NPHP5

Overview
NameNPHP5 (AKN21707.1)
Smed IDSMED30005093
Length (bp)2730
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of NPHP5 (SMED30005093) t-SNE clustered cells

Violin plots show distribution of expression levels for NPHP5 (SMED30005093) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of NPHP5 (SMED30005093) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for NPHP5 (SMED30005093) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005093

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30005093SMESG000005436.1 SmedASXL_013403SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30005093SMESG000005436.1 dd_Smed_v4_11329_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30005093SMESG000005436.1 dd_Smed_v4_11329_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30005093SMESG000005436.1 dd_Smed_v6_11329_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30005093SMESG000005436.1 dd_Smed_v4_11329_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30005093SMESG000005436.1 dd_Smed_v4_11329_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of NPHP5 vs. Ensembl Human
Match: IQCB1 (IQ motif containing B1 [Source:HGNC Symbol;Acc:HGNC:28949])

HSP 1 Score: 144.05 bits (362), Expect = 3.424e-35
Identity = 158/614 (25.73%), Postives = 278/614 (45.28%), Query Frame = 1
Query:  739 NDDEFVIEVAKKILASNDSNYSKILIDLNRYLESIEDGQEAIKAF-ETIWKRNLLPIMLLEIKKDFTNIEPKSWKDGFCIVQSIYDILSRIVPQNRSEEN--EIQNRFIPEFIENLMCFLRQMQGNF-NESLVPEYRGILNSVXXXXXXXXXXXXXXSFLVRFSDYVSTMIESPWFLQLFITDNDKISILMTEWLMKLIKINPSGLKKISKSTVNGIGNIVSTIFDEIIYHLASTDNKQLIEININCLLTMFEADQSLVSVIHLR----YKGLKLLILKWSMSQNSTLKVGFSNLFSQNFRLLLTMLDSDLIYQAGMSTNL-WAIIKIQSWWRSVAVRLKLAKTNKAFERFQRNYRSRKLKEIKEQNTLRIRKELEHQISITRQRKFRSKLEAEVLLMETLPAPIVFKHLEKTKQEAATTIQSIWRGHQERRQLIMRQQLYRKSKAAIRIQRCVRAWLSKRDLIQIYHEGDEKSEFKYW-DVPGLNMERKSELNKVHNKWMASHKHEFRGISEDTQLELHHKAQKLYHRHLYELKTNRRKDIDRELTLARLETDSKLLISAPDLAEAVDGFNNQSDLKFKIDNFHCKIRPIANRAAQLHQQKINTIKQPWWKQL 2550
              D  ++ +A ++  S + N   IL+ L   +     G   +K   + I+  +L+   LL + +D++ I+      G+  +  +  ILS         E+  E  N  +P   EN +   RQ+Q  F N +   E   +L+  +++ +           L    + +  +++S  FL L   DN +I   +   L  +++IN   L +I +  +        +I DE+I+ L ST +  +       LL M E+ Q ++  I LR    YKGL+ L+ K                FSQ  R L+ +L S ++YQ      L  A   IQ++W+    R +L K   A    QR++RS++ K + E N  +  ++L+ Q+ + RQR  R   E ++ ++E +    V KH  + ++++A  IQ  WRG++ER+    ++Q   + KAA+ +QR    +L+K           +K  F  W  +  L   R+ EL K  + ++   +H    +S+    ELH +AQ+    +        R    RE  +A++ T+ + L+ AP L EA      + +L      F  + RP+A +A Q H   +  I+ PWWK+L
Sbjct:    5 GTDPRILSIAAEVAKSPEQNVPVILLKLKEIINITPLGSSELKKIKQDIYCYDLIQYCLLVLSQDYSRIQ-----GGWTTISQLTQILSHCCVGLEPGEDAEEFYNELLPSAAENFLVLGRQLQTCFINAAKAEEKDELLHFFQIVTDSLFW------LLGGHVELIQNVLQSDHFLHLLQADNVQIGSAVMMMLQNILQINSGDLLRIGRKALY-------SILDEVIFKLFSTPSPVIRSTATKLLLLMAESHQEIL--ILLRQSTCYKGLRRLLSKQETGTE----------FSQELRQLVGLL-SPMVYQEVEEQKLHQAACLIQAYWKGFQTRKRLKKLPSAVIALQRSFRSKRSKMLLEINRQKEEEDLKLQLQLQRQRAMRLSRELQLSMLEIVHPGQVEKHYREMEEKSALIIQKHWRGYRERKNFHQQRQSLIEYKAAVTLQRAALKFLAKCR--------KKKKLFAPWRGLQELTDARRVELKKRVDDYV--RRHLGSPMSDVVSRELHAQAQERLQHYFMGRALEERAQQHREALIAQISTNVEQLMKAPSLKEAE---GKEPEL------FLSRSRPVAAKAKQAHLTTLKHIQAPWWKKL 568          
BLAST of NPHP5 vs. Ensembl Human
Match: IQCB1 (IQ motif containing B1 [Source:HGNC Symbol;Acc:HGNC:28949])

HSP 1 Score: 70.8626 bits (172), Expect = 4.571e-12
Identity = 61/223 (27.35%), Postives = 107/223 (47.98%), Query Frame = 1
Query: 1885 EAEVLLMETLPAPIVFKHLEKTKQEAATTIQSIWRGHQERRQLIMRQQLYRKSKAAIRIQRCVRAWLSKRDLIQIYHEGDEKSEFKYW-DVPGLNMERKSELNKVHNKWMASHKHEFRGISEDTQLELHHKAQKLYHRHLYELKTNRRKDIDRELTLARLETDSKLLISAPDLAEAVDGFNNQSDLKFKIDNFHCKIRPIANRAAQLHQQKINTIKQPWWKQL 2550
            E ++ ++E +    V KH  + ++++A  IQ  WRG++ER+    ++Q   + KAA+ +QR    +L+K           +K  F  W  +  L   R+ EL K  + ++   +H    +S+    ELH +AQ+    +        R    RE  +A++ T+ + L+ AP L EA      + +L      F  + RP+A +A Q H   +  I+ PWWK+L
Sbjct:  232 ELQLSMLEIVHPGQVEKHYREMEEKSALIIQKHWRGYRERKNFHQQRQSLIEYKAAVTLQRAALKFLAKCR--------KKKKLFAPWRGLQELTDARRVELKKRVDDYV--RRHLGSPMSDVVSRELHAQAQERLQHYFMGRALEERAQQHREALIAQISTNVEQLMKAPSLKEAE---GKEPEL------FLSRSRPVAAKAKQAHLTTLKHIQAPWWKKL 435          
BLAST of NPHP5 vs. Ensembl Zebrafish
Match: iqcb1 (IQ motif containing B1 [Source:ZFIN;Acc:ZDB-GENE-041212-47])

HSP 1 Score: 156.762 bits (395), Expect = 1.218e-39
Identity = 139/550 (25.27%), Postives = 260/550 (47.27%), Query Frame = 1
Query:  946 PKSWKDGFCIVQSIYDILSRI-VPQNRSEENEI-QNRFIPEFIENLMCFL------RQMQGNFNESLVPEYRGILNSVXXXXXXXXXXXXXXSFLVRFSDY-VSTMIESPWFLQLFITDNDKISILMTEWLMKLIKINPSGLKKISKSTVNGIGN-IVSTIFDEIIYHLASTDNKQLIEININCLLTMFEADQSLVSVIHLRYKGLKLLILK-WSMSQNSTLKVGFSNLFSQNFRLLLTMLDSDLIYQAGMSTN---LWAIIKIQSWWRSVAVRLKLAKTNKAFERFQRNYRSRKLKEIKEQNTLRIRKELEHQISITRQRKFRSKLEAEVLLMETLPAPIVFKHLEKTKQEAATTIQSIWRGHQERRQLIMRQQLYRKSKAAIRIQRCVRAWLSKRDLIQIYHEGDEKSEFKYWDVP-GLNMERKSELNKVHNKWMASHKHEFRGISEDTQLELHHKAQKLYHRHLYELKTNRRKDIDRELTLARLETDSKLLISAPDLAEAVDGFNNQSDLKFKIDNFHCKIRPIANRAAQLHQQKINTIKQPWWKQL 2550
            P   + G+  +  I D+LS   V      + E+  + F+P  +E+L+ FL      R ++      ++  +R + +S+               +L+R   + +  ++    +  + I ++D +SI+       + + N + L ++        GN  ++ I D+I+Y ++S+ N  +    +  L+ + +   S   +I  RY+GL  L  K W          GF +   Q    L+  L  D+ ++    ++   + A   IQ+ WR+   R +L K  +A    QR++R ++ ++ +     R  +EL HQ+ + RQR  R   + ++ LME LPA  V ++L + + +AA  IQ +WRGH+ERR     + + R+ +AA+ +QR V  +L +R          +++       P GL   R++EL K   + ++ H    +  S +   ELH +AQ L HRHL    ++R ++  R+  LA++ TD +LL++AP L +       + D+      F  +  P+A RA Q H   + +++ PWW+ L
Sbjct:   73 PARIQGGYAALTQIADLLSTCCVGLAAFRDIEVFSHEFLPSVVESLL-FLAERLMNRALRDKAPSEMIRLFRKVFDSI--------------GWLLRAHRHLIHHVLRCKHYESVQICEDDDVSIVTVTLWNDIFRTNSAVLAEM--------GNRALTDIMDDIVYKMSSSSNPVIGRAAVKTLVLILDHSSSTQQLIQRRYRGLSDLAEKDWRGK-------GFDSALDQ----LIDHLQLDVPWKEPKESSEECVRAACVIQAAWRAHLTRRRLKKLPRAVSTLQRSFREKRRQQQEHTERRRAEEELRHQVCLRRQRAMRLFRQHQLHLMEILPAGQVQRYLGELENKAALVIQRVWRGHRERRHFQQHKHILRRHRAAVTLQRAVLLFLKRRKA--------QRNILTPLKAPKGLTDSRRTELRKQIQEHISLHPSSVQ--SAEGSAELHQRAQSLLHRHLVNRASDRAQEQHRQALLAQINTDIELLLNAPSLRDV-----REEDVNL----FLSRSCPVATRARQSHNALLQSMRLPWWRTL 569          
BLAST of NPHP5 vs. Ensembl Zebrafish
Match: iqcb1 (IQ motif containing B1 [Source:ZFIN;Acc:ZDB-GENE-041212-47])

