIKASPLKVGIQLAETTDMDDCSQLMAFVRYI 195          
BLAST of Protein ZBED8 vs. UniProt/SwissProt
Match: sp|A4Z943|ZBED5_BOVIN (Zinc finger BED domain-containing protein 5 OS=Bos taurus OX=9913 GN=ZBED5 PE=4 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 8.613e-65
Identity = 84/197 (42.64%), Postives = 119/197 (60.41%), Query Frame = 2
Query: 1172 FLFLLDVFRNEIKEDFLF*EPLTETTNAVYIMSIMNGFFVANELSWNNVRAICTDGAPAMPWKNSGFIALVKQINPHVFSSHCVLRRHALESKTLPSYFKEVLNIVVKTVNFIKSRALNQSLFKVLCEEVGCAHTVLLLHTGIRWLSRGKVLSRVFELRSQIETFLNDKESTLLLDFTDTSFVLSLAYLADIFSHLN 1762
             +F+   F   I+ED L  E L        I + +N F   +E+ W     +C+D + AM  K +  + L+K + P   SSHC+L RHAL  KT+P+  K VL+  V+ +N+IK+R     L K+LCEE+G  HT LLL+T +RWLSRGKVL R+FELR ++  F+ D    L    T++S++L LAYLADIF+ LN
Sbjct:  291 LVFVRYRFNKSIEEDLLLCESLQSNATGEEIFNCINSFMQKHEIEWEKCVDVCSDASRAMDGKIAEAVTLIKYVAPESTSSHCLLYRHALAVKTMPTSLKNVLDQAVQIINYIKARPHQSRLLKILCEEMGAQHTALLLNTEVRWLSRGKVLVRLFELRRELLVFM-DSAFRLSDCLTNSSWLLRLAYLADIFTKLN 486          

HSP 2 Score: 109.768 bits (273), Expect = 8.613e-65
Identity = 70/191 (36.65%), Postives = 106/191 (55.50%), Query Frame = 1
Query:  616 KKRCYQDSDIQFGFTFLVDKNGLHKPQYLLCLKVLSNGFMEPSKLKEHLQAVHPKNVNDPEALFIINRARFETSAKLTNHGFVPEKKPALEASYRVALRIAKDKTSHTIAETLIKLCAMEMAEIICGKDAKLKISQIPLSNHTIHDQIKDMSEDVLKQIVVQIQESSTKIGLQLDESIDVSNCAQLLVFVR 1188
            K+R Y +S + FGFT+  +++  H  Q +LC K+LSN  + PSKL+ HL+  H    +   + F  +    E +   T      + + A EASY V+  IA    +HTI E LIK CA ++   +  +    KI  + LSN T+  +IKD++ D+ +++V +++       LQLDES DVS  A LLVFVR
Sbjct:  107 KRRKYDESYLSFGFTYFGNRDAPH-AQCVLCKKILSNSSLAPSKLRRHLETKHAAYKDKDISFFKQHLDSPENNKPPTPKIVNTDNESATEASYNVSYHIALSGEAHTIGELLIKPCAKDVVMRMFDEQYSKKIDAVQLSNSTVARRIKDLAADIEEELVCRLKICD-GFSLQLDESADVSGLAVLLVFVR 295          
BLAST of Protein ZBED8 vs. UniProt/SwissProt
Match: sp|A4Z944|ZBED5_CANLF (Zinc finger BED domain-containing protein 5 OS=Canis lupus familiaris OX=9615 GN=ZBED5 PE=4 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 3.441e-64
Identity = 83/197 (42.13%), Postives = 118/197 (59.90%), Query Frame = 2
Query: 1172 FLFLLDVFRNEIKEDFLF*EPLTETTNAVYIMSIMNGFFVANELSWNNVRAICTDGAPAMPWKNSGFIALVKQINPHVFSSHCVLRRHALESKTLPSYFKEVLNIVVKTVNFIKSRALNQSLFKVLCEEVGCAHTVLLLHTGIRWLSRGKVLSRVFELRSQIETFLNDKESTLLLDFTDTSFVLSLAYLADIFSHLN 1762
             +F+   F   I+ED L  E L        I + +N F   +E+ W     +C+D + AM  K +  + L+K + P   SSHC+L RHAL  K +P+  K VL+  V+ +N+IK+R     L K+LCEE+G  HT LLL+T +RWLSRGKVL R+FELR ++  F+ D    L    T++S++L LAYLADIF+ LN
Sbjct:  291 LVFVRYRFNKSIEEDLLLCESLQSNATGEEIFNCINSFMQKHEIEWEKCVDVCSDASRAMDGKIAEAVTLIKYVAPESTSSHCLLYRHALAVKIMPTSLKNVLDQAVQIINYIKARPHQSRLLKILCEEMGAQHTALLLNTEVRWLSRGKVLVRLFELRRELLVFM-DSAFRLSDCLTNSSWLLRLAYLADIFTKLN 486          

HSP 2 Score: 109.383 bits (272), Expect = 3.441e-64
Identity = 70/191 (36.65%), Postives = 106/191 (55.50%), Query Frame = 1
Query:  616 KKRCYQDSDIQFGFTFLVDKNGLHKPQYLLCLKVLSNGFMEPSKLKEHLQAVHPKNVNDPEALFIINRARFETSAKLTNHGFVPEKKPALEASYRVALRIAKDKTSHTIAETLIKLCAMEMAEIICGKDAKLKISQIPLSNHTIHDQIKDMSEDVLKQIVVQIQESSTKIGLQLDESIDVSNCAQLLVFVR 1188
            K+R Y +S + FGFT+  +++  H  Q +LC K+LSN  + PSKL+ HL+  H    +   + F  +    E +   T      + + A EASY V+  IA    +HTI E LIK CA ++   +  +    KI  + LSN T+  +IKD++ D+ +++V +++       LQLDES DVS  A LLVFVR
Sbjct:  107 KRRKYDESYLSFGFTYFGNRDAPH-AQCVLCKKILSNSSLAPSKLRRHLETKHAAYKDKDISFFKQHLDSPENNKPPTPKIVNTDNESATEASYNVSYHIALSGEAHTIGELLIKPCAKDVVMRMFDEQYSKKIDAVQLSNSTVARRIKDLAADIEEELVCRLKICD-GFSLQLDESADVSGLAVLLVFVR 295          
BLAST of Protein ZBED8 vs. UniProt/SwissProt
Match: sp|Q49AG3|ZBED5_HUMAN (Zinc finger BED domain-containing protein 5 OS=Homo sapiens OX=9606 GN=ZBED5 PE=2 SV=2)

HSP 1 Score: 157.147 bits (396), Expect = 1.636e-63
Identity = 82/197 (41.62%), Postives = 118/197 (59.90%), Query Frame = 2
Query: 1172 FLFLLDVFRNEIKEDFLF*EPLTETTNAVYIMSIMNGFFVANELSWNNVRAICTDGAPAMPWKNSGFIALVKQINPHVFSSHCVLRRHALESKTLPSYFKEVLNIVVKTVNFIKSRALNQSLFKVLCEEVGCAHTVLLLHTGIRWLSRGKVLSRVFELRSQIETFLNDKESTLLLDFTDTSFVLSLAYLADIFSHLN 1762
             +F+   F   I+ED L  E L        I + +N F   +E+ W     +C+D + A+  K +  + L+K + P   SSHC+L RHAL  K +P+  K VL+  V+ +N+IK+R     L K+LCEE+G  HT LLL+T +RWLSRGKVL R+FELR ++  F+ D    L    T++S++L LAYLADIF+ LN
Sbjct:  290 LVFVRYRFNKSIEEDLLLCESLQSNATGEEIFNCINSFMQKHEIEWEKCVDVCSDASRAVDGKIAEAVTLIKYVAPESTSSHCLLYRHALAVKIMPTSLKNVLDQAVQIINYIKARPHQSRLLKILCEEMGAQHTALLLNTEVRWLSRGKVLVRLFELRRELLVFM-DSAFRLSDCLTNSSWLLRLAYLADIFTKLN 485          

HSP 2 Score: 109.383 bits (272), Expect = 1.636e-63
Identity = 70/191 (36.65%), Postives = 106/191 (55.50%), Query Frame = 1
Query:  616 KKRCYQDSDIQFGFTFLVDKNGLHKPQYLLCLKVLSNGFMEPSKLKEHLQAVHPKNVNDPEALFIINRARFETSAKLTNHGFVPEKKPALEASYRVALRIAKDKTSHTIAETLIKLCAMEMAEIICGKDAKLKISQIPLSNHTIHDQIKDMSEDVLKQIVVQIQESSTKIGLQLDESIDVSNCAQLLVFVR 1188
            K+R Y +S + FGFT+  +++  H  Q +LC K+LSN  + PSKL+ HL+  H    +   + F  +    E +   T      + + A EASY V+  IA    +HTI E LIK CA ++   +  +    KI  + LSN T+  +IKD++ D+ +++V +++       LQLDES DVS  A LLVFVR
Sbjct:  106 KRRKYDESYLSFGFTYFGNRDAPH-AQCVLCKKILSNSSLAPSKLRRHLETKHAAYKDKDISFFKQHLDSPENNKPPTPKIVNTDNESATEASYNVSYHIALSGEAHTIGELLIKPCAKDVVMRMFDEQYSKKIDAVQLSNSTVARRIKDLAADIEEELVCRLK-ICDGFSLQLDESADVSGLAVLLVFVR 294          
BLAST of Protein ZBED8 vs. TrEMBL
Match: A0A3S2TK00 (Reverse transcriptase domain-containing protein OS=Chilo suppressalis OX=168631 GN=evm_007079 PE=4 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 2.725e-108
Identity = 104/195 (53.33%), Postives = 138/195 (70.77%), Query Frame = 1
Query:  610 MSKKRCYQDSDIQFGFTFLVDKNGLHKPQYLLCLKVLSNGFMEPSKLKEHLQAVHPKNVNDPEALFIINRARFETSAKLTNHGFVPEKKPALEASYRVALRIAKDKTSHTIAETLIKLCAMEMAEIICGKDAKLKISQIPLSNHTIHDQIKDMSEDVLKQIVVQIQESSTKIGLQLDESIDVSNCAQLLVFVRCV 1194
            MSKKR Y +S + FGFTF+ +++G  KPQ  LC KVL+NG M+P+KL EHL+ VHP NV D    F   +ARFE +  L   GF P +KP LEASY+VA RIA+ K  HTIAETL+K CA+++ E++CGK+ + K+  +PLSN  IH +I +MS +VLKQ++ ++  S     +QLDES DVS C+QLLVFVR V
Sbjct:  335 MSKKRKYDESYVNFGFTFVTERDGTQKPQCFLCGKVLANGSMKPAKLSEHLKTVHPGNVCDSIDDFRTKKARFEKAGTLPKLGFTPTQKPCLEASYKVAYRIAQQKKPHTIAETLVKPCALDIVELVCGKNERKKVEAVPLSNDVIHSRIVEMSSNVLKQVIEELNASPFPFSMQLDESTDVSQCSQLLVFVRYV 529          

