Protein kinase domain-containing protein

Overview
NameProtein kinase domain-containing protein
Smed IDSMED30005074
Length (bp)1706
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase domain-containing protein (SMED30005074) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30005074) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase domain-containing protein (SMED30005074) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30005074) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005074

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30005074SMESG000014619.1 dd_Smed_v4_1212_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005074SMESG000014619.1 dd_Smed_v4_1212_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30005074SMESG000014613.1 dd_Smed_v4_4447_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005074SMESG000014613.1 dd_Smed_v4_4447_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30005074SMESG000027219.1 SMESG000014613.1 OX_Smed_1.0.22066ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30005074SMESG000014619.1 dd_Smed_v4_1212_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 107.071 bits (266), Expect = 1.158e-23
Identity = 59/149 (39.60%), Postives = 86/149 (57.72%), Query Frame = 3
Query: 1005 LFIVTEDMPGGSLRQQL-SIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTR-IDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNE 1445
            L I  E MPGGS++ QL +   L  SV  KY +QILEG+ ++H   I+HR+I   ++L D  GNVKL +F  SK L       I M   G R +      ++PEV+ GE YG +AD+WS G T++E++T + P+ +     AI+ I  +
Sbjct:  470 LTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRL-----QTICMSGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQ 613          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 107.071 bits (266), Expect = 1.158e-23
Identity = 59/149 (39.60%), Postives = 86/149 (57.72%), Query Frame = 3
Query: 1005 LFIVTEDMPGGSLRQQL-SIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTR-IDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNE 1445
            L I  E MPGGS++ QL +   L  SV  KY +QILEG+ ++H   I+HR+I   ++L D  GNVKL +F  SK L       I M   G R +      ++PEV+ GE YG +AD+WS G T++E++T + P+ +     AI+ I  +
Sbjct:  470 LTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRL-----QTICMSGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQ 613          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 106.686 bits (265), Expect = 1.276e-23
Identity = 59/149 (39.60%), Postives = 86/149 (57.72%), Query Frame = 3
Query: 1005 LFIVTEDMPGGSLRQQL-SIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTR-IDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNE 1445
            L I  E MPGGS++ QL +   L  SV  KY +QILEG+ ++H   I+HR+I   ++L D  GNVKL +F  SK L       I M   G R +      ++PEV+ GE YG +AD+WS G T++E++T + P+ +     AI+ I  +
Sbjct:  439 LTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRL-----QTICMSGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQ 582          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 106.686 bits (265), Expect = 1.354e-23
Identity = 59/149 (39.60%), Postives = 86/149 (57.72%), Query Frame = 3
Query: 1005 LFIVTEDMPGGSLRQQL-SIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTR-IDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNE 1445
            L I  E MPGGS++ QL +   L  SV  KY +QILEG+ ++H   I+HR+I   ++L D  GNVKL +F  SK L       I M   G R +      ++PEV+ GE YG +AD+WS G T++E++T + P+ +     AI+ I  +
Sbjct:  435 LTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRL-----QTICMSGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQ 578          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 106.686 bits (265), Expect = 1.359e-23
Identity = 59/149 (39.60%), Postives = 86/149 (57.72%), Query Frame = 3
Query: 1005 LFIVTEDMPGGSLRQQL-SIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTR-IDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNE 1445
            L I  E MPGGS++ QL +   L  SV  KY +QILEG+ ++H   I+HR+I   ++L D  GNVKL +F  SK L       I M   G R +      ++PEV+ GE YG +AD+WS G T++E++T + P+ +     AI+ I  +
Sbjct:  466 LTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRL-----QTICMSGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQ 609          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: pak-2 (Serine/threonine-protein kinase pak-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EFU0])

HSP 1 Score: 97.0561 bits (240), Expect = 4.114e-21
Identity = 62/189 (32.80%), Postives = 95/189 (50.26%), Query Frame = 3
Query:  954 YKYP-FVELLTMYTEQDNLFIVTEDMPGGSLRQQLSIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMI-FMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNEKKIDYERNCYAGTNFDEIIDKCI 1514
            Y++P  V   + +   D L++V E M GGSL   ++   +    I    +Q+L  L F+H  K+IHR+I   S+LL   G VKL++F    F   LS ++     + GT         A EV+  EPY  +ADIWSFG  LIE+V  E P+      +A+  I++E +  + R+        E++  CI
Sbjct:  281 YQHPNIVRFFSSHLVDDELWVVMEFMEGGSLTDIVTATRMTEPQIATISRQVLGALDFLHARKVIHRDIKSDSILLKRDGTVKLTDF---GFCGQLSEEVPRRRSLVGT-----PYWTAAEVIAREPYDTRADIWSFGIMLIEMVEGEPPFFNDQPFQAMKRIRDEHEARFSRHAKVSVELSELLSHCI 461          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: pak-2 (Serine/threonine-protein kinase pak-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EFU0])

HSP 1 Score: 97.0561 bits (240), Expect = 4.421e-21
Identity = 62/189 (32.80%), Postives = 95/189 (50.26%), Query Frame = 3
Query:  954 YKYP-FVELLTMYTEQDNLFIVTEDMPGGSLRQQLSIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMI-FMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNEKKIDYERNCYAGTNFDEIIDKCI 1514
            Y++P  V   + +   D L++V E M GGSL   ++   +    I    +Q+L  L F+H  K+IHR+I   S+LL   G VKL++F    F   LS ++     + GT         A EV+  EPY  +ADIWSFG  LIE+V  E P+      +A+  I++E +  + R+        E++  CI
Sbjct:  283 YQHPNIVRFFSSHLVDDELWVVMEFMEGGSLTDIVTATRMTEPQIATISRQVLGALDFLHARKVIHRDIKSDSILLKRDGTVKLTDF---GFCGQLSEEVPRRRSLVGT-----PYWTAAEVIAREPYDTRADIWSFGIMLIEMVEGEPPFFNDQPFQAMKRIRDEHEARFSRHAKVSVELSELLSHCI 463          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: pak-1 (Serine/threonine-protein kinase pak-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17850])

HSP 1 Score: 96.2857 bits (238), Expect = 7.078e-21
Identity = 63/201 (31.34%), Postives = 99/201 (49.25%), Query Frame = 3
Query:  966 FVELLTMYTEQDNLFIVTEDMPGGSLRQQLSIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNEKKIDYERNCYAGTNFDEIIDKCISPIQSNRPTVSFLIDDYF 1568
             V  L  Y   D L++V E + GGSL   ++   +E  +I   C+++L+ L+F+H   +IHR+I   ++LL   G+VKL++F    F   LS +      K T +      +APEV+  + YG + D+WS G   IE+V  E PY      +AIY+I    K D+         F + +D  +     NR + S L+   F
Sbjct:  303 IVNYLDSYLVCDELWVVMEYLAGGSLTDVVTECQMEDGIIAAVCREVLQALEFLHSRHVIHRDIKSDNILLGMDGSVKLTDF---GFCAQLSPEQ----RKRTTMVGTPYWMAPEVVTRKQYGPKVDVWSLGIMAIEMVEGEPPYLNENPLRAIYLIATNGKPDFPGRDSMTLLFKDFVDSALEVQVENRWSASQLLTHPF 496          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: pak-1 (Serine/threonine-protein kinase pak-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17850])

HSP 1 Score: 95.9005 bits (237), Expect = 1.185e-20
Identity = 63/201 (31.34%), Postives = 99/201 (49.25%), Query Frame = 3
Query:  966 FVELLTMYTEQDNLFIVTEDMPGGSLRQQLSIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNEKKIDYERNCYAGTNFDEIIDKCISPIQSNRPTVSFLIDDYF 1568
             V  L  Y   D L++V E + GGSL   ++   +E  +I   C+++L+ L+F+H   +IHR+I   ++LL   G+VKL++F    F   LS +      K T +      +APEV+  + YG + D+WS G   IE+V  E PY      +AIY+I    K D+         F + +D  +     NR + S L+   F
Sbjct:  352 IVNYLDSYLVCDELWVVMEYLAGGSLTDVVTECQMEDGIIAAVCREVLQALEFLHSRHVIHRDIKSDNILLGMDGSVKLTDFG---FCAQLSPEQ----RKRTTMVGTPYWMAPEVVTRKQYGPKVDVWSLGIMAIEMVEGEPPYLNENPLRAIYLIATNGKPDFPGRDSMTLLFKDFVDSALEVQVENRWSASQLLTHPF 545          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: pak-1 (Serine/threonine-protein kinase pak-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17850])

HSP 1 Score: 95.9005 bits (237), Expect = 1.452e-20
Identity = 63/201 (31.34%), Postives = 99/201 (49.25%), Query Frame = 3
Query:  966 FVELLTMYTEQDNLFIVTEDMPGGSLRQQLSIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNEKKIDYERNCYAGTNFDEIIDKCISPIQSNRPTVSFLIDDYF 1568
             V  L  Y   D L++V E + GGSL   ++   +E  +I   C+++L+ L+F+H   +IHR+I   ++LL   G+VKL++F    F   LS +      K T +      +APEV+  + YG + D+WS G   IE+V  E PY      +AIY+I    K D+         F + +D  +     NR + S L+   F
Sbjct:  349 IVNYLDSYLVCDELWVVMEYLAGGSLTDVVTECQMEDGIIAAVCREVLQALEFLHSRHVIHRDIKSDNILLGMDGSVKLTDFG---FCAQLSPEQ----RKRTTMVGTPYWMAPEVVTRKQYGPKVDVWSLGIMAIEMVEGEPPYLNENPLRAIYLIATNGKPDFPGRDSMTLLFKDFVDSALEVQVENRWSASQLLTHPF 542          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Slik (gene:FBgn0035001 transcript:FBtr0100470)

HSP 1 Score: 98.2117 bits (243), Expect = 6.050e-21
Identity = 75/255 (29.41%), Postives = 124/255 (48.63%), Query Frame = 3
Query:  858 EKCVAYAYDCKLTDINSMK--ILKYEIVTRLKLSYKYP-FVELLTMYTEQDNLFIVTEDMPGGSLRQQLSI-----APLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFS-KFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGE-----PYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNEKKIDYERNCYAGTNFDEIIDKCISPIQSNRPTVSFLIDDYFKNSN 1580
            +K  A A  C+L D  ++   +++ +I++ +K    +P  VEL   ++  D L+++ E   GG+L    SI      PL    I   C+ + EGL F+H  K+IHR++  G+VLL  +G VKL++F  S K  + +     F+G            +APE++L E     PY  + DIWS G TLIE+   E P  +++  + +  I+  +    E+       F++ + K +      RPT   L+   F N N
Sbjct:   59 QKRFAAAKMCQLEDEENLSDHMVEIDILSEIK----HPNIVELYEAFSIDDKLWMLIEYCDGGALD---SIMVELEKPLTEPQIAYVCKHMTEGLTFLHRNKVIHRDLKAGNVLLTMEGGVKLADFGVSAKNKHTMQKHDTFIGT--------PYWMAPELVLCETFRDNPYDHKVDIWSLGITLIELAQMEPPNSEMSPMRVLLKIQKSEPPKLEQPSRWSKEFNDFLKKSLVKDPQVRPTTDVLMQHAFINRN 298          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Slik (gene:FBgn0035001 transcript:FBtr0072363)