HSP 1 Score: 130.183 bits (326), Expect = 6.592e-31
Identity = 130/550 (23.64%), Postives = 248/550 (45.09%), Query Frame = 1
Query:  946 PKSWKDGFCIVQSIYDILSRI-VPQNRSEENEI-QNRFIPEFIENLMCFL------RQMQGNFNESLVPEYRGILNSVXXXXXXXXXXXXXXSFLVRFSDY-VSTMIESPWFLQLFITDNDKISILMTEWLMKLIKINPSGLKKISKSTVNGIGN-IVSTIFDEIIYHLASTDNKQLIEININCLLTMFEADQSLVSVIHLRYKGLKLLILK-WSMSQNSTLKVGFSNLFSQNFRLLLTMLDSDLIYQAGMSTN---LWAIIKIQSWWRSVAVRLKLAKTNKAFERFQRNYRSRKLKEIKEQNTLRIRKELEHQISITRQRKFRSKLEAEVLLMETLPAPIVFKHLEKTKQEAATTIQSIWRGHQERRQLIMRQQLYRKSKAAIRIQRCVRAWLSKRDLIQIYHEGDEKSEFKYWDVP-GLNMERKSELNKVHNKWMASHKHEFRGISEDTQLELHHKAQKLYHRHLYELKTNRRKDIDRELTLARLETDSKLLISAPDLAEAVDGFNNQSDLKFKIDNFHCKIRPIANRAAQLHQQKINTIKQPWWKQL 2550
            P   + G+  +  I D+LS   V      + E+  + F+P  +E+L+ FL      R ++      ++  +R + +S+               +L+R   + +  ++    +  + I ++D +SI+       + + N + L ++        GN  ++ I D+I+Y ++S+ N  +    +  L+ + +   S   +I  RY+GL  L  K W          GF +   Q    L+  L  D+ ++    ++   + A   IQ+ WR+   R +L K  +A    QR++RS   +   E+N      E+ + ++I    +    +    L  +      V ++L + + +AA  IQ +WRGH+ERR     + + R+ +AA+ +QR V  +L +R          +++       P GL   R++EL K   + +  H    +  S +   ELH +AQ L HRHL    ++R ++  R+  LA++ TD +LL++AP L +       + D+      F  +  P+A RA Q H   + +++ PWW+ L
Sbjct:   73 PARIQGGYAALTQIADLLSTCCVGLAAFRDIEVFSHEFLPSVVESLL-FLAERLMNRALRDKAPSEMIRLFRKVFDSI--------------GWLLRAHRHLIHHVLRCKHYESVQICEDDDVSIVTVTLWNDIFRTNSAVLAEM--------GNRALTDIMDDIVYKMSSSSNPVIGRAAVKTLVLILDHSSSTQQLIQRRYRGLSDLAEKDWRGK-------GFDSALDQ----LIDHLQLDVPWKEPKESSEECVRAACVIQAAWRAHLTRRRLKKLPRAVSTLQRSFRSGHHQHSYEENCT---LEMLYTLTIITLTQANKCISCPPLSGQ------VQRYLGELENKAALVIQRVWRGHRERRHFQQHKHILRRHRAAVTLQRAVLLFLKRRKA--------QRNILTPLKAPKGLTDSRRTELRKQIQEHITLHPSSVQ--SAEGSAELHQRAQSLLHRHLVNRASDRAQEQHRQALLAQINTDIELLLNAPSLRDV-----REEDVNL----FLSRSCPVATRARQSHNALLQSMRLPWWRTL 560          
BLAST of NPHP5 vs. Ensembl Zebrafish
Match: iqcb1 (IQ motif containing B1 [Source:ZFIN;Acc:ZDB-GENE-041212-47])

HSP 1 Score: 105.145 bits (261), Expect = 2.228e-23
Identity = 97/397 (24.43%), Postives = 186/397 (46.85%), Query Frame = 1
Query:  946 PKSWKDGFCIVQSIYDILSRI-VPQNRSEENEI-QNRFIPEFIENLMCFL------RQMQGNFNESLVPEYRGILNSVXXXXXXXXXXXXXXSFLVRFSDY-VSTMIESPWFLQLFITDNDKISILMTEWLMKLIKINPSGLKKISKSTVNGIGN-IVSTIFDEIIYHLASTDNKQLIEININCLLTMFEADQSLVSVIHLRYKGLKLLILK-WSMSQNSTLKVGFSNLFSQNFRLLLTMLDSDLIYQAGMSTN---LWAIIKIQSWWRSVAVRLKLAKTNKAFERFQRNYRSRKLKEIKEQNTLRIRKELEHQISITRQRKFRSKLEAEVLLMETLPAPIVFKHLEKTKQEAATTIQSIWRGHQERRQLIMRQQLYRKSKAAIRIQRCVRAWLSKR 2094
            P   + G+  +  + D+LS   V      + E+  + F+P  +E+L+ FL      R ++      ++  +R + +S+               +L+R   + +  ++    +  + I ++D +SI+       + + N + L ++        GN  ++ I D+I+Y ++S+ N  +    +  L+ + +   S   +I  RY+GL  L  K W          GF +   Q    L+  L  D+ ++    ++   + A   IQ+ WR+   R +L K  +A    QR++R ++ ++ +     R  +EL HQ+ + RQR  R   + ++ LME LPA  V ++L + + +AA  IQ +WRGH+ERR     + + R+ +AAI +QR V  +L  R
Sbjct:   19 PARIQGGYAALTQMADLLSTCCVGLAAFRDIEVFSHEFLPSVVESLL-FLAERLMNRALRDKAPSEMIRLFRKVFDSI--------------GWLLRAHRHLIHHVLRCKHYESVQICEDDDVSIVTVTLWNDIFRTNSAVLAEM--------GNRALTDIMDDIVYKMSSSSNPVIGRAAVKTLVLILDHSSSTQQLIQRRYRGLSDLAEKDWRGK-------GFDSALDQ----LIDHLQLDVPWKEPKESSEECVRAACVIQAAWRAHLTRRRLKKLPRAVSTLQRSFREKRRQQQEHTERRRAEEELRHQVCLRRQRAMRLFRQHQLHLMEILPAGQVQRYLGELENKAALVIQRVWRGHRERRHFQQHKHILRRHRAAITLQRAVLLFLKHR 381          
BLAST of NPHP5 vs. Ensembl Zebrafish
Match: iqcb1 (IQ motif containing B1 [Source:ZFIN;Acc:ZDB-GENE-041212-47])

HSP 1 Score: 103.99 bits (258), Expect = 6.622e-23
Identity = 92/389 (23.65%), Postives = 183/389 (47.04%), Query Frame = 1
Query:  946 PKSWKDGFCIVQSIYDILSRI-VPQNRSEENEI-QNRFIPEFIENLMCFL------RQMQGNFNESLVPEYRGILNSVXXXXXXXXXXXXXXSFLVRFSDY-VSTMIESPWFLQLFITDNDKISILMTEWLMKLIKINPSGLKKISKSTVNGIGN-IVSTIFDEIIYHLASTDNKQLIEININCLLTMFEADQSLVSVIHLRYKGLKLLILKWSMSQNSTLKVGFSNLFSQNFRLLLTMLDSDLIYQAGMSTN---LWAIIKIQSWWRSVAVRLKLAKTNKAFERFQRNYRSRKLKEIKEQNTLRIRKELEHQISITRQRKFRSKLEAEVLLMETLPAPIVFKHLEKTKQEAATTIQSIWRGHQERRQLIMRQQLYRKSKAAIRIQRCV 2073
            P   + G+  +  I D+LS   V      + E+  + F+P  +E+L+ FL      R ++      ++  +R + +S+               +L+R   + +  ++    +  + I ++D +SI+       + + N + L ++        GN  ++ I D+I+Y ++S+ N  +    +  L+ + +   S   +I  RY+GL        +++      GF +   Q    L+  L  D+ ++    ++   + A   IQ+ WR+   R +L K  +A    QR++R ++ ++ +     R  +EL HQ+ + RQR  R   + ++ LME LPA  V ++L + + +AA  IQ +WRGH+ERR     + + R+ +AA+ +QR V
Sbjct:   73 PARIQGGYAALTQIADLLSTCCVGLAAFRDIEVFSHEFLPSVVESLL-FLAERLMNRALRDKAPSEMIRLFRKVFDSI--------------GWLLRAHRHLIHHVLRCKHYESVQICEDDDVSIVTVTLWNDIFRTNSAVLAEM--------GNRALTDIMDDIVYKMSSSSNPVIGRAAVKTLVLILDHSSSTQQLIQRRYRGLS------DLAEKDWRGKGFDSALDQ----LIDHLQLDVPWKEPKESSEECVRAACVIQAAWRAHLTRRRLKKLPRAVSTLQRSFREKRRQQQEHTERRRAEEELRHQVCLRRQRAMRLFRQHQLHLMEILPAGQVQRYLGELENKAALVIQRVWRGHRERRHFQQHKHILRRHRAAVTLQRAV 428          
BLAST of NPHP5 vs. Ensembl Xenopus
Match: iqcb1 (IQ motif containing B1 [Source:NCBI gene;Acc:780113])

HSP 1 Score: 181.415 bits (459), Expect = 1.021e-47
Identity = 154/611 (25.20%), Postives = 289/611 (47.30%), Query Frame = 1
Query:  745 DEFVIEVAKKILASNDSNYSKILIDLNRYLESIEDG-QEAIKAFETIWKRNLLPIMLLEIKKDFTNIEPKSWKDGFCIVQSIYDILSRIV----PQNRSEENEIQNRFIPEFIENLMCFLRQMQGNFNESLVPEYRGILNSVXXXXXXXXXXXXXXSFLVRFSDYVS---TMIESPWFLQLFITDNDKISILMTEWLMKLIKINPSGLKKISKSTVNGIGNIVSTIFDEIIYHLASTDNKQLIEININCLLTMFEADQSLVSVIHLRYKGLKLLILK-WSMSQNSTLKVGFSNLFSQNFRLLLTMLDSDLIYQAGMSTNLWAIIKIQSWWRSVAVRLKLAKTNKAFERFQRNYRSRKLKEIKEQNTLRIRKELEHQISITRQRKFRSKLEAEVLLMETLPAPIVFKHLEKTKQEAATTIQSIWRGHQERRQLIMRQQLYRKSKAAIRIQRCVRAWLSKRDLIQIYHEGDEKSEFKYWDVPGLNMERKSELNKVHNKWMASHKHEFRGISEDTQLELHHKAQKLYHRHLYELKTNRRKDIDRELTLARLETDSKLLISAPDLAEAVDGFNNQSDLKFKIDNFHCKIRPIANRAAQLHQQKINTIKQPWWKQL 2550
            D  ++++A +    ++    ++L+ L   ++S+  G +E  K  E ++   L+   +L + +D+  +       G+    S+ DILS       PQ  +EE    N+ +P  + N++   R++Q  +  ++  E RG L S        + +  S S+L  FS +V     ++    FLQL + D+++   +    L K+++++ S  +++ + ++        TI DE++Y L+++ N  +       LL M E+   +  ++  RYKGL+ L+ K W+              F Q    LL +L S    Q  +     A   IQ+ WR+  VR ++ +  KA    QR++R+R+ +E+ +    R  + L  Q+ + R R  R   E ++ L+E +    + KHL + +++AA TIQ IW G++ERR+   ++    + KAA+ IQR    +L++R  +        +     W    L+ ER+ EL    +  +  H H    +S +   +LH +AQ+   ++L +   +R  +  RE  LA++ TD  +L+ AP LA   +           +D F  +  P+A +A Q H   +   + PWW++L
Sbjct:    6 DPRILQLAAEYTECSNEKTPELLLQLKDIVKSVPAGSEEQRKVKEDLYHYGLIQCSVLFLIQDYRRV-----NGGWMTAASLADILSLCCVGLDPQEDAEE--FYNKLLPSALGNMLLLARRIQARYVRAMKEEERGELFS------SFRRVSDSVSWL--FSGHVQLAKDVLRMKHFLQLLMADDEETEAVAMSVLQKVLRVDSSAPRQLDEDSL-------LTILDELVYKLSASSNPVIGRAATGSLLLMLESSPGIGQLVGARYKGLRTLLSKQWT-----------GKGFGQELGQLLEILYSSSYQQEDLQRLHRAACTIQAVWRAFLVRKRMKRLPKAVTSLQRSFRARREREVSQLQRQREEEALRQQLQLHRLRAMRRFREKQLALLEIVHPGQMDKHLREVQEKAAQTIQRIWGGYRERRKFHKQKVHLAQYKAAVCIQRAALRFLNRRRKM--------RESLTPWRKTDLSDERRQELQLRLDSRL--HLHPAPQMSAEQSSDLHSRAQEKLGQYLLKRSFHRGSEQRREALLAQINTDINMLMDAPALAHVTEK---------DLDKFTSRSVPVALKAKQRHNVTLRRSRWPWWRKL 564          
BLAST of NPHP5 vs. Ensembl Mouse
Match: Iqcb1 (IQ calmodulin-binding motif containing 1 [Source:MGI Symbol;Acc:MGI:2443764])