HSP 2 Score: 205.297 bits (521), Expect = 2.725e-108
Identity = 99/187 (52.94%), Postives = 132/187 (70.59%), Query Frame = 2
Query: 1205 IKEDFLF*EPLTETTNAVYIMSIMNGFFVANELSWN-NVRAICTDGAPAMPWKNSGFIALVKQINPHVFSSHCVLRRHALESKTLPSYFKEVLNIVVKTVNFIKSRALNQSLFKVLCEEVGCAHTVLLLHTGIRWLSRGKVLSRVFELRSQIETFLNDKESTLLLDFTDTSFVLSLAYLADIFSHLN 1762
            IKE+FLF + L ETT A  +  ++  FF+A  + W   + +ICTDGAPAM    SGF AL+K+  PHV  +HCVL RHAL S+T+P++ KEV++  VK +NFI++RALN  LFK LC+E+G  H VLL +T +RWLSRG+VL R+FELR ++  FL +KE++L        FV  LAYLADIF+HLN
Sbjct:  536 IKEEFLFCDSLLETTKASDVFEMIKKFFIAQNVDWKTKLGSICTDGAPAMLGNTSGFAALIKKECPHVIITHCVLHRHALASRTMPTFLKEVMSTCVKIINFIRARALNHRLFKKLCQEMGSEHEVLLYYTEVRWLSRGQVLKRLFELREEVLLFLKNKENSLYEYLEREDFVEGLAYLADIFTHLN 722          
BLAST of Protein ZBED8 vs. TrEMBL
Match: I3KX55 (Uncharacterized protein OS=Oreochromis niloticus OX=8128 GN=LOC109194546 PE=4 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 2.462e-90
Identity = 93/186 (50.00%), Postives = 126/186 (67.74%), Query Frame = 2
Query: 1205 IKEDFLF*EPLTETTNAVYIMSIMNGFFVANELSWNNVRAICTDGAPAMPWKNSGFIALVKQINPHVFSSHCVLRRHALESKTLPSYFKEVLNIVVKTVNFIKSRALNQSLFKVLCEEVGCAHTVLLLHTGIRWLSRGKVLSRVFELRSQIETFLNDKESTLLLDFTDTSFVLSLAYLADIFSHLN 1762
            IKEDFLF +PLT TT A  +  +++ FF  N LSW+ V A+CTDGAP M  +NSGF ALVK   PH+  +HC+L RHAL +KTLP    EVL  VV+ VN++++ AL   +F  LC+E+G    VLL H+ +RWLSRG+VL+RVF +R ++  FL + +      F +  F+L LAY+ADIF+ LN
Sbjct:  203 IKEDFLFCKPLTTTTKAADVKKLVDDFFRDNNLSWDMVSAVCTDGAPVMLGRNSGFGALVKADAPHIIVTHCILHRHALATKTLPPKMAEVLKTVVECVNYVRNSALRHRIFSELCKEMGSEFEVLLYHSNVRWLSRGQVLNRVFAMRVELALFLQEHQHCHANCFKNPEFLLILAYMADIFAALN 388          

HSP 2 Score: 171.4 bits (433), Expect = 2.462e-90
Identity = 91/194 (46.91%), Postives = 121/194 (62.37%), Query Frame = 1
Query:  613 SKKRCYQDSDIQFGFTFLVDKNGLHKPQYLLCLKVLSNGFMEPSKLKEHLQAVHPKNV--NDPEALFIINRARFETSAKLTNHGFVPEKKPALEASYRVALRIAKDKTSHTIAETLIKLCAMEMAEIICGKDAKLKISQIPLSNHTIHDQIKDMSEDVLKQIVVQIQESSTKIGLQLDESIDVSNCAQLLVFVR 1188
             K+R + D  +Q+GFT + +++G  +P  ++C   LSN  + P+KLKEH   +H      N   A F + RARF+    L   GFVP  KP L ASY VA  IAK    HTI ETL+K  A++MA +I G  A+ K+SQIPLSN T+ D+I+DMS+D+L Q+V  +  S  K  LQLDES DV+N  QL VFVR
Sbjct:    3 GKRRKWSDEYVQYGFTCITERDGSERPICMICNAKLSNSSLAPAKLKEHFLKLHGDGEYKNTTLAEFKVKRARFDERPTLPALGFVPVNKPILTASYEVAYLIAKQGKPHTIGETLVKPAALKMANLILGTVAEGKLSQIPLSNDTVSDRIEDMSKDILAQVVADLISSPAKFSLQLDESTDVANLRQLTVFVR 196          
BLAST of Protein ZBED8 vs. TrEMBL
Match: A0A4C1ZHQ9 (Protein ZBED8 OS=Eumeta variegata OX=151549 GN=ZBED8 PE=4 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 3.891e-90
Identity = 97/187 (51.87%), Postives = 130/187 (69.52%), Query Frame = 2
Query: 1205 IKEDFLF*EPLTETTNAVYIMSIMNGFFVANELSWN-NVRAICTDGAPAMPWKNSGFIALVKQINPHVFSSHCVLRRHALESKTLPSYFKEVLNIVVKTVNFIKSRALNQSLFKVLCEEVGCAHTVLLLHTGIRWLSRGKVLSRVFELRSQIETFLNDKESTLLLDFTDTSFVLSLAYLADIFSHLN 1762
            IKE+FLF + L ETT A  +  ++  FF+A  + W   + +ICTDG PAM    SGF AL+K+   HV  +HCVL RHAL S+T+P++ KEV++  VK +NFI++RALN  LFK LC+E+G  H VLL +T +RWLSRG+VL R+FELR ++  FL +KE++L        FV  LAYLADIF+HLN
Sbjct:  212 IKEEFLFCDSLLETTKASDVFEMIKKFFIAQNVDWKTKLGSICTDGTPAMLGNTSGFAALIKKECSHVIITHCVLHRHALASRTMPTFLKEVMSTCVKIINFIRARALNHRLFKKLCQEMGSEHEVLLYYTEVRWLSRGQVLKRLFELREEVLLFLKNKENSLYEYLEREDFVEGLAYLADIFTHLN 398          

HSP 2 Score: 163.31 bits (412), Expect = 3.891e-90
Identity = 79/150 (52.67%), Postives = 104/150 (69.33%), Query Frame = 1
Query:  745 KLKEHLQAVHPKNVNDPEALFIINRARFETSAKLTNHGFVPEKKPALEASYRVALRIAKDKTSHTIAETLIKLCAMEMAEIICGKDAKLKISQIPLSNHTIHDQIKDMSEDVLKQIVVQIQESSTKIGLQLDESIDVSNCAQLLVFVRCV 1194
            KL EHL+ VHP NV D    F   +ARFE +  L   GF P +KP LEASY+VA RIA+ K  HTIAETL+K CA+++ E++CGK+ + K+  +PLSN  IH +I +MS +VLKQ++ ++  S     +QLDES DVS C+QLLVFVR V
Sbjct:   56 KLSEHLKTVHPGNVCDSIDDFRTKKARFEKAGTLPKLGFTPTQKPCLEASYKVAYRIAQQKKPHTIAETLVKPCALDIVELVCGKNERKKVEAVPLSNDVIHSRIVEMSSNVLKQVIEELNASPFPFSMQLDESTDVSQCSQLLVFVRYV 205          
BLAST of Protein ZBED8 vs. TrEMBL
Match: A0A3P8NKB0 (DUF4371 domain-containing protein OS=Astatotilapia calliptera OX=8154 PE=4 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 4.263e-90
Identity = 94/196 (47.96%), Postives = 131/196 (66.84%), Query Frame = 2
Query: 1175 LFLLDVFRNEIKEDFLF*EPLTETTNAVYIMSIMNGFFVANELSWNNVRAICTDGAPAMPWKNSGFIALVKQINPHVFSSHCVLRRHALESKTLPSYFKEVLNIVVKTVNFIKSRALNQSLFKVLCEEVGCAHTVLLLHTGIRWLSRGKVLSRVFELRSQIETFLNDKESTLLLDFTDTSFVLSLAYLADIFSHLN 1762
            +F+  V  + IKEDFLF +PLT TT A  +  +++ FF  N LSW+ V A+CTDGAP M  +NSGF ALVK   PH+  +HC+L RHAL +KTLP    EVL  VV+ VN++++ AL   +F  LC+E+G    VLL H+ ++WLSRG+VL+RVF +R ++  FL + +      F +  F+L LAY+ADIF+ LN
Sbjct:  193 VFVRYVKDDMIKEDFLFCKPLTTTTKAADVKKLVDDFFGDNNLSWDMVSAVCTDGAPVMLGRNSGFGALVKADAPHIIVTHCILHRHALATKTLPPKMAEVLKTVVECVNYVRNSALRHRIFSELCKEMGSEFEVLLYHSNVQWLSRGQVLNRVFAMRMELALFLQEHQHCHADCFKNPEFILILAYMADIFAALN 388          