HSP 1 Score: 98.2117 bits (243), Expect = 6.815e-21
Identity = 75/255 (29.41%), Postives = 124/255 (48.63%), Query Frame = 3
Query:  858 EKCVAYAYDCKLTDINSMK--ILKYEIVTRLKLSYKYP-FVELLTMYTEQDNLFIVTEDMPGGSLRQQLSI-----APLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFS-KFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGE-----PYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNEKKIDYERNCYAGTNFDEIIDKCISPIQSNRPTVSFLIDDYFKNSN 1580
            +K  A A  C+L D  ++   +++ +I++ +K    +P  VEL   ++  D L+++ E   GG+L    SI      PL    I   C+ + EGL F+H  K+IHR++  G+VLL  +G VKL++F  S K  + +     F+G            +APE++L E     PY  + DIWS G TLIE+   E P  +++  + +  I+  +    E+       F++ + K +      RPT   L+   F N N
Sbjct:   59 QKRFAAAKMCQLEDEENLSDHMVEIDILSEIK----HPNIVELYEAFSIDDKLWMLIEYCDGGALD---SIMVELEKPLTEPQIAYVCKHMTEGLTFLHRNKVIHRDLKAGNVLLTMEGGVKLADFGVSAKNKHTMQKHDTFIGT--------PYWMAPELVLCETFRDNPYDHKVDIWSLGITLIELAQMEPPNSEMSPMRVLLKIQKSEPPKLEQPSRWSKEFNDFLKKSLVKDPQVRPTTDVLMQHAFINRN 298          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Slik (gene:FBgn0035001 transcript:FBtr0332925)

HSP 1 Score: 98.2117 bits (243), Expect = 6.884e-21
Identity = 75/255 (29.41%), Postives = 124/255 (48.63%), Query Frame = 3
Query:  858 EKCVAYAYDCKLTDINSMK--ILKYEIVTRLKLSYKYP-FVELLTMYTEQDNLFIVTEDMPGGSLRQQLSI-----APLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFS-KFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGE-----PYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNEKKIDYERNCYAGTNFDEIIDKCISPIQSNRPTVSFLIDDYFKNSN 1580
            +K  A A  C+L D  ++   +++ +I++ +K    +P  VEL   ++  D L+++ E   GG+L    SI      PL    I   C+ + EGL F+H  K+IHR++  G+VLL  +G VKL++F  S K  + +     F+G            +APE++L E     PY  + DIWS G TLIE+   E P  +++  + +  I+  +    E+       F++ + K +      RPT   L+   F N N
Sbjct:   59 QKRFAAAKMCQLEDEENLSDHMVEIDILSEIK----HPNIVELYEAFSIDDKLWMLIEYCDGGALD---SIMVELEKPLTEPQIAYVCKHMTEGLTFLHRNKVIHRDLKAGNVLLTMEGGVKLADFGVSAKNKHTMQKHDTFIGT--------PYWMAPELVLCETFRDNPYDHKVDIWSLGITLIELAQMEPPNSEMSPMRVLLKIQKSEPPKLEQPSRWSKEFNDFLKKSLVKDPQVRPTTDVLMQHAFINRN 298          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0334539)

HSP 1 Score: 95.1301 bits (235), Expect = 3.561e-20
Identity = 57/187 (30.48%), Postives = 98/187 (52.41%), Query Frame = 3
Query:  957 KYP-FVELLTMYTEQDNLFIVTEDMPGGSLRQQLSIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNEKKIDYERNCYAGTNFDEIIDKCI 1514
            K+P  V  L  Y   + L++V E +PGGSL   ++   ++   I   C+++L+ L+F+H  ++IHR+I   ++LL   G+VKL++F F   +    +       K T +      +APEV+  + YG + D+WS G   IE+V  E PY      KA+Y+I    K + +      + F + +D+C+
Sbjct:  483 KHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQS-------KRTTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCL 662          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0081714)

HSP 1 Score: 95.1301 bits (235), Expect = 3.561e-20
Identity = 57/187 (30.48%), Postives = 98/187 (52.41%), Query Frame = 3
Query:  957 KYP-FVELLTMYTEQDNLFIVTEDMPGGSLRQQLSIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNEKKIDYERNCYAGTNFDEIIDKCI 1514
            K+P  V  L  Y   + L++V E +PGGSL   ++   ++   I   C+++L+ L+F+H  ++IHR+I   ++LL   G+VKL++F F   +    +       K T +      +APEV+  + YG + D+WS G   IE+V  E PY      KA+Y+I    K + +      + F + +D+C+
Sbjct:  483 KHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQS-------KRTTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCL 662          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 106.686 bits (265), Expect = 8.487e-24
Identity = 58/152 (38.16%), Postives = 87/152 (57.24%), Query Frame = 3
Query:  996 QDNLFIVTEDMPGGSLRQQL-SIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTR-IDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNE 1445
            +  L I  E MPGGS++ QL +   L  +V  KY +QILEG+ ++H   I+HR+I   ++L D  GNVKL +F  SK L       I M   G R +      ++PEV+ GE YG +AD+WS G T++E++T + P+ +     AI+ I  +
Sbjct:  436 EKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRL-----QTICMSSTGVRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEFEAMAAIFKIATQ 582          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 106.686 bits (265), Expect = 8.798e-24
Identity = 58/152 (38.16%), Postives = 87/152 (57.24%), Query Frame = 3
Query:  996 QDNLFIVTEDMPGGSLRQQL-SIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTR-IDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNE 1445
            +  L I  E MPGGS++ QL +   L  +V  KY +QILEG+ ++H   I+HR+I   ++L D  GNVKL +F  SK L       I M   G R +      ++PEV+ GE YG +AD+WS G T++E++T + P+ +     AI+ I  +
Sbjct:  430 EKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRL-----QTICMSSTGVRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEFEAMAAIFKIATQ 576          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 106.301 bits (264), Expect = 9.434e-24
Identity = 58/152 (38.16%), Postives = 87/152 (57.24%), Query Frame = 3
Query:  996 QDNLFIVTEDMPGGSLRQQL-SIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTR-IDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNE 1445
            +  L I  E MPGGS++ QL +   L  +V  KY +QILEG+ ++H   I+HR+I   ++L D  GNVKL +F  SK L       I M   G R +      ++PEV+ GE YG +AD+WS G T++E++T + P+ +     AI+ I  +
Sbjct:  418 EKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRL-----QTICMSSTGVRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEFEAMAAIFKIATQ 564          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 105.531 bits (262), Expect = 2.310e-23
Identity = 59/153 (38.56%), Postives = 89/153 (58.17%), Query Frame = 3
Query:  990 TEQDNLFIVTEDMPGGSLRQQL-SIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNE 1445
            T +  L I  E MPGGS++ QL S   L  +V  KY +QILEG+ ++H   I+HR+I   ++L D  GNVKL +F  S+ L  +   +   GIK   +      ++PEV+ GE YG +ADIWS G T++E++T+  P+ +     AI+ I  +
Sbjct:  434 THEKTLSIFMEYMPGGSIKDQLKSYGALTENVTRKYTRQILEGVCYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASRRLQTIC--LSGTGIKS--VTGTPYWMSPEVISGEGYGRKADIWSIGCTVVEMLTQRPPWAEFEAMAAIFKIATQ 582          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 105.145 bits (261), Expect = 2.722e-23
Identity = 59/153 (38.56%), Postives = 89/153 (58.17%), Query Frame = 3
Query:  990 TEQDNLFIVTEDMPGGSLRQQL-SIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNE 1445
            T +  L I  E MPGGS++ QL S   L  +V  KY +QILEG+ ++H   I+HR+I   ++L D  GNVKL +F  S+ L  +   +   GIK   +      ++PEV+ GE YG +ADIWS G T++E++T+  P+ +     AI+ I  +
Sbjct:  426 THEKTLSIFMEYMPGGSIKDQLKSYGALTENVTRKYTRQILEGVCYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASRRLQTIC--LSGTGIKS--VTGTPYWMSPEVISGEGYGRKADIWSIGCTVVEMLTQRPPWAEFEAMAAIFKIATQ 574          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: samd8 (sterile alpha motif domain containing 8 [Source:Xenbase;Acc:XB-GENE-1012742])

HSP 1 Score: 104.76 bits (260), Expect = 5.617e-23
Identity = 56/151 (37.09%), Postives = 88/151 (58.28%), Query Frame = 3
Query:  996 QDNLFIVTEDMPGGSLRQQL-SIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNE 1445
            +  L I  E MPGGS++ QL +   L  +V  +Y +QILEG+ ++H   I+HR+I   ++L D  GNVKL +F  SK L  +   M   GI+   +      ++PEV+ GE YG +AD+WS G T++E++T + P+ +     AI+ I  +
Sbjct:  439 EKTLTIFMEYMPGGSVKDQLKAYGALTENVTRRYTRQILEGVSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTIC--MSGTGIRS--VTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQ 585          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: samd8 (sterile alpha motif domain containing 8 [Source:Xenbase;Acc:XB-GENE-1012742])

HSP 1 Score: 104.375 bits (259), Expect = 7.227e-23
Identity = 56/151 (37.09%), Postives = 88/151 (58.28%), Query Frame = 3
Query:  996 QDNLFIVTEDMPGGSLRQQL-SIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNE 1445
            +  L I  E MPGGS++ QL +   L  +V  +Y +QILEG+ ++H   I+HR+I   ++L D  GNVKL +F  SK L  +   M   GI+   +      ++PEV+ GE YG +AD+WS G T++E++T + P+ +     AI+ I  +
Sbjct:  421 EKTLTIFMEYMPGGSVKDQLKAYGALTENVTRRYTRQILEGVSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTIC--MSGTGIRS--VTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQ 567          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: MAP3K2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:100493570])

HSP 1 Score: 103.99 bits (258), Expect = 9.531e-23
Identity = 58/154 (37.66%), Postives = 88/154 (57.14%), Query Frame = 3
Query:  990 TEQDNLFIVTEDMPGGSLRQQL-SIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFM-GIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNE 1445
            +++  L I  E MPGGS++ QL +   L   V  KY +QILEG+ ++H   I+HR+I   ++L D  GNVKL +F  SK L  +      M  + GT        ++PEV+ GE YG +ADIWS G T++E++T + P+ +     AI+ I  +
Sbjct:  439 SQEKTLSIFMEYMPGGSIKDQLKAYGALTEFVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRLQTICLSGTGMKSVTGT-----PYWMSPEVISGEGYGRKADIWSVGCTVVEMLTEKPPWAEFEAMAAIFKIATQ 587          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: MAP3K2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:100493570])