HSP 1 Score: 150.984 bits (380), Expect = 1.208e-37
Identity = 150/618 (24.27%), Postives = 273/618 (44.17%), Query Frame = 1
Query:  739 NDDEFVIEVAKKILASNDSNYSKILIDLNRYLESIEDGQEAIKAF-ETIWKRNLLPIMLLEIKKDFTNIEPKSWKDGFCIVQSIYDILSRIVPQNRSEEN--EIQNRFIPEFIENLM--------CFLRQMQGNFNESLVPEYRGILNSVXXXXXXXXXXXXXXSFLVRFSDYVSTMIESPWFLQLFITDNDKISILMTEWLMKLIKINPSGLKKISKSTVNGIGNIVSTIFDEIIYHLASTDNKQLIEININCLLTMFEADQSLVSVIHLR--YKGLKLLILKWSMSQNSTLKVGFSNLFSQNFRLLLTMLDSDLIYQAGMSTNLWAIIKIQSWWRSVAVRLKLAKTNKAFERFQRNYRSRKLKEIKEQNTLRIRKELEHQISITRQRKFRSKLEAEVLLMETLPAPIVFKHLEKTKQEAATTIQSIWRGHQERRQLIMRQQLYRKSKAAIRIQRCVRAWLSKRDLIQIYHEGDEKSEFKYW-DVPGLNMERKSELNKVHNKWMASHKHEFRGISEDTQLELHHKAQKLYHRHLYELKTNRRKDIDRELTLARLETDSKLLISAPDLAEAVDGFNNQSDLKFKIDNFHCKIRPIANRAAQLHQQKINTIKQPWWKQL 2550
              D  ++ +A ++  S + N   IL+ L   + +   G   +K   + I+  +L+   LL + +D + I+      G+  +  +  ILS         E+  E     +P   EN +        CF+   +G   + L+  ++ + +S+                L      +  +++S  FL L  TDN +I   +   L  +++IN   L KI        G  + +I DEI++ L ST +  +       LL + E+ Q ++ ++ L   YKGL+ L     +++  TL       FS+  R L+ +L   +  +        A   IQ++W+    R +L K   A    QR++RS++ K + E N  +  ++L  ++ + RQR  R   E+ + ++E +    V K+  + ++++A TIQ  WRG++ER+    ++    + KAA+ +QR V  +L+K           +K  F  W  +  L   R+ EL +  + ++   +H    +SE    ELH +AQ+    +        R    RE  +A++ T+ + L+ AP L EA      Q         F  + RP+A +A Q H   +  I+ PWWK+L
Sbjct:    5 GTDPRILSLAAEVAKSPEQNVPVILLKLKEIINNTPLGSSELKKVKQDIYCYDLIQYCLLVLSQDSSRIQ-----GGWSTISQLTQILSHCCVGLEPGEDGEEFYKELLPSAAENFLILGRRLQTCFINATKGEEQDKLLHFFQIVTDSLFW-------------LLGGHVQLIQNVLQSDHFLHLLQTDNVQIGASVMTLLQNILQINSGNLLKIE-------GKALHSILDEILFKLLSTPSPVIRSTATKLLLVLAESHQEILILLRLSACYKGLRSL-----LNKQETL-----TEFSRELRQLVDLLTPKIHQEVEEQKLHKAACLIQAYWKGFQTRKRLKKLPSAVIALQRSFRSKRTKMMLELNRQKEEEDLRLKLQLQRQRAMRLSRESRLNMLEIIHPGQVEKYNREMEEKSALTIQKHWRGYRERKNFRQQRPSLTEYKAAVTLQRAVLKFLAKCR--------KKKKLFASWHGLQELTDARRVELKQQVDDYVK--RHPCSQMSEAASRELHAQAQERLQHYFMGRAIEERAQQHREALMAQISTNIEQLMKAPSLKEAEGKEPEQ---------FLSRSRPVAAKAKQAHLTTLKHIQAPWWKKL 568          
BLAST of NPHP5 vs. Ensembl Mouse
Match: Iqcb1 (IQ calmodulin-binding motif containing 1 [Source:MGI Symbol;Acc:MGI:2443764])

HSP 1 Score: 122.094 bits (305), Expect = 2.804e-28
Identity = 132/564 (23.40%), Postives = 249/564 (44.15%), Query Frame = 1
Query:  739 NDDEFVIEVAKKILASNDSNYSKILIDLNRYLESIEDGQEAIKAF-ETIWKRNLLPIMLLEIKKDFTNIEPKSWKDGFCIVQSIYDILSRIVPQNRSEEN--EIQNRFIPEFIENLM--------CFLRQMQGNFNESLVPEYRGILNSVXXXXXXXXXXXXXXSFLVRFSDYVSTMIESPWFLQLFITDNDKISILMTEWLMKLIKINPSGLKKISKSTVNGIGNIVSTIFDEIIYHLASTDNKQLIEININCLLTMFEADQSLVSVIHLR--YKGLKLLILKWSMSQNSTLKVGFSNLFSQNFRLLLTMLDSDLIYQAGMSTNLWAIIKIQSWWRSVAVRLKLAKTNKAFERFQRNYRSRKLKEIKEQNTLRIRKELEHQISITRQRKFRSKLEAEVLLMETLPAPIVFKHLEKTKQEAATTIQSIWRGHQERRQLIMRQQLYRKSKAAIRIQRCVRAWLSKRDLIQIYHEGDEKSEFKYW-DVPGLNMERKSELNKVHNKWMASHKHEFRGISEDTQLELHHKAQKLYHRHLYELKTNRRKDIDRELTLARLETDSKLLIS 2388
              D  ++ +A ++  S + N   IL+ L   + +   G   +K   + I+  +L+   LL + +D + I+      G+  +  +  ILS         E+  E     +P   EN +        CF+   +G   + L+  ++ + +S+                L      +  +++S  FL L  TDN +I   +   L  +++IN   L KI        G  + +I DEI++ L ST +  +       LL + E+ Q ++ ++ L   YKGL+ L     +++  TL       FS+  R L+ +L   +  +        A   IQ++W+    R +L K   A    QR++RS++ K + E N  +  ++L  ++ + RQR  R   E+ + ++E +    V K+  + ++++A TIQ  WRG++ER+    ++    + KAA+ +QR V  +L+K           +K  F  W  +  L   R+ EL +  + ++   +H    +SE    ELH +AQ+    +        R    RE  +A++ T+ + L+S
Sbjct:    5 GTDPRILSLAAEVAKSPEQNVPVILLKLKEIINNTPLGSSELKKVKQDIYCYDLIQYCLLVLSQDSSRIQ-----GGWSTISQLTQILSHCCVGLEPGEDGEEFYKELLPSAAENFLILGRRLQTCFINATKGEEQDKLLHFFQIVTDSLFW-------------LLGGHVQLIQNVLQSDHFLHLLQTDNVQIGASVMTLLQNILQINSGNLLKIE-------GKALHSILDEILFKLLSTPSPVIRSTATKLLLVLAESHQEILILLRLSACYKGLRSL-----LNKQETL-----TEFSRELRQLVDLLTPKIHQEVEEQKLHKAACLIQAYWKGFQTRKRLKKLPSAVIALQRSFRSKRTKMMLELNRQKEEEDLRLKLQLQRQRAMRLSRESRLNMLEIIHPGQVEKYNREMEEKSALTIQKHWRGYRERKNFRQQRPSLTEYKAAVTLQRAVLKFLAKCR--------KKKKLFASWHGLQELTDARRVELKQQVDDYVK--RHPCSQMSEAASRELHAQAQERLQHYFMGRAIEERAQQHREALMAQISTNIEQLMS 523          
BLAST of NPHP5 vs. UniProt/SwissProt
Match: sp|Q8BP00|IQCB1_MOUSE (IQ calmodulin-binding motif-containing protein 1 OS=Mus musculus OX=10090 GN=Iqcb1 PE=1 SV=2)