HSP 2 Score: 171.014 bits (432), Expect = 4.263e-90
Identity = 92/196 (46.94%), Postives = 122/196 (62.24%), Query Frame = 1
Query:  613 SKKRCYQDSDIQFGFTFLVDKNGLHKPQYLLCLKVLSNGFMEPSKLKEHLQAVHPKNV--NDPEALFIINRARFETSAKLTNHGFVPEKKPALEASYRVALRIAKDKTSHTIAETLIKLCAMEMAEIICGKDAKLKISQIPLSNHTIHDQIKDMSEDVLKQIVVQIQESSTKIGLQLDESIDVSNCAQLLVFVRCV 1194
             KKR + D  +Q+GFT + +++G  +P  ++C   LSN  + P+KLKE    +H      N   A F + RARF+    L   GFVP  KP L ASY VA  IAK    HTI ETL+K  A++MA +I G  A+ K+SQIPLSN T+ D+I+DMS+D+L Q+V  +  S  K  LQLDES DV+N +QL VFVR V
Sbjct:    3 GKKRKWLDEYVQYGFTCITERDGSERPICMICNAKLSNSSLAPAKLKERFLKLHGDGEYKNTTLAEFKVKRARFDERPTLPALGFVPVNKPILTASYEVAYLIAKQGKPHTIGETLVKPAALKMANLILGTAAEGKLSQIPLSNDTVSDRIEDMSKDILAQVVADLISSPAKFSLQLDESTDVANLSQLTVFVRYV 198          
BLAST of Protein ZBED8 vs. TrEMBL
Match: A0A3P8NNM4 (Uncharacterized protein OS=Astatotilapia calliptera OX=8154 PE=4 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 8.077e-90
Identity = 94/196 (47.96%), Postives = 131/196 (66.84%), Query Frame = 2
Query: 1175 LFLLDVFRNEIKEDFLF*EPLTETTNAVYIMSIMNGFFVANELSWNNVRAICTDGAPAMPWKNSGFIALVKQINPHVFSSHCVLRRHALESKTLPSYFKEVLNIVVKTVNFIKSRALNQSLFKVLCEEVGCAHTVLLLHTGIRWLSRGKVLSRVFELRSQIETFLNDKESTLLLDFTDTSFVLSLAYLADIFSHLN 1762
            +F+  V  + IKE FLF +PLT+TT A  +  +++ FF  N LSW+ V A+CTDGAP M  +NSGF ALVK   PH+  +HC+L RHAL +KTLP    EVL  VV+ VN++++ AL   +F  LC+E+G    VLL H+ +RWLSRG+VL+RVF +R ++  FL + +      F +  F+L LAY+ADIF+ LN
Sbjct:  193 VFVRYVKDDMIKEGFLFCKPLTKTTKAADVKKLVDDFFGDNNLSWDMVSAVCTDGAPVMLGRNSGFGALVKADAPHIIVTHCILHRHALATKTLPPKMAEVLKTVVECVNYVRNSALRHRIFSELCKEMGSEFEVLLYHSNVRWLSRGQVLNRVFAMRVELALFLQEHQHCHADCFKNPEFILILAYMADIFAALN 388          

HSP 2 Score: 170.629 bits (431), Expect = 8.077e-90
Identity = 92/196 (46.94%), Postives = 122/196 (62.24%), Query Frame = 1
Query:  613 SKKRCYQDSDIQFGFTFLVDKNGLHKPQYLLCLKVLSNGFMEPSKLKEHLQAVHPKNV--NDPEALFIINRARFETSAKLTNHGFVPEKKPALEASYRVALRIAKDKTSHTIAETLIKLCAMEMAEIICGKDAKLKISQIPLSNHTIHDQIKDMSEDVLKQIVVQIQESSTKIGLQLDESIDVSNCAQLLVFVRCV 1194
             KKR + D  +Q+GFT + +++G  +P  ++C   LSN  + P+KLKEH   +H      N   A F + RARF+    L   GFVP  KP L ASY VA  IAK    HTI ETL+K  A++MA +I G  A+ K+SQIPLSN T+ D+I+DMS+D+L Q+V  +  S  K  LQLDES DV+N +Q  VFVR V
Sbjct:    3 GKKRKWLDEYVQYGFTCITERDGSERPICMICNAKLSNSSLAPAKLKEHFLKLHGDGEYKNTTLAEFKVKRARFDERPTLPALGFVPVNKPILTASYEVAYLIAKQGKPHTIGETLVKPAALKMANLILGTVAEGKLSQIPLSNDTVSDRIEDMSKDILAQVVADLISSPAKFSLQLDESTDVANLSQPTVFVRYV 198          
BLAST of Protein ZBED8 vs. Ensembl Cavefish
Match: ENSAMXT00000051422.1 (pep primary_assembly:Astyanax_mexicanus-2.0:15:35461191:35465166:-1 gene:ENSAMXG00000032672.1 transcript:ENSAMXT00000051422.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 183.341 bits (464), Expect = 3.612e-70
Identity = 95/187 (50.80%), Postives = 120/187 (64.17%), Query Frame = 2
Query: 1202 EIKEDFLF*EPLTETTNAVYIMSIMNGFFVANELSWNNVRAICTDGAPAMPWKNSGFIALVKQINPHVFSSHCVLRRHALESKTLPSYFKEVLNIVVKTVNFIKSRALNQSLFKVLCEEVGCAHTVLLLHTGIRWLSRGKVLSRVFELRSQIETFLNDKESTLLLDFTDTSFVLSLAYLADIFSHLN 1762
            EI ED LF +PL   T AV I  ++N F V+N + W+    + TDGA AM  + SG IA VK + P   S HC L R AL +K +    K VL+  VK VNFIKSR L   LF+VLCEE+G +H  LLLHT +RWLSRGKVL+R+FELR ++  FL D    L   FTD  ++  L+YL+DIF+HLN
Sbjct:  276 EIFEDILFCKPLPTKTTAVAIFDVLNAFIVSNGIEWSKCVGVSTDGARAMMGQRSGVIARVKAVAPLATSVHCSLHREALAAKRMSRDLKIVLDEAVKIVNFIKSRPLQSRLFRVLCEEMGSSHVQLLLHTEVRWLSRGKVLARLFELRDEVRIFLLDSNFELSDRFTDFEWLAKLSYLSDIFTHLN 462          

HSP 2 Score: 102.834 bits (255), Expect = 3.612e-70
Identity = 67/198 (33.84%), Postives = 108/198 (54.55%), Query Frame = 1
Query:  604 IPMSKKRCYQDSDIQFGFTFLVDKNGLHKPQYLLCLKVLSNGFMEPSKLKEHLQAVHPKNVNDPEALFIINRARFETSAK---LTNHGFVPEKKPALEASYRVALRIAKDKTSHTIAETLIKLCAMEMAEIICGKDAKLKISQIPLSNHTIHDQIKDMSEDVLKQIVVQIQESSTKIGLQLDESIDVSNCAQLLVFVR 1188
             P  K   Y    +  GFT    +N    P  ++C +VL+N  ++P+KL+ HL+  H +  + P   F      +++  K   L   G   +   A+EASYRVA  IAK    HTI E+LI   A EM  ++ G+    +++ I LS++T+  +I +M+ DV +Q++ +++ES     +QLDES D++N + LL FVR
Sbjct:   77 FPFPKWTLYCSEYLALGFTCTGTENE-PLPLCVVCSEVLANEALKPTKLRRHLETKHSEYASKPVEFFENKLKEYQSRKKTLELACSG--TDNAKAVEASYRVAQLIAKAGKPHTIGESLILPAAKEMVSVMLGEKPCKQLNLISLSDNTVERRINEMAHDVTQQLIKRVRESRF-YAIQLDESTDIANLSNLLAFVR 270          
BLAST of Protein ZBED8 vs. Ensembl Cavefish
Match: ENSAMXT00000044261.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000070.1:2279767:2281653:1 gene:ENSAMXG00000037161.1 transcript:ENSAMXT00000044261.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 173.326 bits (438), Expect = 9.883e-67
Identity = 91/187 (48.66%), Postives = 116/187 (62.03%), Query Frame = 2
Query: 1202 EIKEDFLF*EPLTETTNAVYIMSIMNGFFVANELSWNNVRAICTDGAPAMPWKNSGFIALVKQINPHVFSSHCVLRRHALESKTLPSYFKEVLNIVVKTVNFIKSRALNQSLFKVLCEEVGCAHTVLLLHTGIRWLSRGKVLSRVFELRSQIETFLNDKESTLLLDFTDTSFVLSLAYLADIFSHLN 1762
            EI ED LF +PL   T A  I  ++N   V+N + W+    + TDGA AM  + SG IA VK + P   S HC L R AL +K +    K VL+  VK VNFIKSR L   LF+VLCEE+  +H  LLLHT +RWLS GKVL+R+FELR ++  FL D    L   FTD  ++  L+YL+DIF+HLN
Sbjct:  233 EIFEDILFCKPLPTKTTAEAIFDVLNALIVSNGIEWSKCVGVSTDGARAMMGQRSGVIASVKAVAPLATSVHCSLHREALAAKRMSRDLKIVLDEAVKIVNFIKSRPLQSRLFRVLCEEMASSHVQLLLHTEVRWLSHGKVLARLFELRDEVRIFLLDSNFELSDRFTDFEWLAKLSYLSDIFTHLN 419          