HSP 1 Score: 103.605 bits (257), Expect = 1.149e-22
Identity = 58/154 (37.66%), Postives = 88/154 (57.14%), Query Frame = 3
Query:  990 TEQDNLFIVTEDMPGGSLRQQL-SIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFM-GIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNE 1445
            +++  L I  E MPGGS++ QL +   L   V  KY +QILEG+ ++H   I+HR+I   ++L D  GNVKL +F  SK L  +      M  + GT        ++PEV+ GE YG +ADIWS G T++E++T + P+ +     AI+ I  +
Sbjct:  411 SQEKTLSIFMEYMPGGSIKDQLKAYGALTEFVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRLQTICLSGTGMKSVTGT-----PYWMSPEVISGEGYGRKADIWSVGCTVVEMLTEKPPWAEFEAMAAIFKIATQ 559          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: stk25 (serine/threonine kinase 25 [Source:NCBI gene;Acc:548355])

HSP 1 Score: 98.9821 bits (245), Expect = 7.336e-22
Identity = 61/194 (31.44%), Postives = 97/194 (50.00%), Query Frame = 3
Query:  987 YTEQDNLFIVTEDMPGGSLRQQLSIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNEKKIDYERNCYAGTNFDEIIDKCISPIQSNRPTVSFLIDDYF 1568
            Y +   L+I+ E + GGS    L   PLE + I    ++IL+GL ++H E+ IHR+I   +VLL  +G+VKL++F  +  L +         IK          +APEV+    Y F+ADIWS G T IE+   E PY  L   + +++I        +   Y+   F + ++ C++    +RPT   L+   F
Sbjct:   72 YLKGSKLWIIMEYLGGGSALDLLKPGPLEEAYIATILREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQ-------IKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPYSDLHPMRVLFLIPKNNPPSLQ-GQYS-KPFKDFVEACLNKDPRSRPTARELLKHRF 256          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:MGI Symbol;Acc:MGI:1346874])

HSP 1 Score: 107.071 bits (266), Expect = 6.405e-24
Identity = 58/148 (39.19%), Postives = 87/148 (58.78%), Query Frame = 3
Query: 1005 LFIVTEDMPGGSLRQQL-SIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNE 1445
            L I  E MPGGS++ QL +   L  SV  KY +QILEG+ ++H   I+HR+I   ++L D  GNVKL +F  SK L  +   M   GI+   +      ++PEV+ GE YG +AD+WS G T++E++T + P+ +     AI+ I  +
Sbjct:  439 LTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTIC--MSGTGIRS--VTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQ 582          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:MGI Symbol;Acc:MGI:1346873])

HSP 1 Score: 101.293 bits (251), Expect = 5.154e-22
Identity = 56/153 (36.60%), Postives = 87/153 (56.86%), Query Frame = 3
Query:  993 EQDNLFIVTEDMPGGSLRQQL-SIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFM-GIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNE 1445
            ++  L I  E MPGGS++ QL +   L  +V  KY +QILEG+ ++H   I+HR+I   ++L D  GN+KL +F  SK L  +      M  + GT        ++PEV+ GE YG +ADIWS   T++E++T + P+ +     AI+ I  +
Sbjct:  429 QEKTLSIFMEYMPGGSIKDQLKAYGALTENVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSTGNIKLGDFGASKRLQTICLSGTGMKSVTGT-----PYWMSPEVISGEGYGRKADIWSVACTVVEMLTEKPPWAEFEAMAAIFKIATQ 576          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Stk25 (serine/threonine kinase 25 (yeast) [Source:MGI Symbol;Acc:MGI:1891699])

HSP 1 Score: 97.0561 bits (240), Expect = 3.798e-21
Identity = 60/194 (30.93%), Postives = 94/194 (48.45%), Query Frame = 3
Query:  987 YTEQDNLFIVTEDMPGGSLRQQLSIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNEKKIDYERNCYAGTNFDEIIDKCISPIQSNRPTVSFLIDDYF 1568
            Y +   L+I+ E + GGS    L   PLE + I    ++IL+GL ++H E+ IHR+I   +VLL  +G+VKL++F        ++  +    IK          +APEV+    Y F+ADIWS G T IE+   E P   L   + +++I        E   +    F E ++ C++     RPT   L+   F
Sbjct:   85 YLKSTKLWIIMEYLGGGSALDLLKPGPLEETYIATILREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLADF-------GVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNNPPTLE--GHHSKPFKEFVEACLNKDPRFRPTAKELLKHKF 269          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Stk24 (serine/threonine kinase 24 [Source:MGI Symbol;Acc:MGI:2385007])

HSP 1 Score: 93.9745 bits (232), Expect = 4.331e-20
Identity = 63/194 (32.47%), Postives = 94/194 (48.45%), Query Frame = 3
Query:  987 YTEQDNLFIVTEDMPGGSLRQQLSIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNEKKIDYERNCYAGTNFDEIIDKCISPIQSNRPTVSFLIDDYF 1568
            Y +   L+I+ E + GGS    L   PL+   I    ++IL+GL ++H EK IHR+I   +VLL   G VKL++F  +  L +         IK          +APEV+    Y  +ADIWS G T IE+   E P+ +L   K +++I        E N Y+     E ++ C++   S RPT   L+   F
Sbjct:   89 YLKDTKLWIIMEYLGGGSALDLLEPGPLDEIQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQ-------IKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPHSELHPMKVLFLIPKNNPPTLEGN-YS-KPLKEFVEACLNKEPSFRPTAKELLKHKF 273          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Stk25 (serine/threonine kinase 25 (yeast) [Source:MGI Symbol;Acc:MGI:1891699])

HSP 1 Score: 89.7373 bits (221), Expect = 9.650e-20
Identity = 52/150 (34.67%), Postives = 79/150 (52.67%), Query Frame = 3
Query:  987 YTEQDNLFIVTEDMPGGSLRQQLSIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYII 1436
            Y +   L+I+ E + GGS    L   PLE + I    ++IL+GL ++H E+ IHR+I   +VLL  +G+VKL++F  +  L +         IK          +APEV+    Y F+ADIWS G T IE+   E P   L   + +++I
Sbjct:   85 YLKSTKLWIIMEYLGGGSALDLLKPGPLEETYIATILREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQ-------IKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSDLHPMRVLFLI 227          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|O22040|ANP1_ARATH (Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana OX=3702 GN=ANP1 PE=1 SV=2)

HSP 1 Score: 109.768 bits (273), Expect = 6.547e-24
Identity = 76/222 (34.23%), Postives = 119/222 (53.60%), Query Frame = 3
Query:  915 ILKYEIVTRLKLSYKYP-FVELLTMYTEQDNLFIVTEDMPGGSLRQQLS-IAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKK--AIYIIKNEKKIDYERNCYAGTNFDEIIDKCISPIQSNRPTVSFLIDDYF 1568
            I + E   +L  +  +P  V  L    E D L I+ E +PGGS+   L    P   SV+  Y +Q+L GL+++H+  I+HR+I   ++L+D KG +KL++F  SK +  L+T      +KGT        +APEV+L   + F ADIWS G T+IE+VT + P+ +  YK+  AI+ I   K      +  +    D ++ KC+  + + RPT S L+   F
Sbjct:  116 IQELEEEVKLLKNLSHPNIVRYLGTVREDDTLNILLEFVPGGSISSLLEKFGPFPESVVRTYTRQLLLGLEYLHNHAIMHRDIKGANILVDNKGCIKLADFGASKQVAELATMTGAKSMKGT-----PYWMAPEVILQTGHSFSADIWSVGCTVIEMVTGKAPWSQ-QYKEVAAIFFIGTTKSHPPIPDTLSSDAKDFLL-KCLQEVPNLRPTASELLKHPF 330          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q61084|M3K3_MOUSE (Mitogen-activated protein kinase kinase kinase 3 OS=Mus musculus OX=10090 GN=Map3k3 PE=1 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 4.480e-23
Identity = 58/148 (39.19%), Postives = 87/148 (58.78%), Query Frame = 3
Query: 1005 LFIVTEDMPGGSLRQQL-SIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNE 1445
            L I  E MPGGS++ QL +   L  SV  KY +QILEG+ ++H   I+HR+I   ++L D  GNVKL +F  SK L  +   M   GI+   +      ++PEV+ GE YG +AD+WS G T++E++T + P+ +     AI+ I  +
Sbjct:  439 LTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTIC--MSGTGIRS--VTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQ 582          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q99759|M3K3_HUMAN (Mitogen-activated protein kinase kinase kinase 3 OS=Homo sapiens OX=9606 GN=MAP3K3 PE=1 SV=2)

HSP 1 Score: 106.686 bits (265), Expect = 6.127e-23
Identity = 59/149 (39.60%), Postives = 86/149 (57.72%), Query Frame = 3
Query: 1005 LFIVTEDMPGGSLRQQL-SIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTR-IDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNE 1445
            L I  E MPGGS++ QL +   L  SV  KY +QILEG+ ++H   I+HR+I   ++L D  GNVKL +F  SK L       I M   G R +      ++PEV+ GE YG +AD+WS G T++E++T + P+ +     AI+ I  +
Sbjct:  439 LTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRL-----QTICMSGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQ 582          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9Y2U5|M3K2_HUMAN (Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP3K2 PE=1 SV=2)