HSP 1 Score: 150.984 bits (380), Expect = 8.452e-37
Identity = 150/618 (24.27%), Postives = 273/618 (44.17%), Query Frame = 1
Query:  739 NDDEFVIEVAKKILASNDSNYSKILIDLNRYLESIEDGQEAIKAF-ETIWKRNLLPIMLLEIKKDFTNIEPKSWKDGFCIVQSIYDILSRIVPQNRSEEN--EIQNRFIPEFIENLM--------CFLRQMQGNFNESLVPEYRGILNSVXXXXXXXXXXXXXXSFLVRFSDYVSTMIESPWFLQLFITDNDKISILMTEWLMKLIKINPSGLKKISKSTVNGIGNIVSTIFDEIIYHLASTDNKQLIEININCLLTMFEADQSLVSVIHLR--YKGLKLLILKWSMSQNSTLKVGFSNLFSQNFRLLLTMLDSDLIYQAGMSTNLWAIIKIQSWWRSVAVRLKLAKTNKAFERFQRNYRSRKLKEIKEQNTLRIRKELEHQISITRQRKFRSKLEAEVLLMETLPAPIVFKHLEKTKQEAATTIQSIWRGHQERRQLIMRQQLYRKSKAAIRIQRCVRAWLSKRDLIQIYHEGDEKSEFKYW-DVPGLNMERKSELNKVHNKWMASHKHEFRGISEDTQLELHHKAQKLYHRHLYELKTNRRKDIDRELTLARLETDSKLLISAPDLAEAVDGFNNQSDLKFKIDNFHCKIRPIANRAAQLHQQKINTIKQPWWKQL 2550
              D  ++ +A ++  S + N   IL+ L   + +   G   +K   + I+  +L+   LL + +D + I+      G+  +  +  ILS         E+  E     +P   EN +        CF+   +G   + L+  ++ + +S+                L      +  +++S  FL L  TDN +I   +   L  +++IN   L KI        G  + +I DEI++ L ST +  +       LL + E+ Q ++ ++ L   YKGL+ L     +++  TL       FS+  R L+ +L   +  +        A   IQ++W+    R +L K   A    QR++RS++ K + E N  +  ++L  ++ + RQR  R   E+ + ++E +    V K+  + ++++A TIQ  WRG++ER+    ++    + KAA+ +QR V  +L+K           +K  F  W  +  L   R+ EL +  + ++   +H    +SE    ELH +AQ+    +        R    RE  +A++ T+ + L+ AP L EA      Q         F  + RP+A +A Q H   +  I+ PWWK+L
Sbjct:    5 GTDPRILSLAAEVAKSPEQNVPVILLKLKEIINNTPLGSSELKKVKQDIYCYDLIQYCLLVLSQDSSRIQ-----GGWSTISQLTQILSHCCVGLEPGEDGEEFYKELLPSAAENFLILGRRLQTCFINATKGEEQDKLLHFFQIVTDSLFW-------------LLGGHVQLIQNVLQSDHFLHLLQTDNVQIGASVMTLLQNILQINSGNLLKIE-------GKALHSILDEILFKLLSTPSPVIRSTATKLLLVLAESHQEILILLRLSACYKGLRSL-----LNKQETL-----TEFSRELRQLVDLLTPKIHQEVEEQKLHKAACLIQAYWKGFQTRKRLKKLPSAVIALQRSFRSKRTKMMLELNRQKEEEDLRLKLQLQRQRAMRLSRESRLNMLEIIHPGQVEKYNREMEEKSALTIQKHWRGYRERKNFRQQRPSLTEYKAAVTLQRAVLKFLAKCR--------KKKKLFASWHGLQELTDARRVELKQQVDDYVK--RHPCSQMSEAASRELHAQAQERLQHYFMGRAIEERAQQHREALMAQISTNIEQLMKAPSLKEAEGKEPEQ---------FLSRSRPVAAKAKQAHLTTLKHIQAPWWKKL 568          
BLAST of NPHP5 vs. UniProt/SwissProt
Match: sp|Q15051|IQCB1_HUMAN (IQ calmodulin-binding motif-containing protein 1 OS=Homo sapiens OX=9606 GN=IQCB1 PE=1 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 1.644e-34
Identity = 158/614 (25.73%), Postives = 278/614 (45.28%), Query Frame = 1
Query:  739 NDDEFVIEVAKKILASNDSNYSKILIDLNRYLESIEDGQEAIKAF-ETIWKRNLLPIMLLEIKKDFTNIEPKSWKDGFCIVQSIYDILSRIVPQNRSEEN--EIQNRFIPEFIENLMCFLRQMQGNF-NESLVPEYRGILNSVXXXXXXXXXXXXXXSFLVRFSDYVSTMIESPWFLQLFITDNDKISILMTEWLMKLIKINPSGLKKISKSTVNGIGNIVSTIFDEIIYHLASTDNKQLIEININCLLTMFEADQSLVSVIHLR----YKGLKLLILKWSMSQNSTLKVGFSNLFSQNFRLLLTMLDSDLIYQAGMSTNL-WAIIKIQSWWRSVAVRLKLAKTNKAFERFQRNYRSRKLKEIKEQNTLRIRKELEHQISITRQRKFRSKLEAEVLLMETLPAPIVFKHLEKTKQEAATTIQSIWRGHQERRQLIMRQQLYRKSKAAIRIQRCVRAWLSKRDLIQIYHEGDEKSEFKYW-DVPGLNMERKSELNKVHNKWMASHKHEFRGISEDTQLELHHKAQKLYHRHLYELKTNRRKDIDRELTLARLETDSKLLISAPDLAEAVDGFNNQSDLKFKIDNFHCKIRPIANRAAQLHQQKINTIKQPWWKQL 2550
              D  ++ +A ++  S + N   IL+ L   +     G   +K   + I+  +L+   LL + +D++ I+      G+  +  +  ILS         E+  E  N  +P   EN +   RQ+Q  F N +   E   +L+  +++ +           L    + +  +++S  FL L   DN +I   +   L  +++IN   L +I +  +        +I DE+I+ L ST +  +       LL M E+ Q ++  I LR    YKGL+ L+ K                FSQ  R L+ +L S ++YQ      L  A   IQ++W+    R +L K   A    QR++RS++ K + E N  +  ++L+ Q+ + RQR  R   E ++ ++E +    V KH  + ++++A  IQ  WRG++ER+    ++Q   + KAA+ +QR    +L+K           +K  F  W  +  L   R+ EL K  + ++   +H    +S+    ELH +AQ+    +        R    RE  +A++ T+ + L+ AP L EA      + +L      F  + RP+A +A Q H   +  I+ PWWK+L
Sbjct:    5 GTDPRILSIAAEVAKSPEQNVPVILLKLKEIINITPLGSSELKKIKQDIYCYDLIQYCLLVLSQDYSRIQ-----GGWTTISQLTQILSHCCVGLEPGEDAEEFYNELLPSAAENFLVLGRQLQTCFINAAKAEEKDELLHFFQIVTDSLFW------LLGGHVELIQNVLQSDHFLHLLQADNVQIGSAVMMMLQNILQINSGDLLRIGRKALY-------SILDEVIFKLFSTPSPVIRSTATKLLLLMAESHQEIL--ILLRQSTCYKGLRRLLSKQETGTE----------FSQELRQLVGLL-SPMVYQEVEEQKLHQAACLIQAYWKGFQTRKRLKKLPSAVIALQRSFRSKRSKMLLEINRQKEEEDLKLQLQLQRQRAMRLSRELQLSMLEIVHPGQVEKHYREMEEKSALIIQKHWRGYRERKNFHQQRQSLIEYKAAVTLQRAALKFLAKCR--------KKKKLFAPWRGLQELTDARRVELKKRVDDYV--RRHLGSPMSDVVSRELHAQAQERLQHYFMGRALEERAQQHREALIAQISTNVEQLMKAPSLKEAE---GKEPEL------FLSRSRPVAAKAKQAHLTTLKHIQAPWWKKL 568          
BLAST of NPHP5 vs. TrEMBL
Match: A0A0H3YFP4 (NPHP5 OS=Schmidtea mediterranea OX=79327 GN=NPHP5 PE=2 SV=1)

HSP 1 Score: 1243.41 bits (3216), Expect = 0.000e+0
Identity = 647/647 (100.00%), Postives = 647/647 (100.00%), Query Frame = 1
Query:  736 MNDDEFVIEVAKKILASNDSNYSKILIDLNRYLESIEDGQEAIKAFETIWKRNLLPIMLLEIKKDFTNIEPKSWKDGFCIVQSIYDILSRIVPQNRSEENEIQNRFIPEFIENLMCFLRQMQGNFNESLVPEYRGILNSVXXXXXXXXXXXXXXSFLVRFSDYVSTMIESPWFLQLFITDNDKISILMTEWLMKLIKINPSGLKKISKSTVNGIGNIVSTIFDEIIYHLASTDNKQLIEININCLLTMFEADQSLVSVIHLRYKGLKLLILKWSMSQNSTLKVGFSNLFSQNFRLLLTMLDSDLIYQAGMSTNLWAIIKIQSWWRSVAVRLKLAKTNKAFERFQRNYRSRKLKEIKEQNTLRIRKELEHQISITRQRKFRSKLEAEVLLMETLPAPIVFKHLEKTKQEAATTIQSIWRGHQERRQLIMRQQLYRKSKAAIRIQRCVRAWLSKRDLIQIYHEGDEKSEFKYWDVPGLNMERKSELNKVHNKWMASHKHEFRGISEDTQLELHHKAQKLYHRHLYELKTNRRKDIDRELTLARLETDSKLLISAPDLAEAVDGFNNQSDLKFKIDNFHCKIRPIANRAAQLHQQKINTIKQPWWKQLLVXXXXXXXXXXXXXXXXXXXXQYMILRNRLEFLKDSEMAYY 2676
            MNDDEFVIEVAKKILASNDSNYSKILIDLNRYLESIEDGQEAIKAFETIWKRNLLPIMLLEIKKDFTNIEPKSWKDGFCIVQSIYDILSRIVPQNRSEENEIQNRFIPEFIENLMCFLRQMQGNFNESLVPEYRGILNSVELLKEIKQILELSESFLVRFSDYVSTMIESPWFLQLFITDNDKISILMTEWLMKLIKINPSGLKKISKSTVNGIGNIVSTIFDEIIYHLASTDNKQLIEININCLLTMFEADQSLVSVIHLRYKGLKLLILKWSMSQNSTLKVGFSNLFSQNFRLLLTMLDSDLIYQAGMSTNLWAIIKIQSWWRSVAVRLKLAKTNKAFERFQRNYRSRKLKEIKEQNTLRIRKELEHQISITRQRKFRSKLEAEVLLMETLPAPIVFKHLEKTKQEAATTIQSIWRGHQERRQLIMRQQLYRKSKAAIRIQRCVRAWLSKRDLIQIYHEGDEKSEFKYWDVPGLNMERKSELNKVHNKWMASHKHEFRGISEDTQLELHHKAQKLYHRHLYELKTNRRKDIDRELTLARLETDSKLLISAPDLAEAVDGFNNQSDLKFKIDNFHCKIRPIANRAAQLHQQKINTIKQPWWKQLLVEEPIDLEADDDLLLEPVDLDQYMILRNRLEFLKDSEMAYY
Sbjct:    1 MNDDEFVIEVAKKILASNDSNYSKILIDLNRYLESIEDGQEAIKAFETIWKRNLLPIMLLEIKKDFTNIEPKSWKDGFCIVQSIYDILSRIVPQNRSEENEIQNRFIPEFIENLMCFLRQMQGNFNESLVPEYRGILNSVELLKEIKQILELSESFLVRFSDYVSTMIESPWFLQLFITDNDKISILMTEWLMKLIKINPSGLKKISKSTVNGIGNIVSTIFDEIIYHLASTDNKQLIEININCLLTMFEADQSLVSVIHLRYKGLKLLILKWSMSQNSTLKVGFSNLFSQNFRLLLTMLDSDLIYQAGMSTNLWAIIKIQSWWRSVAVRLKLAKTNKAFERFQRNYRSRKLKEIKEQNTLRIRKELEHQISITRQRKFRSKLEAEVLLMETLPAPIVFKHLEKTKQEAATTIQSIWRGHQERRQLIMRQQLYRKSKAAIRIQRCVRAWLSKRDLIQIYHEGDEKSEFKYWDVPGLNMERKSELNKVHNKWMASHKHEFRGISEDTQLELHHKAQKLYHRHLYELKTNRRKDIDRELTLARLETDSKLLISAPDLAEAVDGFNNQSDLKFKIDNFHCKIRPIANRAAQLHQQKINTIKQPWWKQLLVEEPIDLEADDDLLLEPVDLDQYMILRNRLEFLKDSEMAYY 647          
BLAST of NPHP5 vs. TrEMBL
Match: A0A1S3JUD9 (IQ calmodulin-binding motif-containing protein 1 OS=Lingula unguis OX=7574 GN=LOC106176047 PE=4 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 5.021e-68
Identity = 169/617 (27.39%), Postives = 311/617 (50.41%), Query Frame = 1
Query:  745 DEFVIEVAKKILASNDSNYSKILIDLNRYLESIEDG-QEAIKAFETIWKRNLLPIMLLEIKKDFTNIEPKSWKDGFCIVQSIYDILSRIVPQ-NRSEENEIQNRFIPEFIENLMCFLRQMQG----------NFNESLVPEYRGILNSVXXXXXXXXXXXXXXSFLVRFSDYV---STMIESPWFLQLFITDNDKISILMTEWLMKLIKINPSGLKKISKSTVNGIGNIVSTIFDEIIYHLASTDNKQLIEININCLLTMFEADQSLVSVIHLRYKGLKLLILKWSMSQNSTLKVGFSNLFSQNFRLLLTMLDSDLIYQAGMSTNLWAIIKIQSWWRSVAVRLKLAKTNKAFERFQRNYRSRKLKEIKEQNTLRIRKELEHQISITRQRKFRSKLEAEVLLMETLPAPIVFKHLEKTKQEAATTIQSIWRGHQERRQLIMRQQLYRKSKAAIRIQRCVRAWLSKRDLIQIYHEGDEKSEFKYWDVPGLNMERKSELNKVHNKWMASHKHEFRGISEDTQLELHHKAQKLYHRHLYELKTNRRKDIDRELTLARLETDSKLLISAPDLAEAVDGFNNQSDLKFKIDNFHCKIRPIANRAAQLHQQKINTIKQPWWKQL 2550
            D  V+ +A ++  + D N   +L+DL   ++S+  G +EA +    IW  +LL +++L +K+DF  +     + G+     + ++LS      +  +  E     +PE +EN +   R++Q           N    L+  +RG+L +V              ++L  FS +V   + +++S W LQL ITD+   ++     ++   ++N      +S+  VN       +I DE++Y L+++ N  +       LLT+ + +  +V  I +RY+GL+ L+ KW+              F ++ + L+ +L+S   ++A M     A   IQ+ WRS   R +L K ++AF + QR++R ++ +  KE+   +++ ELEHQ+ + R++  R     ++ L+  +PA    K+LE  ++ AA  IQ+ W+GH+ R+QL  RQ   ++ +AA+ IQR  R W ++R       E  ++    +   PGL  ER+ E+ +   +W   H  + +  ++  Q E+H+KAQ+L  R+    +  R+K ++RE  LA +ETD  LL++A  L +  +           ID F  K  PIA +A   HQ ++  ++QPW+++L
Sbjct:   10 DRRVLTLAAEVAETKDRNVPILLLDLQEIVDSVPVGSKEATRIKNEIWTYDLLQVLILVLKQDFDRV-----RGGWGTATKLANLLSHCCTGLDPPDSQEFYQLSLPEAVENQLMLSRKIQTKYLKTDENMTNMRRDLLDHFRGVLEAV--------------TYL--FSGHVFLTTNVLKSQWLLQLLITDDVDTALSCMTLILNCTRVNRDVFSTLSERLVN-------SILDELVYKLSASTNMDIGSATTRILLTICDTNPPMVEQICIRYRGLRPLLSKWT-----------GKGFGKDLKQLILLLESGSAHRAKMERLHRAATTIQAMWRSFQTRNQLKKADRAFAKLQRSFRVKRERTQKERENEQLQSELEHQLLLARRKAIRESRLKQLELLSIMPAAKSQKYLESVQENAALKIQTSWKGHRARKQLTERQANMKRVRAAVAIQRKFRHWSARR-------ERKKREPLAFQRPPGLTDERRVEIQQHITRWREDHPTKCKTRAQ--QEEIHNKAQELIQRNQMLNRVTRKKHLEREALLAMIETDCDLLLNATSLKDVTEK---------DIDVFSSKSVPIATKARLNHQHELRLLRQPWYRKL 569          
BLAST of NPHP5 vs. TrEMBL
Match: A0A2R2MJY0 (IQ calmodulin-binding motif-containing protein 1-like OS=Lingula unguis OX=7574 GN=LOC106157792 PE=4 SV=1)