HSP 2 Score: 100.908 bits (250), Expect = 9.883e-67
Identity = 66/198 (33.33%), Postives = 108/198 (54.55%), Query Frame = 1
Query:  616 KKRCYQDSDIQFGFTFLVDKNGLHKPQYLLCLKVLSNGFMEPSKLKEHLQAVHPKNVNDPEALFIINRARFETSAKL-------TNHGFVPEKKPALEASYRVALRIAKDKTSHTIAETLIKLCAMEMAEIICGKDAKLKISQIPLSNHTIHDQIKDMSEDVLKQIVVQIQESSTKIGLQLDESIDVSNCAQLLVFVR 1188
            K+R Y    +  GFT    +N    P  ++C +VL+N  ++ +KL+ HL+  H +  + P   F      +++  K        T+H        A+EASYRVA  IAK    HTI E+LI   A EM  ++ G+    +++ I LS++T+  +I +M+ DV +Q++ +++ES     +QLDES D++N + LL FVR
Sbjct:   38 KRRKYSSEYLALGFTCTGTENE-PLPLCVVCSEVLANEALKTTKLRRHLETKHSEYASKPVEFFENKLKEYQSRKKTLELACSGTDHA------KAVEASYRVAQLIAKAGKPHTIGESLILPAAKEMVSVMLGEKPCKQLNLISLSDNTVERRINEMAHDVTQQLIKRVRESRF-YAIQLDESTDIANLSNLLAFVR 227          
BLAST of Protein ZBED8 vs. Ensembl Cavefish
Match: ENSAMXT00000057314.1 (pep primary_assembly:Astyanax_mexicanus-2.0:1:4224188:4227217:-1 gene:ENSAMXG00000029268.1 transcript:ENSAMXT00000057314.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 122.865 bits (307), Expect = 5.586e-52
Identity = 71/187 (37.97%), Postives = 95/187 (50.80%), Query Frame = 2
Query: 1202 EIKEDFLF*EPLTETTNAVYIMSIMNGFFVANELSWNNVRAICTDGAPAMPWKNSGFIALVKQINPHVFSSHCVLRRHALESKTLPSYFKEVLNIVVKTVNFIKSRALNQSLFKVLCEEVGCAHTVLLLHTGIRWLSRGKVLSRVFELRSQIETFLNDKESTLLLDFTDTSFVLSLAYLADIFSHLN 1762
            E+K+D L    L  TT    I S ++ +  ++ + + N+ A CTDGA +M  KN GF + +K+  PH    HC++ RHAL  K L     E L  VVK VNFIK+R +N+ +F  LCE+    H  LLLHT +RWLSRGK                               F++  AYLADIFS  N
Sbjct:  199 EVKQDILMSVNLKSTTRGEDIFSAVDTYITSHNIPYKNIVACCTDGAASMMGKNKGFNSRLKEKAPHCLVFHCMVHRHALAGKHLCEDLNETLKTVVKIVNFIKARPVNRRIFAQLCEDE--THQTLLLHTEVRWLSRGK-------------------------------FLIKTAYLADIFSLYN 352          

HSP 2 Score: 102.064 bits (253), Expect = 5.586e-52
Identity = 68/199 (34.17%), Postives = 106/199 (53.27%), Query Frame = 1
Query:  619 KRCYQDSDIQFGFTFLVDKNGLHKPQYLLCLKVLSNGFMEPSKLKEHLQAVHPKNVNDPEALF-------IINRARFETSAKLTNHGFVPEKKPALEASYRVALRIAKDKTSHTIAETLIKLCAMEMAEIICGKDAKLKISQIPLSNHTIHDQIKDMSEDVLKQIVVQIQESSTKIGLQLDESIDVSNCAQLLVFVRCV 1194
            KR YQ+S I++GF   +DK    + + + C   L+N  ++P  LK H    HP+ V  P+  F       + NR +      L   G   + + A  AS+  +L IAKDK  HTI ETLIK   ++MAE +CG     K   +PLSN+T+ D+I  M+ +V   +V +++ S     +QLDE+  V+  A L+V+ + +
Sbjct:    5 KRWYQESFIEYGFIEAMDKV---RAECIFCRDKLANESLKPCNLKRHQTTKHPETVGKPKEFFLRKKELLVANRPQ-NIKDSLLRAG--SDHRQATIASFECSLLIAKDKKPHTIGETLIKPACIKMAERMCGPQVANKFKIVPLSNNTVKDRIDRMAGNVENTLVEKLKTSP--FSIQLDETTTVAEEAILIVYAQYI 195          
BLAST of Protein ZBED8 vs. Ensembl Cavefish
Match: ENSAMXT00000039226.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000099.1:564912:568121:1 gene:ENSAMXG00000042173.1 transcript:ENSAMXT00000039226.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 127.102 bits (318), Expect = 2.535e-38
Identity = 75/188 (39.89%), Postives = 108/188 (57.45%), Query Frame = 2
Query: 1205 IKEDFLF*EPLTETTNAVYIMSIMNGFFVANELSWNNVRAICTDGAPAMPWKNSGFIALVKQ--INPHVFSSHCVLRRHALESKTLPSYFKEVLNIVVKTVNFIKSRALNQSLFKVLCEEVGCAHTVLLLHTGIRWLSRGKVLSRVFELRSQIETFLNDKESTLLLDFTDTSFVLSLAYLADIFSHLN 1762
            +KEDFL   PL E T    I      +   N+L +  + +I  DGAPAM   ++GFIAL ++  I P   S HCV+ + AL SK +   F  V+ +VVK VN I+++AL   LFK L +E+   +  L+LH  +RWLSRGKVL R   L  +I +FL  ++     +  D +++L LA+L D+ S LN
Sbjct:  206 VKEDFLTLLPLNERTRGEDIYRAFRTYATENDLPFQKLVSITRDGAPAMCGIHAGFIALCRKDPIFPAFVSYHCVIHQQALASKVVD--FSHVMTVVVKIVNSIRAKALQHRLFKSLLDELDAEYGDLILHADVRWLSRGKVLQRFINLLPEIISFLKSRKEE-YRELADDTWLLDLAFLTDLTSKLN 390          

HSP 2 Score: 52.373 bits (124), Expect = 2.535e-38
Identity = 38/107 (35.51%), Postives = 59/107 (55.14%), Query Frame = 1
Query:  886 EASYRVALRIAKDKTSHTIAETLIKLCAMEMAEIICGKDAKLK------ISQIPLSNHTIHDQIKDMSEDVLKQIVVQIQESSTKIGLQLDESIDVSNCAQLLVFVR 1188
            EAS+RV+  +AK K + T  E   +  AM  A     +D K K      IS + L   T+  +++ +SED+ KQ++  +        LQ DES+D+++ AQL+VFVR
Sbjct:   95 EASFRVSHLLAKHKKTFTDGELFKE--AMLFASDSLFRDFKNKDEIRTAISNMSLGPATVVRRVELLSEDISKQVLSDLSRCEY-FSLQFDESVDITDTAQLVVFVR 198          
BLAST of Protein ZBED8 vs. Ensembl Cavefish
Match: ENSAMXT00000030525.1 (pep primary_assembly:Astyanax_mexicanus-2.0:1:12992682:12994541:1 gene:ENSAMXG00000035573.1 transcript:ENSAMXT00000030525.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.071 bits (266), Expect = 1.800e-36
Identity = 66/200 (33.00%), Postives = 106/200 (53.00%), Query Frame = 2
Query: 1202 EIKEDFLF*EPLTETTNAVYIMSIMNGFFVANELSWNNVRAICTDGAPAMPWKNSGFIALVKQINPHVFSSHCVLRRHALESKTLPSYFKEVLNIVVKTVNFIKSRALNQSLFKVLCEEVGCAHTVLLLHTGIRWLSRGKVLSRVFELRSQIETFLNDKESTLLLDFTDTSFVLSLAYLADIFSHLNT*EKVTSFKDKLV 1801
            E+ E+ L   P+   T A  I   +        L W     I TDGAP+M  + +G   L ++      + HC++ + AL SK L   F  V+++VVK +N I+SR+L    F+ L EE+   +  +L  T +RWLSRG +L R FELR++++ F+ +K+   +   +D  +++ LA+L DI   LN   K    + +LV
Sbjct:  259 EVTEELLTVIPMHGQTTAQEIFHQLCDAIENAGLPWKRFVGITTDGAPSMTGRKNG---LEEESVEEAIALHCIIHQQALCSKCLK--FDNVMSVVVKCINQIRSRSLKHRRFRALLEEMESEYGDVLYFTEVRWLSRGNILKRFFELRAEVKAFM-EKDGVAVTVLSDPKWLMDLAFLVDITHELNVLNKKLQGQGQLV 452          