HSP 1 Score: 102.064 bits (253), Expect = 2.039e-21
Identity = 57/153 (37.25%), Postives = 87/153 (56.86%), Query Frame = 3
Query:  993 EQDNLFIVTEDMPGGSLRQQL-SIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFM-GIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNE 1445
            ++  L I  E MPGGS++ QL +   L  +V  KY +QILEG+ ++H   I+HR+I   ++L D  GNVKL +F  SK L  +      M  + GT        ++PEV+ GE YG +ADIWS   T++E++T + P+ +     AI+ I  +
Sbjct:  429 QEKTLSIFMEYMPGGSIKDQLKAYGALTENVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSTGNVKLGDFGASKRLQTICLSGTGMKSVTGT-----PYWMSPEVISGEGYGRKADIWSVACTVVEMLTEKPPWAEFEAMAAIFKIATQ 576          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9FZ36|M3K2_ARATH (Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana OX=3702 GN=ANP2 PE=2 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 9.211e-21
Identity = 75/240 (31.25%), Postives = 123/240 (51.25%), Query Frame = 3
Query:  861 KCVAYAYDCKLTDINSMKILKYEIVTRLKLSYKYP-FVELLTMYTEQDNLFIVTEDMPGGSLRQQLS-IAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKK--AIYIIKNEKKIDYERNCYAGTNFDEIIDKCISPIQSNRPTVSFLIDDYF 1568
            K V    +C   +     I + E   +L  +  +P  V  L    E + L I+ E +PGGS+   L        SV+  Y  Q+L GL+++H+  I+HR+I   ++L+D +G +KL++F  SK +  L+T      +KGT        +APEV+L   + F ADIWS G T+IE+VT + P+ +  YK+  AI+ I   K      +  + ++ ++ + KC+    + RPT S L+   F
Sbjct:   97 KQVLITSNCASKEKTQAHIQELEEEVKLLKNLSHPNIVRYLGTVREDETLNILLEFVPGGSISSLLEKFGAFPESVVRTYTNQLLLGLEYLHNHAIMHRDIKGANILVDNQGCIKLADFGASKQVAELATISGAKSMKGTPY-----WMAPEVILQTGHSFSADIWSVGCTVIEMVTGKAPWSQ-QYKEIAAIFHIGTTKSHPPIPDNIS-SDANDFLLKCLQQEPNLRPTASELLKHPF 329          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A0L8HR14 (Protein kinase domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22008257mg PE=4 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 3.741e-26
Identity = 73/189 (38.62%), Postives = 102/189 (53.97%), Query Frame = 3
Query: 1005 LFIVTEDMPGGSLRQQL-SIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNEKKIDYERNCYAGTNFDEIIDKCISPIQSNRPTVSFLIDDYF 1568
            L I  E MPGGSLRQQL +  PL  ++  KY +Q+LEGL F+H   I+HR+I C ++L + +GNVKL +F  SK L ++ +      + GT        +APEV+ GE Y  +ADIWS G T++E+ T + P+P L    AIY I   +   YE   +      + I  C       RPT   L+   F
Sbjct:  440 LSIFMEYMPGGSLRQQLQNYGPLNENLARKYTRQVLEGLAFLHKNVIVHRDIKCANILKNVQGNVKLGDFGASKRLQSICSMSGMKTVIGT-----PHWMAPEVINGEGYCRKADIWSLGCTVVEMFTMKPPWPDLESMAAIYKIATSEHPKYELPFHVSDIARDCIRNCFRKNSRERPTAEDLLRHRF 623          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A2P6QMP9 (Putative mitogen-activated protein kinase kinase kinase STE-STE11 family OS=Rosa chinensis OX=74649 GN=RchiOBHm_Chr5g0080301 PE=3 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 1.375e-25
Identity = 72/205 (35.12%), Postives = 117/205 (57.07%), Query Frame = 3
Query:  969 VELLTMYTEQDNLFIVTEDMPGGSLRQQLSIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEP--YGFQADIWSFGATLIEIVTRERPYPKLTY-KKAIYIIKNEKKIDYERNCYAGTNFDEIIDKCISPIQSNRPTVSFLIDDYFKN 1574
            + LL+ +  ++ L+I+ E +  GSLR+     PL  S +  Y +QIL+GLK++HD+ +IHR+I C ++L+   G+VKL++F  +K +   + DM  +  +GT     A  +APEV+  E   YG  ADIWS G T++E++TRE PYP L +   A  I+  +  +  +       +F   I +C+     NRPT + L++  F N
Sbjct:  126 IALLSQFEHENILYILLELVTEGSLRKLYQTYPLTDSHVSVYTRQILQGLKYLHDQNVIHRDIKCANILVHANGSVKLADFGLAKAIK--TNDM--LSCQGT-----ANWMAPEVVNPESPGYGLPADIWSLGCTVLEMLTREVPYPNLEWMAAACKIMMGKLPLVPDSLSREAQDF---IHRCLQVKPDNRPTAAQLLEHPFVN 318          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A1I8IS63 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 3.408e-25
Identity = 64/185 (34.59%), Postives = 98/185 (52.97%), Query Frame = 3
Query: 1020 EDMPGGSLRQQLS-IAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYK-KAIYIIKNEKKIDYERNCYAGTNFDEIIDKCISPIQSNRPTVSFLIDDYF 1568
            E M  GSLR ++    P+   +  KY + +LEGL F+H   I+HR+I   ++L D +GNVKLS+F  +K +  L + M       T+    A  +APEV+ G+ Y ++ADIWS G+T++E +T   PY +L      IY I +++K+DY           + ID C +     RP    L+   F
Sbjct:    2 EYMDCGSLRDEIKRFGPIREILARKYTRMVLEGLSFLHRNTIVHRDIKGANILKDSQGNVKLSDFGSAKHIKTLQSAM------STKFAGTAPYIAPEVIRGKKYHYKADIWSLGSTVVEFLTGHPPYHQLENAVSVIYRIVSDQKVDYTLPSEVTETARQFIDACFTHALEQRPDADSLLRHRF 180          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A267FTA2 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig024460g1 PE=4 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 6.145e-25
Identity = 75/222 (33.78%), Postives = 116/222 (52.25%), Query Frame = 3
Query:  909 MKILKYEIVTRLKLSYKYPFVELLTMYTEQDNLFIVTEDMPGGSLRQQLS-IAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYK-KAIYIIKNEKKIDYERNCYAGTNFDEIIDKCISPIQSNRPTVSFLIDDYF 1568
            +K L+ EI T  K S++   V+ L  + +   L I  E M  GSLR ++    P+   +  KY + +LEGL F+H   I+HR+I   ++L D +GNVKLS+F  +K +  L + M       T+    A  +APEV+ G+ Y ++ADIWS G+T++E +T   PY +L      IY I +++K+DY           + ID C +     RP    L+   F
Sbjct:  313 VKALEIEIQTLKKFSHER-IVQYLGYHQDAYRLCIFMEYMDCGSLRDEIKRFGPIREILARKYTRMVLEGLSFLHRNTIVHRDIKGANILKDSQGNVKLSDFGSAKHIKTLQSAM------STKFAGTAPYIAPEVIRGKKYHYKADIWSLGSTVVEFLTGHPPYHQLENAVSVIYRIVSDQKVDYTLPSEVTETARQFIDACFTHALEQRPDADSLLRHRF 527          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A210PFZ5 (Mitogen-activated protein kinase kinase kinase 2 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT24565 PE=4 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 1.097e-24
Identity = 61/154 (39.61%), Postives = 94/154 (61.04%), Query Frame = 3
Query: 1005 LFIVTEDMPGGSLRQQLS-IAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNEKKIDYE 1463
            L I  E MPGGS++ +L+   PL   V  KY +Q+LEGL F+H   I+HR+I   +VL D +GN+KL++F  SK L+ + +   F    GT        +APEV+ GE YG +AD+WS G T++E+++ + P+ +L    AIY I   ++ ++E
Sbjct:  205 LSIFMEYMPGGSIKDELAKYGPLTEGVTRKYTRQMLEGLAFLHKNVIVHRDIKAANVLRDLQGNIKLADFGASKRLHTICSATGFKSFVGT-----PHYMAPEVINGEGYGRKADVWSLGCTVVEMISGKPPWSELESMAAIYKIATAERPEFE 353          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 104.375 bits (259), Expect = 4.146e-23
Identity = 57/152 (37.50%), Postives = 87/152 (57.24%), Query Frame = 3
Query:  996 QDNLFIVTEDMPGGSLRQQL-SIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTR-IDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNE 1445
            +  L I  E MPGGS++ QL +   L  +V  KY +QILEG+ ++H   I+HR+I   ++L D  GNVKL +F  SK L       I M   G R +      ++PEV+ G+ YG +AD+WS G T++E++T + P+ +     AI+ I  +
Sbjct:  430 EKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRL-----QTICMSSTGVRSVTGTPYWMSPEVISGDGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQ 576          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 104.375 bits (259), Expect = 4.146e-23
Identity = 57/152 (37.50%), Postives = 87/152 (57.24%), Query Frame = 3
Query:  996 QDNLFIVTEDMPGGSLRQQL-SIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTR-IDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNE 1445
            +  L I  E MPGGS++ QL +   L  +V  KY +QILEG+ ++H   I+HR+I   ++L D  GNVKL +F  SK L       I M   G R +      ++PEV+ G+ YG +AD+WS G T++E++T + P+ +     AI+ I  +
Sbjct:  430 EKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRL-----QTICMSSTGVRSVTGTPYWMSPEVISGDGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQ 576          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 104.375 bits (259), Expect = 4.146e-23
Identity = 57/152 (37.50%), Postives = 87/152 (57.24%), Query Frame = 3
Query:  996 QDNLFIVTEDMPGGSLRQQL-SIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTR-IDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNE 1445
            +  L I  E MPGGS++ QL +   L  +V  KY +QILEG+ ++H   I+HR+I   ++L D  GNVKL +F  SK L       I M   G R +      ++PEV+ G+ YG +AD+WS G T++E++T + P+ +     AI+ I  +
Sbjct:  430 EKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRL-----QTICMSSTGVRSVTGTPYWMSPEVISGDGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQ 576          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:103026704])

HSP 1 Score: 103.605 bits (257), Expect = 7.470e-23
Identity = 59/153 (38.56%), Postives = 88/153 (57.52%), Query Frame = 3
Query:  990 TEQDNLFIVTEDMPGGSLRQQL-SIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNE 1445
            T +  L I  E MPGGS++ QL S   L  +V  KY +QILEG+ ++H   I+HR+I   ++L D  GNVKL +F  S+ L  +   +   GIK   +      ++PEV+ GE YG +ADIWS G T++E++T   P+ +     AI+ I  +
Sbjct:  431 THERTLSIFMEYMPGGSIKDQLKSYGALTENVTRKYTRQILEGVCYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASRRLQTIC--LSGTGIKS--VTGTPYWMSPEVISGEGYGRKADIWSVGCTVVEMLTLRPPWAEFEAMAAIFKIATQ 579          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3-like [Source:NCBI gene;Acc:103044968])

HSP 1 Score: 100.523 bits (249), Expect = 6.461e-22
Identity = 56/152 (36.84%), Postives = 88/152 (57.89%), Query Frame = 3
Query:  993 EQDNLFIVTEDMPGGSLRQQL-SIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNE 1445
            EQ  L I  E MPGGS++ QL +   L   V  +Y +QIL+G+ ++H   I+HR+I   ++L D  GNVKL +F  SK +  +   M   GIK   +      ++PEV+ GE YG +AD+WS   T++E++T++ P+ +     AI+ I  +
Sbjct:  430 EQRKLSIFVEFMPGGSIKDQLKAYGALTEKVTRRYTRQILQGVFYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRIQTIC--MSGTGIK--TVTGTPYWMSPEVINGEGYGRKADVWSVACTVVEMLTQKPPWAEYEAMAAIFKIATQ 577          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 107.071 bits (266), Expect = 9.640e-25
Identity = 60/153 (39.22%), Postives = 89/153 (58.17%), Query Frame = 3
Query:  993 EQDNLFIVTEDMPGGSLRQQL-SIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFM-GIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNE 1445
            +Q  L I  E MPGGS++ QL +   L  +V  KY +QILEG+ F+H   I+HR+I   ++L D  GNVKL +F  SK L  + +    M  + GT        ++PEV+ GE YG +ADIWS G T++E++T + P+ +     AI+ I  +
Sbjct:  432 QQKTLSIFMEYMPGGSIKDQLRAYGALTENVTRKYTRQILEGVSFLHGNMIVHRDIKGANILRDSTGNVKLGDFGASKRLQTICSQGTAMRSVTGT-----PYWMSPEVINGEGYGRKADIWSVGCTVVEMLTEKPPWAEFEAMAAIFKIATQ 579          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: stk25a (serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-GENE-041010-92])