HSP 1 Score: 246.899 bits (629), Expect = 1.179e-67
Identity = 169/617 (27.39%), Postives = 311/617 (50.41%), Query Frame = 1
Query:  745 DEFVIEVAKKILASNDSNYSKILIDLNRYLESIEDG-QEAIKAFETIWKRNLLPIMLLEIKKDFTNIEPKSWKDGFCIVQSIYDILSRIVPQ-NRSEENEIQNRFIPEFIENLMCFLRQMQG----------NFNESLVPEYRGILNSVXXXXXXXXXXXXXXSFLVRFSDYV---STMIESPWFLQLFITDNDKISILMTEWLMKLIKINPSGLKKISKSTVNGIGNIVSTIFDEIIYHLASTDNKQLIEININCLLTMFEADQSLVSVIHLRYKGLKLLILKWSMSQNSTLKVGFSNLFSQNFRLLLTMLDSDLIYQAGMSTNLWAIIKIQSWWRSVAVRLKLAKTNKAFERFQRNYRSRKLKEIKEQNTLRIRKELEHQISITRQRKFRSKLEAEVLLMETLPAPIVFKHLEKTKQEAATTIQSIWRGHQERRQLIMRQQLYRKSKAAIRIQRCVRAWLSKRDLIQIYHEGDEKSEFKYWDVPGLNMERKSELNKVHNKWMASHKHEFRGISEDTQLELHHKAQKLYHRHLYELKTNRRKDIDRELTLARLETDSKLLISAPDLAEAVDGFNNQSDLKFKIDNFHCKIRPIANRAAQLHQQKINTIKQPWWKQL 2550
            D  V+ +A ++  + D N   +L+DL   ++S+  G +EA +    IW  +LL +++L +K+DF  +     + G+     + ++LS      +  +  E     +PE +EN +   R++Q           N    L+  +RG+L +V              ++L  FS +V   + +++S W LQL ITD+   ++     ++   ++N      +S+  VN       +I DE++Y L+++ N  +       LLT+ + +  +V  I +RY+GL+ L+ KW+              F ++ + L+ +L+S   ++A M     A   IQ+ WRS   R +L K ++AF + QR++R ++ +  KE+   +++ ELEHQ+ + R++  R     ++ L+  +PA    K+LE  ++ AA  IQ+ W+GH+ R+QL  RQ   ++ +AA+ IQR  R W ++R       E  ++    +   PGL  ER+ E+ +   +W   H  + +  ++  Q E+H+KAQ+L  R+    +  R+K ++RE  LA +ETD  LL++A  L +  +           ID F  K  PIA +A   HQ ++  ++QPW+++L
Sbjct:   10 DRRVLTLAAEVAETKDRNVPILLLDLQEIVDSVPVGSKEATRIKNEIWTYDLLQVLILVLKQDFDRV-----RGGWGTATKLANLLSHCCTGLDPPDSQEFYQLSLPEAVENQLMLSRKIQTKYLKTDENMTNMRRDLLDHFRGVLEAV--------------TYL--FSGHVFLTTNVLKSQWLLQLLITDDVDTALSCMTLILNCTRVNRDVFSTLSERLVN-------SILDELVYKLSASTNMDIGSATTRILLTICDTNPPMVEQICIRYRGLRPLLSKWT-----------GKGFGKDLKQLILLLESGSAHRAKMERLHRAATTIQAMWRSFQTRNQLKKADRAFAKLQRSFRIKRERTQKERENEQLQSELEHQLLLARRKAIRESRLKQLELLSIMPAAKSQKYLESVQENAALKIQTSWKGHRVRKQLTERQANMKRVRAAVAIQRKFRHWSARR-------ERKKREPLAFQRPPGLTDERRVEIQQHITRWREDHPTKCKTRAQ--QEEIHNKAQELIQRNQMLNRVTRKKHLEREALLAMIETDCDLLLNATSLKDVTEK---------DIDVFSSKSVPIATKARLNHQHELRLLRQPWYRKL 569          
BLAST of NPHP5 vs. TrEMBL
Match: A0A0B6ZDD5 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF59300 PE=4 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 2.223e-60
Identity = 176/609 (28.90%), Postives = 295/609 (48.44%), Query Frame = 1
Query:  745 DEFVIEVAKKILASNDSNYSKILIDLNRYLESIEDGQE-AIKAFETIWKRNLLPIMLLEIKKDFTNIEPKSWKDGFCIVQSIYDILSRIVPQNRSEENEIQNRFIPEFIENLMCFLRQMQGNFNESLVPEYRGILNSVXXXXXXXXXXXXXXSFLVRF-SDY---VSTMIESPWFLQLFITDNDKISILMTEWLMKLIKINPSGLKKISKSTVNGIGNIVSTIFDEIIYHLASTDNKQLIEININCLLTMFEADQSLVSVIHLRYKGLKLLILKWSMSQNSTLKVGFSNLFSQNFRLLLTMLDSDLIYQAGMSTNLWAIIKIQSWWRSVAVRLKLAKTNKAFERFQRNYRSRKLKEIKEQNTLRIRKELEHQISITRQRKFRSKLEAEVLLMETLPAPIVFKHLEKTKQEAATTIQSIWRGHQERRQLIMRQQLYRKSKAAIRIQRCVRAWLSKRDLIQIYHEGDEKSEFKYWDVP-GLNMERKSELNKVHNKWMASHKHEFRGISEDTQLELHHK-AQKLYHRHLYELKTNRRKDIDRELTLARLETDSKLLISAPDLAEAVDGFNNQSDLKFKIDNFHCKIRPIANRAAQLHQQKINTIKQPWWKQL 2550
            D+ VI++AK+I  S D     +L+ L   L  +  G +   +    IW+ NLL +++L +++DF+ +    W+    +   + +    +    + ++ +++   +P+  ENL+   R + G  N   V +      +      +   L++    LVR  S Y    S +I SPW LQL ++D  K++ +    + K+++++P  L K  +STVN       T+ DE++Y L    +  +      CL+   +  + LV  +  RYKGL+ L+ +W               F +N RL+  ML+S    +A    N      IQ+ WR  + R +L   NKAF +FQ++YR ++ +E + +   + + EL +Q+   RQ+  R   E  +  +E LPA  V  +L+K K  AAT IQ++WRGH+ER +L  RQ + ++ +AAI+IQR  R WL K +L         + +F     P GL  +R+ EL+K  + W   +      I E   LE+  K AQ L  RH   ++  R+     E  LARL+TD +L+  AP L E  +           +  +  +  P+A  A   H Q +  ++QPWWK L
Sbjct:   13 DQRVIQLAKEISESKDRKVPSLLMALRPILNDLPAGTDKGTQIRNEIWQYNLLKVLVLVMRQDFSVV-AGEWETAAELAALLSNATCGL-KLTKDDQRQLEEDHLPKSTENLLLLARHIHGIINSVQVSK-----ETERERDNLITNLQVVMDSLVRLCSGYFYICSKVISSPWLLQLLVSDTAKVAKITMAIMDKILRLDPHLLSKSEESTVN-------TLLDELVYKLTVNTDVSVAAEACRCLIRFCDHHKPLVEALCSRYKGLRPLLRRWE-----------GQGFDRNLRLVTMMLESGSAKKAKSQRNYECARYIQAIWRGFSARKRLRNANKAFAKFQKSYRLKRAEEEQVKLQTQYQSELYYQMKRKRQQLMRRFNEKRLHTLEILPASRVEDYLKKEKSVAATRIQTLWRGHRERTKLTDRQSVAQQVRAAIKIQRAFRKWLEKSELA--------RQKFPTHLKPTGLTDDRRVELSKQISNWRELNPTRQESIEE---LEVSLKRAQGLLSRHYSSVRPYRKLQYQVENLLARLDTDMELVALAPSLKEITED---------DVQMYSSRSLPVATAAKHQHNQMMKKLQQPWWKSL 576          
BLAST of NPHP5 vs. TrEMBL
Match: A0A0B6ZDP4 (Uncharacterized protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF59296 PE=4 SV=1)