HSP 2 Score: 65.855 bits (159), Expect = 1.800e-36
Identity = 56/189 (29.63%), Postives = 91/189 (48.15%), Query Frame = 1
Query:  640 DIQFGFTFLVDKNGLHKPQYLLCLKVLSNGFMEPSKLKEHLQAVHPKNVNDPEALFIINRARFETSAKLTNHGF----VPEKKPALEASYRVALRIAKDKTSHTIAETLIKLCAMEMAEIICGKDAKLKISQIPLSNHTIHDQIKDMSEDVLKQIVVQIQESSTKIGLQLDESIDVSNCAQLLVFVRCV 1194
            ++QF   F V+  G+  P  L+C + ++    +   LK H    H +     +     NR     +  L    F      E   A+EASY V+  IAK     T  E  +K C ++ A I+C  + K + S I LS +T+ ++I D+S D+  Q+  + +  S    + LDES D+++ AQL ++VR V
Sbjct:   76 EVQF---FFVEHRGI--PTCLICTEKVA--VHKEYNLKRHYTTRHAEEYAKYQGDERANRVANLKTCLLRQQDFFKKATKENDAAVEASYVVSEMIAKAGKPFTEGE-FVKKCILQAASIVC-PEKKGQFSNISLSANTVAERISDLSSDIYDQLCEKAKRFSV-YSVALDESTDITDTAQLAIYVRGV 254          
BLAST of Protein ZBED8 vs. Ensembl Medaka
Match: ENSORLT00000032191.1 (pep primary_assembly:ASM223467v1:7:34400406:34401509:1 gene:ENSORLG00000024356.1 transcript:ENSORLT00000032191.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 170.629 bits (431), Expect = 4.909e-76
Identity = 94/197 (47.72%), Postives = 124/197 (62.94%), Query Frame = 1
Query:  613 SKKRCYQDSDIQFGFTFLVDKNGLHKPQYLLCLKVLSNGFMEPSKLKEHLQAVHPKN--VNDPEALFIINRARFETSAKLTNHGFVPEKKPALEASYRVALRIAKDKTSHTIAETLIKLCAMEMAEIICGKDA-KLKISQIPLSNHTIHDQIKDMSEDVLKQIVVQIQESSTKIGLQLDESIDVSNCAQLLVFVRCV 1194
            SKKR + D  +Q+GF+ + + +G  +P  ++C   LSN  + P+KLKEH++ +H      N   A F + RARF+  A L   GFVP  KP L ASY VA  IAK    HTI ETL+K  A++MA +I G  A + K+SQIPLSN TI D+I DMS D+L Q+V  +  S  K  LQLDE+ DV+N +QL VFVR V
Sbjct:    3 SKKRKWSDEYVQYGFSCITELDGSQRPICMICNAKLSNSNLAPAKLKEHIEKLHGDGEYKNTTLAEFKVKRARFDDKATLPALGFVPINKPILTASYEVAYLIAKQGEPHTIGETLVKPAALKMANLILGTTAAEGKLSQIPLSNDTISDRIGDMSNDILAQVVADLISSPAKFSLQLDETTDVANLSQLAVFVRYV 199          

HSP 2 Score: 135.191 bits (339), Expect = 4.909e-76
Identity = 64/147 (43.54%), Postives = 94/147 (63.95%), Query Frame = 2
Query: 1175 LFLLDVFRNEIKEDFLF*EPLTETTNAVYIMSIMNGFFVANELSWNNVRAICTDGAPAMPWKNSGFIALVKQINPHVFSSHCVLRRHALESKTLPSYFKEVLNIVVKTVNFIKSRALNQSLFKVLCEEVGCAHTVLLLHTGIRWLSR 1615
            +F+  V  + IKE+FLF +PLT T+ A  +  +++ F   N+LSW+ V  +CTDGAP M  + SGF ALV    PH+  +HC+L RHAL +KTLP    EVL  VV+ V ++++  L   +F  LC+E+G    VL+ H+ +RWLS+
Sbjct:  194 VFVRYVKDDMIKEEFLFCKPLTTTSKAADVKKLVDDFCRDNKLSWDMVSVVCTDGAPVMLGRKSGFGALVNAGAPHIVVTHCILHRHALATKTLPPKMAEVLKTVVECVIYVRNSTLRHRIFSELCKEMGAEFEVLMYHSNVRWLSQ 340          
BLAST of Protein ZBED8 vs. Ensembl Medaka
Match: ENSORLT00000040389.1 (pep primary_assembly:ASM223467v1:19:265767:268275:-1 gene:ENSORLG00000025045.1 transcript:ENSORLT00000040389.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 162.54 bits (410), Expect = 7.001e-67
Identity = 80/185 (43.24%), Postives = 112/185 (60.54%), Query Frame = 2
Query: 1211 EDFLF*EPLTETTNAVYIMSIMNGFFVANELSWNNVRAICTDGAPAMPWKNSGFIALVKQINPHVFSSHCVLRRHALESKTLPSYFKEVLNIVVKTVNFIKSRALNQSLFKVLCEEVGCAHTVLLLHTGIRWLSRGKVLSRVFELRSQIETFLNDKESTLLLD-FTDTSFVLSLAYLADIFSHLN 1762
            ED LF + + +   A  +  +++ F   N L W N   +C+DGA  M     G  AL+K+ +P+V  +HCV+ R AL S+ L S   EV++ +V  VNFIK+R L   +F  +CEE+G  H  +L H+  RWLSRGKVLSRVFELR QI  FL  +    + + F+D +F+  LAYL+DIF  LN
Sbjct:  223 EDLLFCKYVRDRATAEELFKMLDCFLTENGLKWENCIGVCSDGAQTMAGMKKGLRALIKKASPNVEWTHCVIHREALASRKLSSELSEVMSDIVGVVNFIKTRPLKTRVFSAICEEMGAEHQAVLFHSEARWLSRGKVLSRVFELREQIRMFLEQEHKHEVAEKFSDENFLAKLAYLSDIFGKLN 407          

HSP 2 Score: 112.464 bits (280), Expect = 7.001e-67
Identity = 65/197 (32.99%), Postives = 115/197 (58.38%), Query Frame = 1
Query:  601 TIPMSKKRCYQDSDIQFGFTFLVDKNGLHKPQYLLCLKVLSNGFMEPSKLKEHLQAVHPKNVNDPEALFIINRARF-ETSAKLTNHGFVPEKKPALEASYRVALRIAKDKTSHTIAETLIKLCAMEMAEIICGKDAKLKISQIPLSNHTIHDQIKDMSEDVLKQIVVQIQESSTKIGLQLDESIDVSNCAQLLVFVR 1188
            ++P +K R Y ++ +  GFT +       +P  LLCLK+L+   M+P+KL+ HL+ +HP + + P   F   RA + + S++  +   V ++  AL ASY+VA +IA+ K  HTIAE LI   A++M  ++    +  K+  +PLSN T+  +I D++ D+ +Q+V ++++   +  LQ DE+ D +     + +VR
Sbjct:   23 SLPKAKTRKYDEAYVALGFT-VTTVGDEERPVCLLCLKMLAADSMKPNKLRRHLKTLHPNHADKPLEFFQRKRAEYCQQSSRFVSATSVNQR--ALLASYKVAYQIAQCKKPHTIAEELILPAALDMVSVMLDDASAAKLKTVPLSNDTVARRINDIANDLKEQLVEKLKDK--RFALQFDEATDSNKDCLFIAYVR 214          
BLAST of Protein ZBED8 vs. Ensembl Medaka
Match: ENSORLT00000035512.1 (pep primary_assembly:ASM223467v1:11:22712371:22714941:1 gene:ENSORLG00000026495.1 transcript:ENSORLT00000035512.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 162.54 bits (410), Expect = 9.053e-67
Identity = 80/185 (43.24%), Postives = 112/185 (60.54%), Query Frame = 2
Query: 1211 EDFLF*EPLTETTNAVYIMSIMNGFFVANELSWNNVRAICTDGAPAMPWKNSGFIALVKQINPHVFSSHCVLRRHALESKTLPSYFKEVLNIVVKTVNFIKSRALNQSLFKVLCEEVGCAHTVLLLHTGIRWLSRGKVLSRVFELRSQIETFLNDKESTLLLD-FTDTSFVLSLAYLADIFSHLN 1762
            ED LF + + +   A  +  +++ F   N L W N   +C+DGA  M     G  AL+K+ +P+V  +HCV+ R AL S+ L S   EV++ +V  VNFIK+R L   +F  +CEE+G  H  +L H+  RWLSRGKVLSRVFELR QI  FL  +    + + F+D +F+  LAYL+DIF  LN
Sbjct:  223 EDLLFCKYVRDRATAEELFKMLDCFLTENGLKWENCIGVCSDGAQTMAGMKKGLRALIKKASPNVEWTHCVIHREALASRKLSSELSEVMSDIVGVVNFIKTRPLKTRVFSAICEEMGAEHQAVLFHSEARWLSRGKVLSRVFELREQIRMFLEQEHKHEVAEKFSDENFLAKLAYLSDIFGKLN 407          