HSP 1 Score: 92.4337 bits (228), Expect = 2.290e-20
Identity = 62/196 (31.63%), Postives = 94/196 (47.96%), Query Frame = 3
Query:  987 YTEQDNLFIVTEDMPGGSLRQQLSIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNIN--CGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNEKKIDYERNCYAGTNFDEIIDKCISPIQSNRPTVSFLIDDYF 1568
            Y +   L+I+ E + GGS    +   PLE   I    ++IL+GL ++H E+ IHR+I     +VLL  +G+VKL++F  +  L +         IK          +APEV+    Y F+ADIWS G T IE+   E P  +L   + +++I        E N      F E +D C++     RPT   L+   F
Sbjct:   91 YLKGTKLWIIMEYLGGGSALDLIKPGPLEEHQIATILREILKGLDYLHSERKIHRDIKGPAANVLLSEQGDVKLADFGVAGQLTDTQ-------IKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSELHPMRVLFLIPKNNPPTLEGNYSKA--FKEFVDSCLNKDPQFRPTAKELLKHKF 277          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: stk39 (serine threonine kinase 39 [Source:ZFIN;Acc:ZDB-GENE-140106-194])

HSP 1 Score: 88.1965 bits (217), Expect = 3.394e-19
Identity = 54/175 (30.86%), Postives = 91/175 (52.00%), Query Frame = 3
Query: 1068 LEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLG-EPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYI-IKNEKKI------DYERNCYAGTNFDEIIDKCISPIQSNRPTVSFLIDDYF 1568
            LE  VI    +++LEGL ++H    IHR++  G++LL   G +++++F  S FL     D+    ++ T +    C +APEV+     Y F+ADIWSFG T +E+ +   PY K    K + + ++N+         D E     G +F ++I +C+    + RPT + L+   F
Sbjct:    2 LEEPVIASILKEVLEGLDYLHRNGQIHRDVKAGNILLGEDGTIQIADFGVSAFLAT-GGDVTRNKVRKTFV-GTPCWMAPEVMEQVRGYDFKADIWSFGITAMELASGAAPYHKYPPMKVLMLTLQNDPPTLETGVEDKEMVKKYGKSFRKLISQCLQKDPAKRPTAAELLKSKF 174          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008193.1 (pep scaffold:Pmarinus_7.0:GL476850:102262:127365:-1 gene:ENSPMAG00000007385.1 transcript:ENSPMAT00000008193.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.1149 bits (209), Expect = 3.854e-18
Identity = 65/228 (28.51%), Postives = 105/228 (46.05%), Query Frame = 3
Query:  864 CVAYAYDCKLTDINSMKILKYE-IVTRLKLSYKYPFVELLTMYTEQDNLFIVTEDMPGGSLRQQLSIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIY-IIKNEKKIDYERNCYAGTNFDEIIDKCISPIQSNRPT 1541
             V    + K TDI  +  L++  I+T   +    P   ++  Y  Q  L+ V        LR    I+P    +++ + + I  G+ ++H  KIIHR++   +VL+     VK+S+F  SK +   ST M F G            +APEV+  EP   + DIWSFG  L E++T E PY  +     I+ +  N   +    +C  G  F  ++ +C +    NRP+
Sbjct:   39 AVKKVREQKETDIKHLHKLRHPNIITFKGVCTHAPCYCIIMEYCAQGQLYEV--------LRAGRRISP---ELLVGWTRGIARGMSYLHLHKIIHRDLKSPNVLITHDDEVKISDFGTSKEMREKSTRMSFAGT--------VAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYRDVDSSAIIWGVGSNSLHLPIPASCPEG--FKILLTQCWNSKPRNRPS 245          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: slka (STE20-like kinase a [Source:ZFIN;Acc:ZDB-GENE-050411-66])

HSP 1 Score: 83.5741 bits (205), Expect = 5.549e-17
Identity = 59/194 (30.41%), Postives = 94/194 (48.45%), Query Frame = 3
Query:  966 FVELLTMYTEQDNLFIVTEDMPGGS-----LRQQLSIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFS-KFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGE-----PYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNEKKIDYERNCYAGTNFDEIIDKCI 1514
             V LL  +  ++ L+I  E  PGG+     L  +  +A  +  V+   C+Q+LE L ++H  +IIHR++  G++LL  +G+VKL++F  S K    L     F+G            +APEV++ E     PY ++ADIWS G TLIE+   E P  +L   + +  I                 F + + KC+
Sbjct:   90 IVGLLNAFYYENKLWIFIEFCPGGAVDAIMLELERGLAEPQIRVV---CKQMLEALNYLHTHRIIHRDLKAGNILLTFEGDVKLADFGVSAKNTRTLQRRDSFIGT--------PYWMAPEVVMCETMKDAPYDYKADIWSLGITLIELAQMEPPNHELNPMRVMLKIAKNDPPSLSFPSKWSAEFTDFLKKCL 272          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: STE20 (Cdc42p-activated signal transducing kinase; involved in pheromone response, pseudohyphal/invasive growth, vacuole inheritance, down-regulation of sterol uptake; GBB motif binds Ste4p; member of the PAK (p21-activated kinase) family [Source:SGD;Acc:S000000999])

HSP 1 Score: 91.2781 bits (225), Expect = 1.244e-19
Identity = 57/205 (27.80%), Postives = 106/205 (51.71%), Query Frame = 3
Query:  957 KYP-FVELLTMYTEQDNLFIVTEDMPGGSLRQQLSIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNEKKIDYERNCYAGTNFDEIIDKCISPIQSNRPTVSFLIDDYF 1568
            K+P  V  +  Y  + +L+++ E M GGSL   ++   L    I   C++ L GL+F+H + ++HR+I   ++LL  +G++KL++F F   +  L+       +K T +      +APEV+  + YG + DIWS G  +IE++  E PY   T  +A+Y+I        +      ++  + +D C+     +R + + L+ D +
Sbjct:  673 KHPNIVNFIDSYVLKGDLWVIMEYMEGGSLTDVVTHCILTEGQIGAVCRETLSGLEFLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCAQINELN-------LKRTTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPENLSSSLKKFLDWCLCVEPEDRASATELLHDEY 870          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: STE11 (Signal transducing MEK kinase; involved in pheromone response and pseudohyphal/invasive growth pathways where it phosphorylates Ste7p, and the high osmolarity response pathway, via phosphorylation of Pbs2p; regulated by Ste20p and Ste50p; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004354])

HSP 1 Score: 90.5077 bits (223), Expect = 1.780e-19
Identity = 53/149 (35.57%), Postives = 83/149 (55.70%), Query Frame = 3
Query:  993 EQDNLFIVTEDMPGGSLRQQLS-IAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYII 1436
            E  NL I  E +PGGS+   L+   P E S+I  + +QIL G+ ++H + IIHR+I   ++L+D KG VK+++F  SK L  L+        K   +      ++PEV+       +ADIWS G  +IE+ T + P+P  +  +AI+ I
Sbjct:  525 EGGNLNIFLEYVPGGSVSSMLNNYGPFEESLITNFTRQILIGVAYLHKKNIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNKKQ----NKRASLQGSVFWMSPEVVKQTATTAKADIWSTGCVVIEMFTGKHPFPDFSQMQAIFKI 669          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 84.7297 bits (208), Expect = 1.372e-17
Identity = 60/197 (30.46%), Postives = 95/197 (48.22%), Query Frame = 3
Query: 1005 LFIVTEDMPGGSLRQQLSIAP--LEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNEKKIDYERNCYAGTNFDE----IIDKCISPIQSNRPTVSFLIDDYFKNS 1577
            L+I+ E    GSLR+ +S +   L  +    Y  Q L GLK++H E +IHR+I   ++LL     VKL++F  S  + + +     + + GT        +APE+L        +DIWS GAT++E++T+  PY  LT     Y ++N+         Y  ++F E     + KC       RPT   L+   + NS
Sbjct:   95 LYILLEYCANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVSTIVNSSA-----LTLAGT-----LNWMAPEILGNRGASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVEND-------TYYPPSSFSEPLKDFLSKCFVKNMYKRPTADQLLKHVWINS 274          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: MKK2 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk1p; MKK2 has a paralog, MKK1, that arose from the whole genome duplication [Source:SGD;Acc:S000006061])

HSP 1 Score: 80.1073 bits (196), Expect = 1.926e-16
Identity = 60/207 (28.99%), Postives = 94/207 (45.41%), Query Frame = 3
Query:  969 VELLTMYTEQ--DNLFIVTEDMPGGSLRQQLS-----IAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYP--KLTYKKA-------IYIIKNEKKIDYERNCYAGTNFDEIIDKCISPIQSNRPT 1541
            V+   M+T++   +++I  E M G SL             +   VI K  + +L GL ++H+ K+IHR+I   ++LL+ KG +KL +F  S    N S  M F G         +  +APE + G+PY    D+WS G TL+E+     P+   K+T   A       I     + K + E +      F   ID C+      RP+
Sbjct:  274 VQYYGMFTDEQSSSIYIAMEYMGGKSLEATYKNLLKRGGRISERVIGKIAESVLRGLSYLHERKVIHRDIKPQNILLNEKGEIKLCDFGVSGEAVN-SLAMTFTGT--------SFYMAPERIQGQPYSVTCDVWSLGLTLLEVAGGRFPFESDKITQNVAPIELLTMILTFSPQLKDEPELDISWSKTFRSFIDYCLKKDARERPS 471          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: CLA4 (Cdc42p-activated signal transducing kinase; member of the PAK (p21-activated kinase) family, along with Ste20p and Skm1p; involved in septin ring assembly, vacuole inheritance, cytokinesis, sterol uptake regulation; phosphorylates Cdc3p and Cdc10p; CLA4 has a paralog, SKM1, that arose from the whole genome duplication [Source:SGD;Acc:S000005242])

HSP 1 Score: 80.8777 bits (198), Expect = 2.031e-16
Identity = 54/154 (35.06%), Postives = 80/154 (51.95%), Query Frame = 3
Query:  999 DNLFIVTEDMPGGSLRQQL--------SIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYII 1436
            D+L++V E M GGSL   +        S +PL    I    ++  +GLKF+HD+ IIHR+I   +VLLD +  VK+++F F   L +  +    M   GT        +APEV+    Y  + D+WS G   IE++  E PY      KA+Y+I
Sbjct:  634 DDLWVVMEFMEGGSLTDIIENSPTNDNSHSPLTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTRARVKITDFGFCARLTDKRSKRATM--VGT-----PYWMAPEVVKQREYDEKIDVWSLGIMTIEMLEGEPPYLNEDPLKALYLI 780          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO41410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4G7])