HSP 1 Score: 226.868 bits (577), Expect = 4.468e-60
Identity = 179/623 (28.73%), Postives = 303/623 (48.64%), Query Frame = 1
Query:  712 LKIYSVLTMN---DDEFVIEVAKKILASNDSNYSKILIDLNRYLESIEDGQE-AIKAFETIWKRNLLPIMLLEIKKDFTNIEPKSWKDGFCIVQSIYDILSRIVPQNRSEENEIQNRFIPEFIENLMCFLRQMQGNFNESLVPEYRGILNSVXXXXXXXXXXXXXXSFLVRF-SDY---VSTMIESPWFLQLFITDNDKISILMTEWLMKLIKINPSGLKKISKSTVNGIGNIVSTIFDEIIYHLASTDNKQLIEININCLLTMFEADQSLVSVIHLRYKGLKLLILKWSMSQNSTLKVGFSNLFSQNFRLLLTMLDSDLIYQAGMSTNLWAIIKIQSWWRSVAVRLKLAKTNKAFERFQRNYRSRKLKEIKEQNTLRIRKELEHQISITRQRKFRSKLEAEVLLMETLPAPIVFKHLEKTKQEAATTIQSIWRGHQERRQLIMRQQLYRKSKAAIRIQRCVRAWLSKRDLIQIYHEGDEKSEFKYWDVP-GLNMERKSELNKVHNKWMASHKHEFRGISEDTQLELHHK-AQKLYHRHLYELKTNRRKDIDRELTLARLETDSKLLISAPDLAEAVDGFNNQSDLKFKIDNFHCKIRPIANRAAQLHQQKINTIKQPWWKQL 2550
            LK+ + L ++    D+ VI++AK+I  S D     +L+ L   L  +  G +   +    IW+ NLL +++L +++DF+ +  + W+    +   + +    +    + ++ +++   +P+  ENL+   R + G  N   V +      +      +   L++    LVR  S Y    S +I SPW LQL ++D  K++ +    + K+++++P  L K  +STVN       T+ DE++Y L    +  +      CL+   +  + LV  +  RYKGL+ L+ +W               F +N RL+  ML+S    +A    N      IQ+ WR  + R +L   NKAF +FQ++YR ++ +E + +   + + EL +Q+   RQ+  R   E  +  +E LPA  V  +L+K K  AAT IQ++WRGH+ER +L  RQ + ++ +AAI+IQR  R WL K +L         + +F     P GL  +R+ EL+K  + W   +      I E   LE+  K AQ L  RH   ++  R+     E  LARL+TD +L+  AP L E  +           +  +  +  P+A  A   H Q +  ++QPWWK L
Sbjct:   25 LKMDTTLAISPRKGDQRVIQLAKEISESKDRKVPSLLMALRPILNDLPAGTDKGTQIRNEIWQYNLLKVLVLVMRQDFSVVAGE-WETAAELAALLSNATCGL-KLTKDDQRQLEEDHLPKSTENLLLLARHIHGIINSVQVSK-----ETERERDNLITNLQVVMDSLVRLCSGYFYICSKVISSPWLLQLLVSDTAKVAKITMAIMDKILRLDPHLLSKSEESTVN-------TLLDELVYKLTVNTDVSVAAEACRCLIRFCDHHKPLVEALCSRYKGLRPLLRRWE-----------GQGFDRNLRLVTMMLESGSAKKAKSQRNYECARYIQAIWRGFSARKRLRNANKAFAKFQKSYRLKRAEEEQVKLQTQYQSELYYQMKRKRQQLMRRFNEKRLHTLEILPASRVEDYLKKEKSVAATRIQTLWRGHRERTKLTDRQSVAQQVRAAIKIQRAFRKWLEKSELA--------RQKFPTHLKPTGLTDDRRVELSKQISNWRELNPTRQESIEE---LEVSLKRAQGLLSRHYSSVRPYRKLQYQVENLLARLDTDMELVALAPSLKEITED---------DVQMYSSRSLPVATAAKHQHNQMMKKLQQPWWKSL 602          
BLAST of NPHP5 vs. Ensembl Cavefish
Match: iqcb1 (IQ motif containing B1 [Source:NCBI gene;Acc:103033183])

HSP 1 Score: 142.124 bits (357), Expect = 8.845e-35
Identity = 147/619 (23.75%), Postives = 289/619 (46.69%), Query Frame = 1
Query:  742 DDEFVIEVAKKILASNDSNYSKILIDLNRYL---ESIEDGQEAIKAFETIWKRNLLPIMLLEIKKDFTNIEPKSWKDGFCIVQSIYDILSRIVPQNRSEENE--IQNRFIPEFIENLMCFLRQMQGNFNES---LVPEYRGILNSVXXXXXXXXXXXXXXSFLVR-FSDYVSTMIESPWFLQLFITDNDKISILMTEWLMKLIKINPSGLKKISKSTVNGIGNIVSTIFDEIIYHLASTDNKQLIEININCLLTMFEADQSLVSVIHLRYKGLKLLILK-WSMSQNSTLKVGFSNLFSQNFRLLLTMLDSDLI-----YQAGMSTNLWAIIKIQSWWRSVAVRLKLAKTNKAFERFQRNYRSRKLKEIKEQNTLRIRKELEHQISITRQRKFRSKLEAEVLLMETLPAPIVFKHLEKTKQEAATTIQSIWRGHQERRQLIMRQQLYRKSKAAIRIQRCVRAWLSKRDLIQIYHEGDEKSEFKYWDVP-GLNMERKSELNKVHNKWMASHKHEFRGISEDTQLELHHKAQKLYHRHLYELKTNRRKDIDRELTLARLETDSKLLISAPDLAEAVDGFNNQSDLKFKIDNFHCKIRPIANRAAQLHQQKINTIKQPWWKQL 2550
            ++E +I V K + A    +  K ++   + L   +S+ D ++  +  + +++  +L      ++       P   +  +  +  + D++S       S  N     ++F+P   ENL+ F  ++     +    +   +R + +S+              S+++R ++  +S +++S  +  + ++++D++S ++      L ++N    + IS+     +G++V    D+++Y  +++ N  +       LL + +     + ++H  YKGL  L+ K W          GF  +  Q    L+  L S++       Q      + A   IQ+ WR+   R ++ K  KA    QR++R R+ ++ +E +  R  +EL HQ+ + RQR  R   + ++ LME LPA  V ++L + +  AA  IQ +WRGH+ER+     +   R+ KAA+ +QR +  +L +R          ++     W  P GL   R++EL +   + ++ H        E TQ ELH KAQ +  +HL     +R ++  R+  LA++ TD +LL++AP L +AV+          K   F  +   +A RA Q H   + +++ PWW++L
Sbjct:    7 EEEDIISVLKTLSAEKSEHSFKHVLSKTKELLSRKSVGDLRDLERCKQDLYQHGVLAYCSAALR-----FNPVKTEGSYASITQMVDVISTCCVGIGSVRNREVFLHQFLPSVTENLLFFAHRLMNRVEKGQTEMFRLFRKVFDSL--------------SWILRAYTHLISCVLKSKHYESVQMSEDDEVSAVVLMMWYNLFRVNS---EIISEMGRKALGSVV----DDVVYKSSNSTNPVIGSSATKILLLIIDQHSQSLQILHKHYKGLDDLLRKDWQGK-------GFDAVLEQ----LINHLQSEVPERSIKVQRSSEEKIRAACVIQAAWRAHQTRNRMRKLPKAVSALQRSFRERRRRQQEETDKRRAEEELRHQVLLRRQRATRQFRQRQLHLMEILPADQVARYLGELENRAALLIQRVWRGHRERQCFQKTKYQLRQHKAAVTLQRAILRFLKRRR--------SQRMILSPWKGPKGLTDNRRAELRRQIEEHISLHS-SSVVSVEGTQ-ELHEKAQSMLQQHLMTRAHDRAQEQHRQALLAQINTDIELLLNAPSLIDAVED---------KSSPFLSRSAAVAMRARQSHNVMLQSMRLPWWRKL 569          
BLAST of NPHP5 vs. Ensembl Sea Lamprey
Match: iqcb1 (IQ motif containing B1 [Source:ZFIN;Acc:ZDB-GENE-041212-47])

HSP 1 Score: 160.229 bits (404), Expect = 9.174e-42
Identity = 146/582 (25.09%), Postives = 272/582 (46.74%), Query Frame = 1
Query:  832 LESIEDG-QEAIKAFETIWKRNLLPIMLLEIKKDFTNIEPKSWKDGFCIVQSIYDILSRIVPQNR--SEENEIQNRFIPEFIENLMCFLRQMQGNFNESLVPEYR-GILNSVXXXXXXXXXXXXXXSFLVRFSDYV---STMIESPWFLQLFITDNDKISILMTEWLMKLIKINPSGLKKISKSTVNGIGNIVSTIFDEIIYHLASTDNKQLIEININCLLTMFEADQSLVSVIHLRYKGLKLLILKWSMSQNSTLKVGFSNLFSQNFRLLLTMLDSDLIYQAGMSTNLWAIIKIQSWWRSVAVRLKLAKTNKAFERFQRNYRSRKLKEIKEQNTLRIRKELEHQISITRQRKFRSKLEAEVLLMETLPAPIVFKHLEKTKQEAATTIQSIWRGHQERRQLIMRQQLYRKSKAAIRIQRCVRAWLSKRDLIQIYHEGDEKSEFKYWDVPGLNMERKSELNKVHNKWMASH--KHEFRGISEDTQLELHHKAQKLYHRHLYELKTNRRKDIDRELTLARLETDSKLLISAPDLAEAVDGFNNQSDLKFKIDNFHCKIRPIANRAAQLHQQKINTIKQPWWKQL 2550
            L S   G +E+ +  + +W   L+  +LL ++KD++  +     +G+ +   I  ILS      +  ++  E  ++ +P  +E ++   R++Q     +   E + G L + + + +         S    F  ++   S  ++S    QL ITD+   +      +  +++ N   + ++ + T+N I        DE++Y LA T + +L       LL + E+ + +++    R+KGL+LL+  W               F ++FR LL +L +    QA +     A   +QS WR+   R +L K   A    QR++R ++ KE  +    R ++EL  ++ I RQR  R+  +  +LL+E +PA  + ++L      AA  IQ+ WRG Q+R+     +QL  ++KAA+ IQR VR +L +R      H     +  +     G++  R+ EL + H   +  H  KH    +  +   ELH+ AQ L  + L + +  R+ +  R  TLA++ T ++LL + P  A+A             ++    +  P+A RA Q H   + ++++ WW++L
Sbjct:    3 LASAPAGSKESGRIKQLLWYYELVQYLLLVLEKDYSRTQ-----EGWSVAAQIAQILSTCCVGLKPLTDAEEFHSQVLPAALEGMLLLARRLQARMLHARKEEEKNGFLQNFQNVVD---------SICWLFGGHIELTSRALKSEHLQQLLITDDADTACSTMSLIQNVLRTNRGAVGEVDEKTMNAI-------LDELVYKLAVTSDPRLGGGVARALLCIAESHRPIIASFSTRFKGLQLLLNMW-----------IGKGFEKDFRRLLDLLSAGSNKQAELQHLHKAASVVQSAWRAYRARCRLKKLPHAVTYLQRSFRQKREKERLQSEQQRQQEELRQELIIRRQRAMRTSRQRRLLLLEIVPANEMDRYLALEMTRAAILIQARWRGFQKRKAFRRDRQLLLQAKAAVTIQRAVRRFLERR------HSQQTAASSRSLGWRGMSDARRMEL-RAH---IEEHIQKHPATPMHGEEARELHNHAQALLGQFLLQRQLGRQSEQRRAATLAQINTQAELLANIPIPAQASP---------RDVEALRSRSGPVAARARQAHSLALRSLRRAWWQRL 533          
BLAST of NPHP5 vs. Ensembl Nematostella
Match: EDO49031 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHT0])

HSP 1 Score: 138.272 bits (347), Expect = 4.496e-34
Identity = 153/609 (25.12%), Postives = 285/609 (46.80%), Query Frame = 1
Query:  754 VIEVAKKILASNDSNYSKILIDLNRYLESIEDGQEAIKAFET-IWKRNLLPIMLLEIKKDFTNIEPKSWKDGFCIVQSIYDILSRIVPQNRSEENEIQNRFIPEFIENLMCFLRQMQGNFNESLVPEYRGI-LNSVXXXXXXXXXXXXXXSFLVRFSDYVSTMIESPWFLQLFITDNDKISILMTEWLMKLIKINPSG--LKKISKSTVNGIGNIVSTIFDEIIYHLASTDNKQLIEININCLLTMFEADQSLVSVI-HLRYKGLKLLILKWSMSQNSTLKVGFSNLFSQNFRLLLTMLDSDLIYQAGMSTNLWAIIKIQSWWRSVAVRLKLAKTNKAFERFQRNYRSRKLKEIKEQNTLRIRKELEHQISITRQRKFRSKLEAEVLLMETLPAPIVFKHLEKTKQEAATTIQSIWRGHQERRQLI-MRQQLYRKSKAAIRIQRCVRAWLSKRDLIQIYHEGDEKSEFKYWDVPGLNMERKSELNKVHNKWMASHKHEFRGISEDTQLELHHKAQKLYHRHLYELKTNRRKDIDRELTLARLETDSKLLISAPDL----AEAVDGFNNQSDLKFKIDNFHCKIRPIANRAAQLHQQKINTIKQPWWKQL 2550
             + +A ++  + DSN   +L+ L   LE      E        +W  +L+ +  L +++DF  I+ + W     +  S+  +    V  +  E  E +  F+P  +E+++    ++   F++  + E R   L+ V+ +    Q L  + + L       +  ++S   LQ+ +T++ ++ +++   L  + K N  G  L ++S  +++       +I DEII+ L+++D+  +   + + +LT  + +QS+V ++   RY+G+K  + KW               F  + + L+ +L++    QA       A   IQS +R    R +L        + QR +R ++  +I+E   ++  +  +H     R ++FR  ++ ++ L+ET+PA  V KH+++ +  AATTIQ+ +RG + RRQ   +R  L R  +AAIRIQR +  +  +    + Y +G E      + + GL   R+ EL ++  +       + R   E    ELH KA  L   H+      RR +  R+  +ARLE DS  L++AP L     E +D + +QS              P+  +A   H  K+   K PWWK+L
Sbjct:   13 ALHLAAEVAETEDSNVPVLLLGLRDILECSPVKSELGTIIRIDLWTYDLIHVTNLALRQDFNAIQGQ-WSTAANL--SVL-LCQCCVGLDLPEVEEYERAFLPSVLESVLTVASKIHDIFSKETLDEDRSYYLHHVKNIFSWLQQLISAHAHLA------TKFVQSKRLLQMLMTEDPQVGLIIMSVLEDIWKSNRLGTILDELSPPSLH-------SILDEIIFKLSASDDTSIGRTSTHLVLTAAKCNQSVVQILLSKRYRGVKAYLSKWR-----------GRGFDSDVKHLIGLLEAGTAAQAEQMKFSSAATTIQSGFRGYKTRKQLELAKAGMTKLQRLFRQKRDLKIREAERVKEEENRKHLAEQKRIQEFRCSMKKQLKLLETVPAREVNKHMQENQIAAATTIQAAYRGMRCRRQAQHVRTHLLR-VRAAIRIQRQIILFPVQ---FRRYRKGKEDKPPHPF-LSGLTDARRVELQEIIVQRRERFPPKHRTPVELK--ELHEKAHSLLSSHVMVAMKARRDEQRRDALMARLEMDSDHLLAAPGLEAAKTEVIDSYTSQSA-------------PVITKAKMEHSAKLRYYKLPWWKKL 573          
BLAST of NPHP5 vs. Ensembl Medaka
Match: ENSORLT00000001802.2 (IQ motif containing B1 [Source:NCBI gene;Acc:101166696])

HSP 1 Score: 74.7146 bits (182), Expect = 2.600e-13
Identity = 95/405 (23.46%), Postives = 182/405 (44.94%), Query Frame = 1
Query: 1225 VSTMIESPWFLQLFITDNDKISILMTEWLMKLIKINPSGLKKISKSTVNGIGNIVSTIFDEIIYHLASTDNKQLIEININCLLTMFEADQSLVSVIHLRYKGLKLLILK-WSMSQNSTLKVGFSNLFSQNFRLLLTMLDS--DLIYQAGMSTNLWAIIKIQSWWRSVAVRLKLAKTNKAFERFQRNYRSRKLKEIKEQNTLRIRKELEHQISITRQRKFRSKLEAEVLLMETLPAPIVFKHLEKTKQEAATTIQSIWRGHQERRQL--IMRQQLYR---KSKAAIRIQRCVRAWLSKRDLIQIYHEGDEKSEFKYWDVPGLNMERKSELNKVHNKWMASHKHEFRGISEDTQLELHHKAQKLYHRHLYELKTNRRKDIDRELTLARLETDSKLLISAPDLAEAVD 2415
             S ++ S  + Q+ + ++  + +L  +  +++  ++   L  ++  ++         + +E +  LA   +  +   +I  +L M          + + +KGL  L+LK W               F Q+   L+ ++ S  D       S    A   IQ+ WRS   R ++   N+A    QR YR+++ ++ +++   +  +EL++Q+ + RQR  R   + +  L++ LP   V  +L++ ++ AA  IQS WRG ++RR     +R+ L     + +AA  +QR VR +L KR + +         +  +    GL   R++EL +   +++  HK     +S +    LH +AQ L    L +    RR++   E  LA   T  +LL  AP L    +
Sbjct:  156 TSQVLSSIHYEQIQMCEDASVCLLCMQLWIQICTVSRGFLPSLTDDSI-------LLLLNEAVGQLAVMSDTAVGGASIKLILLMASQLGFRFRPLLMSFKGLDSLLLKDWR-----------GRGFDQDIDQLIEVIQSEKDARKSQVSSERERAACLIQAAWRSYRTRRRVKSLNRAVSALQRRYRAQRRQQQQQKEAKQWEEELKYQVCLRRQRARREFHQKQRRLLQLLPPDQVQAYLQECERRAAVKIQSFWRGVRDRRHYHNTVRKALKERRMRQQAARTLQRAVRRFLEKRRMAKA-----RPLDLLWIGQKGLTDSRRAELKQQVEEYITVHKSSR--VSPEECASLHEEAQLLLQAELQKGAQQRREEQRVEALLAHTRTQLELLRDAPPLGAVTE 535          
BLAST of NPHP5 vs. Ensembl Medaka
Match: ENSORLT00000001803.2 (IQ motif containing B1 [Source:NCBI gene;Acc:101166696])

HSP 1 Score: 58.9214 bits (141), Expect = 2.099e-8
Identity = 55/195 (28.21%), Postives = 92/195 (47.18%), Query Frame = 1
Query: 1846 ISITRQRKFRSKLEAEVLLMETLPAPIVFKHLEKTKQEAATTIQSIWRGHQERRQL--IMRQQLYR---KSKAAIRIQRCVRAWLSKRDLIQIYHEGDEKSEFKYWDVPGLNMERKSELNKVHNKWMASHKHEFRGISEDTQLELHHKAQKLYHRHLYELKTNRRKDIDRELTLARLETDSKLLISAPDLAEAVD 2415
            + + RQR  R   + +  L++ LP   V  +L++ ++ AA  IQS WRG ++RR     +R+ L     + +AA  +QR VR +L KR + +         +  +    GL   R++EL +   +++  HK     +S +    LH +AQ L    L +    RR++   E  LA   T  +LL  AP L    +
Sbjct:  389 VCLRRQRARREFHQKQRRLLQLLPPDQVQAYLQECERRAAVKIQSFWRGVRDRRHYHNTVRKALKERRMRQQAARTLQRAVRRFLEKRRMAKA-----RPLDLLWIGQKGLTDSRRAELKQQVEEYITVHKSSR--VSPEECASLHEEAQLLLQAELQKGAQQRREEQRVEALLAHTRTQLELLRDAPPLGAVTE 576          
BLAST of NPHP5 vs. Planmine SMEST
Match: SMESG000005436.1 (SMESG000005436.1)