HSP 2 Score: 112.079 bits (279), Expect = 9.053e-67
Identity = 65/197 (32.99%), Postives = 115/197 (58.38%), Query Frame = 1
Query:  601 TIPMSKKRCYQDSDIQFGFTFLVDKNGLHKPQYLLCLKVLSNGFMEPSKLKEHLQAVHPKNVNDPEALFIINRARF-ETSAKLTNHGFVPEKKPALEASYRVALRIAKDKTSHTIAETLIKLCAMEMAEIICGKDAKLKISQIPLSNHTIHDQIKDMSEDVLKQIVVQIQESSTKIGLQLDESIDVSNCAQLLVFVR 1188
            ++P +K R Y ++ +  GFT +       +P  LLCLK+L+   M+P+KL+ HL+ +HP + + P   F   RA + + S++  +   V ++  AL ASY+VA +IA+ K  HTIAE LI   A++M  ++    +  K+  +PLSN T+  +I D++ D+ +Q+V ++++   +  LQ DE+ D +     + +VR
Sbjct:   23 SLPKAKMRKYDEAYVALGFT-VTTVGDEERPVCLLCLKMLAADSMKPNKLRRHLKTLHPNHADKPLEFFQRKRAEYCQQSSRFVSATSVNQR--ALLASYKVAYQIAQCKKPHTIAEELILPAALDMVSVMLDDASAAKLKTVPLSNDTVARRINDIANDLKEQLVEKLKDK--RFALQFDEATDSNKDCLFIAYVR 214          
BLAST of Protein ZBED8 vs. Ensembl Medaka
Match: ENSORLT00000032459.1 (pep primary_assembly:ASM223467v1:8:14240678:14247355:1 gene:ENSORLG00000024991.1 transcript:ENSORLT00000032459.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 157.918 bits (398), Expect = 2.612e-64
Identity = 80/188 (42.55%), Postives = 112/188 (59.57%), Query Frame = 2
Query: 1199 NEIKEDFLF*EPLTETTNAVYIMSIMNGFFVANELSWNNVRAICTDGAPAMPWKNSGFIALVKQINPHVFSSHCVLRRHALESKTLPSYFKEVLNIVVKTVNFIKSRALNQSLFKVLCEEVGCAHTVLLLHTGIRWLSRGKVLSRVFELRSQIETFLNDKESTLLLDFTDTSFVLSLAYLADIFSHLN 1762
            + ++ED LF   L     A      M+ +F  N L W N   +C+DGA +M  ++ G I  +  + P    +HC L R  L  K  P  F EV+++ VKT+NFIKS A+N   F  LCE +   H  LL H+ +RWLSRG VL+R+FELR++I +FL DK+S L   +T+ +F+  LAYL+DIFS LN
Sbjct:  203 SSLQEDILFCGELPTRATAEECFRCMDNYFTENGLDWQNCVGVCSDGAASMTGRHRGVIKQILDLAPEAKWTHCFLHRENLAKKMSPE-FHEVMDVTVKTINFIKSNAVNSRCFAQLCEGMEADHVQLLYHSEVRWLSRGLVLTRIFELRNEIFSFLTDKKSPLAHHYTNATFIAKLAYLSDIFSLLN 389          

HSP 2 Score: 108.612 bits (270), Expect = 2.612e-64
Identity = 75/194 (38.66%), Postives = 108/194 (55.67%), Query Frame = 1
Query:  622 RCYQDSDIQFGFTFLVDKNGLHKP--QYLLCLKVLSNGFMEPSKLKEHLQAVHPKNVNDPEALFIINRARFETSAKLTNHGFVP---EKKPALEASYRVALRIAKDKTSHTIAETLIKLCAMEMAEIICGKDAKLKISQIPLSNHTIHDQIKDMSEDVLKQIVVQIQESSTKIGLQLDESIDVSNCAQLLVFVR 1188
            R Y    I FGF   V+     +P  Q + C   LSN  ++PSKLK HL+  HPK +  P   F     R +   ++     V    + K AL+ASY VA R+A+ K + TIAE L+   A++M   + G+ A  K+  IPLSN  +  +I D++ D+ +Q++ +I++S     LQLDES DV+N A LLVFVR
Sbjct:   13 RKYNPDLINFGF---VNGGSEAEPRAQCVECGLTLSNEALKPSKLKRHLETKHPKLIGKPVDYF----KRKDDGLQMQRRSIVSLTGDAKCALKASYLVARRVAQSKKAFTIAEELVLPAAVDMCREMIGEAAAKKLKTIPLSNDIVSHRIADIASDIEQQLLERIRKSPF-FSLQLDESTDVTNAALLLVFVR 198          
BLAST of Protein ZBED8 vs. Ensembl Medaka
Match: ENSORLT00000035028.1 (pep primary_assembly:ASM223467v1:2:7372701:7381259:1 gene:ENSORLG00000027324.1 transcript:ENSORLT00000035028.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 162.155 bits (409), Expect = 1.027e-63
Identity = 85/196 (43.37%), Postives = 113/196 (57.65%), Query Frame = 2
Query: 1178 FLLDVFRNEIKEDFLF*EPLTETTNAVYIMSIMNGFFVANELSWNNVRAICTDGAPAMPWKNSGFIALVKQINPHVFSSHCVLRRHALESKTLPSYFKEVLNIVVKTVNFIKSRALNQSLFKVLCEEVGCAHTVLLLHTGIRWLSRGKVLSRVFELRSQIETFLNDKESTLLLDFTDTSFVLSLAYLADIFSHLNT 1765
            F+  ++   + ++FLF   L   T    I   +N F V N L W+    ICTDGA AM  K  G +A +  + P   ++HC + R  L  K +P   K VL+  VK VN IK++ LN  LFK LCEE+G  HT LL HT +RWLSRGKVL+R+FELR ++  FL+  +  L     D  ++  LAYLADI S LNT
Sbjct:  164 FVRYIYAGGLHDEFLFCRSLPTNTTGEAIFHSLNDFIVKNNLDWSRCVGICTDGATAMTGKQKGLVARIAAVAPSAVTTHCCIHREQLAVKKMPQCLKSVLDESVKIVNKIKAKQLNSLLFKALCEEMGSEHTKLLFHTEVRWLSRGKVLTRLFELRDEVMLFLHHSDE-LYDRMHDFQWLAKLAYLADILSILNT 358          

HSP 2 Score: 102.449 bits (254), Expect = 1.027e-63
Identity = 67/161 (41.61%), Postives = 90/161 (55.90%), Query Frame = 1
Query:  718 LSNGFMEPSKLKEHLQAVHPKNVNDPEALFIINRARFETSA-KLTNHGFVP-EKKPALEASYRVALRIAKDKTSHTIAETLIKLCAMEMAEIICGKDAKLKISQIPLSNHTIHDQIKDMSEDVLKQIVVQIQESSTKIGLQLDESIDVSNCAQLLVFVRCV 1194
            L+N  M+P+KLK HL+  H +    P   F       +    K T+  F P E   A EASY+V+L IAK    H+I E L+K  A  MA I  G  A  +I++IPLSN T+  +IK M+E V  Q+V  +++S     LQLDES D+ N A LL FVR +
Sbjct:    9 LTNEAMKPAKLKRHLETKHKEYQGKPIGFFERKCDELKKHMMKETSQFFAPGENVKATEASYKVSLLIAKAGKPHSIGENLVKPAAKVMANIFFGGKAGDEINRIPLSNDTVQRRIKAMAESVEHQLVTHLRQSQF-FSLQLDESTDLGNEANLLCFVRYI 168          
BLAST of Protein ZBED8 vs. Planmine SMEST
Match: SMESG000028317.1 (SMESG000028317.1)

HSP 1 Score: 108.997 bits (271), Expect = 1.745e-49
Identity = 61/189 (32.28%), Postives = 98/189 (51.85%), Query Frame = 2
Query: 1202 EIKEDFLF*EPLTETTNAVYIMSIMNGFFVANELSWNNVRAICTDGAPAMPWKNSGFIALVKQIN--PHVFSSHCVLRRHALESKTLPSYFKEVLNIVVKTVNFIKSRALNQSLFKVLCEEVGCAHTVLLLHTGIRWLSRGKVLSRVFELRSQIETFLNDKESTLLLDFTDTSFVLSLAYLADIFSHLN 1762
            ++ ED LF +PL E T    I   ++ FF A+ L W+N   +C DGA +M  KN G +AL+++ N   H+  +HC++ + AL SK       +   ++               LF  + E       +L+ H  +RWLS+GK L R+F+L  ++ TFL  +  ++   F +  ++ + AYLADIF  LN
Sbjct:  836 QLVEDLLFCQPLHEKTTGEDIYKKIDDFFKAHNLKWSNCVHVCKDGAASMTGKNKGLLALIRKFNNGSHIKYAHCMIHKEALASKNDHQNLTKFYEML--------------RLFARVYENSNSQFEILINHAEMRWLSKGKSLRRLFDLSDEVRTFLMAENPSMTDFFQNAQWLCTFAYLADIFEKLN 1010          

HSP 2 Score: 107.457 bits (267), Expect = 1.745e-49
Identity = 68/185 (36.76%), Postives = 111/185 (60.00%), Query Frame = 1
Query:  619 KRCYQDSDIQFGFTFLVDKNGLHKPQYLLCLKVLSNGFMEPSKLKEHLQAVHPKNVNDPEALFIINRARFETSAKLTNHGFVPEKKPALEASYRVALRIAKDKTSHTIAETLIKLCAMEMAEIICGKDAKLKISQIPLSNHTIHDQIKDMSEDVLKQIVVQIQESSTKIGLQLDESIDVSNCAQL 1173
            KR YQ+  + +GF+  +  NG  +PQ  +  +VL+N  M+P+KL++++   H    + P A F   + +   S K  +H  + + K  L AS+ ++  IAKDK   TIAE L+K  AM+M EI+ G +   KI  IP SN T+ ++I +++ D   Q++ +I++SS K  +QL+E+ DV+N AQL
Sbjct:  655 KRKYQEIYLAYGFSSCI-VNGEQRPQCAIFYEVLANESMKPAKLRKYVATKHESYQDKPLAFFK-RKEKVLNSQKSLSHNIIYDSK-LLRASFEISYLIAKDKMPCTIAEMLLKPAAMKMCEILLGSNFYEKIKLIPFSNDTVANRIGEINTDFFIQLLDRIKKSS-KFAIQLEETNDVTNFAQL 835          
BLAST of Protein ZBED8 vs. Planmine SMEST
Match: SMESG000073961.1 (SMESG000073961.1)