HSP 1 Score: 104.375 bits (259), Expect = 4.358e-25
Identity = 61/182 (33.52%), Postives = 102/182 (56.04%), Query Frame = 3
Query:  903 NSMKILKYEIVTRLKLSYKYPFVELLTMYTEQDNLFIVTEDMPGGSLRQQL-SIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNE 1445
            N +K L+ EI   +K       V+   + T+  +++I  E +PGGS+ + +     L  S+  KY +QILEG+ ++H  +I+HR+I   ++L D  GNVKL++F  SK L  + +   F  + GT        +APEV+ GE YG +AD+WS G T++E++T + P+       A++ I  +
Sbjct:   46 NEVKALEGEI-EFMKAFRNERIVQYYGIETDDLHIYIFMEYLPGGSIHEHIKQHGALNESLTRKYSRQILEGILYLHTNRIVHRDIKGANILRDLYGNVKLADFGASKRLQTIRSKTGFRSVHGT-----PYWMAPEVINGEGYGRKADVWSVGCTVVEMLTTKPPWADFEPMAALFKIATQ 221          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO27976 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7S3])

HSP 1 Score: 91.2781 bits (225), Expect = 1.561e-20
Identity = 48/142 (33.80%), Postives = 85/142 (59.86%), Query Frame = 3
Query:  981 TMYTEQDNLFIVTEDMPGGSLRQQLS-IAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKG-NVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPY 1400
            T +T   N+F+  E M GGS+   LS   P E +++I+Y +QIL+G+ ++H+ +++HR+I   ++L+D  G ++++++F  +     L+T +   G    ++      +APEVL GE YG   D+WS G  LIE+ T + P+
Sbjct:  109 TRHTGHFNIFL--EWMAGGSISMLLSKYGPFEEAILIRYLRQILQGVSYLHENQVVHRDIKGANILVDSTGQDIRIADFGAAA---RLATQITGAGEFQGQLLGTIAFMAPEVLRGESYGRSCDVWSVGCVLIEMATGKPPW 245          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO47821 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL88])

HSP 1 Score: 89.3521 bits (220), Expect = 6.589e-20
Identity = 57/200 (28.50%), Postives = 99/200 (49.50%), Query Frame = 3
Query:  984 MYTEQDNLFIVTEDMPGGSLRQQLS-IAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFL----YNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNEKKIDYERNCYAGTNFDEIIDKCISPIQSNRPTVSFLIDDYF 1568
            M   Q  + I  E +PGGS+ Q L         V  +Y +QIL+G+ ++H+  +IHR+I  G+++L   G +KL +F  +K +     ++S   I   ++GT        +APEV+    +G ++DIWS G T+ E+ T + P+  +    AI+ I N   +      ++    D  +  C++  Q  RP+   L+   F
Sbjct:   75 MDDSQCTINIFMEFVPGGSIAQALKRFGAFVEPVFRRYTRQILDGVSYLHNNNVIHRDIKGGNIMLMPNGVIKLIDFGCAKKICMVGAHVSKSNILRSMRGT-----PYWMAPEVIRETGHGRKSDIWSIGCTVFEMATGQPPWSNVPPLSAIFAIGNGSPVPRLDESFSAAAID-FVTSCMTRDQDTRPSADELLRHDF 268          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO33129 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST31])

HSP 1 Score: 91.2781 bits (225), Expect = 1.602e-19
Identity = 72/269 (26.77%), Postives = 130/269 (48.33%), Query Frame = 3
Query:  855 IEKCVAYAYDCKLTDINSMKILKYEIVTRLKLSYKYPFVELLTMYTEQDNLFIVTEDMPGGSL----RQQLSIAP-------LEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGF--QADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNEKKIDYERNCYAGTN---------FDEIIDKCISPIQSNRPTVSFLIDD-YFKNSN*QDW 1592
            +EKC A + D  + +I++M    +E V           V   T +  +  L+IV   + GGS+    +Q++   P       LE  +I    +++L+GL++ H   +IHR++  G++LL   G+V+L++F  S  + +   D     ++ T +    C +APEV+  + +G+  +ADIWSFG T IE+ T   PY K    K + +         E  C  G+          F +++  C+    +NRP  + L+ + +FK +  +D+
Sbjct:   49 LEKCGA-SIDEMMKEIHAMSQCNHENV-----------VNYYTSFVVRQELWIVMRLLNGGSMLDVIKQRIKQQPGLVDEGVLEEDIIATVLREVLKGLEYFHKNGLIHRDVKAGNILLATDGSVQLADFGVSSAISDYG-DRTKPKMRKTFVGT-PCWMAPEVMEQQVHGYNHKADIWSFGITAIELATGTAPYAKFPAMKVLMLTLQNDPPRME-TCADGSTRDYKKYSKVFKKMVSLCLQKEPANRPDANELLKNPFFKKAKGKDY 302          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO45846 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRL1])

HSP 1 Score: 87.8113 bits (216), Expect = 3.895e-19
Identity = 50/150 (33.33%), Postives = 79/150 (52.67%), Query Frame = 3
Query:  960 YPFVELLTMYTEQ---DNLFIVTEDMPGGSLRQQLSIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPY 1400
            YP   ++ MY      D L++V E + GG+L   ++   L    +   C+ +L+ L F+H + +IHR+I   S+LL   G VKLS+F F      ++ DM     +   +      +APEV+  +PYG + DIWS G  ++E+V  E PY
Sbjct:   81 YPHPNIVEMYGSHLVGDELWVVMEFLEGGTLTDIVTHTNLSEEQVACVCRAVLKALTFLHSQGVIHRDIKSDSILLTSNGTVKLSDFGFCA---QVTEDM----PRRKSLVGTPYWMAPEVISRKPYGTEVDIWSLGIMVLEMVDGEPPY 223          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101169290])

HSP 1 Score: 105.145 bits (261), Expect = 2.017e-23
Identity = 57/151 (37.75%), Postives = 88/151 (58.28%), Query Frame = 3
Query:  996 QDNLFIVTEDMPGGSLRQQL-SIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNE 1445
            +  L I  E MPGGS++ QL +   L  +V  KY +QILEG+ ++H   I+HR+I   ++L D  GNVKL +F  SK L  +   M   GI+   +      ++PEV+ GE YG +AD+WS G T++E++T + P+ +     AI+ I  +
Sbjct:  427 EKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTIC--MSGTGIRS--VTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQ 573          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:101160297])

HSP 1 Score: 104.76 bits (260), Expect = 2.879e-23
Identity = 58/153 (37.91%), Postives = 89/153 (58.17%), Query Frame = 3
Query:  990 TEQDNLFIVTEDMPGGSLRQQL-SIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNE 1445
            T +  L I  E MPGGS++ QL S   L  +V  +Y +QILEG+ ++H   I+HR+I   ++L D  GNVKL +F  S+ L  +   +   GIK   +      ++PEV+ GE YG +ADIWS G T++E++T+  P+ +     AI+ I  +
Sbjct:  461 TMERTLSIFMEHMPGGSIKDQLKSYGALTENVTRRYTRQILEGVSYLHSNMIVHRDIKGANILRDSVGNVKLGDFGASRRLQTIC--LSGTGIKS--VTGTPYWMSPEVISGEGYGRKADIWSVGCTVVEMLTQRPPWAEFEAMAAIFKIATQ 609          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101156127])

HSP 1 Score: 101.679 bits (252), Expect = 2.811e-22
Identity = 55/152 (36.18%), Postives = 88/152 (57.89%), Query Frame = 3
Query:  993 EQDNLFIVTEDMPGGSLRQQL-SIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNE 1445
            +Q  L I  E MPGGS++ QL +   L   V  +Y +QIL+G+ ++H   I+HR+I   ++L D  GNVKL +F  SK +  +   M   GIK   +      ++PEV+ GE YG +AD+WS   T++E++T++ P+ +     AI+ I  +
Sbjct:  400 DQRKLTIFVEFMPGGSIKDQLKAYGALTEKVTRRYTRQILQGVSYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRIQTIC--MSGTGIKS--VTGTPYWMSPEVINGEGYGRKADVWSVACTVVEMLTQKPPWAEYEAMAAIFKIATQ 547          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101156127])

HSP 1 Score: 101.679 bits (252), Expect = 3.069e-22
Identity = 55/152 (36.18%), Postives = 88/152 (57.89%), Query Frame = 3
Query:  993 EQDNLFIVTEDMPGGSLRQQL-SIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNE 1445
            +Q  L I  E MPGGS++ QL +   L   V  +Y +QIL+G+ ++H   I+HR+I   ++L D  GNVKL +F  SK +  +   M   GIK   +      ++PEV+ GE YG +AD+WS   T++E++T++ P+ +     AI+ I  +
Sbjct:  430 DQRKLTIFVEFMPGGSIKDQLKAYGALTEKVTRRYTRQILQGVSYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRIQTIC--MSGTGIKS--VTGTPYWMSPEVINGEGYGRKADVWSVACTVVEMLTQKPPWAEYEAMAAIFKIATQ 577          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101156127])

HSP 1 Score: 101.679 bits (252), Expect = 3.069e-22
Identity = 55/152 (36.18%), Postives = 88/152 (57.89%), Query Frame = 3
Query:  993 EQDNLFIVTEDMPGGSLRQQL-SIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNE 1445
            +Q  L I  E MPGGS++ QL +   L   V  +Y +QIL+G+ ++H   I+HR+I   ++L D  GNVKL +F  SK +  +   M   GIK   +      ++PEV+ GE YG +AD+WS   T++E++T++ P+ +     AI+ I  +
Sbjct:  430 DQRKLTIFVEFMPGGSIKDQLKAYGALTEKVTRRYTRQILQGVSYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRIQTIC--MSGTGIKS--VTGTPYWMSPEVINGEGYGRKADVWSVACTVVEMLTQKPPWAEYEAMAAIFKIATQ 577          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000014613.1 (SMESG000014613.1)