HSP 1 Score: 1237.63 bits (3201), Expect = 0.000e+0
Identity = 643/647 (99.38%), Postives = 646/647 (99.85%), Query Frame = 1
Query:  736 MNDDEFVIEVAKKILASNDSNYSKILIDLNRYLESIEDGQEAIKAFETIWKRNLLPIMLLEIKKDFTNIEPKSWKDGFCIVQSIYDILSRIVPQNRSEENEIQNRFIPEFIENLMCFLRQMQGNFNESLVPEYRGILNSVXXXXXXXXXXXXXXSFLVRFSDYVSTMIESPWFLQLFITDNDKISILMTEWLMKLIKINPSGLKKISKSTVNGIGNIVSTIFDEIIYHLASTDNKQLIEININCLLTMFEADQSLVSVIHLRYKGLKLLILKWSMSQNSTLKVGFSNLFSQNFRLLLTMLDSDLIYQAGMSTNLWAIIKIQSWWRSVAVRLKLAKTNKAFERFQRNYRSRKLKEIKEQNTLRIRKELEHQISITRQRKFRSKLEAEVLLMETLPAPIVFKHLEKTKQEAATTIQSIWRGHQERRQLIMRQQLYRKSKAAIRIQRCVRAWLSKRDLIQIYHEGDEKSEFKYWDVPGLNMERKSELNKVHNKWMASHKHEFRGISEDTQLELHHKAQKLYHRHLYELKTNRRKDIDRELTLARLETDSKLLISAPDLAEAVDGFNNQSDLKFKIDNFHCKIRPIANRAAQLHQQKINTIKQPWWKQLLVXXXXXXXXXXXXXXXXXXXXQYMILRNRLEFLKDSEMAYY 2676
            MNDDEFVIEVAKKILASNDSNYSKILIDLNRYL+SIEDGQEAIKAFETIWKRNLLPIMLLEIKKDFTNIEPKSWKDGFCIVQSIYDILSRIVPQNRSEENEIQNRFIPEFIENLMCFLRQMQGNFNESLVPEYRGILNSVELLKEIKQILELSESFLVRFSDYVSTMIESPWFLQLFITDNDKISILMTEWLMKLIKINPSGLKKISKSTVNGIGNIVSTIFDEIIYHLASTDNKQLIEININCLLTMFEADQSLVSVIHLRYKGLKLLILKWSMSQNSTLKVGFSNLFSQNFRLLLTMLDSDLIYQAGMSTNLWAIIKIQSWWRSVAVRLKLAKTNKAFERFQRNYRSRKLKEIKEQNTLRIRKELEHQISITRQRKFRSKLEAEVLLMETLPAPIVFKHLEKTKQEAATTIQSIWRGHQERRQLIMRQQLYRKSKAAIRIQRCVRAWLSKRDLIQIYHEGDEKSEFKYWDVPGLNMERKSELNKVHNKWMASHKHEFRGISEDTQLELHHKAQKLYHRHLYELK NRRKDI+RELTLARLETDSKLLISAPDLAEAVDGFNNQSDLKFKIDNFHCKIRPIANRAAQLHQQKINTIKQPWWKQLLV+EPIDLEADDDLLLEPVDLDQYMILRNRLEFLKDSEMAYY
Sbjct:    1 MNDDEFVIEVAKKILASNDSNYSKILIDLNRYLDSIEDGQEAIKAFETIWKRNLLPIMLLEIKKDFTNIEPKSWKDGFCIVQSIYDILSRIVPQNRSEENEIQNRFIPEFIENLMCFLRQMQGNFNESLVPEYRGILNSVELLKEIKQILELSESFLVRFSDYVSTMIESPWFLQLFITDNDKISILMTEWLMKLIKINPSGLKKISKSTVNGIGNIVSTIFDEIIYHLASTDNKQLIEININCLLTMFEADQSLVSVIHLRYKGLKLLILKWSMSQNSTLKVGFSNLFSQNFRLLLTMLDSDLIYQAGMSTNLWAIIKIQSWWRSVAVRLKLAKTNKAFERFQRNYRSRKLKEIKEQNTLRIRKELEHQISITRQRKFRSKLEAEVLLMETLPAPIVFKHLEKTKQEAATTIQSIWRGHQERRQLIMRQQLYRKSKAAIRIQRCVRAWLSKRDLIQIYHEGDEKSEFKYWDVPGLNMERKSELNKVHNKWMASHKHEFRGISEDTQLELHHKAQKLYHRHLYELKANRRKDINRELTLARLETDSKLLISAPDLAEAVDGFNNQSDLKFKIDNFHCKIRPIANRAAQLHQQKINTIKQPWWKQLLVKEPIDLEADDDLLLEPVDLDQYMILRNRLEFLKDSEMAYY 647          
The following BLAST results are available for this feature:
BLAST of NPHP5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
IQCB13.424e-3525.73IQ motif containing B1 [Source:HGNC Symbol;Acc:HGN... [more]
IQCB14.571e-1227.35IQ motif containing B1 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of NPHP5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NPHP5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NPHP5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
iqcb11.218e-3925.27IQ motif containing B1 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
iqcb16.592e-3123.64IQ motif containing B1 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
iqcb12.228e-2324.43IQ motif containing B1 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
iqcb16.622e-2323.65IQ motif containing B1 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of NPHP5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
iqcb11.021e-4725.20IQ motif containing B1 [Source:NCBI gene;Acc:78011... [more]
back to top
BLAST of NPHP5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Iqcb11.208e-3724.27IQ calmodulin-binding motif containing 1 [Source:M... [more]
Iqcb12.804e-2823.40IQ calmodulin-binding motif containing 1 [Source:M... [more]
back to top
BLAST of NPHP5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q8BP00|IQCB1_MOUSE8.452e-3724.27IQ calmodulin-binding motif-containing protein 1 O... [more]
sp|Q15051|IQCB1_HUMAN1.644e-3425.73IQ calmodulin-binding motif-containing protein 1 O... [more]
back to top
BLAST of NPHP5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YFP40.000e+0100.00NPHP5 OS=Schmidtea mediterranea OX=79327 GN=NPHP5 ... [more]
A0A1S3JUD95.021e-6827.39IQ calmodulin-binding motif-containing protein 1 O... [more]
A0A2R2MJY01.179e-6727.39IQ calmodulin-binding motif-containing protein 1-l... [more]
A0A0B6ZDD52.223e-6028.90Uncharacterized protein OS=Arion vulgaris OX=10286... [more]
A0A0B6ZDP44.468e-6028.73Uncharacterized protein (Fragment) OS=Arion vulgar... [more]
back to top
BLAST of NPHP5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
iqcb18.845e-3523.75IQ motif containing B1 [Source:NCBI gene;Acc:10303... [more]
back to top
BLAST of NPHP5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
iqcb19.174e-4225.09IQ motif containing B1 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of NPHP5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NPHP5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO490314.496e-3425.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of NPHP5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSORLT00000001802.22.600e-1323.46IQ motif containing B1 [Source:NCBI gene;Acc:10116... [more]
ENSORLT00000001803.22.099e-828.21IQ motif containing B1 [Source:NCBI gene;Acc:10116... [more]
back to top
BLAST of NPHP5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000005436.10.000e+099.38SMESG000005436.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30005093
GenBankAKN21707.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005093 ID=SMED30005093|Name=NPHP5|organism=Schmidtea mediterranea sexual|type=transcript|length=2730bp
CGAAAATACGGAGATTTTAATTAATTTTTAAAAAAATTATTTAATCAACA
TTATTTAGTCGTGTAAGGTTCGCTGGACCCATGATAGCTTTTCTAAAAAT
ATTTTGAACATTATAAATTTTCAACGAAATAATTAACAAATTATTTGACA
TTTTAACCTGACACAATAGTAATTATTGAATGTTTACGATCATAGAGATT
GCATAGACTATCCTTGACACAGGGATTAAAGCTGTCTTTTTTGAGTAAAA
GCGCATTAGGATTTGGGTATATGAATCAAGCATTACTAAATCTTCGATCA
TTGAAATACTGCAATCATATAGTTATATCAGGATATAAGACAACAGTTGA
TTTGACGAAAAGCTGTTCACAGAACATTTCATTTAAGGATTCTTGAACAA
CTTCCATGATGTCAATAATTATTTAACCCTGTACCACCGAAATAGTATCT
GCTGCTGGCTTGTACTACATTAAGAACACTTTCGCTGTACTTCATAAATT
CTAATTTTATTACAAAACCAACGAATACCCTTGACTTTCCACATATTCAT
TTTTGTTTTGTGAAAGAGAAACATAGGAACTTTAACAAGCAATTGAAGAA
AATACTGTGGATCCATTGGGACCTTACGCGACCGTTTGATGTATAATTTC
GACTTTTATAATTTCAAATGTTCGGATAATATATAAACTTTCCTATTAAT
ATGTGATCTCTTTAAAAATTTATTCAGTTTTAACAATGAACGACGATGAA
TTTGTTATTGAGGTTGCAAAGAAAATTTTAGCCTCCAATGATTCCAATTA
CTCAAAAATTCTTATTGACCTTAACAGATATCTTGAGTCAATCGAAGACG
GCCAAGAAGCCATTAAAGCTTTCGAGACAATTTGGAAAAGAAATCTTCTA
CCGATCATGTTACTGGAGATCAAAAAAGATTTTACAAACATTGAACCGAA
ATCCTGGAAAGATGGATTTTGCATAGTTCAATCAATTTATGATATTTTAT
CTCGAATTGTCCCCCAGAACCGATCTGAGGAGAACGAAATTCAAAATAGA
TTCATTCCTGAATTTATTGAAAATCTCATGTGCTTTCTTCGTCAAATGCA
AGGAAACTTTAACGAATCCCTAGTGCCAGAATATCGGGGAATACTCAATT
CTGTAGAATTGTTGAAAGAAATAAAACAGATTTTGGAATTGTCGGAAAGT
TTTCTAGTTAGATTTTCCGATTACGTATCAACAATGATTGAGTCTCCCTG
GTTTCTTCAACTTTTTATTACTGACAACGATAAAATATCCATATTAATGA
CTGAATGGCTAATGAAACTTATCAAAATTAATCCAAGTGGCCTTAAAAAG
ATCTCCAAATCTACAGTGAATGGAATAGGAAACATAGTCTCGACAATATT
TGATGAAATCATATACCATCTAGCTAGCACTGACAATAAGCAGTTGATCG
AAATAAATATTAATTGCCTTCTCACAATGTTTGAAGCGGATCAATCTCTT
GTCTCTGTGATCCATCTTCGTTACAAAGGGTTGAAATTGCTTATTCTCAA
ATGGTCAATGTCTCAAAATTCCACTTTAAAAGTTGGATTCTCGAATTTGT
TTTCCCAAAACTTTCGGCTTTTGTTAACAATGTTGGATTCGGATTTGATT
TATCAAGCCGGAATGTCAACGAATTTATGGGCAATCATCAAAATCCAGTC
ATGGTGGAGGAGTGTCGCCGTTCGACTAAAGTTAGCTAAAACTAACAAAG
CATTTGAAAGATTTCAAAGAAATTATAGATCAAGAAAATTGAAAGAAATT
AAAGAACAAAATACTTTGAGAATTCGAAAGGAATTGGAACATCAAATTTC
GATTACAAGGCAACGAAAATTTCGTAGTAAATTGGAAGCTGAAGTTTTAT
TAATGGAAACACTACCAGCACCAATTGTGTTCAAACATTTAGAAAAGACG
AAACAAGAAGCCGCTACTACTATTCAGTCTATTTGGAGGGGTCACCAAGA
ACGGCGTCAACTAATAATGAGACAGCAGTTATATCGAAAAAGTAAAGCAG
CTATTAGAATTCAGAGATGTGTCCGAGCTTGGTTGTCAAAGAGAGATTTA
ATCCAAATCTACCACGAAGGTGATGAAAAATCAGAATTCAAATATTGGGA
TGTTCCGGGCTTGAATATGGAAAGAAAATCCGAATTAAATAAGGTTCATA
ATAAATGGATGGCGTCTCACAAACATGAATTCAGGGGAATCAGTGAAGAT
ACTCAACTGGAACTTCACCATAAAGCTCAAAAATTGTACCACCGTCATCT
TTATGAATTGAAAACTAATCGTCGCAAGGACATTGATCGAGAACTGACTT
TGGCAAGATTGGAAACCGATTCGAAATTATTGATCTCAGCACCCGATCTC
GCTGAAGCCGTTGATGGTTTCAACAATCAGTCTGATCTAAAATTCAAAAT
TGACAATTTCCATTGCAAAATCCGCCCGATTGCTAATAGAGCTGCACAGT
TGCACCAACAGAAAATCAATACGATTAAACAACCCTGGTGGAAACAGTTA
CTTGTTGAAGAACCAATAGACTTGGAAGCTGACGATGATCTGCTTTTGGA
ACCTGTGGATTTGGATCAATACATGATCCTTAGGAATCGCTTGGAATTTT
TGAAAGATTCTGAAATGGCGTATTATTGAAATTGGTTTCATTTATTTAAT
ATATTTATCTATTTTAAAATGATTTTTGTC
back to top

protein sequence of SMED30005093-orf-1

>SMED30005093-orf-1 ID=SMED30005093-orf-1|Name=SMED30005093-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=648bp
MNDDEFVIEVAKKILASNDSNYSKILIDLNRYLESIEDGQEAIKAFETIW
KRNLLPIMLLEIKKDFTNIEPKSWKDGFCIVQSIYDILSRIVPQNRSEEN
EIQNRFIPEFIENLMCFLRQMQGNFNESLVPEYRGILNSVELLKEIKQIL
ELSESFLVRFSDYVSTMIESPWFLQLFITDNDKISILMTEWLMKLIKINP
SGLKKISKSTVNGIGNIVSTIFDEIIYHLASTDNKQLIEININCLLTMFE
ADQSLVSVIHLRYKGLKLLILKWSMSQNSTLKVGFSNLFSQNFRLLLTML
DSDLIYQAGMSTNLWAIIKIQSWWRSVAVRLKLAKTNKAFERFQRNYRSR
KLKEIKEQNTLRIRKELEHQISITRQRKFRSKLEAEVLLMETLPAPIVFK
HLEKTKQEAATTIQSIWRGHQERRQLIMRQQLYRKSKAAIRIQRCVRAWL
SKRDLIQIYHEGDEKSEFKYWDVPGLNMERKSELNKVHNKWMASHKHEFR
GISEDTQLELHHKAQKLYHRHLYELKTNRRKDIDRELTLARLETDSKLLI
SAPDLAEAVDGFNNQSDLKFKIDNFHCKIRPIANRAAQLHQQKINTIKQP
WWKQLLVEEPIDLEADDDLLLEPVDLDQYMILRNRLEFLKDSEMAYY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR028765IQCB1
IPR000048IQ_motif_EF-hand-BS
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005516calmodulin binding
Vocabulary: biological process
TermDefinition
GO:0060271cilium morphogenesis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000048IQ motif, EF-hand binding siteSMARTSM00015iq_5coord: 312..334
e-value: 150.0
score: 3.9
coord: 405..427
e-value: 0.011
score: 24.9
coord: 434..456
e-value: 0.69
score: 19.0
IPR000048IQ motif, EF-hand binding sitePFAMPF00612IQcoord: 408..426
e-value: 7.6E-5
score: 22.2
coord: 315..331
e-value: 0.011
score: 15.5
coord: 437..454
e-value: 0.0067
score: 16.1
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 435..464
score: 7.108
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 406..435
score: 9.395
NoneNo IPR availableGENE3DG3DSA:1.20.5.190coord: 406..456
e-value: 7.5E-8
score: 34.0
IPR028765IQ calmodulin-binding motif-containing protein 1PANTHERPTHR15673IQ CALMODULIN-BINDING MOTIF CONTAINING PROTEIN 1coord: 4..606