HSP 1 Score: 128.257 bits (321), Expect = 5.851e-43
Identity = 66/167 (39.52%), Postives = 92/167 (55.09%), Query Frame = 2
Query: 1262 IMSIMNGFFVANELSWNNVRAICTDGAPAMPWKNSGFIALVKQINPHVFSSHCVLRRHALESKTLPSYFKEVLNIVVKTVNFIKSRALNQSLFKVLCEEVGCAHTVLLLHTGIRWLSRGKVLSRVFELRSQIETFLNDKESTLLLDFTDTSFVLSLAYLADIFSHLN 1762
            + +I++ F     + W N   ICTDGA +M  +      LVKQ +     +H ++ R AL SK + +    VL+ VV  VN+IK+R L   +F  LC+ +G  HT LL +   RWLSRGK L RVFE R +I  FL ++     + F D  F++ L YL DIF  LN
Sbjct:  342 LFTILDNFINEANIEWENCVGICTDGARSMSGRFKSMQTLVKQKSSQCIWTHYMIYREALASKEMSTGLNIVLSTVVTVVNYIKTRPLKSRMFSELCKGMGSVHTALLFYCEARWLSRGKFLKRVFESREEICIFLEEENRQEAVMFRDIEFIMKLGYLVDIFEKLN 508          

HSP 2 Score: 66.2402 bits (160), Expect = 5.851e-43
Identity = 47/132 (35.61%), Postives = 73/132 (55.30%), Query Frame = 1
Query:  784 VNDPEA-LFIINRAR--FETS------AKLTNHGFVPEKKPALEASYRVALRIAKDKTSHTIAETLIKLCAMEMAEIICGKDAKLKISQIPLSNHTIHDQIKDMSEDVLKQIVVQIQESSTKIGLQLDESID 1152
            VN+ E  L  +N++R  FE+        KL     +   + AL ASY+V+ +IA+ K  HTI E LI   A+E+ E + G++   K+  IPLSN T+   +  M+EDV  Q+  +++       +QLDE+ID
Sbjct:  199 VNEEERPLEYVNKSRQFFESKLKSYEKQKLVFKNTLSVNEKALLASYKVSYQIARCKKPHTIGEELILPAAIEIVETMFGENFAKKLKSIPLSNDTVARHVGGMAEDVQHQLFAKLRRKL--FSIQLDEAID 328          
BLAST of Protein ZBED8 vs. Planmine SMEST
Match: SMESG000019238.1 (SMESG000019238.1)

HSP 1 Score: 120.553 bits (301), Expect = 6.337e-38
Identity = 67/184 (36.41%), Postives = 100/184 (54.35%), Query Frame = 2
Query: 1211 EDFLF*EPLTETTNAVYIMSIMNGFFVANELSWNNVRAICTDGAPAMPWKNSGFIALVKQINPHVFSSHCVLRRHALESKTLPSYFKEVLNIVVKTVNFIKSRALNQSLFKVLCEEVGCAHTVLLLHTGIRWLSRGKVLSRVFELRSQIETFLNDKESTLLLDFTDTSFVLSLAYLADIFSHLN 1762
            E+ LF + + +   +  + +I++ F     + W N   ICTDGA +M  +      LVKQ +     +HC++ + AL SK + +     LNIV+     +KSR     +F  LC+++G  HT LL H   RWLSRGK L RVFELR +I  FL ++     + F +T F++ L Y+ DIF  LN
Sbjct:  117 EELLFWKSIQQRATSPALFTILDNFINEANIEWENCVGICTDGARSMSGRFQSMQTLVKQKSSQCIWTHCMIHKEALASKEMST----GLNIVLS----LKSR-----MFSELCKDMGSVHTALLFHYEARWLSRGKFLKRVFELREEICIFLEEENRQEAVMFRNTVFIMKLGYIVDIFEKLN 287          

HSP 2 Score: 56.9954 bits (136), Expect = 6.337e-38
Identity = 38/102 (37.25%), Postives = 57/102 (55.88%), Query Frame = 1
Query:  880 ALEASYRVALRIAKDKTSHTIAETLIKLCAMEMAEIICGKDAKLKISQIPLSNHTIHDQIKDMSEDVLKQIVVQIQESSTKIGLQLDESIDVSNCAQLLVFV 1185
            AL ASY+V  +I++ K  HTI E LI   A+E        +   K+  IPLSN T+  ++  M+EDV  Q+  ++ E      +QLDE+ID +  A L+ +V
Sbjct:   16 ALLASYKVLYQISRCKKPHTIGEELILPAAIE--------NFAKKLKSIPLSNDTVAPRVGGMAEDVQHQLFARLCEKL--FSIQLDETIDNNKDAHLIAYV 107          
BLAST of Protein ZBED8 vs. Planmine SMEST
Match: SMESG000006631.1 (SMESG000006631.1)

HSP 1 Score: 94.7449 bits (234), Expect = 2.608e-34
Identity = 55/142 (38.73%), Postives = 75/142 (52.82%), Query Frame = 2
Query: 1178 FLLDVFRNEIKEDFLF*EPLTETTNAVYIMSIMNGFFVANELSWNNVRAICTDGAPAMPWKNSGFIALVKQINPHVFSSHCVLRRHALESKTLPSYFKEVLNIVVKTVNFIKSRALNQSLFKVLCEEVGCAHTVLLLHTGIR 1603
            F+  V  NEI  + L  + L+E T    I + +N +F    L+W     I TDGAP+M     GF+   KQ    ++ +HC L R AL +KTLP+  K VL  V   VN+IK+R L   +FK LC  +   +  LL HT IR
Sbjct:  170 FIRFVNENEIVNELLCCKELSERTTGEAIYNQINSYFEHLNLNWGQCVEISTDGAPSMIGSVKGFVTYAKQQYSEIYLNHCFLHREALFAKTLPAELKSVLTNVTDMVNYIKTRPLKCRIFKQLCMAMEAKYEGLLYHTEIR 311          

HSP 2 Score: 70.8626 bits (172), Expect = 2.608e-34
Identity = 52/168 (30.95%), Postives = 86/168 (51.19%), Query Frame = 1
Query:  691 PQYLLCLKVLSNGFMEPSKLKEHLQAVHPKNVNDPEALFIINRARFETSAKLTNHGFVPEKKPALEASYRVALRIAKDKTSHTIAETLIKLCAMEMAEIICGKDAKLKISQIPLSNHTIHDQIKDMSEDVLKQIVVQIQESSTKIGLQLDESIDVSNCAQLLVFVRCV 1194
            P   +C   L+N  M P+KLK H    H +N    E  +     + +          V     A  ASY++A  +   +  HTIAE++I L   E++ I+ G+DAK ++ +I +S++TI  +I DM+ D+   +  ++   +    LQ+DE+ D+S  A LL F+R V
Sbjct:   10 PLCCVCGLKLANSAMVPTKLKRHFITNH-ENFTAKEKDYFERLLKIKNKEATCFQKTVKLYDKAQIASYKIAKLVDMKQKPHTIAESVILLAYCEISNILFGEDAKKEVLKIHVSDNTIQRRIIDMARDIESTLANKL--PNINFALQIDETTDISEKAILLGFIRFV 174          
BLAST of Protein ZBED8 vs. Planmine SMEST
Match: SMESG000024494.1 (SMESG000024494.1)

HSP 1 Score: 101.679 bits (252), Expect = 4.690e-30
Identity = 57/156 (36.54%), Postives = 85/156 (54.49%), Query Frame = 2
Query: 1199 NEIKEDFLF*EPLTETTNAVYIMSIMNGFFVANELSWNNVRAICTDGAPAMPWKNSGFIALVKQINPHVFSSHCVLRRHALESKTLPSYFKEVLNIVVKTVNFIKSRALNQSLFKVLCEEVGCAHTVLLLHTGIRWLSRGKVLSRVFELRSQIETF 1666
            ++  E  LF + L +TT A  I S +  +F  N +   N+ +   DGAP M  K +G + L+K  NP + + HCV+ R  L +K L     +V+N V++ +N IKS A  + +FK+ CE     +  LLLHT  RWLS+G  L R  EL   ++ F
Sbjct:  250 DDYAEKMLFCKNL-KTTTARDIFSSLKSYFNDNNIQMENITSCAADGAPNMIGKRNGCLKLIKDENPLIITMHCVIHRENLVAKNLSLVLSDVMNKVIRCINTIKSSAKCERMFKLFCEGNNEEYVKLLLHTETRWLSKGNSLKRFMELFESLKFF 404          