HSP 1 Score: 901.738 bits (2329), Expect = 0.000e+0
Identity = 446/508 (87.80%), Postives = 470/508 (92.52%), Query Frame = 3
Query:   69 VITLENVNNSNDIETFEMLISDNLIYLKKKLADRICERVQDIKLFDQRNIAVPPLNNNGRIP----CKELYYSIYEEENDDIILHIKRNYCGIPKFFQFPKLTTIGQLISELKTLYNIQKNFYILQGNGSFADNNATLEQCKFDNSKVKIWVGESLIVNITLLNPLNTEDENVTQVIGRFDFSATETVASLKEFILNENKQFHNLQLFTETSFLDDKKQLASYPLDRECKIYCVDMSKRTDIIINTADKTKEKYYARYPGTINSSVIEKCVAYAYDCKLTDINSMKILKYEIVTRLKLSYKYPFVELLTMYTEQDNLFIVTEDMPGGSLRQQLSIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNEKKIDYERNCYAGTNFDEIIDKCISPIQSNRPTVSFLIDDYFKNSN 1580
            +I L ++   N + TFE+L SDN++YLK KL+D+I  R QD ++    ++   PLN+N  I        L+Y+I +E++DDIIL++KRNYCGIPKF QFPKLTTIGQLISELKTLYNIQKNFYI Q NGSFADNNATLEQCKFDNSKVKIWVGE+ IVNITLLNPLNTED+NV   IGRF+FSATETVASLKEFILNENKQFHNLQLFTETSFLDDKKQLASYPLDRECKIYCVDMSKRTDIIINTADKTKEKYYARYPGTINSSVIEKCVAYAYDCKLTDINSMKILKYEIVTRLKLSYKYPFVELLTMYTEQDNLFIVTEDMPGGSLRQQLSIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNEKKIDYERNCYAGTNFDEIIDKCISPIQSNRPTVSFLIDDYFKNSN
Sbjct:    5 LIKLTDLFTQNSVNTFEILQSDNVVYLKVKLSDKIGGRAQDFQIHSTDSVN-NPLNDNRSISDISFAGNLFYTISKEQSDDIILYVKRNYCGIPKFLQFPKLTTIGQLISELKTLYNIQKNFYIFQENGSFADNNATLEQCKFDNSKVKIWVGENYIVNITLLNPLNTEDKNV---IGRFEFSATETVASLKEFILNENKQFHNLQLFTETSFLDDKKQLASYPLDRECKIYCVDMSKRTDIIINTADKTKEKYYARYPGTINSSVIEKCVAYAYDCKLTDINSMKILKYEIVTRLKLSYKYPFVELLTMYTEQDNLFIVTEDMPGGSLRQQLSIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNEKKIDYERNCYAGTNFDEIIDKCISPIQSNRPTVSFLIDDYFKNSN 508          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000014619.1 (SMESG000014619.1)

HSP 1 Score: 735.332 bits (1897), Expect = 0.000e+0
Identity = 372/504 (73.81%), Postives = 416/504 (82.54%), Query Frame = 3
Query:   63 MEVITLENVNNSNDIETFEMLISDNLIYLKKKLADRICERVQDIKLFDQRNIAVPPLNNNGRIPCKELYYSIYEEENDDIILHIKRNYCGIPKFFQFPKLTTIGQLISELKTLYNIQKNFYILQGNGSFADNNATLEQCKFDNSKVKIWVGESLIVNITLLNPLNTEDENVTQVIGRFDFSATETVASLKEFILNENKQFHNLQLFTETSFLDDKKQLASYPLDRECKIYCVDMSKRTDIIINTADKTKEKYYARYPGTINSSVIEKCVAYAYDCKLTDINSMKILKYEIVTRLKLSYK--YPFVELLTMYTEQDNLFIVTEDMPGGSLRQQLSIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNEKKIDYERNCYAGTNFDEIIDKCISPIQSNRPTVSFLIDDYF 1568
            MEVITLENVNNSNDIETFEMLISDNLIYLKKKLADRICERVQDIKLFDQRNIAVPPLNNNGRIPCKELYYSIYEEENDDIILHIKRNYCGIPKFFQFPKLTTIGQLISELKTLYNIQKNFYILQGNGSFADNNATLEQCKFDNSKVKIWVGESLIVNITLLNPLNTEDENVTQVIGRFDFSATETVASLKEFILNENKQFHNLQLFTETSFLDDKKQLASYPLDRECKIYCV+MS + ++ I +   T  K+   Y G IN S    C    Y   ++D N+ K  KYE++TRLKL Y    PFVEL+ MYTE + L IVTE M GGSL+ +LS A L  + I KYC+QIL+GL+F+H EKIIHRNINC SVL+DG GN KL+NF+ SKFL+N +TDM+  GI G+++DDD CCVAPEVLLGEPYGF+AD+WSFGA LI+IV+ +RPYP +   +A  +I   + I YE      + +D II +CI PIQ +RP    L +D+ 
Sbjct:    1 MEVITLENVNNSNDIETFEMLISDNLIYLKKKLADRICERVQDIKLFDQRNIAVPPLNNNGRIPCKELYYSIYEEENDDIILHIKRNYCGIPKFFQFPKLTTIGQLISELKTLYNIQKNFYILQGNGSFADNNATLEQCKFDNSKVKIWVGESLIVNITLLNPLNTEDENVTQVIGRFDFSATETVASLKEFILNENKQFHNLQLFTETSFLDDKKQLASYPLDRECKIYCVEMSNKLELTIISKISTG-KFADIYLGKIN-SFNRDCEVLKYRQNISDFNNFKNSKYEVITRLKLPYATGSPFVELINMYTENEKLCIVTEYMTGGSLKSRLS-ASLGVAEINKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFNCTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRTILYEP---IISGYDAIIARCIRPIQKHRPNAWELHNDFL 498          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000014940.1 (SMESG000014940.1)

HSP 1 Score: 252.292 bits (643), Expect = 7.640e-77
Identity = 172/500 (34.40%), Postives = 257/500 (51.40%), Query Frame = 3
Query:   72 ITLENVNNSNDIETFEMLISDNLIYLKKKLADRICERVQDIKLFDQRNIAVPPLNNNGRIPC--KELYYSIYEEENDDIILHIKRNYCGIPKFFQFPKLTTIGQLISELKTLYNIQ-KNFYILQGNGSFADNNATLEQCKFDNSKVKIWVGESLIVNITLLNPLNTEDENVTQVIGRFDFSATETVASLKEFI---LNENKQFHNLQLFTETSFLDDKKQLASYPLDRE-CKIYCVDMSKRTDIIINTADKTKEKYYARYPGTINSSVIEKCVAYAYDCKLTDINSMKILKYEIVTRLKLSYK--YPFVELLTMYTEQDNLFIVTEDMPGGSLRQQLSIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNEKKIDYERNCYAGTNFDEIIDKCISPIQSNRPTV 1544
            IT +N+ N+   E       DN + +KK+++D I   V  I LF +R      LN+N  I    K ++Y + +   + I++ + +N+  IPK+ Q     T+ QL   L +      K F   +      DN A       + SK+K+W G  L+V + + +PL  +    TQ     + S TE++ +LK+ I   ++  K+   L LFTETSFL D K L  YP+ RE C+IY  D+ K      N      E  YAR          E+     Y  +   +    IL+YEIVTR+ LS      F EL+ MY +    +IVT+ M  GSL+   +   L    II+Y  QI E L +MH  ++IHR+++C SVL+    N+KLSNF  S++L+  +T  +  GI G++I+     +APEVL  +PYG ++DIWSFG T++E++TR+RPYP +      + I N K I+Y +N        E IDKC+   Q  RPT 
Sbjct:    7 ITCQNIQNNQKCEVI-CSTDDNAVIIKKRISDLINIEVHKINLFAER---WQRLNDNDFIDSNIKLIFYEVSQPITEKIVVQMMKNHFNIPKWIQVKTEATVLQLKKILSSFSESHLKTFLFTEAGEMLLDNTAIKSYDLMNASKLKVWRGNDLLVQLEICDPLAKDPS--TQKRFPLEISVTESIINLKKKISEKISIGKEI-KLALFTETSFLQDGKCLLDYPIPRENCQIYYADLIKEE--TANIKGPLAEGRYARIFEGEFGQFNERVAIKRYKIEERRVEDANILRYEIVTRIMLSKANVSRFAELMAMYDDSKYFYIVTDFMEQGSLKDIYTARQLNDHEIIRYSIQISEALDYMHSNRLIHRDLSCSSVLVGSDNNIKLSNFQLSEYLF--TTAQLLEGIPGSKIESQQLWLAPEVLHKKPYGIKSDIWSFGVTVMEMLTRDRPYPNMNIVSGSHKICNNKCIEYNKN--ISPKISEFIDKCLHECQCERPTA 493          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000014940.1 (SMESG000014940.1)

HSP 1 Score: 171.4 bits (433), Expect = 5.584e-49
Identity = 91/231 (39.39%), Postives = 133/231 (57.58%), Query Frame = 3
Query:  858 EKCVAYAYDCKLTDINSMKILKYEIVTRLKLSYK--YPFVELLTMYTEQDNLFIVTEDMPGGSLRQQLSIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNEKKIDYERNCYAGTNFDEIIDKCISPIQSNRPTV 1544
            E+     Y  +   +    IL+YEIVTR+ LS      F EL+ MY +    +IVT+ M  GSL+   +   L    II+Y  QI E L +MH  ++IHR+++C SVL+    N+KLSNF  S++L+  +T  +  GI G++I+     +APEVL  +PYG ++DIWSFG T++E++TR+RPYP +      + I N K I+Y +N        E IDKC+   Q  RPT 
Sbjct:   39 ERVAIKRYKIEERRVEDANILRYEIVTRIMLSKANVSRFAELMAMYDDSKYFYIVTDFMEQGSLKDIYTARQLNDHEIIRYSIQISEALDYMHSNRLIHRDLSCSSVLVGSDNNIKLSNFQLSEYLF--TTAQLLEGIPGSKIESQQLWLAPEVLHKKPYGIKSDIWSFGVTVMEMLTRDRPYPNMNIVSGSHKICNNKCIEYNKNI--SPKISEFIDKCLHECQCERPTA 265          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000014940.1 (SMESG000014940.1)

HSP 1 Score: 171.4 bits (433), Expect = 7.643e-49
Identity = 91/231 (39.39%), Postives = 133/231 (57.58%), Query Frame = 3
Query:  858 EKCVAYAYDCKLTDINSMKILKYEIVTRLKLSYK--YPFVELLTMYTEQDNLFIVTEDMPGGSLRQQLSIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNEKKIDYERNCYAGTNFDEIIDKCISPIQSNRPTV 1544
            E+     Y  +   +    IL+YEIVTR+ LS      F EL+ MY +    +IVT+ M  GSL+   +   L    II+Y  QI E L +MH  ++IHR+++C SVL+    N+KLSNF  S++L+  +T  +  GI G++I+     +APEVL  +PYG ++DIWSFG T++E++TR+RPYP +      + I N K I+Y +N        E IDKC+   Q  RPT 
Sbjct:   50 ERVAIKRYKIEERRVEDANILRYEIVTRIMLSKANVSRFAELMAMYDDSKYFYIVTDFMEQGSLKDIYTARQLNDHEIIRYSIQISEALDYMHSNRLIHRDLSCSSVLVGSDNNIKLSNFQLSEYLF--TTAQLLEGIPGSKIESQQLWLAPEVLHKKPYGIKSDIWSFGVTVMEMLTRDRPYPNMNIVSGSHKICNNKCIEYNKNI--SPKISEFIDKCLHECQCERPTA 276          
The following BLAST results are available for this feature:
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAP3K31.158e-2339.60mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K31.158e-2339.60mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K31.276e-2339.60mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K31.354e-2339.60mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K31.359e-2339.60mitogen-activated protein kinase kinase kinase 3 [... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pak-24.114e-2132.80Serine/threonine-protein kinase pak-2 [Source:Uni... [more]
pak-24.421e-2132.80Serine/threonine-protein kinase pak-2 [Source:Uni... [more]
pak-17.078e-2131.34Serine/threonine-protein kinase pak-1 [Source:Uni... [more]
pak-11.185e-2031.34Serine/threonine-protein kinase pak-1 [Source:Uni... [more]
pak-11.452e-2031.34Serine/threonine-protein kinase pak-1 [Source:Uni... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slik6.050e-2129.41gene:FBgn0035001 transcript:FBtr0100470[more]
Slik6.815e-2129.41gene:FBgn0035001 transcript:FBtr0072363[more]
Slik6.884e-2129.41gene:FBgn0035001 transcript:FBtr0332925[more]
Pak3.561e-2030.48gene:FBgn0267698 transcript:FBtr0334539[more]
Pak3.561e-2030.48gene:FBgn0267698 transcript:FBtr0081714[more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k38.487e-2438.16mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k38.798e-2438.16mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k39.434e-2438.16mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k22.310e-2338.56mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k22.722e-2338.56mitogen-activated protein kinase kinase kinase 2 [... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
samd85.617e-2337.09sterile alpha motif domain containing 8 [Source:Xe... [more]
samd87.227e-2337.09sterile alpha motif domain containing 8 [Source:Xe... [more]
MAP3K29.531e-2337.66mitogen-activated protein kinase kinase kinase 2 [... [more]
MAP3K21.149e-2237.66mitogen-activated protein kinase kinase kinase 2 [... [more]
stk257.336e-2231.44serine/threonine kinase 25 [Source:NCBI gene;Acc:5... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Map3k36.405e-2439.19mitogen-activated protein kinase kinase kinase 3 [... [more]
Map3k25.154e-2236.60mitogen-activated protein kinase kinase kinase 2 [... [more]
Stk253.798e-2130.93serine/threonine kinase 25 (yeast) [Source:MGI Sym... [more]
Stk244.331e-2032.47serine/threonine kinase 24 [Source:MGI Symbol;Acc:... [more]
Stk259.650e-2034.67serine/threonine kinase 25 (yeast) [Source:MGI Sym... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O22040|ANP1_ARATH6.547e-2434.23Mitogen-activated protein kinase kinase kinase ANP... [more]
sp|Q61084|M3K3_MOUSE4.480e-2339.19Mitogen-activated protein kinase kinase kinase 3 O... [more]
sp|Q99759|M3K3_HUMAN6.127e-2339.60Mitogen-activated protein kinase kinase kinase 3 O... [more]
sp|Q9Y2U5|M3K2_HUMAN2.039e-2137.25Mitogen-activated protein kinase kinase kinase 2 O... [more]
sp|Q9FZ36|M3K2_ARATH9.211e-2131.25Mitogen-activated protein kinase kinase kinase 2 O... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0L8HR143.741e-2638.62Protein kinase domain-containing protein OS=Octopu... [more]
A0A2P6QMP91.375e-2535.12Putative mitogen-activated protein kinase kinase k... [more]
A0A1I8IS633.408e-2534.59Protein kinase domain-containing protein OS=Macros... [more]
A0A267FTA26.145e-2533.78Protein kinase domain-containing protein OS=Macros... [more]
A0A210PFZ51.097e-2439.61Mitogen-activated protein kinase kinase kinase 2 O... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k34.146e-2337.50mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k34.146e-2337.50mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k34.146e-2337.50mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k27.470e-2338.56mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k226.461e-2236.84mitogen-activated protein kinase kinase kinase 3-l... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k29.640e-2539.22mitogen-activated protein kinase kinase kinase 2 [... [more]
stk25a2.290e-2031.63serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-G... [more]
stk393.394e-1930.86serine threonine kinase 39 [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000008193.13.854e-1828.51pep scaffold:Pmarinus_7.0:GL476850:102262:127365:-... [more]
slka5.549e-1730.41STE20-like kinase a [Source:ZFIN;Acc:ZDB-GENE-0504... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
STE201.244e-1927.80Cdc42p-activated signal transducing kinase; involv... [more]
STE111.780e-1935.57Signal transducing MEK kinase; involved in pheromo... [more]
CDC151.372e-1730.46Protein kinase of the Mitotic Exit Network; locali... [more]
MKK21.926e-1628.99MAPKK involved in the protein kinase C signaling p... [more]
CLA42.031e-1635.06Cdc42p-activated signal transducing kinase; member... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO414104.358e-2533.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO279761.561e-2033.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478216.589e-2028.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO331291.602e-1926.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458463.895e-1933.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k32.017e-2337.75mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k22.879e-2337.91mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k222.811e-2236.18mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k223.069e-2236.18mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k223.069e-2236.18mitogen-activated protein kinase kinase kinase 3 [... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014613.10.000e+087.80SMESG000014613.1[more]
SMESG000014619.10.000e+073.81SMESG000014619.1[more]
SMESG000014940.17.640e-7734.40SMESG000014940.1[more]
SMESG000014940.15.584e-4939.39SMESG000014940.1[more]
SMESG000014940.17.643e-4939.39SMESG000014940.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005074 ID=SMED30005074|Name=Protein kinase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1706bp
CCTAGATTAAAAGTTCTTGTTTAAATAATATATTTTTTTGTAACTTCCTT
TTGAATAAAGTAATGGAAGTAATTACTTTAGAAAATGTTAACAACTCAAA
TGACATTGAAACATTTGAAATGTTGATATCTGATAATCTTATATATCTAA
AGAAAAAATTAGCAGACAGAATTTGTGAAAGAGTGCAAGACATTAAGTTA
TTTGATCAAAGAAATATAGCCGTTCCACCATTAAATAATAATGGTAGGAT
TCCTTGCAAAGAGTTATATTATTCAATTTATGAAGAAGAAAATGACGACA
TAATTCTCCACATTAAGCGCAATTATTGCGGCATTCCGAAGTTTTTCCAA
TTTCCGAAACTTACTACAATCGGCCAATTAATTTCGGAATTGAAAACATT
ATATAATATTCAAAAGAATTTCTATATATTGCAAGGAAATGGCTCGTTTG
CTGACAATAATGCGACATTGGAGCAATGCAAATTCGACAATTCAAAGGTC
AAAATATGGGTGGGTGAAAGTTTAATTGTCAACATTACCCTTCTGAATCC
ACTGAACACAGAGGATGAAAATGTCACTCAAGTTATTGGTAGATTTGATT
TCTCAGCTACGGAAACGGTTGCTAGTTTAAAGGAATTTATTCTAAATGAA
AATAAACAATTTCATAATTTACAACTGTTTACAGAAACATCATTTTTAGA
CGATAAGAAGCAATTAGCAAGCTATCCGCTTGACAGAGAGTGCAAAATTT
ATTGTGTAGATATGTCGAAGAGAACTGATATAATTATAAATACTGCTGAT
AAAACAAAAGAAAAATATTATGCAAGATATCCTGGTACAATAAATTCCTC
TGTAATTGAAAAGTGTGTTGCATATGCATATGATTGCAAGCTGACCGATA
TCAACAGCATGAAAATATTAAAATATGAAATCGTAACTCGCCTTAAGTTA
TCGTATAAATATCCGTTTGTTGAACTTTTGACTATGTATACGGAGCAGGA
CAATCTTTTCATAGTTACGGAGGATATGCCTGGAGGATCGCTGAGACAGC
AACTGAGTATTGCACCATTGGAAGCGTCGGTAATCATCAAGTATTGTCAG
CAAATACTTGAAGGGCTAAAGTTCATGCATGACGAAAAAATTATTCACAG
GAACATTAACTGCGGAAGTGTTCTTCTCGATGGAAAGGGAAATGTGAAAC
TCTCAAACTTTCACTTTTCTAAATTCCTTTATAATCTATCAACAGACATG
ATATTCATGGGCATTAAAGGCACCAGAATTGATGATGACGCCTGTTGTGT
TGCACCAGAAGTGCTGCTTGGTGAACCCTATGGATTTCAAGCTGACATAT
GGTCATTTGGAGCGACGCTTATTGAGATCGTTACTCGTGAACGGCCTTAT
CCAAAGTTAACTTATAAGAAAGCTATTTATATAATAAAAAATGAAAAAAA
AATTGATTATGAGCGAAATTGTTACGCCGGCACAAATTTTGATGAAATAA
TTGACAAGTGCATCAGTCCAATACAATCGAACAGACCAACCGTTTCATTC
TTGATTGATGATTATTTTAAGAATTCCAACTGACAAGATTGGTCTAAAAC
CTTTCTTTGATTGAAGCTTCTTTTTTTATTTCTATCCAACTACTACTGCA
TGATATTCTATTTTAGTGTAATTTTTGAATTTAATTTTCGGTTGTTGTAA
AAAAAA
back to top

protein sequence of SMED30005074-orf-1

>SMED30005074-orf-1 ID=SMED30005074-orf-1|Name=SMED30005074-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=507bp
MEVITLENVNNSNDIETFEMLISDNLIYLKKKLADRICERVQDIKLFDQR
NIAVPPLNNNGRIPCKELYYSIYEEENDDIILHIKRNYCGIPKFFQFPKL
TTIGQLISELKTLYNIQKNFYILQGNGSFADNNATLEQCKFDNSKVKIWV
GESLIVNITLLNPLNTEDENVTQVIGRFDFSATETVASLKEFILNENKQF
HNLQLFTETSFLDDKKQLASYPLDRECKIYCVDMSKRTDIIINTADKTKE
KYYARYPGTINSSVIEKCVAYAYDCKLTDINSMKILKYEIVTRLKLSYKY
PFVELLTMYTEQDNLFIVTEDMPGGSLRQQLSIAPLEASVIIKYCQQILE
GLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMG
IKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLT
YKKAIYIIKNEKKIDYERNCYAGTNFDEIIDKCISPIQSNRPTVSFLIDD
YFKNSN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0004702signal transducer, downstream of receptor, with serine/threonine kinase activity
GO:0005515protein binding
GO:0016301kinase activity
GO:0016740transferase activity
GO:0042803protein homodimerization activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0006915apoptotic process
GO:0007163establishment or maintenance of cell polarity
GO:0016310phosphorylation
GO:0023014signal transduction by protein phosphorylation
GO:0032874positive regulation of stress-activated MAPK cascade
GO:0036481intrinsic apoptotic signaling pathway in response to hydrogen peroxide
GO:0042542response to hydrogen peroxide
GO:0046777protein autophosphorylation
GO:0050772positive regulation of axonogenesis
GO:0051645Golgi localization
GO:0051683establishment of Golgi localization
GO:0090168Golgi reassembly
Vocabulary: cellular component
TermDefinition
GO:0000139Golgi membrane
GO:0005737cytoplasm
GO:0005794Golgi apparatus
GO:0070062extracellular exosome