HSP 2 Score: 49.6766 bits (117), Expect = 4.690e-30
Identity = 31/87 (35.63%), Postives = 51/87 (58.62%), Query Frame = 1
Query:  934 HTIAETLIKLCAMEMAEIICGKDAKLKISQIPLSNHTIHDQIKDMSEDVLKQIVVQIQESSTKIGLQLDESIDVSNCAQLLVFVRCV 1194
            HTI ETLIK        I+  KD   ++ ++PLSN +++ +I DM+E+V  Q++ +++ S+    LQLDES        L+ +VR +
Sbjct:  164 HTIGETLIKQAITVFHRIVLQKDIT-EVERMPLSNSSVYRRIDDMAENVEHQLIEKLKIST--FSLQLDESTIRGGEIVLMEYVRYI 247          
The following BLAST results are available for this feature:
BLAST of Protein ZBED8 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZBED82.188e-7942.56zinc finger BED-type containing 8 [Source:HGNC Sym... [more]
ZBED82.188e-7942.56zinc finger BED-type containing 8 [Source:HGNC Sym... [more]
ZBED53.733e-6441.62zinc finger BED-type containing 5 [Source:HGNC Sym... [more]
ZBED53.733e-6441.62zinc finger BED-type containing 5 [Source:HGNC Sym... [more]
ZMYM65.909e-5336.14zinc finger MYM-type containing 6 [Source:HGNC Sym... [more]
back to top
BLAST of Protein ZBED8 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein ZBED8 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein ZBED8 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
AL928808.11.606e-3132.80pep chromosome:GRCz11:20:17257101:17259573:-1 gene... [more]
CR392001.32.588e-2333.71pep chromosome:GRCz11:8:38963323:38965260:-1 gene:... [more]
back to top
BLAST of Protein ZBED8 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
spag16.379e-3235.23sperm associated antigen 1 [Source:Xenbase;Acc:XB-... [more]
ENSXETT00000016563.17.097e-3235.23pep primary_assembly:Xenopus_tropicalis_v9.1:4:373... [more]
ENSXETT00000028445.16.841e-1927.75general transcription factor II-I repeat domain-co... [more]
back to top
BLAST of Protein ZBED8 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Zbed55.694e-6741.80zinc finger, BED type containing 5 [Source:MGI Sym... [more]
Zmym64.715e-4834.33zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI... [more]
Zmym65.204e-4834.33zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI... [more]
Gtf2ird28.149e-1727.94GTF2I repeat domain containing 2 [Source:MGI Symbo... [more]
Epm2aip11.583e-625.49EPM2A (laforin) interacting protein 1 [Source:MGI ... [more]
back to top
BLAST of Protein ZBED8 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8IZ13|ZBED8_HUMAN9.589e-7942.56Protein ZBED8 OS=Homo sapiens OX=9606 GN=ZBED8 PE=... [more]
sp|A4Z945|ZBED8_BOVIN9.720e-7841.03Protein ZBED8 OS=Bos taurus OX=9913 GN=ZBED8 PE=2 ... [more]
sp|A4Z943|ZBED5_BOVIN8.613e-6542.64Zinc finger BED domain-containing protein 5 OS=Bos... [more]
sp|A4Z944|ZBED5_CANLF3.441e-6442.13Zinc finger BED domain-containing protein 5 OS=Can... [more]
sp|Q49AG3|ZBED5_HUMAN1.636e-6341.62Zinc finger BED domain-containing protein 5 OS=Hom... [more]
back to top
BLAST of Protein ZBED8 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3S2TK002.725e-10853.33Reverse transcriptase domain-containing protein OS... [more]
I3KX552.462e-9050.00Uncharacterized protein OS=Oreochromis niloticus O... [more]
A0A4C1ZHQ93.891e-9051.87Protein ZBED8 OS=Eumeta variegata OX=151549 GN=ZBE... [more]
A0A3P8NKB04.263e-9047.96DUF4371 domain-containing protein OS=Astatotilapia... [more]
A0A3P8NNM48.077e-9047.96Uncharacterized protein OS=Astatotilapia callipter... [more]
back to top
BLAST of Protein ZBED8 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000051422.13.612e-7050.80pep primary_assembly:Astyanax_mexicanus-2.0:15:354... [more]
ENSAMXT00000044261.19.883e-6748.66pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000057314.15.586e-5237.97pep primary_assembly:Astyanax_mexicanus-2.0:1:4224... [more]
ENSAMXT00000039226.12.535e-3839.89pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000030525.11.800e-3633.00pep primary_assembly:Astyanax_mexicanus-2.0:1:1299... [more]
back to top
BLAST of Protein ZBED8 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein ZBED8 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein ZBED8 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein ZBED8 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000032191.14.909e-7647.72pep primary_assembly:ASM223467v1:7:34400406:344015... [more]
ENSORLT00000040389.17.001e-6743.24pep primary_assembly:ASM223467v1:19:265767:268275:... [more]
ENSORLT00000035512.19.053e-6743.24pep primary_assembly:ASM223467v1:11:22712371:22714... [more]
ENSORLT00000032459.12.612e-6442.55pep primary_assembly:ASM223467v1:8:14240678:142473... [more]
ENSORLT00000035028.11.027e-6343.37pep primary_assembly:ASM223467v1:2:7372701:7381259... [more]
back to top
BLAST of Protein ZBED8 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000028317.11.745e-4932.28SMESG000028317.1[more]
SMESG000073961.15.851e-4339.52SMESG000073961.1[more]
SMESG000019238.16.337e-3836.41SMESG000019238.1[more]
SMESG000006631.12.608e-3438.73SMESG000006631.1[more]
SMESG000024494.14.690e-3036.54SMESG000024494.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005112 ID=SMED30005112|Name=Protein ZBED8|organism=Schmidtea mediterranea sexual|type=transcript|length=1803bp
CTCTTCCGATCTGTGAGAATCTAATAAAAAAATTTCGTGGGATTTGCGTG
GGATTTGCATAGAATCACAATCACAATTCAACATCGATGGCAATTGACTT
GGGCTGTTGCCTACCTATTGAAAATAAATAACTAATAATAAATGAAATAA
GATACAAAAGTATATCTACTTACTAATAAGTAGTTTCACTTAAGTTAGGT
ACGTAATAAAAATTATACGAATAAAATTAATTTTCAAATTCATGTTTGTA
AAAATTAATAAATAAAAATATGAAAAATACGAAAAACCATGCTTAGTCTT
TTAATTTTTAGTTGTCATAGAAAAGAAACTTATATAATAGCAAAATGGTA
AAACTACTTGTAAGGATTTGGTTGATTTTTAGAAGTTCCTGAGATTTTAA
TTTTTTGCGATTCTCTGTGCACTATTGAAGTAATTTGATTATCAAATTGT
TATTGTTTTTACTACTAAAATGTGTATAAAAAATAAATAAATATAACGGT
TTTCGATTTATTTTGGTAAGTACAATAAATAAACCGGTGCATAATTAATT
GTTTTGGATTCCAGAAATAATTACTTTTTACTTTTCGACAGCTAACCCAT
ACTATCCCGATGTCAAAGAAGCGTTGTTATCAGGACTCAGATATTCAATT
CGGCTTCACTTTCTTAGTTGATAAAAATGGATTGCATAAGCCACAATATT
TACTTTGCTTGAAAGTACTTAGTAATGGTTTTATGGAACCATCCAAACTT
AAGGAACATCTACAAGCAGTACATCCAAAAAACGTTAATGACCCAGAAGC
TTTATTCATAATTAACAGAGCCCGATTTGAAACAAGCGCAAAGCTTACCA
ATCACGGATTTGTTCCCGAGAAAAAACCGGCTTTAGAAGCAAGTTATCGT
GTGGCATTGAGGATTGCGAAAGATAAAACATCTCATACAATTGCAGAAAC
TTTGATTAAACTATGTGCGATGGAAATGGCAGAGATTATTTGTGGTAAGG
ATGCGAAACTTAAAATATCACAAATCCCACTATCCAACCACACTATTCAT
GATCAAATCAAAGATATGTCAGAAGATGTCCTAAAGCAGATTGTGGTGCA
AATACAAGAAAGTTCAACAAAAATAGGATTGCAATTGGATGAATCCATTG
ATGTTTCAAACTGTGCTCAACTTCTTGTTTTTGTTAGATGTGTTTAGAAA
TGAAATCAAAGAAGATTTTCTTTTTTGAGAACCTCTGACAGAAACTACAA
ATGCTGTGTATATTATGTCAATTATGAATGGATTTTTTGTTGCCAATGAG
CTTTCTTGGAACAATGTTAGAGCCATTTGTACTGATGGTGCTCCCGCTAT
GCCCTGGAAAAATTCTGGATTTATTGCTCTTGTGAAACAGATAAACCCAC
ATGTTTTTTCTAGCCATTGTGTTCTTCGTCGCCATGCTTTGGAATCAAAG
ACTCTTCCCTCTTATTTCAAAGAGGTATTGAATATTGTCGTGAAAACCGT
AAACTTTATTAAATCAAGGGCATTGAATCAGAGCCTATTTAAAGTGTTGT
GCGAAGAAGTTGGATGCGCACATACCGTACTTCTTTTACATACAGGAATA
CGTTGGCTATCAAGAGGAAAAGTTCTTAGCCGGGTTTTTGAACTTAGATC
TCAAATTGAAACATTTCTAAATGACAAAGAATCAACTCTTTTGCTTGACT
TCACAGATACCAGTTTTGTGCTCTCTTTGGCTTACCTTGCAGATATATTT
AGCCATCTAAACACCTAGGAGAAGGTTACATCATTTAAAGATAAGTTGGT
TCT
back to top

protein sequence of SMED30005112-orf-1

>SMED30005112-orf-1 ID=SMED30005112-orf-1|Name=SMED30005112-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=168bp
MSIMNGFFVANELSWNNVRAICTDGAPAMPWKNSGFIALVKQINPHVFSS
HCVLRRHALESKTLPSYFKEVLNIVVKTVNFIKSRALNQSLFKVLCEEVG
CAHTVLLLHTGIRWLSRGKVLSRVFELRSQIETFLNDKESTLLLDFTDTS
FVLSLAYLADIFSHLNT*
back to top

protein sequence of SMED30005112-orf-2

>SMED30005112-orf-2 ID=SMED30005112-orf-2|Name=SMED30005112-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=196bp
MSKKRCYQDSDIQFGFTFLVDKNGLHKPQYLLCLKVLSNGFMEPSKLKEH
LQAVHPKNVNDPEALFIINRARFETSAKLTNHGFVPEKKPALEASYRVAL
RIAKDKTSHTIAETLIKLCAMEMAEIICGKDAKLKISQIPLSNHTIHDQI
KDMSEDVLKQIVVQIQESSTKIGLQLDESIDVSNCAQLLVFVRCV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
GO:0003676nucleic acid binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast