Multiple epidermal growth factor domains protein 6

Overview
NameMultiple epidermal growth factor domains protein 6
Smed IDSMED30005066
Length (bp)4095
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Multiple epidermal growth factor domains protein 6 (SMED30005066) t-SNE clustered cells

Violin plots show distribution of expression levels for Multiple epidermal growth factor domains protein 6 (SMED30005066) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Multiple epidermal growth factor domains protein 6 (SMED30005066) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Multiple epidermal growth factor domains protein 6 (SMED30005066) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005066

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30005066SMESG000002074.1 dd_Smed_v4_5630_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005066SMESG000002074.1 dd_Smed_v4_5630_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005066SMESG000002074.1 dd_Smed_v4_5630_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30005066SMESG000002074.1 dd_Smed_v6_5630_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30005066SMESG000002074.1 dd_Smed_v4_5630_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30005066SMESG000002074.1 dd_Smed_v4_5630_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Human
Match: MEGF6 (multiple EGF like domains 6 [Source:HGNC Symbol;Acc:HGNC:3232])

HSP 1 Score: 731.865 bits (1888), Expect = 0.000e+0
Identity = 466/1309 (35.60%), Postives = 631/1309 (48.20%), Query Frame = 3
Query:  222 GMPNVCEVEQRQMIRVRRTVEVPRSKEVKVWKANCRFKGDWCLVHENKSFVEKTETSQIQMVPSIKYECCEGYAELSGYRGCIPKPNCEERIGKYCQNGAFCYQSGYNAKCICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGFYCKCPPGYEMSENGKNC-IDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTC-------------------------------------------QNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSC-QCRKDRLCDHVTGICYCADVAFG-KCE-ACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCI--YGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKE--SDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCE 3995
            GMP+VC  ++  ++  R+      S  V VWKA C ++  WC+ HE ++                   CC G+ +     GC+      E     C +G  C                                              C CPPG++    G  C  D++EC  +   C H CVN PG + C+C P   L  D   C+  I+ C   N GGC HHCV+L+  R  C C  G  L +D R C     C + NG C H CQ      +  C+C  GY +   D K C+D++EC      C H CLN +GSF C CH G+++G D + CY+++ME+ + C+  NGGC+  C+ + +   +C+C  G++L+ D  TC D D+C            C N+ G Y C C  GYRL  +   CED+DEC    GGC + C N  GS++C C  G  L +D + C                                           +    RG     +   C   +FG +C   C +C + G C     GC C   ++G IC   C  +     C    C C+NGGTC+S T  C CPPG+SG  CE GC +G++G++C K C  A +  RCH++ G CLC PG YG  CHL CP   +G GCS+ C C Q + + CD ++G C CK G+ G  C  +C+ GYFG  C  +C       C+  +G+C  +   G     C ++CP G  G +C  +C C      C    G C C PG TG+ CE  C +G +G  CQ  C  C+    CD  TG C C     G +C+  CP+G +GP+C   C C     C    G C C  G+ G  C + C  G +G  CS  C C   +G+CD ISG+C C  G+ G  CE  C +G++G  C+++C+C +G  CD     C C  GW G FCE +C  G++G +C   C C  G  CD ++G C C  G RG  C E CP+ TYG NC+Q C C NG  C P +G C C  G  G  C   CP   YG NC H+C+C+    CD  +G C CP+   GL+CE K C  ++  + CR    C     C+  TG+C C  G  G +C   C  G FG  C Q+C C  G  C+ V G C C  GFTG  C+Q C  G +G +C   C     N  CHP TG CSC AG     C+ +CP G YGP C+Q C C++G SC+ +TGAC+C +GF G  C   CP   +G NC H C C   + C+PVTG C+CP   +G  CE
Sbjct:   43 GMPHVCAEQELTLVGRRQPCVQALSHTVPVWKAGCGWQA-WCVGHERRTVYYMGYRQVYTTEARTVLRCCRGWMQQPDEEGCLSA----ECSASLCFHGGRCVPGSAQP---------------------------------------CHCPPGFQ----GPRCQYDVDECRTHNGGCQHRCVNTPGSYLCECKPGFRLHTDSRTCL-AINSCALGN-GGCQHHCVQLTITRHRCQCRPGFQLQEDGRHCVRRSPCANRNGSCMHRCQV--VRGLARCECHVGYQL-AADGKACEDVDECAAGLAQCAHGCLNTQGSFKCVCHAGYELGADGRQCYRIEMEIVNSCEANNGGCSHGCSHT-SAGPLCTCPRGYELDTDQRTCIDVDDCADSP---CCQQVCTNNPGGYECGCYAGYRLSADGCGCEDVDECASSRGGCEHHCTNLAGSFQCSCEAGYRLHEDRRGCSPLEEPMVDLDGELPFVRPLPHIAVLQDELPQLFQDDDVGADEEEAELRGEHTLTEKFVCLDDSFGHDCSLTCDDCRNGGTCLLGLDGCDCPEGWTGLICNETCPPDTFGKNCS-FSCSCQNGGTCDSVTGACRCPPGVSGTNCEDGCPKGYYGKHCRKKCNCA-NRGRCHRLYGACLCDPGLYGRFCHLTCPPWAFGPGCSEECQCVQPHTQSCDKRDGSCSCKAGFRGERCQAECELGYFGPGCWQACTCPVGVACDSVSGECGKRCPAGFQGEDCGQECPVGTFGVNCSSSCSC--GGAPCHGVTGQCRCPPGRTGEDCEADCPEGRWGLGCQEICPACQHAARCDPETGACLCLPGFVGSRCQDVCPAGWYGPSCQTRCSCANDGHCHPATGHCSCAPGWTGFSCQRACDTGHWGPDCSHPCNCSAGHGSCDAISGLCLCEAGYVGPRCEQQCPQGHFGPGCEQRCQCQHGAACDHVSGACTCPAGWRGTFCEHACPAGFFGLDCRSACNCTAGAACDAVNGSCLCPAGRRGPRCAETCPAHTYGHNCSQACACFNGASCDPVHGQCHCAPGWMGPSCLQACPAGLYGDNCRHSCLCQNGGTCDPVSGHCACPEGWAGLACE-KECLPRDVRAGCRHSGGCLNGGLCDPHTGRCLCPAGWTGDKCQSPCLRGWFGEACAQRCSCPPGAACHHVTGACRCPPGFTGSGCEQACPPGSFGEDCAQMCQCPGENPACHPATGTCSCAAGYHGPSCQQRCPPGRYGPGCEQLCGCLNGGSCDAATGACRCPTGFLGTDCNLTCPQGRFGPNCTHVCGCGQGAACDPVTGTCLCPPGRAGVRCE 1289          

HSP 2 Score: 553.132 bits (1424), Expect = 3.835e-171
Identity = 418/1274 (32.81%), Postives = 560/1274 (43.96%), Query Frame = 3
Query:  648 IDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINC----IPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCE-DIDECLDYTGGCGYKCVNT--------DGSYRCVCPNGETLGKDNKTCQ-NQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDC----LQNPSQVECQPLQ----------------------------------------CHCKNGGTCESETLKC--NCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK-CE-ACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAV-------------------------------------------GYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCL-NGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSK-ESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNP-------------------------------------------STGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVSVINRL 4016
            + G   C+C  GY+++ +GK C D++EC      C+H C+N  G F+C C     LG D   C    +  ++ C+ AN GGC+H C   S    +C+CP G+ LD D+R+C  VD C D+   C  +C ++P      C C  GY +  +    C+D++EC    GGC+H C N+ GSF C C  G+++  D + C  ++  + D       G   F    P+   +   LP    + D +   +E+  + G+H       C++D  S+   C +     +N  TC   +D C    G  G  C  T        + S+ C C NG T       C+      G++ +     CPKG +G+ C   C NC ++G C+     CLC P   G  C + C           ECQ +Q                                        C C  G  C+S + +C   CP G  GE C   C  G FG NC  +C  +C    CH +TG+C C PG  G  C   CP G WG+GC + C   Q+    CDP+ G C C  G+ G  C   C  G++G  C   C       C+  TG C      G     CQR C TG  G DC   C+CS    SC+  +G+C C  G+ G RCE +C +G +G  C+  CQC+    CDHV+G C C     G  CE ACP+G +G  C   C+CT    CD +NG C+C AG  GP+C++ CP   YG  CS+ C C  G +CDP+ G C C PGW G  C   C  G YGD C+  C C NGGTCD     C C  GW G  CEK C                                             G++G  C  RC C  G  C  ++G C C PG+ G  C++ CP  ++G +C Q+CQC      CHP  G C C AG HG  C+  CPP +YGP C   C C     CD  TG C CP    G  C +     +   +C   C C    +C+ VTG C C PG  G +C + C    FG+ C+  C C NG  C+  +G+C C  G+TG  C+  C  G YG  C L+C  C+ N TC P TG C C  G     C+  CP G++G  CQ  C C HGA C+P                                            TG C C  G  GA C   C    +G +C   C C   + C+PV+G C C     G  C      RL
Sbjct:  262 VRGLARCECHVGYQLAADGKACEDVDECAAGLAQCAHGCLNTQGSFKCVCHAGYELGADGRQCYRIEMEIVNSCE-ANNGGCSHGCSHTS-AGPLCTCPRGYELDTDQRTCIDVDDCADSPC-CQQVCTNNPGG--YECGCYAGYRLSADGCG-CEDVDECASSRGGCEHHCTNLAGSFQCSCEAGYRLHEDRRGCSPLEEPMVD-----LDGELPFVRPLPHIAVLQDELPQL-FQDDDVGADEEEAELRGEHTLTEKFVCLDD--SFGHDCSLTCDDCRNGGTCLLGLDGCDCPEGWTGLICNETCPPDTFGKNCSFSCSCQNGGTCDSVTGACRCPPGVSGTNCEDG---CPKGYYGKHCRKKC-NCANRGRCHRLYGACLCDPGLYGRFCHLTCPPWAFGPGCSEECQCVQPHTQSCDKRDGSCSCKAGFRGERCQAECELGYFGPGCWQACTCPVGVACDSVSGECGKRCPAGFQGEDCGQECPVGTFGVNCSSSC--SCGGAPCHGVTGQCRCPPGRTGEDCEADCPEGRWGLGCQEICPACQHAAR-CDPETGACLCLPGFVGSRCQDVCPAGWYGPSCQTRCSCANDGHCHPATGHC--SCAPGWTGFSCQRACDTGHWGPDCSHPCNCSAGHGSCDAISGLCLCEAGYVGPRCEQQCPQGHFGPGCEQRCQCQHGAACDHVSGACTCPAGWRGTFCEHACPAGFFGLDCRSACNCTAGAACDAVNGSCLCPAGRRGPRCAETCPAHTYGHNCSQACACFNGASCDPVHGQCHCAPGWMGPSCLQACPAGLYGDNCRHSCLCQNGGTCDPVSGHCACPEGWAGLACEKECLPRDVRAGCRHSGGCLNGGLCDPHTGRCLCPAGWTGDKCQSPCLRGWFGEACAQRCSCPPGAACHHVTGACRCPPGFTGSGCEQACPPGSFGEDCAQMCQCPGENPACHPATGTCSCAAGYHGPSCQQRCPPGRYGPGCEQLCGCLNGGSCDAATGACRCPTGFLGTDCNLTCPQGRFGPNCTHVCGCGQGAACDPVTGTCLCPPGRAGVRCERGCPQNRFGVGCEHTCSCRNGGLCHASNGSCSCGLGWTGRHCELACPPGRYGAACHLEC-SCHNNSTCEPATGTCRCGPGFYGQACEHPCPPGFHGAGCQGLCWCQHGAPCDPISGRCLCPAGFHGHFCERGCEPGSFGEGCHQRCDCDGGAPCDPVTGLCLCPPGRSGATCNLDCRRGQFGPSCTLHCDCGGGADCDPVSGQCHCVDGYMGPTCREGGPLRL 1511          

HSP 3 Score: 449.129 bits (1154), Expect = 3.273e-133
Identity = 372/1168 (31.85%), Postives = 494/1168 (42.29%), Query Frame = 3
Query:  654 GGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSH---------------LCQSDPSSS--VITCK-CRPGYAIDVN-DVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCY------KVDMELTDPCKYGNGGCTQFCNSSPNKR-----AICSCLPGFKLEADGLTCSD-------EDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTG-GCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTC-QGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK--CEACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN-CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQC-HNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEI--------------------------------------KNCDSK------ESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQ----FRCPNN 3884
            GG+ C C  GY +S +G  C D++EC  +R  C H C NL G F+C C     L  DR  C P   P    +            ++ F+   P   +L  +     +  L +D++ G                  +C  D       +TC  CR G    +  D   C +     I N  C         SF C C  G        +C         + E   P  Y    C + CN +   R       C C PG       LTC          +EC     +CV P T   D     C+C  G+R  + +  CE     L Y G GC   C          CP G      +  C  +   G   +   + CP GTFG  C  +CS       C+     C C P  +G  CE DC +    + CQ +   C++   C+ ET  C C PG  G  C+  C  G++G +C+  C  A +   CH  TG C C PGW G SC   C TG WG  CS  C+C+   +  CD  +G C C+ GY G  C  +C  G+FG  C   C       C+H +G C   TC  G     C+  CP G  G DCR  C+C+  + +C+  NG C C  G  G RC   C    YG  C  +C C     CD V G C+CA    G    +ACP+G +G  C  +C C     CD ++G C C  G+ G  C K C       GC     C+ G  CDP +G C C  GW G+ C++PC  G++G+ C ++C C  G  C      C+C PG+ G  CE++C  G +G +C   CQC      C   +G C C  G+ G +C +RCP   YGP C Q+C CLNGG C    G C+CP G  G  C LTCP  ++GPNC H C C     CD  TG C CP    G+ CE                                       ++C+         + C  +C C    +C   TG C+C PG  G  C   C  G  G  C+  C C +G PC+P+ G CLC +GF G  C++ C  G +G  C  +C  C+    C P TG C C  G     C   C  G +GP C   C C  GA C+P +G C C+ G+ G  C+     R P N
Sbjct:  391 GGYECGCYAGYRLSADGCGCEDVDECASSRGGCEHHCTNLAGSFQCSCEAGYRLHEDRRGCSPLEEPMVDLD-----------GELPFVRPLPHIAVLQDE-----LPQLFQDDDVGADEEEAELRGEHTLTEKFVCLDDSFGHDCSLTCDDCRNGGTCLLGLDGCDCPEGWTGLICNETCPPDTFGKNCSFSCSCQNGGTCDSVTGACRCPPGVSGTNCEDGCPKGYYGKHCRKKCNCANRGRCHRLYGACLCDPGLYGRFCHLTCPPWAFGPGCSEEC-----QCVQPHTQSCDKRDGSCSCKAGFRGERCQAECE-----LGYFGPGCWQACT---------CPVGVACDSVSGECGKRCPAGFQGEDCGQECPVGTFGVNCSSSCS--CGGAPCHGVTGQCRCPPGRTGEDCEADCPEGRWGLGCQEICPACQHAARCDPETGACLCLPGFVGSRCQDVCPAGWYGPSCQTRCSCA-NDGHCHPATGHCSCAPGWTGFSCQRACDTGHWGPDCSHPCNCSAG-HGSCDAISGLCLCEAGYVGPRCEQQCPQGHFGPGCEQRCQCQHGAACDHVSGAC---TCPAGWRGTFCEHACPAGFFGLDCRSACNCTAGA-ACDAVNGSCLCPAGRRGPRCAETCPAHTYGHNCSQACACFNGASCDPVHGQCHCAPGWMGPSCLQACPAGLYGDNCRHSCLCQNGGTCDPVSGHCACPEGWAGLACEKECLPRDVRAGCRHSGGCLNGGLCDPHTGRCLCPAGWTGDKCQSPCLRGWFGEACAQRCSCPPGAACHHVTGACRCPPGFTGSGCEQACPPGSFGEDCAQMCQCPGENPACHPATGTCSCAAGYHGPSCQQRCPPGRYGPGCEQLCGCLNGGSCDAATGACRCPTGFLGTDCNLTCPQGRFGPNCTHVCGCGQGAACDPVTGTCLCPPGRAGVRCERGCPQNRFGVGCEHTCSCRNGGLCHASNGSCSCGLGWTGRHCELACPPGRYGAACHLECSCHNNSTCEPATGTCRCGPGFYGQACEHPCPPGFHGAGCQGLCWCQHGAPCDPISGRCLCPAGFHGHFCERGCEPGSFGEGCHQRC-DCDGGAPCDPVTGLCLCPPGRSGATCNLDCRRGQFGPSCTLHCDCGGGADCDPVSGQCHCVDGYMGPTCREGGPLRLPEN 1514          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Human
Match: MEGF6 (multiple EGF like domains 6 [Source:HGNC Symbol;Acc:HGNC:3232])

HSP 1 Score: 644.425 bits (1661), Expect = 0.000e+0
Identity = 420/1171 (35.87%), Postives = 562/1171 (47.99%), Query Frame = 3
Query:  681 GYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTC-------------------------------------------QNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSC-QCRKDRLCDHVTGICYCADVAFG-KCE-ACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCI--YGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKE--SDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFR---------CPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVSVINRL 4016
            GY +S  G    D++EC  +   C H CVN PG + C+C P   L  D   C+  I+ C   N GGC HHCV+L+  R  C C  G  L +D R C     C + NG C H CQ      +  C+C  GY +   D K C+D++EC      C H CLN +GSF C CH G+++G D + CY+++ME+ + C+  NGGC+  C+ + +   +C+C  G++L+ D  TC D D+C            C N+ G Y C C  GYRL  +   CED+DEC    GGC + C N  GS++C C  G  L +D + C                                           +    RG     +   C   +FG +C   C +C + G C     GC C   ++G IC   C  +     C    C C+NGGTC+S T  C CPPG+SG  CE GC +G++G++C K C  A +  RCH++ G CLC PG YG  CHL CP   +G GCS+ C C Q + + CD ++G C CK G+ G  C  +C+ GYFG  C  +C       C+  +G+C  +   G     C ++CP G  G +C  +C C      C    G C C PG TG+ CE  C +G +G  CQ  C  C+    CD  TG C C     G +C+  CP+G +GP+C   C C     C    G C C  G+ G  C + C  G +G  CS  C C   +G+CD ISG+C C  G+ G  CE  C +G++G  C+++C+C +G  CD     C C  GW G FCE +C  G++G +C   C C  G  CD ++G C C  G RG  C E+C  +     C     CLNGG C P  G C CPAG  GD C+  C    +G  C   C C     C   TG C CP    G  CE + C        C Q C C    SC+  TG C+C  G  G  C   C  G FG +C   C C  G  C+PV GTCLC  G  G+ C++ C +  +G  C+  C  C     CH   G CSC  G     C+  CP G YG  C   C C + ++C P+TG C+C  GFYG  C+ R         C    +G +C   C C   + C+PV+G C C     G  C      RL
Sbjct:   45 GYPVSA-GDQRPDVDECRTHNGGCQHRCVNTPGSYLCECKPGFRLHTDSRTCL-AINSCALGN-GGCQHHCVQLTITRHRCQCRPGFQLQEDGRHCVRRSPCANRNGSCMHRCQV--VRGLARCECHVGYQL-AADGKACEDVDECAAGLAQCAHGCLNTQGSFKCVCHAGYELGADGRQCYRIEMEIVNSCEANNGGCSHGCSHT-SAGPLCTCPRGYELDTDQRTCIDVDDCADSP---CCQQVCTNNPGGYECGCYAGYRLSADGCGCEDVDECASSRGGCEHHCTNLAGSFQCSCEAGYRLHEDRRGCSPLEEPMVDLDGELPFVRPLPHIAVLQDELPQLFQDDDVGADEEEAELRGEHTLTEKFVCLDDSFGHDCSLTCDDCRNGGTCLLGLDGCDCPEGWTGLICNETCPPDTFGKNCS-FSCSCQNGGTCDSVTGACRCPPGVSGTNCEDGCPKGYYGKHCRKKCNCA-NRGRCHRLYGACLCDPGLYGRFCHLTCPPWAFGPGCSEECQCVQPHTQSCDKRDGSCSCKAGFRGERCQAECELGYFGPGCWQACTCPVGVACDSVSGECGKRCPAGFQGEDCGQECPVGTFGVNCSSSCSC--GGAPCHGVTGQCRCPPGRTGEDCEADCPEGRWGLGCQEICPACQHAARCDPETGACLCLPGFVGSRCQDVCPAGWYGPSCQTRCSCANDGHCHPATGHCSCAPGWTGFSCQRACDTGHWGPDCSHPCNCSAGHGSCDAISGLCLCEAGYVGPRCEQQCPQGHFGPGCEQRCQCQHGAACDHVSGACTCPAGWRGTFCEHACPAGFFGLDCRSACNCTAGAACDAVNGSCLCPAGRRGPRCAEKCLPRDVRAGCRHSGGCLNGGLCDPHTGRCLCPAGWTGDKCQSPCLRGWFGEACAQRCSCPPGAACHHVTGACRCPPGFTGSGCE-QGCPPGRYGPGCEQLCGCLNGGSCDAATGACRCPTGFLGTDCNLTCPQGRFGPNCTHVCGCGQGAACDPVTGTCLCPPGRAGVRCERGCPQNRFGVGCEHTC-SCRNGGLCHASNGSCSCGLGWTGRHCELACPPGRYGAACHLECSCHNNSTCEPATGTCRCGPGFYGQACEHRRSGATCNLDCRRGQFGPSCTLHCDCGGGADCDPVSGQCHCVDGYMGPTCREGGPLRL 1199          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Human
Match: MEGF6 (multiple EGF like domains 6 [Source:HGNC Symbol;Acc:HGNC:3232])

HSP 1 Score: 628.246 bits (1619), Expect = 0.000e+0
Identity = 405/1176 (34.44%), Postives = 560/1176 (47.62%), Query Frame = 3
Query:  222 GMPNVCEVEQRQMIRVRRTVEVPRSKEVKVWKANCRFKGDWCLVHENKSFVEKTETSQIQMVPSIKYECCEGYAELSGYRGCIPKPNCEERIGKYCQNGAFCYQSGYNAKCICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGFYCKCPP-GYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTC-------------------------------------------QNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSC-QCRKDRLCDHVTGICYCADVAFG-KCE-ACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCI--YGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKE--SDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGI 3596
            GMP+VC  ++  ++  R+      S  V VWKA C ++  WC+ HE ++                   CC G+ +     GC+                          +C    G     C   +                  GGFYC+ PP  +++  +G+ C D++EC  +   C H CVN PG + C+C P   L  D   C+  I+ C   N GGC HHCV+L+  R  C C  G  L +D R C     C + NG C H CQ      +  C+C  GY +   D K C+D++EC      C H CLN +GSF C CH G+++G D + CY+++ME+ + C+  NGGC+  C+ + +   +C+C  G++L+ D  TC D D+C            C N+ G Y C C  GYRL  +   CED+DEC    GGC + C N  GS++C C  G  L +D + C                                           +    RG     +   C   +FG +C   C +C + G C     GC C   ++G IC   C  +     C    C C+NGGTC+S T  C CPPG+SG  CE GC +G++G++C K C  A +  RCH++ G CLC PG YG  CHL CP   +G GCS+ C C Q + + CD ++G C CK G+ G  C  +C+ GYFG  C  +C       C+  +G+C  +   G     C ++CP G  G +C  +C C      C    G C C PG TG+ CE  C +G +G  CQ  C  C+    CD  TG C C     G +C+  CP+G +GP+C   C C     C    G C C  G+ G  C + C  G +G  CS  C C   +G+CD ISG+C C  G+ G  CE  C +G++G  C+++C+C +G  CD     C C  GW G FCE +C  G++G +C   C C  G  CD ++G C C  G RG  C E CP+ TYG NC+Q C C NG  C P +G C C  G  G  C   CP   YG NC H+C+C+    CD  +G C CP+   GL+CE K C  ++  + CR    C     C+  TG+C C  G  G +C   C  G FG  C+ +C C  G PC+   G CLC  G+ G 
Sbjct:   43 GMPHVCAEQELTLVGRRQPCVQALSHTVPVWKAGCGWQA-WCVGHERRTVYYMGYRQVYTTEARTVLRCCRGWMQQPDEEGCLSD----------------------VGECANANGGCAGRCRDTV------------------GGFYCRWPPPSHQLQGDGETCQDVDECRTHNGGCQHRCVNTPGSYLCECKPGFRLHTDSRTCL-AINSCALGN-GGCQHHCVQLTITRHRCQCRPGFQLQEDGRHCVRRSPCANRNGSCMHRCQV--VRGLARCECHVGYQL-AADGKACEDVDECAAGLAQCAHGCLNTQGSFKCVCHAGYELGADGRQCYRIEMEIVNSCEANNGGCSHGCSHT-SAGPLCTCPRGYELDTDQRTCIDVDDCADSP---CCQQVCTNNPGGYECGCYAGYRLSADGCGCEDVDECASSRGGCEHHCTNLAGSFQCSCEAGYRLHEDRRGCSPLEEPMVDLDGELPFVRPLPHIAVLQDELPQLFQDDDVGADEEEAELRGEHTLTEKFVCLDDSFGHDCSLTCDDCRNGGTCLLGLDGCDCPEGWTGLICNETCPPDTFGKNCS-FSCSCQNGGTCDSVTGACRCPPGVSGTNCEDGCPKGYYGKHCRKKCNCA-NRGRCHRLYGACLCDPGLYGRFCHLTCPPWAFGPGCSEECQCVQPHTQSCDKRDGSCSCKAGFRGERCQAECELGYFGPGCWQACTCPVGVACDSVSGECGKRCPAGFQGEDCGQECPVGTFGVNCSSSCSC--GGAPCHGVTGQCRCPPGRTGEDCEADCPEGRWGLGCQEICPACQHAARCDPETGACLCLPGFVGSRCQDVCPAGWYGPSCQTRCSCANDGHCHPATGHCSCAPGWTGFSCQRACDTGHWGPDCSHPCNCSAGHGSCDAISGLCLCEAGYVGPRCEQQCPQGHFGPGCEQRCQCQHGAACDHVSGACTCPAGWRGTFCEHACPAGFFGLDCRSACNCTAGAACDAVNGSCLCPAGRRGPRCAETCPAHTYGHNCSQACACFNGASCDPVHGQCHCAPGWMGPSCLQACPAGLYGDNCRHSCLCQNGGTCDPVSGHCACPEGWAGLACE-KECLPRDVRAGCRHSGGCLNGGLCDPHTGRCLCPAGWTGDKCQSPCAKGTFGPHCEGRCACRWGGPCHLATGACLCPPGWRGA 1163          

HSP 2 Score: 394.045 bits (1011), Expect = 6.214e-115
Identity = 322/1039 (30.99%), Postives = 455/1039 (43.79%), Query Frame = 3
Query: 1020 QSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHP-GWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTG----KHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQV--ECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKN--CPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCD------PKNGKCKCKKGYHGVNCLYKCDP---GYFGLD--CSFSCPEDCKTICNHETGQC----------PDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCAD-VAFGKCE-ACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCI---YGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKC--QCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVC-QCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKE--SDCRQDCQCSIKK-SCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVSVINR 4013
            Q   + +    +C  G+    ++     D+ EC   NGGC   C +  G F C   P   Q+  D ++C  VD      C+  NGGC   C ++P    +C C PGF+L  D  TC   + C  G    +H CV  +     +  + C C  G++L+++   C     C +  G C ++C    G  RC C  G  L  D K C++                     +EC    + C H          C+CH  Y        C +   ++   C+     C +G +  S    C CP G   +  +  C +    ++C  +  C   C++N            PG Y   C+        G GC     C  ++  GC+        + +C C+ GY        C P       LD    F  P     +   E  Q            +   +G +++  +  C     G DC  TCD   N  +C      C C  G+TG  C   C    +G+ C  SC C+    CD VTG C C   V+   CE  CP G +G  C + C+C     C ++ G C+C  G YG  C   CP   +G GCS+ECQC+     +CD   G C C  G+ GE C+  C+ GY+G  C + C C  G  CD    +C  +C  G+ GE C + C VG +G NC   C C  G  C G++G+C C PG  G +C+  CP   +G  C ++C  C +  +C PE G C C  G  G  C+  CP   YGP+C   C C     C   TG C+C     G SC+ + CD+     DC   C CS    SC+ ++G C C+ G  GP+C Q C  G+FG  C+Q+C+C +G  C+ V G C C +G+ G  C+  C  G++G +C+  C  C     C    G C C AG     C   CP+  YG  C QAC C +GASC+P  G C C  G+ G  C   CP   YG NC+H C C +   C+PV+GHC CP+  +G  CE   + R
Sbjct:   98 QVYTTEARTVLRCCRGWMQQPDEEGCLSDVGECANANGGCAGRCRDTVGGFYCRWPPPSHQLQGDGETCQDVDE-----CRTHNGGCQHRCVNTPGSY-LCECKPGFRLHTDSRTCLAINSCALGNGGCQHHCVQLT-----ITRHRCQCRPGFQLQEDGRHCVRRSPCANRNGSCMHRCQVVRGLARCECHVGYQLAADGKACEDV--------------------DECAAGLAQCAHGCLNTQGSFKCVCHAGYELGADGRQCYRIEMEIVNSCEANNGGCSHGCSHTSAGPLCTCPRGYELDTDQRTCIDV---DDCADSPCCQQVCTNN------------PGGYECGCYAGYRLSADGCGCEDVDEC-ASSRGGCEHHCTNLAGSFQCSCEAGYRLHEDRRGCSPLEEPMVDLDGELPFVRPLPHIAVLQDELPQLFQDDDVGADEEEAELRGEHTLTEKFVCLDDSFGHDCSLTCDDCRNGGTCLLGLDGCDCPEGWTGLICNETCPPDTFGKNCSFSCSCQNGGTCDSVTGACRCPPGVSGTNCEDGCPKGYYGKHCRKKCNCANRGRCHRLYGACLCDPGLYGRFCHLTCPPWAFGPGCSEECQCVQPHTQSCDKRDGSCSCKAGFRGERCQAECELGYFGPGCWQACTCPVGVACDSVSGECGKRCPAGFQGEDCGQECPVGTFGVNCSSSCSC-GGAPCHGVTGQCRCPPGRTGEDCEADCPEGRWGLGCQEICPACQHAARCDPETGACLCLPGFVGSRCQDVCPAGWYGPSCQTRCSCANDGHCHPATGHCSCAPGWTGFSCQ-RACDTGHWGPDCSHPCNCSAGHGSCDAISGLCLCEAGYVGPRCEQQCPQGHFGPGCEQRCQCQHGAACDHVSGACTCPAGWRGTFCEHACPAGFFGLDCRSAC-NCTAGAACDAVNGSCLCPAGRRGPRCAETCPAHTYGHNCSQACACFNGASCDPVHGQCHCAPGWMGPSCLQACPAGLYGDNCRHSCLCQNGGTCDPVSGHCACPEGWAGLACEKECLPR 1086          

HSP 3 Score: 358.607 bits (919), Expect = 1.152e-102
Identity = 248/671 (36.96%), Postives = 322/671 (47.99%), Query Frame = 3
Query: 1998 HQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRK--DRLCDHVTGICYC-ADVAFGKCEA-CPSGKWGPTCNQNCDCTYSTGCDQINGQC--ICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKC-KCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNG-GKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIK-NCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSG 3983
            H +T K +C    +G  C L C     G  C           +GCD       C +G+ G+ C   C P  FG +CSFSC       C+  TG C  +   G +   C+  CP G  G  CRK C+C+ N   C    G C C PG  G+ C L C    +G  C   CQC +   + CD   G C C A     +C+A C  G +GP C Q C C     CD ++G+C   C AG+ G  C + CP G +G  CS  C C    C  ++G CRC PG  GE CE  C EG +G  C+E C  C +   CD     C C PG+ G  C+  C  G+YG +C+ RC C N G C   +G C C PGW G +C   C +  +GP+C+  C C  G G C   +G+C C AG  G  CE  CP   +GP C   C C+    CD  +G CTCP    G  CE          DCR  C C+   +C+ V G C C  G RGP+C + C    +G +C Q C C NG  C+PV G C C  G+ G  C Q C  G YG NC+  CL C    TC P +G C+C  G     C+ +C        C+ +  C++G  C+P TG C C +G+ G  CQ  C    +G +C+ RC C    PC+  TG C+CP    G
Sbjct:  510 HTLTEKFVCLDDSFGHDCSLTCDDCRNGGTCLL-------GLDGCD-------CPEGWTGLICNETCPPDTFGKNCSFSCSCQNGGTCDSVTGAC--RCPPGVSGTNCEDGCPKGYYGKHCRKKCNCA-NRGRCHRLYGACLCDPGLYGRFCHLTCPPWAFGPGCSEECQCVQPHTQSCDKRDGSCSCKAGFRGERCQAECELGYFGPGCWQACTCPVGVACDSVSGECGKRCPAGFQGEDCGQECPVGTFGVNCSSSCSCGGAPCHGVTGQCRCPPGRTGEDCEADCPEGRWGLGCQEICPACQHAARCDPETGACLCLPGFVGSRCQDVCPAGWYGPSCQTRCSCANDGHCHPATGHCSCAPGWTGFSCQRACDTGHWGPDCSHPCNCSAGHGSCDAISGLCLCEAGYVGPRCEQQCPQGHFGPGCEQRCQCQHGAACDHVSGACTCPAGWRGTFCEHACPAGFFGLDCRSACNCTAGAACDAVNGSCLCPAGRRGPRCAETCPAHTYGHNCSQACACFNGASCDPVHGQCHCAPGWMGPSCLQACPAGLYGDNCRHSCL-CQNGGTCDPVSGHCACPEGWAGLACEKECLPRDVRAGCRHSGGCLNGGLCDPHTGRCLCPAGWTGDKCQSPCAKGTFGPHCEGRCACRWGGPCHLATGACLCPPGWRG 1162          

HSP 4 Score: 332.798 bits (852), Expect = 9.371e-94
Identity = 225/626 (35.94%), Postives = 302/626 (48.24%), Query Frame = 3
Query: 2163 KGYHGVNCLYKCDPGYFGLDCSFSCPEDCKT----ICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCT--YSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGIC--RCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRC-QCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATE-KCDLKTGECTCPKSAFGLSCEIKNCDSKE--SDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCE 3995
            +G H +   + C    FG DCS +C +DC+     +   +   CP    +G   + C   CP    G +C  +C C +N  +C+   G C C PG +G  CE  C KG YG+ C+  C C     C  + G C C    +G+     CP   +GP C++ C C   ++  CD+ +G C C AG+ G +C   C  G +G GC + C C  G  CD +SG C  RC  G+ GE C   C  G +G  C   C C  G  C     +C+C PG  GE CE  C  G +G  C+  C  C +   CD  +G C C+PG+ G  C + CP+  YGP+C   C C N G CHP  G C C  G  G  C+  C    +GP+C H C C A    CD  +G C C     G  CE + C        C Q CQC    +C+ V+G C C  G RG  C   C  G FGLDC+  C C  G  C+ V+G+CLC +G  G  C + C    YG NC   C  C    +C P  GQC C  G +   C   CP+G YG  C+ +C C +G +C+P +G C C  G+ G  C+  C      A C+H   C +   C+P TG C+CP   +G  C+
Sbjct:  507 RGEHTLTEKFVCLDDSFGHDCSLTC-DDCRNGGTCLLGLDGCDCP----EGWTGLICNETCPPDTFGKNCSFSCSC-QNGGTCDSVTGACRCPPGVSGTNCEDGCPKGYYGKHCRKKCNCANRGRCHRLYGACLCDPGLYGRFCHLTCPPWAFGPGCSEECQCVQPHTQSCDKRDGSCSCKAGFRGERCQAECELGYFGPGCWQACTCPVGVACDSVSGECGKRCPAGFQGEDCGQECPVGTFGVNCSSSCSC-GGAPCHGVTGQCRCPPGRTGEDCEADCPEGRWGLGCQEICPACQHAARCDPETGACLCLPGFVGSRCQDVCPAGWYGPSCQTRCSCANDGHCHPATGHCSCAPGWTGFSCQRACDTGHWGPDCSHPCNCSAGHGSCDAISGLCLCEAGYVGPRCE-QQCPQGHFGPGCEQRCQCQHGAACDHVSGACTCPAGWRGTFCEHACPAGFFGLDCRSACNCTAGAACDAVNGSCLCPAGRRGPRCAETCPAHTYGHNCSQAC-ACFNGASCDPVHGQCHCAPGWMGPSCLQACPAGLYGDNCRHSCLCQNGGTCDPVSGHCACPEGWAGLACEKECLPRDVRAGCRHSGGCLNGGLCDPHTGRCLCPAGWTGDKCQ 1123          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Human
Match: MEGF11 (multiple EGF like domains 11 [Source:HGNC Symbol;Acc:HGNC:29635])

HSP 1 Score: 440.654 bits (1132), Expect = 2.272e-136
Identity = 272/670 (40.60%), Postives = 341/670 (50.90%), Query Frame = 3
Query: 2013 KCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFG-KC-EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKR-CPEGLYGEGCSKECQCIYGN---CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKES-DCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCR--CANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCE 3995
             C C PGW G  C   C +  WG  CS  C C   N   C+P  G C C  G+ G  C   C PG  G  C   C       C+   G+C      G   + C+  CP G  G+ C   C C +N  +C    G C C PG+TG  C   C  G +G+ C   C C     CDHVTG C+C     G +C E CP G +G  C+Q+CDC     C    G C C  GY GP+C +R CPEGL+G GC+  C C   N   C P++G C C PGW G  C   C  GYYGD C+  C C NG  C      C C PG+ GE C  SCA G YG NC   C C+NGG C  + G C C  GW+G++C   CPS T+G NCN+ C C NG  C P +G C C  G  GD CEL CP   +G NC  +C C   + CD  TG C C     G+ C+      +   +C   C C    SC+   G C+C PG RGP C ++C  G +G  C Q C     +  PC+ + G C CL GF+G LC+QVCA G++G +C   C  C  N TC P  G C C  G I  DC   CP G++GP C  AC C +GASC+   GAC C  G+ G  C  RCP  F+G +C   C+C + + C+ ++G C C    +G+ CE
Sbjct:   42 TCHCEPGWGGPDCSSGCDSDHWGPHCSNRCQCQ--NGALCNPITGACVCAAGFRGWRCEELCAPGTHGKGCQLPCQCRHGASCDPRAGEC--LCAPGYTGVYCEELCPPGSHGAHCELRCPC-QNGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPCHHGGQCDHVTGQCHCTAGYMGDRCQEECPFGSFGFQCSQHCDCHNGGQCSPTTGACECEPGYKGPRCQERLCPEGLHGPGCTLPCPCDADNTISCHPVTGACTCQPGWSGHHCNESCPVGYYGDGCQLPCTCQNGADCHSITGGCTCAPGFMGEVCAVSCAAGTYGPNCSSICSCNNGGTCSPVDGSCTCKEGWQGLDCTLPCPSGTWGLNCNESCTCANGAACSPIDGSCSCTPGWLGDTCELPCPDGTFGLNCSEHCDCSHADGCDPVTGHCCCLAGWTGIRCDSTCPPGRWGPNCSVSCSCENGGSCSPEDGSCECAPGFRGPLCQRICPPGFYGHGCAQPCPLCVHSSRPCHHISGICECLPGFSGALCNQVCAGGYFGQDCAQLC-SCANNGTCSPIDGSCQCFPGWIGKDCSQACPPGFWGPACFHACSCHNGASCSAEDGACHCTPGWTGLFCTQRCPAAFFGKDCGRVCQCQNGASCDHISGKCTCRTGFTGQHCE 705          

HSP 2 Score: 395.586 bits (1015), Expect = 8.078e-120
Identity = 280/754 (37.14%), Postives = 359/754 (47.61%), Query Frame = 3
Query: 1392 KHKCVPPSTCINDLGSYLCT--CPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQ-NQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYK-CDPGYFGLDCSFSCP--EDCKTICNHETGQCPDKTCQ-GNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK--CEACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN-CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQ--CHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSK--ESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQV 3611
             H     ST  +  G+ LCT  C  G  +  +   CE      D + GC         S RC C NG         C      RG   ++    C  GT G+ C   C  C H   C+     CLC P Y+G  CE  C        C+ L+C C+NGGTC   T +C CPPG +G +C   C  G FG+NC ++CP      +C  +TG+C C  G+ G  C   CP G++G  CS+ C C+  N   C P  G C+C+ GY G  C  + C  G  G  C+  CP   D    C+  TG C   TCQ G +   C   CP G  G  C+  C C +N   C    G C CAPGF G+ C + C  G YG  C S C C     C  V G C C +   G      CPSG WG  CN++C C     C  I+G C C  G+ G  C   CP+G +G  CS+ C C + + CDP++G C C  GW G  C++ C  G +G  C   C C NGG+C      C+C PG+ G  C++ C  G+YG  C   C    H+   C  ISG C+C+PG+ G  C++ C    +G +C Q+C C N G C P +G CQC  G  G  C   CPP  +GP C H C C     C  + G C C     GL C  + C +     DC + CQC    SC+ ++GKC C+ G  G  C Q C  G FG  C+Q C C N   C+ V GTC C  GF GI CDQ 
Sbjct:   10 THDAQTSSTGSSAPGTALCTEECVHGRCVSPDTCHCEPGWGGPDCSSGCDSDHWGPHCSNRCQCQNGALCNPITGACVCAAGFRGWRCEE---LCAPGTHGKGCQLPC-QCRHGASCDPRAGECLCAPGYTGVYCEELCPPGSHGAHCE-LRCPCQNGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPCH-HGGQCDHVTGQCHCTAGYMGDRCQEECPFGSFGFQCSQHCDCH--NGGQCSPTTGACECEPGYKGPRCQERLCPEGLHGPGCTLPCPCDADNTISCHPVTGAC---TCQPGWSGHHCNESCPVGYYGDGCQLPCTC-QNGADCHSITGGCTCAPGFMGEVCAVSCAAGTYGPNCSSICSCNNGGTCSPVDGSCTCKEGWQGLDCTLPCPSGTWGLNCNESCTCANGAACSPIDGSCSCTPGWLGDTCELPCPDGTFGLNCSEHCDCSHADGCDPVTGHCCCLAGWTGIRCDSTCPPGRWGPNCSVSCSCENGGSCSPEDGSCECAPGFRGPLCQRICPPGFYGHGCAQPCPLCVHSSRPCHHISGICECLPGFSGALCNQVCAGGYFGQDCAQLCSCANNGTCSPIDGSCQCFPGWIGKDCSQACPPGFWGPACFHACSCHNGASCSAEDGACHCTPGWTGLFC-TQRCPAAFFGKDCGRVCQCQNGASCDHISGKCTCRTGFTGQHCEQRCAPGTFGYGCQQLCECMNNSTCDHVTGTCYCSPGFKGIRCDQA 750          

HSP 3 Score: 389.037 bits (998), Expect = 2.183e-117
Identity = 276/750 (36.80%), Postives = 345/750 (46.00%), Query Frame = 3
Query: 1641 SLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRC-ELKCTKGLYGERCQSSCQCRKDRL--CDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNC-IC-KATEKCDLKTGECTCPKSAFGLSC-EIKNCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALC 3863
            S+  D +    G+           C+H G C    T C C P + G  C   C  +     C   +C C+NG  C   T  C C  G  G  CE  C  G  G+ C+  C        C    G+CLC PG+ G  C  LCP G+ G  C   C C   N   C    G+C C  G+ G  C   C PG FG +CS  CP      C+H TGQC      G     CQ +CP G  G  C + CDC  N   C    G C C PG+ G RC E  C +GL+G  C   C C  D    C  VTG C C     G    E+CP G +G  C   C C     C  I G C C  G+ G  C+  C  G YG  CS  C C  G  C P+ G C C  GW G  C  PC  G +G  C E C C NG  C      C C PGW G+ CE  C  G +G NC   C C +   CD ++G C C+ GW GI CD  CP   +GPNC+  C C NGG C PE+G C+C  G  G +C+  CPP  YG  C   C +C  ++  C   +G C C     G  C ++        DC Q C C+   +C+ + G CQC PG  G  C Q C  G +G  C   C C NG  C+  DG C C  G+TG+ C Q C   ++G +C   C  C    +C   +G+C+C  G     C+ +C  G +G  CQQ C+CM+ ++C+  TG C C  GF G  C
Sbjct:    8 SITHDAQTSSTGSSAPGTALCTEECVH-GRCVSPDT-CHCEPGWGGPDCSSGCDSDHWGPHCS-NRCQCQNGALCNPITGACVCAAGFRGWRCEELCAPGTHGKGCQLPCQCR-HGASCDPRAGECLCAPGYTGVYCEELCPPGSHGAHCELRCPCQ--NGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPCHHGGQCDHVTGQC--HCTAGYMGDRCQEECPFGSFGFQCSQHCDC-HNGGQCSPTTGACECEPGYKGPRCQERLCPEGLHGPGCTLPCPCDADNTISCHPVTGACTCQPGWSGHHCNESCPVGYYGDGCQLPCTCQNGADCHSITGGCTCAPGFMGEVCAVSCAAGTYGPNCSSICSCNNGGTCSPVDGSCTCKEGWQGLDCTLPCPSGTWGLNCNESCTCANGAACSPIDGSCSCTPGWLGDTCELPCPDGTFGLNCSEHCDCSHADGCDPVTGHCCCLAGWTGIRCDSTCPPGRWGPNCSVSCSCENGGSCSPEDGSCECAPGFRGPLCQRICPPGFYGHGCAQPCPLCVHSSRPCHHISGICECLPGFSGALCNQVCAGGYFGQDCAQLCSCANNGTCSPIDGSCQCFPGWIGKDCSQACPPGFWGPACFHACSCHNGASCSAEDGACHCTPGWTGLFCTQRCPAAFFGKDCGRVCQ-CQNGASCDHISGKCTCRTGFTGQHCEQRCAPGTFGYGCQQLCECMNNSTCDHVTGTCYCSPGFKGIRC 747          

HSP 4 Score: 358.221 bits (918), Expect = 3.617e-106
Identity = 263/736 (35.73%), Postives = 334/736 (45.38%), Query Frame = 3
Query: 1605 NKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSN------------CMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQ-----GNNSIGCQ-RDCPTGGSGSDCRKTCDC-SENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK--CEACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN-CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQ-CLNGGK-CHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSK--ESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDC 3734
               C  +   G  +  D   C  G  G +C   C +            C +   CN     C+C   + G  CE  C        CQ L C C++G +C+    +C C PG +G  CE  C  G  G +CE  CP   +   CH ITG+C C PGW G+ C   CP GT+G  CS+ C C+      CD   G+C C  GY G  C  +C  G FG  CS  C  DC     H  GQC   T       G     CQ R CP G  G  C   C C ++N++SC    G C C PG++G  C   C  G YG+ CQ  C C+    C  +TG C CA    G+    +C +G +GP C+  C C     C  ++G C C  G+ G  C+  CP G +G  C++ C C  G  C PI G C C PGW G+ CE PC +G +G  C E C C +   CD     C C  GW G  C+ +C  G +G NC   C C NGG C    G C+C PG+RG  C   CP   YG  C Q C  C++  + CH  +G+C+C  G  G +C   C    +G +C   C C     C    G C C     G  C  + C        C   C C    SC+   G C C PG  G  C Q C    FG DC + C+C NG  C+ + G C C +GFTG  C+Q CA G +G  C+  C  C  N TC   TG C C  G     C
Sbjct:   25 TALCTEECVHGRCVSPDTCHCEPGWGGPDCSSGCDSDHWGPHCSNRCQCQNGALCNPITGACVCAAGFRGWRCEELCAPGTHGKGCQ-LPCQCRHGASCDPRAGECLCAPGYTGVYCEELCPPGSHGAHCELRCPCQ-NGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPCHHGGQ--CDHVTGQCHCTAGYMGDRCQEECPFGSFGFQCSQHC--DC-----HNGGQCSPTTGACECEPGYKGPRCQERLCPEGLHGPGCTLPCPCDADNTISCHPVTGACTCQPGWSGHHCNESCPVGYYGDGCQLPCTCQNGADCHSITGGCTCAPGFMGEVCAVSCAAGTYGPNCSSICSCNNGGTCSPVDGSCTCKEGWQGLDCTLPCPSGTWGLNCNESCTCANGAACSPIDGSCSCTPGWLGDTCELPCPDGTFGLNCSEHCDCSHADGCDPVTGHCCCLAGWTGIRCDSTCPPGRWGPNCSVSCSCENGGSCSPEDGSCECAPGFRGPLCQRICPPGFYGHGCAQPCPLCVHSSRPCHHISGICECLPGFSGALCNQVCAGGYFGQDCAQLCSCANNGTCSPIDGSCQCFPGWIGKDCS-QACPPGFWGPACFHACSCHNGASCSAEDGACHCTPGWTGLFCTQRCPAAFFGKDCGRVCQCQNGASCDHISGKCTCRTGFTGQHCEQRCAPGTFGYGCQQLC-ECMNNSTCDHVTGTCYCSPGFKGIRC 747          

HSP 5 Score: 263.848 bits (673), Expect = 3.100e-73
Identity = 158/418 (37.80%), Postives = 216/418 (51.67%), Query Frame = 3
Query: 2757 QCIYGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIK-NCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQ-MCEFGNFGLDCKQKCRCA--NGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEV 3998
            +C++G C      C C PGW G  C + CD  ++G  C  +C+C NG  C+     C C  G+ G  CE+ CA G +G+ C+  CQC +G  CD  +G+C C PG+ G+ C+E CP  ++G +C   C C NGG CH   G C CP G  G VC   CPP  +G NC  +C C    +CD  TG+C C     G  C+ +    S    C Q C C     C+  TG C+C+PG +GP+C + +C  G  G  C   C C   N   C+PV G C C  G++G  C++ C  G+YG  C+L C  C     CH  TG C+C  G +   C   C +G YGP C   C C +G +C+P  G+C C  G+ G  C   CP+  +G NC   C C + + C+P+ G C C     G  CE+
Sbjct:   31 ECVHGRCVSPD-TCHCEPGWGGPDCSSGCDSDHWGPHCSNRCQCQNGALCNPITGACVCAAGFRGWRCEELCAPGTHGKGCQLPCQCRHGASCDPRAGECLCAPGYTGVYCEELCPPGSHGAHCELRCPCQNGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPCHHGGQCDHVTGQCHCTAGYMGDRCQEECPFGSFGFQCSQHCDCHNGGQCSPTTGACECEPGYKGPRCQERLCPEGLHGPGCTLPCPCDADNTISCHPVTGACTCQPGWSGHHCNESCPVGYYGDGCQLPC-TCQNGADCHSITGGCTCAPGFMGEVCAVSCAAGTYGPNCSSICSCNNGGTCSPVDGSCTCKEGWQGLDCTLPCPSGTWGLNCNESCTCANGAACSPIDGSCSCTPGWLGDTCEL 446          

HSP 6 Score: 190.274 bits (482), Expect = 5.561e-49
Identity = 124/321 (38.63%), Postives = 158/321 (49.22%), Query Frame = 3
Query: 3051 KCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCE-IKNCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQ-CPSGYYGPLCQQACQCM--HGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVS 4001
             C C PGW G +C   C S  +GP+C+  CQC NG  C+P  G C C AG  G  CE  C P  +G  C   C C+    CD + GEC C     G+ CE +    S  + C   C C    +C+ +TG+C C PG  G  C Q C  G FG +C Q C C +G  C+ V G C C +G+ G  C + C  G +G  C   C  C+    C P TG C CE G     C+ + CP G +GP C   C C   +  SC+P TGAC C  G+ G  C   CP  +YG  CQ  C C + + C+ +TG C C     G  C VS
Sbjct:   42 TCHCEPGWGGPDCSSGCDSDHWGPHCSNRCQCQNGALCNPITGACVCAAGFRGWRCEELCAPGTHGKGCQLPCQCRHGASCDPRAGECLCAPGYTGVYCEELCPPGSHGAHCELRCPCQNGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPCHHGGQCDHVTGQCHCTAGYMGDRCQEECPFGSFGFQCSQHC-DCHNGGQCSPTTGACECEPGYKGPRCQERLCPEGLHGPGCTLPCPCDADNTISCHPVTGACTCQPGWSGHHCNESCPVGYYGDGCQLPCTCQNGADCHSITGGCTCAPGFMGEVCAVS 361          

HSP 7 Score: 181.03 bits (458), Expect = 5.826e-46
Identity = 201/707 (28.43%), Postives = 289/707 (40.88%), Query Frame = 3
Query:  507 CQNGAFCYQSGYNAKCICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDL-------CKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFI--------CDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQ--FCNSSPNKRAI---CSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLR--KNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNR-CHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCA 2558
            C++GA C       +C+C  G+ G +C++                          CPPG     +G +C     C    T     C ++ G   C CPP          C P     + +    C HH  +   +   C C  G++ D+ +  C            C  +NGG     Q  P++    C+C PGY       + C +     +   GC   C     + I        C C PGW   H ++SC         P  Y   GC     C +  +  +I   C+C PGF  E   ++C+      T    C           S +C+C  G          TC++  + LD T  C       + +  C C NG      + +C    T G         CP GTFG  C  +C +C H   C+     C C   ++G  C+  C        C  + C C+NGG+C  E   C C PG  G +C+  C  GF+G  C + CP    S+R CH I+G C C PG+ G+ C+ +C  G +G  C++ CSC  N    C P +G C+C  G+ G +C   C PG++G  C  +C       C+ E G C      G   + C + CP    G DC + C C +N  SC+  +G C C  GFTG+ CE +C  G +G  CQ  C+C  +  CDHVTG CYC+
Sbjct:  116 CRHGASCDPRA--GECLCAPGYTGVYCEE-------------------------LCPPG----SHGAHCELRCPCQNGGT-----CHHITG--ECACPPGWTGAVCAQPCPPGTFGQNCSQDCPC-HHGGQCDHVTGQCHCTAGYMGDRCQEECPFGSFGFQCSQHCDCHNGG-----QCSPTTGA--CECEPGYKGPRCQERLCPE----GLHGPGCTLPCPCDADNTISCHPVTGACTCQPGWSGHHCNESC---------PVGYYGDGCQLPCTCQNGADCHSITGGCTCAPGFMGEVCAVSCAAG----TYGPNC-----------SSICSCNNGGTCSPVDGSCTCKEGWQGLDCTLPCPSGTWGLNCNESCTCANGAACSPIDGSC--SCTPGWLGDTCELPCPDGTFGLNCSEHC-DCSHADGCDPVTGHCCCLAGWTGIRCDSTCPPGRWGPNCS-VSCSCENGGSCSPEDGSCECAPGFRGPLCQRICPPGFYGHGCAQPCPLCVHSSRPCHHISGICECLPGFSGALCNQVCAGGYFGQDCAQLCSCANNGT--CSPIDGSCQCFPGWIGKDCSQACPPGFWGPACFHACSCHNGASCSAEDGAC--HCTPGWTGLFCTQRCPAAFFGKDCGRVCQC-QNGASCDHISGKCTCRTGFTGQHCEQRCAPGTFGYGCQQLCECMNNSTCDHVTGTCYCS 739          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Human
Match: MEGF11 (multiple EGF like domains 11 [Source:HGNC Symbol;Acc:HGNC:29635])

HSP 1 Score: 440.654 bits (1132), Expect = 1.255e-135
Identity = 280/700 (40.00%), Postives = 352/700 (50.29%), Query Frame = 3
Query: 1929 CTEGFF--GENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFG-KC-EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKR-CPEGLYGEGCSKECQCIYGN---CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKES-DCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCR--CANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCE 3995
            C  G++  G+ C   C   C   RC      C C PGW G  C   C +  WG  CS  C C   N   C+P  G C C  G+ G  C   C PG  G  C   C       C+   G+C      G   + C+  CP G  G+ C   C C +N  +C    G C C PG+TG  C   C  G +G+ C   C C     CDHVTG C+C     G +C E CP G +G  C+Q+CDC     C    G C C  GY GP+C +R CPEGL+G GC+  C C   N   C P++G C C PGW G  C   C  GYYGD C+  C C NG  C      C C PG+ GE C  SCA G YG NC   C C+NGG C  + G C C  GW+G++C   CPS T+G NCN+ C C NG  C P +G C C  G  GD CEL CP   +G NC  +C C   + CD  TG C C     G+ C+      +   +C   C C    SC+   G C+C PG RGP C ++C  G +G  C Q C     +  PC+ + G C CL GF+G LC+QVCA G++G +C   C  C  N TC P  G C C  G I  DC   CP G++GP C  AC C +GASC+   GAC C  G+ G  C  RCP  F+G +C   C+C + + C+ ++G C C    +G+ CE
Sbjct:   88 CCPGYYESGDFCIPLCTEECVHGRCVSPD-TCHCEPGWGGPDCSSGCDSDHWGPHCSNRCQCQ--NGALCNPITGACVCAAGFRGWRCEELCAPGTHGKGCQLPCQCRHGASCDPRAGEC--LCAPGYTGVYCEELCPPGSHGAHCELRCPC-QNGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPCHHGGQCDHVTGQCHCTAGYMGDRCQEECPFGSFGFQCSQHCDCHNGGQCSPTTGACECEPGYKGPRCQERLCPEGLHGPGCTLPCPCDADNTISCHPVTGACTCQPGWSGHHCNESCPVGYYGDGCQLPCTCQNGADCHSITGGCTCAPGFMGEVCAVSCAAGTYGPNCSSICSCNNGGTCSPVDGSCTCKEGWQGLDCTLPCPSGTWGLNCNESCTCANGAACSPIDGSCSCTPGWLGDTCELPCPDGTFGLNCSEHCDCSHADGCDPVTGHCCCLAGWTGIRCDSTCPPGRWGPNCSVSCSCENGGSCSPEDGSCECAPGFRGPLCQRICPPGFYGHGCAQPCPLCVHSSRPCHHISGICECLPGFSGALCNQVCAGGYFGQDCAQLC-SCANNGTCSPIDGSCQCFPGWIGKDCSQACPPGFWGPACFHACSCHNGASCSAEDGACHCTPGWTGLFCTQRCPAAFFGKDCGRVCQCQNGASCDHISGKCTCRTGFTGQHCE 780          

HSP 2 Score: 392.889 bits (1008), Expect = 5.529e-118
Identity = 285/780 (36.54%), Postives = 363/780 (46.54%), Query Frame = 3
Query: 1308 RAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQ-NQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYK-CDPGYFGLDCSFSCP--EDCKTICNHETGQCPDKTCQ-GNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK--CEACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN-CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQ--CHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSK--ESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQV 3611
            R    C PG+    D       +ECV G+  CV P TC                       CE      D + GC         S RC C NG         C      RG   ++    C  GT G+ C   C  C H   C+     CLC P Y+G  CE  C        C+ L+C C+NGGTC   T +C CPPG +G +C   C  G FG+NC ++CP      +C  +TG+C C  G+ G  C   CP G++G  CS+ C C+  N   C P  G C+C+ GY G  C  + C  G  G  C+  CP   D    C+  TG C   TCQ G +   C   CP G  G  C+  C C +N   C    G C CAPGF G+ C + C  G YG  C S C C     C  V G C C +   G      CPSG WG  CN++C C     C  I+G C C  G+ G  C   CP+G +G  CS+ C C + + CDP++G C C  GW G  C++ C  G +G  C   C C NGG+C      C+C PG+ G  C++ C  G+YG  C   C    H+   C  ISG C+C+PG+ G  C++ C    +G +C Q+C C N G C P +G CQC  G  G  C   CPP  +GP C H C C     C  + G C C     GL C  + C +     DC + CQC    SC+ ++GKC C+ G  G  C Q C  G FG  C+Q C C N   C+ V GTC C  GF GI CDQ 
Sbjct:   83 RRRSQCCPGYYESGDFCIPLCTEECVHGR--CVSPDTC----------------------HCEPGWGGPDCSSGCDSDHWGPHCSNRCQCQNGALCNPITGACVCAAGFRGWRCEE---LCAPGTHGKGCQLPC-QCRHGASCDPRAGECLCAPGYTGVYCEELCPPGSHGAHCE-LRCPCQNGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPCH-HGGQCDHVTGQCHCTAGYMGDRCQEECPFGSFGFQCSQHCDCH--NGGQCSPTTGACECEPGYKGPRCQERLCPEGLHGPGCTLPCPCDADNTISCHPVTGAC---TCQPGWSGHHCNESCPVGYYGDGCQLPCTC-QNGADCHSITGGCTCAPGFMGEVCAVSCAAGTYGPNCSSICSCNNGGTCSPVDGSCTCKEGWQGLDCTLPCPSGTWGLNCNESCTCANGAACSPIDGSCSCTPGWLGDTCELPCPDGTFGLNCSEHCDCSHADGCDPVTGHCCCLAGWTGIRCDSTCPPGRWGPNCSVSCSCENGGSCSPEDGSCECAPGFRGPLCQRICPPGFYGHGCAQPCPLCVHSSRPCHHISGICECLPGFSGALCNQVCAGGYFGQDCAQLCSCANNGTCSPIDGSCQCFPGWIGKDCSQACPPGFWGPACFHACSCHNGASCSAEDGACHCTPGWTGLFC-TQRCPAAFFGKDCGRVCQCQNGASCDHISGKCTCRTGFTGQHCEQRCAPGTFGYGCQQLCECMNNSTCDHVTGTCYCSPGFKGIRCDQA 825          

HSP 3 Score: 387.497 bits (994), Expect = 4.068e-116
Identity = 273/736 (37.09%), Postives = 340/736 (46.20%), Query Frame = 3
Query: 1683 GEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRC-ELKCTKGLYGERCQSSCQCRKDRL--CDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCI--CKATEKCDLKTGECTCPKSAFGLSC-EIKNCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALC 3863
            G+ C+  C+     G C    T C C P + G  C   C  +     C   +C C+NG  C   T  C C  G  G  CE  C  G  G+ C+  C        C    G+CLC PG+ G  C  LCP G+ G  C   C C   N   C    G+C C  G+ G  C   C PG FG +CS  CP      C+H TGQC      G     CQ +CP G  G  C + CDC  N   C    G C C PG+ G RC E  C +GL+G  C   C C  D    C  VTG C C     G    E+CP G +G  C   C C     C  I G C C  G+ G  C+  C  G YG  CS  C C  G  C P+ G C C  GW G  C  PC  G +G  C E C C NG  C      C C PGW G+ CE  C  G +G NC   C C +   CD ++G C C+ GW GI CD  CP   +GPNC+  C C NGG C PE+G C+C  G  G +C+  CPP  YG  C   C     ++  C   +G C C     G  C ++        DC Q C C+   +C+ + G CQC PG  G  C Q C  G +G  C   C C NG  C+  DG C C  G+TG+ C Q C   ++G +C   C  C    +C   +G+C+C  G     C+ +C  G +G  CQQ C+CM+ ++C+  TG C C  GF G  C
Sbjct:   96 GDFCIPLCTEECVHGRCVSPDT-CHCEPGWGGPDCSSGCDSDHWGPHCS-NRCQCQNGALCNPITGACVCAAGFRGWRCEELCAPGTHGKGCQLPCQCR-HGASCDPRAGECLCAPGYTGVYCEELCPPGSHGAHCELRCPCQ--NGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPCHHGGQCDHVTGQC--HCTAGYMGDRCQEECPFGSFGFQCSQHCDC-HNGGQCSPTTGACECEPGYKGPRCQERLCPEGLHGPGCTLPCPCDADNTISCHPVTGACTCQPGWSGHHCNESCPVGYYGDGCQLPCTCQNGADCHSITGGCTCAPGFMGEVCAVSCAAGTYGPNCSSICSCNNGGTCSPVDGSCTCKEGWQGLDCTLPCPSGTWGLNCNESCTCANGAACSPIDGSCSCTPGWLGDTCELPCPDGTFGLNCSEHCDCSHADGCDPVTGHCCCLAGWTGIRCDSTCPPGRWGPNCSVSCSCENGGSCSPEDGSCECAPGFRGPLCQRICPPGFYGHGCAQPCPLCVHSSRPCHHISGICECLPGFSGALCNQVCAGGYFGQDCAQLCSCANNGTCSPIDGSCQCFPGWIGKDCSQACPPGFWGPACFHACSCHNGASCSAEDGACHCTPGWTGLFCTQRCPAAFFGKDCGRVCQ-CQNGASCDHISGKCTCRTGFTGQHCEQRCAPGTFGYGCQQLCECMNNSTCDHVTGTCYCSPGFKGIRC 822          

HSP 4 Score: 357.066 bits (915), Expect = 4.302e-105
Identity = 263/733 (35.88%), Postives = 334/733 (45.57%), Query Frame = 3
Query: 1614 CQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSN------------CMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQ-----GNNSIGCQ-RDCPTGGSGSDCRKTCDC-SENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK--CEACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN-CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQ-CLNGGK-CHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSK--ESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDC 3734
            C  +   G  +  D   C  G  G +C   C +            C +   CN     C+C   + G  CE  C        CQ L C C++G +C+    +C C PG +G  CE  C  G  G +CE  CP   +   CH ITG+C C PGW G+ C   CP GT+G  CS+ C C+      CD   G+C C  GY G  C  +C  G FG  CS  C  DC     H  GQC   T       G     CQ R CP G  G  C   C C ++N++SC    G C C PG++G  C   C  G YG+ CQ  C C+    C  +TG C CA    G+    +C +G +GP C+  C C     C  ++G C C  G+ G  C+  CP G +G  C++ C C  G  C PI G C C PGW G+ CE PC +G +G  C E C C +   CD     C C  GW G  C+ +C  G +G NC   C C NGG C    G C+C PG+RG  C   CP   YG  C Q C  C++  + CH  +G+C+C  G  G +C   C    +G +C   C C     C    G C C     G  C  + C        C   C C    SC+   G C C PG  G  C Q C    FG DC + C+C NG  C+ + G C C +GFTG  C+Q CA G +G  C+  C  C  N TC   TG C C  G     C
Sbjct:  103 CTEECVHGRCVSPDTCHCEPGWGGPDCSSGCDSDHWGPHCSNRCQCQNGALCNPITGACVCAAGFRGWRCEELCAPGTHGKGCQ-LPCQCRHGASCDPRAGECLCAPGYTGVYCEELCPPGSHGAHCELRCPCQ-NGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPCHHGGQ--CDHVTGQCHCTAGYMGDRCQEECPFGSFGFQCSQHC--DC-----HNGGQCSPTTGACECEPGYKGPRCQERLCPEGLHGPGCTLPCPCDADNTISCHPVTGACTCQPGWSGHHCNESCPVGYYGDGCQLPCTCQNGADCHSITGGCTCAPGFMGEVCAVSCAAGTYGPNCSSICSCNNGGTCSPVDGSCTCKEGWQGLDCTLPCPSGTWGLNCNESCTCANGAACSPIDGSCSCTPGWLGDTCELPCPDGTFGLNCSEHCDCSHADGCDPVTGHCCCLAGWTGIRCDSTCPPGRWGPNCSVSCSCENGGSCSPEDGSCECAPGFRGPLCQRICPPGFYGHGCAQPCPLCVHSSRPCHHISGICECLPGFSGALCNQVCAGGYFGQDCAQLCSCANNGTCSPIDGSCQCFPGWIGKDCS-QACPPGFWGPACFHACSCHNGASCSAEDGACHCTPGWTGLFCTQRCPAAFFGKDCGRVCQCQNGASCDHISGKCTCRTGFTGQHCEQRCAPGTFGYGCQQLC-ECMNNSTCDHVTGTCYCSPGFKGIRC 822          

HSP 5 Score: 263.077 bits (671), Expect = 1.955e-72
Identity = 158/418 (37.80%), Postives = 216/418 (51.67%), Query Frame = 3
Query: 2757 QCIYGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIK-NCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQ-MCEFGNFGLDCKQKCRCA--NGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEV 3998
            +C++G C      C C PGW G  C + CD  ++G  C  +C+C NG  C+     C C  G+ G  CE+ CA G +G+ C+  CQC +G  CD  +G+C C PG+ G+ C+E CP  ++G +C   C C NGG CH   G C CP G  G VC   CPP  +G NC  +C C    +CD  TG+C C     G  C+ +    S    C Q C C     C+  TG C+C+PG +GP+C + +C  G  G  C   C C   N   C+PV G C C  G++G  C++ C  G+YG  C+L C  C     CH  TG C+C  G +   C   C +G YGP C   C C +G +C+P  G+C C  G+ G  C   CP+  +G NC   C C + + C+P+ G C C     G  CE+
Sbjct:  106 ECVHGRCVSPD-TCHCEPGWGGPDCSSGCDSDHWGPHCSNRCQCQNGALCNPITGACVCAAGFRGWRCEELCAPGTHGKGCQLPCQCRHGASCDPRAGECLCAPGYTGVYCEELCPPGSHGAHCELRCPCQNGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPCHHGGQCDHVTGQCHCTAGYMGDRCQEECPFGSFGFQCSQHCDCHNGGQCSPTTGACECEPGYKGPRCQERLCPEGLHGPGCTLPCPCDADNTISCHPVTGACTCQPGWSGHHCNESCPVGYYGDGCQLPC-TCQNGADCHSITGGCTCAPGFMGEVCAVSCAAGTYGPNCSSICSCNNGGTCSPVDGSCTCKEGWQGLDCTLPCPSGTWGLNCNESCTCANGAACSPIDGSCSCTPGWLGDTCEL 521          

HSP 6 Score: 191.815 bits (486), Expect = 3.430e-49
Identity = 136/370 (36.76%), Postives = 177/370 (47.84%), Query Frame = 3
Query: 2910 IFGRKCQCEPGWH--GEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCE-IKNCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQ-CPSGYYGPLCQQACQCM--HGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVS 4001
            ++ R+ QC PG++  G+FC   C          GRC   +          C C PGW G +C   C S  +GP+C+  CQC NG  C+P  G C C AG  G  CE  C P  +G  C   C C+    CD + GEC C     G+ CE +    S  + C   C C    +C+ +TG+C C PG  G  C Q C  G FG +C Q C C +G  C+ V G C C +G+ G  C + C  G +G  C   C  C+    C P TG C CE G     C+ + CP G +GP C   C C   +  SC+P TGAC C  G+ G  C   CP  +YG  CQ  C C + + C+ +TG C C     G  C VS
Sbjct:   81 MYRRRSQCCPGYYESGDFCIPLCTE----ECVHGRCVSPD---------TCHCEPGWGGPDCSSGCDSDHWGPHCSNRCQCQNGALCNPITGACVCAAGFRGWRCEELCAPGTHGKGCQLPCQCRHGASCDPRAGECLCAPGYTGVYCEELCPPGSHGAHCELRCPCQNGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPCHHGGQCDHVTGQCHCTAGYMGDRCQEECPFGSFGFQCSQHC-DCHNGGQCSPTTGACECEPGYKGPRCQERLCPEGLHGPGCTLPCPCDADNTISCHPVTGACTCQPGWSGHHCNESCPVGYYGDGCQLPCTCQNGADCHSITGGCTCAPGFMGEVCAVS 436          

HSP 7 Score: 179.489 bits (454), Expect = 3.302e-45
Identity = 201/707 (28.43%), Postives = 289/707 (40.88%), Query Frame = 3
Query:  507 CQNGAFCYQSGYNAKCICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDL-------CKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFI--------CDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQ--FCNSSPNKRAI---CSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLR--KNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNR-CHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCA 2558
            C++GA C       +C+C  G+ G +C++                          CPPG     +G +C     C    T     C ++ G   C CPP          C P     + +    C HH  +   +   C C  G++ D+ +  C            C  +NGG     Q  P++    C+C PGY       + C +     +   GC   C     + I        C C PGW   H ++SC         P  Y   GC     C +  +  +I   C+C PGF  E   ++C+      T    C           S +C+C  G          TC++  + LD T  C       + +  C C NG      + +C    T G         CP GTFG  C  +C +C H   C+     C C   ++G  C+  C        C  + C C+NGG+C  E   C C PG  G +C+  C  GF+G  C + CP    S+R CH I+G C C PG+ G+ C+ +C  G +G  C++ CSC  N    C P +G C+C  G+ G +C   C PG++G  C  +C       C+ E G C      G   + C + CP    G DC + C C +N  SC+  +G C C  GFTG+ CE +C  G +G  CQ  C+C  +  CDHVTG CYC+
Sbjct:  191 CRHGASCDPRA--GECLCAPGYTGVYCEE-------------------------LCPPG----SHGAHCELRCPCQNGGT-----CHHITG--ECACPPGWTGAVCAQPCPPGTFGQNCSQDCPC-HHGGQCDHVTGQCHCTAGYMGDRCQEECPFGSFGFQCSQHCDCHNGG-----QCSPTTGA--CECEPGYKGPRCQERLCPE----GLHGPGCTLPCPCDADNTISCHPVTGACTCQPGWSGHHCNESC---------PVGYYGDGCQLPCTCQNGADCHSITGGCTCAPGFMGEVCAVSCAAG----TYGPNC-----------SSICSCNNGGTCSPVDGSCTCKEGWQGLDCTLPCPSGTWGLNCNESCTCANGAACSPIDGSC--SCTPGWLGDTCELPCPDGTFGLNCSEHC-DCSHADGCDPVTGHCCCLAGWTGIRCDSTCPPGRWGPNCS-VSCSCENGGSCSPEDGSCECAPGFRGPLCQRICPPGFYGHGCAQPCPLCVHSSRPCHHISGICECLPGFSGALCNQVCAGGYFGQDCAQLCSCANNGT--CSPIDGSCQCFPGWIGKDCSQACPPGFWGPACFHACSCHNGASCSAEDGAC--HCTPGWTGLFCTQRCPAAFFGKDCGRVCQC-QNGASCDHISGKCTCRTGFTGQHCEQRCAPGTFGYGCQQLCECMNNSTCDHVTGTCYCS 814          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Celegans
Match: Y64G10A.7 (pep chromosome:WBcel235:IV:14291901:14319564:1 gene:WBGene00013416.1 transcript:Y64G10A.7c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y64G10A.7)

HSP 1 Score: 686.026 bits (1769), Expect = 0.000e+0
Identity = 489/1358 (36.01%), Postives = 644/1358 (47.42%), Query Frame = 3
Query:  141 MRFAIIFFLTIQIIPKLSG-----AGSQKLELGMPNVCEVEQRQMIRVRRTVEVPRSKEVKVWKANCRFKGDWCLVHENKSFVEKTETSQIQMVPSIKYECCEGYAELSGYRGCIPKPNCEERIGKYCQNGAFCYQSGYNAK---CICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFI-CSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNT------------------------RGSSLQKDPR--------------RCPKGTFGEECLFNCSNCMHKGYCNDDQTGCL----CHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIG-CTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSE-----NSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNG----------GLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIK-NCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVS 4001
            M+  I  F  IQ+I + SG        Q+L LG  NVC  E+ +++ ++       +K V+  K  C  K   C V + K+    T     +       ECC G+    G  GC  + NC   +   C NG  C  S +N     C CP GF G  C  D NEC  NNGGCE EC N  G +YC+C PG+E+S +G  C DI+EC  +   CS  CVN PGGFRC CP D+ L  D   C        S + GGC H C   S+  F  C C  G  L +++RSC  VD C DN GGC H C ++   +   C+C PG+ +   D + C DI+EC  KN GC+H C NV+G++ C C  G+Q+G D ++C     E+   C+ GNGGC   C   P+   +C C  G+ L  D   C D +EC      C     C+N  GS  C C  G+RL K++ TCEDI EC    GGC   C N +G Y C C  G  L +D  +C + N                          G  L  D +               CP G FG  C  +CS+C + G C+   +G L    C   Y+G  CE  C      V+C   +C CK    C+  T  C C      E C  G C +GF+G  C   C   C + RC  + G C C  G YG SC   CP  T+G  C   C C + N EGCD   GKC+CK GY+G +C   C PG FG  C+  C       C+  TG C  K   G     C + CP G  G DC + C C++      S  C    G C C PG TG  C+  C    YG  C  +C C     CD   G C+C    +G    E CP+G++G  C Q C C     CD  NG C C  G+ G KC K C  G +G+ CSK+C C  G +CDP  G C C PG  G  C+  CD G +G  CK  C C NG TCD     C+C PGW G+ C++ C  G +G  C   C C               CD ++G+C C  GW G +C   CP   +G  C   CQC NG  C    G C CP+G  G  CE  CP   +G NC+ +C+C    +C+ + G+C C     G SCE          +C Q C C    SC++ TG+C+C PG  G  C + C  G++G  C++ C C NG  C+P+ G C C  G+ G  C++ C KG++G +C   C  C  +K+C   +G+C C  G   + C   CP G +G  C Q C C   + C+  +G C C  G  G+ C+  C    +G +C   C C +   C+  TG CVCP    G  CE++
Sbjct:    1 MKILIQLFF-IQLIRQTSGGELVDVQLQELRLGQRNVCPHEEVEIVTLKEPCVQAYTKYVRSRKPGCNGKFQSCAVRQPKTIYFHTYKKVNRTRRHTVAECCPGWVHRPGEAGC-QRANCSADL---CHNGGTCVPSEHNDNEQVCECPVGFTGAKCQYDANECMANNGGCEHECVNTIGTYYCRCWPGFELSGDGNTCSDIDECAVSNGGCSDRCVNSPGGFRCDCPSDLYLHADGRTCGKVTSC--STDNGGCEHECENDSNGEFYRCRCRVGFKLSENKRSCQPVDPCFDNKGGCQHHCTNNHGRA--QCQCYPGFHLSY-DRRSCVDIDEC-AKNNGCEHFCENVKGTYRCKCREGYQLGRDGRTC----EEMLGGCQVGNGGCQHDCYDQPDGGHVCKCRNGYILANDQKLCHDINECHENNGDCS--QICVNLAGSVECQCKPGFRLMKDRKTCEDISECSSNNGGCEQICSNQEGGYMCSCEPGFELSEDGHSCHDMNECLINNGGCAQLCKNRKGSRRCQCFAGYILAHDEKSCVAASDSADIFSNECPNGFFGSTCQLSCSDCQNGGKCSMRGSGLLSKCDCPSGYTGEKCEQICRNGYWGVDCA-HKCSCK---LCDPSTGSCRCE---DPEKCSDGPCPDGFYGSQCNLKCRMDCPNGRCDPVFGYCTCPDGLYGQSCEKPCPHFTFGKNCRFPCKCARENSEGCDEITGKCRCKPGYYGHHCKRMCSPGLFGAGCAMKCSCPAGIRCDPVTGDCTKKCPAGYQGNLCDQPCPAGYFGYDCEQKCSCADVASPHKSKVCHHVTGTCTCLPGKTGPLCDQSCAPNTYGPNCAHTCSCVNGAKCDESDGSCHCTPGFYGATCSEVCPTGRFGIDCMQLCKCQNGAICDTSNGSCECAPGWSGKKCDKACAPGTFGKDCSKKCDCADGMHCDPSDGECICPPGKKGHKCDETCDSGLFGAGCKGICSCQNGATCDSVTGSCECRPGWRGKKCDRPCPDGRFGEGCNAICDCTTTNDTSMYNPFVARCDHVTGECRCPAGWTGPDCQTSCPLGRHGEGCRHSCQCSNGASCDRVTGFCDCPSGFMGKNCESECPEGLWGSNCMKHCLCMHGGECNKENGDCECIDGWTGPSCEFLCPFGQFGRNCAQRCNCKNGASCDRKTGRCECLPGWSGEHCEKSCVSGHYGAKCEETCECENGALCDPISGHCSCQPGWRGKKCNRPCLKGYFGRHCSQSCR-CANSKSCDHISGRCQCPKGYAGHSCTELCPDGTFGESCSQKCDCGENSMCDAISGKCFCKPGHSGSDCKSGCVQGRFGPDCNQLCSCENGGVCDSSTGSCVCPPGYIGTKCEIA 1333          

HSP 2 Score: 589.726 bits (1519), Expect = 0.000e+0
Identity = 436/1222 (35.68%), Postives = 580/1222 (47.46%), Query Frame = 3
Query:  654 GGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTC---SDE-----DECVTGKHKCVPPSTCIN--------DLGSYL---CTCPVGYRLRKNKMTCEDIDECLDYTGGCGYK-CVNTDGSYRCV---------CPNGETLGKDNKTCQNQ--NTR------------GSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTG-CLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCN--CPPGISGEICEIGCTEGFFGENCEKNCPTA-----CSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCT----------YSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDI------------------------FGR-------------------KCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKES-DCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCE 3995
            G   C+C PG+ +S + ++C+DI+EC +N   C H C N+ G +RC+C     LG D   C   +  C   N GGC H C    D   +C C +G+IL  D++ C  ++ C +NNG CS +C +   S  + C+C+PG+ + + D K C+DI+EC+  NGGC+ IC N EG ++C C PG+++  D  SC+ ++      C   NGGC Q C +    R  C C  G+ L  D  +C   SD      +EC  G        +C +          GS L   C CP GY   K +  C +    +D    C  K C  + GS RC          CP+G    + N  C+    N R            G   Q   + CP  TFG+ C F C          D+ TG C C P Y G  C+  C        C  ++C C  G  C+  T  C   CP G  G +C+  C  G+FG +CE+ C  A       S  CH +TG C C PG  G  C   C   T+G  C+ TCSC   N   CD  +G C C  G++G  C   C  G FG+DC   C      IC+   G C  +   G +   C + C  G  G DC K CDC++  + C+  +G C C PG  G +C+  C  GL+G  C+  C C+    CD VTG C C     GK     CP G++G  CN  CDCT          +   CD + G+C C AG+ GP C   CP G +GEGC   CQC  G +CD ++G C C  G+ G+ CE+ C EG +G  C + C C++GG C+                         FGR                   +C+C PGW GE CEKSC  G+YG  CE  C+C NG LCD ISG C C PGWRG  C+  C    +G +C+Q C+C N   C   +G CQCP G  G  C   CP   +G +C   C C     CD  +G+C C     G  C+      +   DC Q C C     C+  TG C C PG  G +C   C+   FG  C++ C C NG  C+ + G C CL GFTG+ C+QVC +G +G  CK KC   N +  C+  +G+C C  G     C+  CPSG YG  C   C+C   A C+P  G C C  G YG+ CQF CPN FYG  C   C C + + C+   G C+CP    G  CE
Sbjct:  300 GRAQCQCYPGFHLSYDRRSCVDIDECAKN-NGCEHFCENVKGTYRCKCREGYQLGRDGRTCEEMLGGCQVGN-GGCQHDCYDQPDGGHVCKCRNGYILANDQKLCHDINECHENNGDCSQICVNLAGS--VECQCKPGFRL-MKDRKTCEDISECSSNNGGCEQICSNQEGGYMCSCEPGFELSEDGHSCHDMNE-----CLINNGGCAQLCKNRKGSRR-CQCFAGYILAHDEKSCVAASDSADIFSNECPNGFFGSTCQLSCSDCQNGGKCSMRGSGLLSKCDCPSGYTGEKCEQICRNGYWGVDCAHKCSCKLCDPSTGSCRCEDPEKCSDGPCPDGFYGSQCNLKCRMDCPNGRCDPVFGYCTCPDGLYGQSCEKPCPHFTFGKNCRFPCKCARENSEGCDEITGKCRCKPGYYGHHCKRMCSPGLFGAGCA-MKCSCPAGIRCDPVTGDCTKKCPAGYQGNLCDQPCPAGYFGYDCEQKCSCADVASPHKSKVCHHVTGTCTCLPGKTGPLCDQSCAPNTYGPNCAHTCSCV--NGAKCDESDGSCHCTPGFYGATCSEVCPTGRFGIDCMQLCKCQNGAICDTSNGSC--ECAPGWSGKKCDKACAPGTFGKDCSKKCDCAD-GMHCDPSDGECICPPGKKGHKCDETCDSGLFGAGCKGICSCQNGATCDSVTGSCECRPGWRGKKCDRPCPDGRFGEGCNAICDCTTTNDTSMYNPFVARCDHVTGECRCPAGWTGPDCQTSCPLGRHGEGCRHSCQCSNGASCDRVTGFCDCPSGFMGKNCESECPEGLWGSNCMKHCLCMHGGECNKENGDCECIDGWTGPSCEFLCPFGQFGRNCAQRCNCKNGASCDRKTGRCECLPGWSGEHCEKSCVSGHYGAKCEETCECENGALCDPISGHCSCQPGWRGKKCNRPCLKGYFGRHCSQSCRCANSKSCDHISGRCQCPKGYAGHSCTELCPDGTFGESCSQKCDCGENSMCDAISGKCFCKPGHSGSDCKSGCVQGRFGPDCNQLCSCENGGVCDSSTGSCVCPPGYIGTKCEIACQSDRFGPTCEKICNCENGGTCDRLTGQCRCLPGFTGMTCNQVCPEGRFGAGCKEKCRCANGH--CNASSGECKCNLGFTGPSCEQSCPSGKYGLNCTLDCECYGQARCDPVQGCCDCPPGRYGSRCQFSCPNGFYGWYCSQSCSCQNGAHCDGADGRCLCPAGFQGDKCE 1502          

HSP 3 Score: 497.278 bits (1279), Expect = 1.299e-150
Identity = 412/1187 (34.71%), Postives = 534/1187 (44.99%), Query Frame = 3
Query:  651 DGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVD-----------LCKDNNGGCSHLCQ----------------SDPSSSVITCKCRPGYAIDVNDVK--QCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSC-YKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPS---TCINDLGSYLCTCP-VGYRLRKN-----KMTCEDIDECLDYTGGC-------GYKC--------VNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCS----NCMHKGYCNDDQTG-CLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENS---------VSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK-CEA-CPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIK-NCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCE 3995
            DGG  CKC  GY ++ + K C DINEC  N  DCS  CVNL G   CQC P   L  DR  C   I  C S+N GGC   C    +  ++CSC  G  L +D  SC  ++           LCK+  G  S  CQ                +  S+ + + +C  G+      +    C++  +C+++  G    C    G     C    + G+    C +K   +L DP     G C       P K +   C  GF      L C    +C  G+  C P     TC + L    C  P   +   KN     K   E+ + C + TG C       G+ C             + +C CP G         C  +   G       + CP G FG +C   CS       HK       TG C C P  +G +C+  C  N     C    C C NG  C+     C+C PG  G  C   C  G FG +C + C    +   C    G C C PGW G  C   C  GT+G  CSK C C    +  CDP +G+C C  G  G  C   CD G FG  C   C       C+  TG C  +   G     C R CP G  G  C   CDC+  +           C+   G C C  G+TG  C+  C  G +GE C+ SCQC     CD VTG C C     GK CE+ CP G WG  C ++C C +   C++ NG C C+ G+ GP C   CP G +G  C++ C C  G +CD  +G C C PGW GE CE  C  G+YG +C+E C+C NG  CD     C C+PGW G+ C + C  GY+GR+C   C+C N   CD ISG+C C  G+ G +C E CP  T+G +C+Q C C     C   +G C C  G  G  C+  C   ++GP+C   C C+    CD  TG C CP    G  CEI    D     C + C C    +C+++TG+C+C PG  G  C Q+C  G FG  CK+KCRCANG  CN   G C C  GFTG  C+Q C  G YG NC L C  C     C P  G C C  G     C+  CP+G+YG  C Q+C C +GA C+ + G C C +GF G  C+ +C    +G  C  +C C     C+   G C+CP    G  CE
Sbjct:  382 DGGHVCKCRNGYILANDQKLCHDINECHENNGDCSQICVNLAGSVECQCKPGFRLMKDRKTCED-ISEC-SSNNGGCEQICSN-QEGGYMCSCEPGFELSEDGHSCHDMNECLINNGGCAQLCKNRKG--SRRCQCFAGYILAHDEKSCVAASDSADIFSNECPNGFFGSTCQLSCSDCQNGGKCSMRGSGLLSKCDCPSGYTGEKCEQICRNGYWGVDCAHKCSCKLCDP---STGSCR---CEDPEKCSDGPCPDGFYGSQCNLKC--RMDCPNGR--CDPVFGYCTCPDGLYGQSCEKPCPHFTFGKNCRFPCKCARENSEGCDEITGKCRCKPGYYGHHCKRMCSPGLFGAGCAMKCSCPAGIRCDPVTGDCTKKCPAGYQGNLCDQPCPAGYFGYDCEQKCSCADVASPHKSKVCHHVTGTCTCLPGKTGPLCDQSCAPNTYGPNCAHT-CSCVNGAKCDESDGSCHCTPGFYGATCSEVCPTGRFGIDCMQLCKCQ-NGAICDTSNGSCECAPGWSGKKCDKACAPGTFGKDCSKKCDCADGMH--CDPSDGECICPPGKKGHKCDETCDSGLFGAGCKGICSCQNGATCDSVTGSCECRP--GWRGKKCDRPCPDGRFGEGCNAICDCTTTNDTSMYNPFVARCDHVTGECRCPAGWTGPDCQTSCPLGRHGEGCRHSCQCSNGASCDRVTGFCDCPSGFMGKNCESECPEGLWGSNCMKHCLCMHGGECNKENGDCECIDGWTGPSCEFLCPFGQFGRNCAQRCNCKNGASCDRKTGRCECLPGWSGEHCEKSCVSGHYGAKCEETCECENGALCDPISGHCSCQPGWRGKKCNRPCLKGYFGRHCSQSCRCANSKSCDHISGRCQCPKGYAGHSCTELCPDGTFGESCSQKCDCGENSMCDAISGKCFCKPGHSGSDCKSGCVQGRFGPDCNQLCSCENGGVCDSSTGSCVCPPGYIGTKCEIACQSDRFGPTCEKICNCENGGTCDRLTGQCRCLPGFTGMTCNQVCPEGRFGAGCKEKCRCANGH-CNASSGECKCNLGFTGPSCEQSCPSGKYGLNCTLDC-ECYGQARCDPVQGCCDCPPGRYGSRCQFSCPNGFYGWYCSQSCSCQNGAHCDGADGRCLCPAGFQGDKCEQKCSEGSFGPACSQQCNC-GKYKCDATDGKCICPVGRHGPLCE 1544          

HSP 4 Score: 421.779 bits (1083), Expect = 1.116e-123
Identity = 370/1116 (33.15%), Postives = 500/1116 (44.80%), Query Frame = 3
Query:  792 QCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCV--KLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFC-NSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQ----NTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQ--PLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLY-KCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELK-------CTKGLYGERCQSSCQCR-KDRLCDHVTGICYCADVAFGK-CEA-CPSGKWGPTCNQNCDCTY--STGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGIC--RCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGT------CDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSK--ESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEP----------CNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVSVIN 4010
            +C P  +  P    C       D  + GG    CV  + +D   +C CP G    K +      + C  NNGGC H C +  +     C+C PG+ +   D   C DI+EC + NGGC   C+N  G F CDC     +  D ++C KV    TD     NGGC   C N S  +   C C  GFKL  +  +C   D C   K  C     C N+ G   C C  G+ L  ++ +C DIDEC     GC + C N  G+YRC C  G  LG+D +TC+             Q D    P G    +C         +  C+D      CH N     C   C+     VECQ  P     K+  TCE +  +C+   G   +IC     EG +  +CE     +   + CH +  +CL   G     C  LC         S+ C C        D K+    C       +    +C  G+FG  C  SC  DC+       G+C  +     + +  + DCP+G +G  C + C      V C  K     C P     RCE         C  G YG +C   C+    +  CD V G C C D  +G+ CE  CP   +G  C   C C    S GCD+I G+C C  GYYG  C + C  GL+G GC+ +C C  G  CDP++G C  +C  G+ G +C+ PC  GY+G  C++KC C +  +      C      C C PG  G  C++SCA   YG NC   C C NG  CD   G C C PG+ G  C E CP+  +G +C Q+C+C NG  C   NG C+C  G  G  C+  C P  +G +C   C C     CD   GEC CP    G  C+ + CDS    + C+  C C    +C+ VTG C+C+PG RG +C + C  G FG  C   C C               C+ V G C C +G+TG  C   C  G +G  C+  C  C+   +C   TG C C +G +  +C+ +CP G +G  C + C CMHG  CN   G C+C+ G+ G  C+F CP   +G NC  RC C + + C+  TG C C    SG  CE S ++
Sbjct:   99 ECCPGWVHRPGEAGCQRANCSADLCHNGG---TCVPSEHNDNEQVCECPVGFTGAKCQYD---ANECMANNGGCEHECVN--TIGTYYCRCWPGFELS-GDGNTCSDIDECAVSNGGCSDRCVNSPGGFRCDCPSDLYLHADGRTCGKVTSCSTD-----NGGCEHECENDSNGEFYRCRCRVGFKLSENKRSCQPVDPCFDNKGGCQ--HHCTNNHGRAQCQCYPGFHLSYDRRSCVDIDECAK-NNGCEHFCENVKGTYRCKCREGYQLGRDGRTCEEMLGGCQVGNGGCQHDCYDQPDGGHVCKCRNGYILANDQKLCHDINE---CHENNGD--CSQICVNLAGSVECQCKPGFRLMKDRKTCE-DISECSSNNGGCEQICSN--QEGGYMCSCEPGFELSEDGHSCHDMN-ECLINNG----GCAQLCKNRKG----SRRCQCFAGYILAHDEKS----CVAASDSADIFSNECPNGFFGSTCQLSC-SDCQN-----GGKCSMR----GSGLLSKCDCPSGYTGEKCEQICRNGYWGVDCAHKCSCKLCDPSTGSCRCEDPEKCSDGPCPDGFYGSQCNLKCRMDCPNGRCDPVFGYCTCPDGLYGQSCEKPCPHFTFGKNCRFPCKCARENSEGCDEITGKCRCKPGYYGHHCKRMCSPGLFGAGCAMKCSCPAGIRCDPVTGDCTKKCPAGYQGNLCDQPCPAGYFGYDCEQKCSCADVASPHKSKVCHHVTGTCTCLPGKTGPLCDQSCAPNTYGPNCAHTCSCVNGAKCDESDGSCHCTPGFYGATCSEVCPTGRFGIDCMQLCKCQNGAICDTSNGSCECAPGWSGKKCDKACAPGTFGKDCSKKCDCADGMHCDPSDGECICPPGKKGHKCD-ETCDSGLFGAGCKGICSCQNGATCDSVTGSCECRPGWRGKKCDRPCPDGRFGEGCNAICDCTTTNDTSMYNPFVARCDHVTGECRCPAGWTGPDCQTSCPLGRHGEGCRHSCQ-CSNGASCDRVTGFCDCPSGFMGKNCESECPEGLWGSNCMKHCLCMHGGECNKENGDCECIDGWTGPSCEFLCPFGQFGRNCAQRCNCKNGASCDRKTGRCECLPGWSGEHCEKSCVS 1164          

HSP 5 Score: 332.798 bits (852), Expect = 2.438e-93
Identity = 225/580 (38.79%), Postives = 296/580 (51.03%), Query Frame = 3
Query: 1665 CPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETG--QCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFG-KCE-ACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKESDCRQD 3392
            CP G  GE C  +C  C +   C+     C C   + G  CE +C +      C    C C +GG C  E   C C  G +G  CE  C  G FG NC + C    +   C + TG+C C PGW G  C   C +G +G  C +TC C   N   CDP +G C C+ G+ G  C   C  GYFG  CS SC       C+H +G  QCP    +G     C   CP G  G  C + CDC ENS+ C+  +G C C PG +G  C+  C +G +G  C   C C    +CD  TG C C     G KCE AC S ++GPTC + C+C     CD++ GQC CL G+ G  C++ CPEG +G GC ++C+C  G+C+  SG C+CN G+ G  CE  C  G YG  C   C+C     CD     C C PG +G  C+ SC  G+YG  C   C C NG  CDG  G+C C  G++G  C+++C   ++GP C+Q C C    KC   +G C CP GRHG +CE  C P +YG +C + C C     CD +TG+C+C     G +C+I+  D      R D
Sbjct: 1033 CPLGRHGEGCRHSC-QCSNGASCDRVTGFCDCPSGFMGKNCESECPEGLWGSNCMK-HCLCMHGGECNKENGDCECIDGWTGPSCEFLCPFGQFGRNCAQRCNCK-NGASCDRKTGRCECLPGWSGEHCEKSCVSGHYGAKCEETCECE--NGALCDPISGHCSCQPGWRGKKCNRPCLKGYFGRHCSQSCRCANSKSCDHISGRCQCP----KGYAGHSCTELCPDGTFGESCSQKCDCGENSM-CDAISGKCFCKPGHSGSDCKSGCVQGRFGPDCNQLCSCENGGVCDSSTGSCVCPPGYIGTKCEIACQSDRFGPTCEKICNCENGGTCDRLTGQCRCLPGFTGMTCNQVCPEGRFGAGCKEKCRCANGHCNASSGECKCNLGFTGPSCEQSCPSGKYGLNCTLDCECYGQARCDPVQGCCDCPPGRYGSRCQFSCPNGFYGWYCSQSCSCQNGAHCDGADGRCLCPAGFQGDKCEQKCSEGSFGPACSQQCNC-GKYKCDATDGKCICPVGRHGPLCEEECRPGRYGQSCQNKCQCFNGATCDARTGQCSCSPGWLGPTCQIEMMDPNNVANRGD 1601          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Celegans
Match: Y64G10A.7 (pep chromosome:WBcel235:IV:14291901:14319564:1 gene:WBGene00013416.1 transcript:Y64G10A.7e.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y64G10A.7)

HSP 1 Score: 681.404 bits (1757), Expect = 0.000e+0
Identity = 511/1439 (35.51%), Postives = 676/1439 (46.98%), Query Frame = 3
Query:  141 MRFAIIFFLTIQIIPKLSG-----AGSQKLELGMPNVCEVEQRQMIRVRRTVEVPRSKEVKVWKANCRFKGDWCLVHENKSFVEKTETSQIQMVPSIKYECCEGYAELSGYRGCIPKPNCEERIGKYCQNGAFCYQSGYNAK---CICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFI-CSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNT------------------------RGSSLQKDPR--------------RCPKGTFGEECLFNCSNCMHKGYCNDDQTGCL----CHPNYSGTICE---------IDC-------LQNPSQVECQ---PLQCH---CKNG----------------GTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTAC-SSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQN----------------NYEG---------------------------CDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCT----------YSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSC-EIKNCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVSVINRL 4016
            M+  I  F  IQ+I + SG        Q+L LG  NVC  E+ +++ ++       +K V+  K  C  K   C V + K+    T     +       ECC G+    G  GC  + NC   +   C NG  C  S +N     C CP GF G  C  D NEC  NNGGCE EC N  G +YC+C PG+E+S +G  C DI+EC  +   CS  CVN PGGFRC CP D+ L  D   C        S + GGC H C   S+  F  C C  G  L +++RSC  VD C DN GGC H C ++   +   C+C PG+ +   D + C DI+EC  KN GC+H C NV+G++ C C  G+Q+G D ++C     E+   C+ GNGGC   C   P+   +C C  G+ L  D   C D +EC      C     C+N  GS  C C  G+RL K++ TCEDI EC    GGC   C N +G Y C C  G  L +D  +C + N                          G  L  D +               CP G FG  C  +CS+C + G C+   +G L    C   Y+G  CE         +DC       L +PS   C+   P +C    C +G                G C+     C CP G+ G+ CE  C    FG+NC   C  A  +S  C +ITGKC C PG+YG  C  +C  G +G GC+  CSC                    Y+G                           CD  +G C C  G++G  C   C  G FG+DC   C      IC+   G C  +   G +   C + C  G  G DC K CDC++  + C+  +G C C PG  G +C+  C  GL+G  C+  C C+    CD VTG C C     GK     CP G++G  CN  CDCT          +   CD + G+C C AG+ GP C   CP G +GEGC   CQC  G +CD ++G C C  G+ G+ CE+ C EG +G  C + C C++GG C+     C+C  GW G  CE  C  G +GRNC  RC C NG  CD  +G+C+C+PGW G +C++ C S  YG  C + C+C NG  C P +G C C  G  G  C   C    +G +C  +C C  ++ CD  +G C CPK   G SC E+    +    C Q C C     C+ ++GKC CKPG  G  C   C  G FG DC Q C C NG  C+   G+C+C  G+ G  C+  C    +GP C+  C  C    TC   TGQC C  G     C   CP G +G  C++ C+C +G  CN S+G C+C  GF G  C+  CP+  YG NC   C+C+  + C+PV G C CP    G  C+ S  N  
Sbjct:    1 MKILIQLFF-IQLIRQTSGGELVDVQLQELRLGQRNVCPHEEVEIVTLKEPCVQAYTKYVRSRKPGCNGKFQSCAVRQPKTIYFHTYKKVNRTRRHTVAECCPGWVHRPGEAGC-QRANCSADL---CHNGGTCVPSEHNDNEQVCECPVGFTGAKCQYDANECMANNGGCEHECVNTIGTYYCRCWPGFELSGDGNTCSDIDECAVSNGGCSDRCVNSPGGFRCDCPSDLYLHADGRTCGKVTSC--STDNGGCEHECENDSNGEFYRCRCRVGFKLSENKRSCQPVDPCFDNKGGCQHHCTNNHGRA--QCQCYPGFHLSY-DRRSCVDIDEC-AKNNGCEHFCENVKGTYRCKCREGYQLGRDGRTC----EEMLGGCQVGNGGCQHDCYDQPDGGHVCKCRNGYILANDQKLCHDINECHENNGDCS--QICVNLAGSVECQCKPGFRLMKDRKTCEDISECSSNNGGCEQICSNQEGGYMCSCEPGFELSEDGHSCHDMNECLINNGGCAQLCKNRKGSRRCQCFAGYILAHDEKSCVAASDSADIFSNECPNGFFGSTCQLSCSDCQNGGKCSMRGSGLLSKCDCPSGYTGEKCEQICRNGYWGVDCAHKCSCKLCDPSTGSCRCEDPEKCSDGPCPDGFYGSQCNLKCRMDCPNGRCDPVFGYCTCPDGLYGQSCEKPCPHFTFGKNCRFPCKCARENSEGCDEITGKCRCKPGYYGHHCKRMCSPGLFGAGCAMKCSCPAGIRCDPVTGDCTKKCPAGYQGNLCDQPCAPNTYGPNCAHTCSCVNGAKCDESDGSCHCTPGFYGATCSEVCPTGRFGIDCMQLCKCQNGAICDTSNGSC--ECAPGWSGKKCDKACAPGTFGKDCSKKCDCAD-GMHCDPSDGECICPPGKKGHKCDETCDSGLFGAGCKGICSCQNGATCDSVTGSCECRPGWRGKKCDRPCPDGRFGEGCNAICDCTTTNDTSMYNPFVARCDHVTGECRCPAGWTGPDCQTSCPLGRHGEGCRHSCQCSNGASCDRVTGFCDCPSGFMGKNCESECPEGLWGSNCMKHCLCMHGGECNKENGDCECIDGWTGPSCEFLCPFGQFGRNCAQRCNCKNGASCDRKTGRCECLPGWSGEHCEKSCVSGHYGAKCEETCECENGALCDPISGHCSCQPGWRGKKCNRPCLKGYFGRHCSQSCRCANSKSCDHISGRCQCPKGYAGHSCTELCPDGTFGESCSQKCDCGENSMCDAISGKCFCKPGHSGSDCKSGCVQGRFGPDCNQLCSCENGGVCDSSTGSCVCPPGYIGTKCEIACQSDRFGPTCEKIC-NCENGGTCDRLTGQCRCLPGFTGMTCNQVCPEGRFGAGCKEKCRCANG-HCNASSGECKCNLGFTGPSCEQSCPSGKYGLNCTLDCECYGQARCDPVQGCCDCPPGRYGSRCQFSCPNGF 1417          

HSP 2 Score: 592.808 bits (1527), Expect = 0.000e+0
Identity = 426/1174 (36.29%), Postives = 572/1174 (48.72%), Query Frame = 3
Query:  654 GGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTC---SDE-----DECVTGKHKCVPPSTCIN--------DLGSYL---CTCPVGYRLRKNKMTCEDIDECLDYTGGCGYK-CVNTDGSYRCV---------CPNGETLGKDNKTCQNQ--NTR------------GSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTG-CLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCN--CPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDR----------LCDHVTGICYCADVAFG-KCE-ACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKES-DCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCE 3995
            G   C+C PG+ +S + ++C+DI+EC +N   C H C N+ G +RC+C     LG D   C   +  C   N GGC H C    D   +C C +G+IL  D++ C  ++ C +NNG CS +C +   S  + C+C+PG+ + + D K C+DI+EC+  NGGC+ IC N EG ++C C PG+++  D  SC+ ++      C   NGGC Q C +    R  C C  G+ L  D  +C   SD      +EC  G        +C +          GS L   C CP GY   K +  C +    +D    C  K C  + GS RC          CP+G    + N  C+    N R            G   Q   + CP  TFG+ C F C          D+ TG C C P Y G  C+  C        C  ++C C  G  C+  T  C   CP G  G +C+  C    +G NC   C +  +  +C +  G C C PG+YG++C  +CPTG +GI C + C C   N   CD  NG C+C  G+ G  C   C PG FG DCS  C       C+   G+C      G     C   C +G  G+ C+  C C +N  +C+   G C C PG+ GK+C+  C  G +GE C + C C               CDHVTG C C     G  C+ +CP G+ G  C  +C C+    CD++ G C C +G+ G  C   CPEGL+G  C K C C++G  C+  +G C C  GW G  CE  C  G +G  C ++C C NG +CD    +C+C PGW GE CEKSC  G+YG  CE  C+C NG LCD ISG C C PGWRG  C+  C    +G +C+Q C+C N   C   +G CQCP G  G  C   CP   +G +C   C C     CD  +G+C C     G  C+      +   DC Q C C     C+  TG C C PG  G +C   C+   FG  C++ C C NG  C+ + G C CL GFTG+ C+QVC +G +G  CK KC   N +  C+  +G+C C  G     C+  CPSG YG  C   C+C   A C+P  G C C  G YG+ CQF CPN FYG  C   C C + + C+   G C+CP    G  CE
Sbjct:  300 GRAQCQCYPGFHLSYDRRSCVDIDECAKN-NGCEHFCENVKGTYRCKCREGYQLGRDGRTCEEMLGGCQVGN-GGCQHDCYDQPDGGHVCKCRNGYILANDQKLCHDINECHENNGDCSQICVNLAGS--VECQCKPGFRL-MKDRKTCEDISECSSNNGGCEQICSNQEGGYMCSCEPGFELSEDGHSCHDMN-----ECLINNGGCAQLCKNRKGSRR-CQCFAGYILAHDEKSCVAASDSADIFSNECPNGFFGSTCQLSCSDCQNGGKCSMRGSGLLSKCDCPSGYTGEKCEQICRNGYWGVDCAHKCSCKLCDPSTGSCRCEDPEKCSDGPCPDGFYGSQCNLKCRMDCPNGRCDPVFGYCTCPDGLYGQSCEKPCPHFTFGKNCRFPCKCARENSEGCDEITGKCRCKPGYYGHHCKRMCSPGLFGAGCA-MKCSCPAGIRCDPVTGDCTKKCPAGYQGNLCDQPCAPNTYGPNCAHTC-SCVNGAKCDESDGSCHCTPGFYGATCSEVCPTGRFGIDCMQLCKCQ--NGAICDTSNGSCECAPGWSGKKCDKACAPGTFGKDCSKKCDCADGMHCDPSDGECICPP--GKKGHKCDETCDSGLFGAGCKGICSC-QNGATCDSVTGSCECRPGWRGKKCDRPCPDGRFGEGCNAICDCTTTNDTSMYNPFVARCDHVTGECRCPAGWTGPDCQTSCPLGRHGEGCRHSCQCSNGASCDRVTGFCDCPSGFMGKNCESECPEGLWGSNCMKHCLCMHGGECNKENGDCECIDGWTGPSCEFLCPFGQFGRNCAQRCNCKNGASCDRKTGRCECLPGWSGEHCEKSCVSGHYGAKCEETCECENGALCDPISGHCSCQPGWRGKKCNRPCLKGYFGRHCSQSCRCANSKSCDHISGRCQCPKGYAGHSCTELCPDGTFGESCSQKCDCGENSMCDAISGKCFCKPGHSGSDCKSGCVQGRFGPDCNQLCSCENGGVCDSSTGSCVCPPGYIGTKCEIACQSDRFGPTCEKICNCENGGTCDRLTGQCRCLPGFTGMTCNQVCPEGRFGAGCKEKCRCANGH--CNASSGECKCNLGFTGPSCEQSCPSGKYGLNCTLDCECYGQARCDPVQGCCDCPPGRYGSRCQFSCPNGFYGWYCSQSCSCQNGAHCDGADGRCLCPAGFQGDKCE 1453          

HSP 3 Score: 332.413 bits (851), Expect = 2.260e-93
Identity = 225/580 (38.79%), Postives = 296/580 (51.03%), Query Frame = 3
Query: 1665 CPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETG--QCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFG-KCE-ACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKESDCRQD 3392
            CP G  GE C  +C  C +   C+     C C   + G  CE +C +      C    C C +GG C  E   C C  G +G  CE  C  G FG NC + C    +   C + TG+C C PGW G  C   C +G +G  C +TC C   N   CDP +G C C+ G+ G  C   C  GYFG  CS SC       C+H +G  QCP    +G     C   CP G  G  C + CDC ENS+ C+  +G C C PG +G  C+  C +G +G  C   C C    +CD  TG C C     G KCE AC S ++GPTC + C+C     CD++ GQC CL G+ G  C++ CPEG +G GC ++C+C  G+C+  SG C+CN G+ G  CE  C  G YG  C   C+C     CD     C C PG +G  C+ SC  G+YG  C   C C NG  CDG  G+C C  G++G  C+++C   ++GP C+Q C C    KC   +G C CP GRHG +CE  C P +YG +C + C C     CD +TG+C+C     G +C+I+  D      R D
Sbjct:  984 CPLGRHGEGCRHSC-QCSNGASCDRVTGFCDCPSGFMGKNCESECPEGLWGSNCMK-HCLCMHGGECNKENGDCECIDGWTGPSCEFLCPFGQFGRNCAQRCNCK-NGASCDRKTGRCECLPGWSGEHCEKSCVSGHYGAKCEETCECE--NGALCDPISGHCSCQPGWRGKKCNRPCLKGYFGRHCSQSCRCANSKSCDHISGRCQCP----KGYAGHSCTELCPDGTFGESCSQKCDCGENSM-CDAISGKCFCKPGHSGSDCKSGCVQGRFGPDCNQLCSCENGGVCDSSTGSCVCPPGYIGTKCEIACQSDRFGPTCEKICNCENGGTCDRLTGQCRCLPGFTGMTCNQVCPEGRFGAGCKEKCRCANGHCNASSGECKCNLGFTGPSCEQSCPSGKYGLNCTLDCECYGQARCDPVQGCCDCPPGRYGSRCQFSCPNGFYGWYCSQSCSCQNGAHCDGADGRCLCPAGFQGDKCEQKCSEGSFGPACSQQCNC-GKYKCDATDGKCICPVGRHGPLCEEECRPGRYGQSCQNKCQCFNGATCDARTGQCSCSPGWLGPTCQIEMMDPNNVANRGD 1552          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Celegans
Match: Y64G10A.7 (pep chromosome:WBcel235:IV:14291901:14319564:1 gene:WBGene00013416.1 transcript:Y64G10A.7a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y64G10A.7)

HSP 1 Score: 671.003 bits (1730), Expect = 0.000e+0
Identity = 489/1400 (34.93%), Postives = 648/1400 (46.29%), Query Frame = 3
Query:  141 MRFAIIFFLTIQIIPKLSG-----AGSQKLELGMPNVCEVEQRQMIRVRRTVEVPRSKEVKVWKANCRFKGDWCLVHENKSFVEKTETSQIQMVPSIKYECCEGYAELSGYRGCIPKPNCEERIGKYCQNGAFCYQSGYNAK---CICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFI-CSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCL-----------------------------------------PGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRG-----------------------SSLQKDP----------------RRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCL----CHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIG-CTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSE-----NSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNG----------GLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIK-NCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVS 4001
            M+  I  F  IQ+I + SG        Q+L LG  NVC  E+ +++ ++       +K V+  K  C  K   C V + K+    T     +       ECC G+    G  GC  + NC   +   C NG  C  S +N     C CP GF G  C  D NEC  NNGGCE EC N  G +YC+C PG+E+S +G  C DI+EC  +   CS  CVN PGGFRC CP D+ L  D   C        S + GGC H C   S+  F  C C  G  L +++RSC  VD C DN GGC H C ++   +   C+C PG+ +   D + C DI+EC  KN GC+H C NV+G++ C C  G+Q+G D ++C     E+   C+ GNGGC   C   P+   +C C                                          PGF+L  D  TC D  EC +    C     C N  G Y+C+C  G+ L ++  +C D++ECL   GGC   C N  GS RC C  G  L  D K+C   +                          SS++  P                + CP G FG  C  +CS+C + G C+   +G L    C   Y+G  CE  C      V+C   +C CK    C+  T  C C      E C  G C +GF+G  C   C   C + RC  + G C C  G YG SC   CP  T+G  C   C C + N EGCD   GKC+CK GY+G +C   C PG FG  C+  C       C+  TG C  K   G     C + CP G  G DC + C C++      S  C    G C C PG TG  C+  C    YG  C  +C C     CD   G C+C    +G    E CP+G++G  C Q C C     CD  NG C C  G+ G KC K C  G +G+ CSK+C C  G +CDP  G C C PG  G  C+  CD G +G  CK  C C NG TCD     C+C PGW G+ C++ C  G +G  C   C C               CD ++G+C C  GW G +C   CP   +G  C   CQC NG  C    G C CP+G  G  CE  CP   +G NC+ +C+C    +C+ + G+C C     G SCE          +C Q C C    SC++ TG+C+C PG  G  C + C  G++G  C++ C C NG  C+P+ G C C  G+ G  C++ C KG++G +C   C  C  +K+C   +G+C C  G   + C   CP G +G  C Q C C   + C+  +G C C  G  G+ C+  C    +G +C   C C +   C+  TG CVCP    G  CE++
Sbjct:    1 MKILIQLFF-IQLIRQTSGGELVDVQLQELRLGQRNVCPHEEVEIVTLKEPCVQAYTKYVRSRKPGCNGKFQSCAVRQPKTIYFHTYKKVNRTRRHTVAECCPGWVHRPGEAGC-QRANCSADL---CHNGGTCVPSEHNDNEQVCECPVGFTGAKCQYDANECMANNGGCEHECVNTIGTYYCRCWPGFELSGDGNTCSDIDECAVSNGGCSDRCVNSPGGFRCDCPSDLYLHADGRTCGKVTSC--STDNGGCEHECENDSNGEFYRCRCRVGFKLSENKRSCQPVDPCFDNKGGCQHHCTNNHGRA--QCQCYPGFHLSY-DRRSCVDIDEC-AKNNGCEHFCENVKGTYRCKCREGYQLGRDGRTC----EEMLGGCQVGNGGCQHDCYDQPDGGHVCKCRNGYILANDQKLCHDINECHENNGDCSQICVNLAGSVECQCKPGFRLMKDRKTCEDISECSSNNGGC--EQICSNQEGGYMCSCEPGFELSEDGHSCHDMNECLINNGGCAQLCKNRKGSRRCQCFAGYILAHDEKSCVAASDSADIFSNDIEDYSKVPGLDSIDEVISSIESYPADESPRPLVFGRRRHVKECPNGFFGSTCQLSCSDCQNGGKCSMRGSGLLSKCDCPSGYTGEKCEQICRNGYWGVDCA-HKCSCK---LCDPSTGSCRCE---DPEKCSDGPCPDGFYGSQCNLKCRMDCPNGRCDPVFGYCTCPDGLYGQSCEKPCPHFTFGKNCRFPCKCARENSEGCDEITGKCRCKPGYYGHHCKRMCSPGLFGAGCAMKCSCPAGIRCDPVTGDCTKKCPAGYQGNLCDQPCPAGYFGYDCEQKCSCADVASPHKSKVCHHVTGTCTCLPGKTGPLCDQSCAPNTYGPNCAHTCSCVNGAKCDESDGSCHCTPGFYGATCSEVCPTGRFGIDCMQLCKCQNGAICDTSNGSCECAPGWSGKKCDKACAPGTFGKDCSKKCDCADGMHCDPSDGECICPPGKKGHKCDETCDSGLFGAGCKGICSCQNGATCDSVTGSCECRPGWRGKKCDRPCPDGRFGEGCNAICDCTTTNDTSMYNPFVARCDHVTGECRCPAGWTGPDCQTSCPLGRHGEGCRHSCQCSNGASCDRVTGFCDCPSGFMGKNCESECPEGLWGSNCMKHCLCMHGGECNKENGDCECIDGWTGPSCEFLCPFGQFGRNCAQRCNCKNGASCDRKTGRCECLPGWSGEHCEKSCVSGHYGAKCEETCECENGALCDPISGHCSCQPGWRGKKCNRPCLKGYFGRHCSQSCR-CANSKSCDHISGRCQCPKGYAGHSCTELCPDGTFGESCSQKCDCGENSMCDAISGKCFCKPGHSGSDCKSGCVQGRFGPDCNQLCSCENGGVCDSSTGSCVCPPGYIGTKCEIA 1375          

HSP 2 Score: 554.288 bits (1427), Expect = 3.594e-171
Identity = 425/1230 (34.55%), Postives = 573/1230 (46.59%), Query Frame = 3
Query:  654 GGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHP-----------------------------------------GWQIGHDHKSCY----KVDMELTDPCKY----GNGGCTQFCNS--------SPN------KRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYK-CVNTDGSYRCV---------CPNGETLGKDNKTCQNQ--NTR------------GSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTG-CLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCN--CPPGISGEICEIGCTEGFFGENCEKNCPTA-----CSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCT----------YSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSC-EIKNCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVSVINRL 4016
            G   C+C PG+ +S + ++C+DI+EC +N   C H C N+ G +RC+C     LG D   C   +  C   N GGC H C    D   +C C +G+IL  D++ C  ++ C +NNG CS +C +   S  + C+C+PG+ + + D K C+DI+EC+  NGGC+ IC N EG ++C C P                                         G+ + HD KSC       D+   D   Y    G     +  +S        SP       +R +  C  GF      L+CSD   C  G    +  S  ++      C CP GY   K +  C +    +D    C  K C  + GS RC          CP+G    + N  C+    N R            G   Q   + CP  TFG+ C F C          D+ TG C C P Y G  C+  C        C  ++C C  G  C+  T  C   CP G  G +C+  C  G+FG +CE+ C  A       S  CH +TG C C PG  G  C   C   T+G  C+ TCSC   N   CD  +G C C  G++G  C   C  G FG+DC   C      IC+   G C  +   G +   C + C  G  G DC K CDC++  + C+  +G C C PG  G +C+  C  GL+G  C+  C C+    CD VTG C C     GK     CP G++G  CN  CDCT          +   CD + G+C C AG+ GP C   CP G +GEGC   CQC  G +CD ++G C C  G+ G+ CE+ C EG +G  C + C C++GG C+     C+C  GW G  CE  C  G +GRNC  RC C NG  CD  +G+C+C+PGW G +C++ C S  YG  C + C+C NG  C P +G C C  G  G  C   C    +G +C  +C C  ++ CD  +G C CPK   G SC E+    +    C Q C C     C+ ++GKC CKPG  G  C   C  G FG DC Q C C NG  C+   G+C+C  G+ G  C+  C    +GP C+  C  C    TC   TGQC C  G     C   CP G +G  C++ C+C +G  CN S+G C+C  GF G  C+  CP+  YG NC   C+C+  + C+PV G C CP    G  C+ S  N  
Sbjct:  300 GRAQCQCYPGFHLSYDRRSCVDIDECAKN-NGCEHFCENVKGTYRCKCREGYQLGRDGRTCEEMLGGCQVGN-GGCQHDCYDQPDGGHVCKCRNGYILANDQKLCHDINECHENNGDCSQICVNLAGS--VECQCKPGFRL-MKDRKTCEDISECSSNNGGCEQICSNQEGGYMCSCEPGFELSEDGHSCHDMNECLINNGGCAQLCKNRKGSRRCQCFAGYILAHDEKSCVAASDSADIFSNDIEDYSKVPGLDSIDEVISSIESYPADESPRPLVFGRRRHVKECPNGFFGSTCQLSCSD---CQNGGKCSMRGSGLLSK-----CDCPSGYTGEKCEQICRNGYWGVDCAHKCSCKLCDPSTGSCRCEDPEKCSDGPCPDGFYGSQCNLKCRMDCPNGRCDPVFGYCTCPDGLYGQSCEKPCPHFTFGKNCRFPCKCARENSEGCDEITGKCRCKPGYYGHHCKRMCSPGLFGAGCA-MKCSCPAGIRCDPVTGDCTKKCPAGYQGNLCDQPCPAGYFGYDCEQKCSCADVASPHKSKVCHHVTGTCTCLPGKTGPLCDQSCAPNTYGPNCAHTCSCV--NGAKCDESDGSCHCTPGFYGATCSEVCPTGRFGIDCMQLCKCQNGAICDTSNGSC--ECAPGWSGKKCDKACAPGTFGKDCSKKCDCAD-GMHCDPSDGECICPPGKKGHKCDETCDSGLFGAGCKGICSCQNGATCDSVTGSCECRPGWRGKKCDRPCPDGRFGEGCNAICDCTTTNDTSMYNPFVARCDHVTGECRCPAGWTGPDCQTSCPLGRHGEGCRHSCQCSNGASCDRVTGFCDCPSGFMGKNCESECPEGLWGSNCMKHCLCMHGGECNKENGDCECIDGWTGPSCEFLCPFGQFGRNCAQRCNCKNGASCDRKTGRCECLPGWSGEHCEKSCVSGHYGAKCEETCECENGALCDPISGHCSCQPGWRGKKCNRPCLKGYFGRHCSQSCRCANSKSCDHISGRCQCPKGYAGHSCTELCPDGTFGESCSQKCDCGENSMCDAISGKCFCKPGHSGSDCKSGCVQGRFGPDCNQLCSCENGGVCDSSTGSCVCPPGYIGTKCEIACQSDRFGPTCEKIC-NCENGGTCDRLTGQCRCLPGFTGMTCNQVCPEGRFGAGCKEKCRCANG-HCNASSGECKCNLGFTGPSCEQSCPSGKYGLNCTLDCECYGQARCDPVQGCCDCPPGRYGSRCQFSCPNGF 1508          

HSP 3 Score: 456.062 bits (1172), Expect = 1.725e-135
Identity = 314/830 (37.83%), Postives = 399/830 (48.07%), Query Frame = 3
Query: 1560 SYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCS----NCMHKGYCNDDQTG-CLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENS---------VSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK-CEA-CPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIK-NCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCE 3995
            + +C CP G         C  +   G       + CP G FG +C   CS       HK       TG C C P  +G +C+  C  N     C    C C NG  C+     C+C PG  G  C   C  G FG +C + C    +   C    G C C PGW G  C   C  GT+G  CSK C C    +  CDP +G+C C  G  G  C   CD G FG  C   C       C+  TG C  +   G     C R CP G  G  C   CDC+  +           C+   G C C  G+TG  C+  C  G +GE C+ SCQC     CD VTG C C     GK CE+ CP G WG  C ++C C +   C++ NG C C+ G+ GP C   CP G +G  C++ C C  G +CD  +G C C PGW GE CE  C  G+YG +C+E C+C NG  CD     C C+PGW G+ C + C  GY+GR+C   C+C N   CD ISG+C C  G+ G +C E CP  T+G +C+Q C C     C   +G C C  G  G  C+  C   ++GP+C   C C+    CD  TG C CP    G  CEI    D     C + C C    +C+++TG+C+C PG  G  C Q+C  G FG  CK+KCRCANG  CN   G C C  GFTG  C+Q C  G YG NC L C  C     C P  G C C  G     C+  CP+G+YG  C Q+C C +GA C+ + G C C +GF G  C+ +C    +G  C  +C C     C+   G C+CP    G  CE
Sbjct:  766 AMKCSCPAGIRCDPVTGDCTKKCPAGYQGNLCDQPCPAGYFGYDCEQKCSCADVASPHKSKVCHHVTGTCTCLPGKTGPLCDQSCAPNTYGPNCAHT-CSCVNGAKCDESDGSCHCTPGFYGATCSEVCPTGRFGIDCMQLCKCQ-NGAICDTSNGSCECAPGWSGKKCDKACAPGTFGKDCSKKCDCADGMH--CDPSDGECICPPGKKGHKCDETCDSGLFGAGCKGICSCQNGATCDSVTGSCECRP--GWRGKKCDRPCPDGRFGEGCNAICDCTTTNDTSMYNPFVARCDHVTGECRCPAGWTGPDCQTSCPLGRHGEGCRHSCQCSNGASCDRVTGFCDCPSGFMGKNCESECPEGLWGSNCMKHCLCMHGGECNKENGDCECIDGWTGPSCEFLCPFGQFGRNCAQRCNCKNGASCDRKTGRCECLPGWSGEHCEKSCVSGHYGAKCEETCECENGALCDPISGHCSCQPGWRGKKCNRPCLKGYFGRHCSQSCRCANSKSCDHISGRCQCPKGYAGHSCTELCPDGTFGESCSQKCDCGENSMCDAISGKCFCKPGHSGSDCKSGCVQGRFGPDCNQLCSCENGGVCDSSTGSCVCPPGYIGTKCEIACQSDRFGPTCEKICNCENGGTCDRLTGQCRCLPGFTGMTCNQVCPEGRFGAGCKEKCRCANGH-CNASSGECKCNLGFTGPSCEQSCPSGKYGLNCTLDC-ECYGQARCDPVQGCCDCPPGRYGSRCQFSCPNGFYGWYCSQSCSCQNGAHCDGADGRCLCPAGFQGDKCEQKCSEGSFGPACSQQCNC-GKYKCDATDGKCICPVGRHGPLCE 1586          

HSP 4 Score: 333.569 bits (854), Expect = 1.519e-93
Identity = 225/580 (38.79%), Postives = 296/580 (51.03%), Query Frame = 3
Query: 1665 CPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETG--QCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFG-KCE-ACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKESDCRQD 3392
            CP G  GE C  +C  C +   C+     C C   + G  CE +C +      C    C C +GG C  E   C C  G +G  CE  C  G FG NC + C    +   C + TG+C C PGW G  C   C +G +G  C +TC C   N   CDP +G C C+ G+ G  C   C  GYFG  CS SC       C+H +G  QCP    +G     C   CP G  G  C + CDC ENS+ C+  +G C C PG +G  C+  C +G +G  C   C C    +CD  TG C C     G KCE AC S ++GPTC + C+C     CD++ GQC CL G+ G  C++ CPEG +G GC ++C+C  G+C+  SG C+CN G+ G  CE  C  G YG  C   C+C     CD     C C PG +G  C+ SC  G+YG  C   C C NG  CDG  G+C C  G++G  C+++C   ++GP C+Q C C    KC   +G C CP GRHG +CE  C P +YG +C + C C     CD +TG+C+C     G +C+I+  D      R D
Sbjct: 1075 CPLGRHGEGCRHSC-QCSNGASCDRVTGFCDCPSGFMGKNCESECPEGLWGSNCMK-HCLCMHGGECNKENGDCECIDGWTGPSCEFLCPFGQFGRNCAQRCNCK-NGASCDRKTGRCECLPGWSGEHCEKSCVSGHYGAKCEETCECE--NGALCDPISGHCSCQPGWRGKKCNRPCLKGYFGRHCSQSCRCANSKSCDHISGRCQCP----KGYAGHSCTELCPDGTFGESCSQKCDCGENSM-CDAISGKCFCKPGHSGSDCKSGCVQGRFGPDCNQLCSCENGGVCDSSTGSCVCPPGYIGTKCEIACQSDRFGPTCEKICNCENGGTCDRLTGQCRCLPGFTGMTCNQVCPEGRFGAGCKEKCRCANGHCNASSGECKCNLGFTGPSCEQSCPSGKYGLNCTLDCECYGQARCDPVQGCCDCPPGRYGSRCQFSCPNGFYGWYCSQSCSCQNGAHCDGADGRCLCPAGFQGDKCEQKCSEGSFGPACSQQCNC-GKYKCDATDGKCICPVGRHGPLCEEECRPGRYGQSCQNKCQCFNGATCDARTGQCSCSPGWLGPTCQIEMMDPNNVANRGD 1643          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Celegans
Match: Y64G10A.7 (pep chromosome:WBcel235:IV:14291901:14319564:1 gene:WBGene00013416.1 transcript:Y64G10A.7d.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y64G10A.7)

HSP 1 Score: 666.766 bits (1719), Expect = 0.000e+0
Identity = 511/1481 (34.50%), Postives = 680/1481 (45.91%), Query Frame = 3
Query:  141 MRFAIIFFLTIQIIPKLSG-----AGSQKLELGMPNVCEVEQRQMIRVRRTVEVPRSKEVKVWKANCRFKGDWCLVHENKSFVEKTETSQIQMVPSIKYECCEGYAELSGYRGCIPKPNCEERIGKYCQNGAFCYQSGYNAK---CICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFI-CSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCL-----------------------------------------PGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRG-----------------------SSLQKDP----------------RRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCL----CHPNYSGTICE---------IDC-------LQNPSQVECQ---PLQCH---CKNG----------------GTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTAC-SSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQN----------------NYEG---------------------------CDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCT----------YSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSC-EIKNCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVSVINRL 4016
            M+  I  F  IQ+I + SG        Q+L LG  NVC  E+ +++ ++       +K V+  K  C  K   C V + K+    T     +       ECC G+    G  GC  + NC   +   C NG  C  S +N     C CP GF G  C  D NEC  NNGGCE EC N  G +YC+C PG+E+S +G  C DI+EC  +   CS  CVN PGGFRC CP D+ L  D   C        S + GGC H C   S+  F  C C  G  L +++RSC  VD C DN GGC H C ++   +   C+C PG+ +   D + C DI+EC  KN GC+H C NV+G++ C C  G+Q+G D ++C     E+   C+ GNGGC   C   P+   +C C                                          PGF+L  D  TC D  EC +    C     C N  G Y+C+C  G+ L ++  +C D++ECL   GGC   C N  GS RC C  G  L  D K+C   +                          SS++  P                + CP G FG  C  +CS+C + G C+   +G L    C   Y+G  CE         +DC       L +PS   C+   P +C    C +G                G C+     C CP G+ G+ CE  C    FG+NC   C  A  +S  C +ITGKC C PG+YG  C  +C  G +G GC+  CSC                    Y+G                           CD  +G C C  G++G  C   C  G FG+DC   C      IC+   G C  +   G +   C + C  G  G DC K CDC++  + C+  +G C C PG  G +C+  C  GL+G  C+  C C+    CD VTG C C     GK     CP G++G  CN  CDCT          +   CD + G+C C AG+ GP C   CP G +GEGC   CQC  G +CD ++G C C  G+ G+ CE+ C EG +G  C + C C++GG C+     C+C  GW G  CE  C  G +GRNC  RC C NG  CD  +G+C+C+PGW G +C++ C S  YG  C + C+C NG  C P +G C C  G  G  C   C    +G +C  +C C  ++ CD  +G C CPK   G SC E+    +    C Q C C     C+ ++GKC CKPG  G  C   C  G FG DC Q C C NG  C+   G+C+C  G+ G  C+  C    +GP C+  C  C    TC   TGQC C  G     C   CP G +G  C++ C+C +G  CN S+G C+C  GF G  C+  CP+  YG NC   C+C+  + C+PV G C CP    G  C+ S  N  
Sbjct:    1 MKILIQLFF-IQLIRQTSGGELVDVQLQELRLGQRNVCPHEEVEIVTLKEPCVQAYTKYVRSRKPGCNGKFQSCAVRQPKTIYFHTYKKVNRTRRHTVAECCPGWVHRPGEAGC-QRANCSADL---CHNGGTCVPSEHNDNEQVCECPVGFTGAKCQYDANECMANNGGCEHECVNTIGTYYCRCWPGFELSGDGNTCSDIDECAVSNGGCSDRCVNSPGGFRCDCPSDLYLHADGRTCGKVTSC--STDNGGCEHECENDSNGEFYRCRCRVGFKLSENKRSCQPVDPCFDNKGGCQHHCTNNHGRA--QCQCYPGFHLSY-DRRSCVDIDEC-AKNNGCEHFCENVKGTYRCKCREGYQLGRDGRTC----EEMLGGCQVGNGGCQHDCYDQPDGGHVCKCRNGYILANDQKLCHDINECHENNGDCSQICVNLAGSVECQCKPGFRLMKDRKTCEDISECSSNNGGC--EQICSNQEGGYMCSCEPGFELSEDGHSCHDMNECLINNGGCAQLCKNRKGSRRCQCFAGYILAHDEKSCVAASDSADIFSNDIEDYSKVPGLDSIDEVISSIESYPADESPRPLVFGRRRHVKECPNGFFGSTCQLSCSDCQNGGKCSMRGSGLLSKCDCPSGYTGEKCEQICRNGYWGVDCAHKCSCKLCDPSTGSCRCEDPEKCSDGPCPDGFYGSQCNLKCRMDCPNGRCDPVFGYCTCPDGLYGQSCEKPCPHFTFGKNCRFPCKCARENSEGCDEITGKCRCKPGYYGHHCKRMCSPGLFGAGCAMKCSCPAGIRCDPVTGDCTKKCPAGYQGNLCDQPCAPNTYGPNCAHTCSCVNGAKCDESDGSCHCTPGFYGATCSEVCPTGRFGIDCMQLCKCQNGAICDTSNGSC--ECAPGWSGKKCDKACAPGTFGKDCSKKCDCAD-GMHCDPSDGECICPPGKKGHKCDETCDSGLFGAGCKGICSCQNGATCDSVTGSCECRPGWRGKKCDRPCPDGRFGEGCNAICDCTTTNDTSMYNPFVARCDHVTGECRCPAGWTGPDCQTSCPLGRHGEGCRHSCQCSNGASCDRVTGFCDCPSGFMGKNCESECPEGLWGSNCMKHCLCMHGGECNKENGDCECIDGWTGPSCEFLCPFGQFGRNCAQRCNCKNGASCDRKTGRCECLPGWSGEHCEKSCVSGHYGAKCEETCECENGALCDPISGHCSCQPGWRGKKCNRPCLKGYFGRHCSQSCRCANSKSCDHISGRCQCPKGYAGHSCTELCPDGTFGESCSQKCDCGENSMCDAISGKCFCKPGHSGSDCKSGCVQGRFGPDCNQLCSCENGGVCDSSTGSCVCPPGYIGTKCEIACQSDRFGPTCEKIC-NCENGGTCDRLTGQCRCLPGFTGMTCNQVCPEGRFGAGCKEKCRCANG-HCNASSGECKCNLGFTGPSCEQSCPSGKYGLNCTLDCECYGQARCDPVQGCCDCPPGRYGSRCQFSCPNGF 1459          

HSP 2 Score: 559.296 bits (1440), Expect = 2.045e-173
Identity = 423/1218 (34.73%), Postives = 568/1218 (46.63%), Query Frame = 3
Query:  654 GGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHP-----------------------------------------GWQIGHDHKSCY----KVDMELTDPCKY----GNGGCTQFCNS--------SPN------KRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYK-CVNTDGSYRCV---------CPNGETLGKDNKTCQNQ--NTR------------GSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTG-CLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCN--CPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDR----------LCDHVTGICYCADVAFG-KCE-ACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKES-DCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCE 3995
            G   C+C PG+ +S + ++C+DI+EC +N   C H C N+ G +RC+C     LG D   C   +  C   N GGC H C    D   +C C +G+IL  D++ C  ++ C +NNG CS +C +   S  + C+C+PG+ + + D K C+DI+EC+  NGGC+ IC N EG ++C C P                                         G+ + HD KSC       D+   D   Y    G     +  +S        SP       +R +  C  GF      L+CSD   C  G    +  S  ++      C CP GY   K +  C +    +D    C  K C  + GS RC          CP+G    + N  C+    N R            G   Q   + CP  TFG+ C F C          D+ TG C C P Y G  C+  C        C  ++C C  G  C+  T  C   CP G  G +C+  C    +G NC   C +  +  +C +  G C C PG+YG++C  +CPTG +GI C + C C   N   CD  NG C+C  G+ G  C   C PG FG DCS  C       C+   G+C      G     C   C +G  G+ C+  C C +N  +C+   G C C PG+ GK+C+  C  G +GE C + C C               CDHVTG C C     G  C+ +CP G+ G  C  +C C+    CD++ G C C +G+ G  C   CPEGL+G  C K C C++G  C+  +G C C  GW G  CE  C  G +G  C ++C C NG +CD    +C+C PGW GE CEKSC  G+YG  CE  C+C NG LCD ISG C C PGWRG  C+  C    +G +C+Q C+C N   C   +G CQCP G  G  C   CP   +G +C   C C     CD  +G+C C     G  C+      +   DC Q C C     C+  TG C C PG  G +C   C+   FG  C++ C C NG  C+ + G C CL GFTG+ C+QVC +G +G  CK KC   N +  C+  +G+C C  G     C+  CPSG YG  C   C+C   A C+P  G C C  G YG+ CQF CPN FYG  C   C C + + C+   G C+CP    G  CE
Sbjct:  300 GRAQCQCYPGFHLSYDRRSCVDIDECAKN-NGCEHFCENVKGTYRCKCREGYQLGRDGRTCEEMLGGCQVGN-GGCQHDCYDQPDGGHVCKCRNGYILANDQKLCHDINECHENNGDCSQICVNLAGS--VECQCKPGFRL-MKDRKTCEDISECSSNNGGCEQICSNQEGGYMCSCEPGFELSEDGHSCHDMNECLINNGGCAQLCKNRKGSRRCQCFAGYILAHDEKSCVAASDSADIFSNDIEDYSKVPGLDSIDEVISSIESYPADESPRPLVFGRRRHVKECPNGFFGSTCQLSCSD---CQNGGKCSMRGSGLLSK-----CDCPSGYTGEKCEQICRNGYWGVDCAHKCSCKLCDPSTGSCRCEDPEKCSDGPCPDGFYGSQCNLKCRMDCPNGRCDPVFGYCTCPDGLYGQSCEKPCPHFTFGKNCRFPCKCARENSEGCDEITGKCRCKPGYYGHHCKRMCSPGLFGAGCA-MKCSCPAGIRCDPVTGDCTKKCPAGYQGNLCDQPCAPNTYGPNCAHTC-SCVNGAKCDESDGSCHCTPGFYGATCSEVCPTGRFGIDCMQLCKCQ--NGAICDTSNGSCECAPGWSGKKCDKACAPGTFGKDCSKKCDCADGMHCDPSDGECICPP--GKKGHKCDETCDSGLFGAGCKGICSC-QNGATCDSVTGSCECRPGWRGKKCDRPCPDGRFGEGCNAICDCTTTNDTSMYNPFVARCDHVTGECRCPAGWTGPDCQTSCPLGRHGEGCRHSCQCSNGASCDRVTGFCDCPSGFMGKNCESECPEGLWGSNCMKHCLCMHGGECNKENGDCECIDGWTGPSCEFLCPFGQFGRNCAQRCNCKNGASCDRKTGRCECLPGWSGEHCEKSCVSGHYGAKCEETCECENGALCDPISGHCSCQPGWRGKKCNRPCLKGYFGRHCSQSCRCANSKSCDHISGRCQCPKGYAGHSCTELCPDGTFGESCSQKCDCGENSMCDAISGKCFCKPGHSGSDCKSGCVQGRFGPDCNQLCSCENGGVCDSSTGSCVCPPGYIGTKCEIACQSDRFGPTCEKICNCENGGTCDRLTGQCRCLPGFTGMTCNQVCPEGRFGAGCKEKCRCANGH--CNASSGECKCNLGFTGPSCEQSCPSGKYGLNCTLDCECYGQARCDPVQGCCDCPPGRYGSRCQFSCPNGFYGWYCSQSCSCQNGAHCDGADGRCLCPAGFQGDKCE 1495          

HSP 3 Score: 395.971 bits (1016), Expect = 1.059e-114
Identity = 274/736 (37.23%), Postives = 375/736 (50.95%), Query Frame = 3
Query: 1569 CVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSN---------RCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK--CEACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN-CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKES-DCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCK 3737
            C C NG      N +C+     G S +K  + C  GTFG++C   C +C    +C+     C+C P   G  C+  C        C+ + C C+NG TC+S T  C C PG  G+ C+  C +G FGE C   C    +++         RC  +TG+C C  GW G  C   CP G  G GC  +C C+  N   CD   G C C  G+ G NC  +C  G +G +C   C       CN E G C  +   G     C+  CP G  G +C + C+C +N  SC+ K G C C PG++G+ CE  C  G YG +C+ +C+C    LCD ++G C C     GK     C  G +G  C+Q+C C  S  CD I+G+C C  GY G  C++ CP+G +GE CS++C C   + CD ISG C C PG  G  C++ C +G +G  C + C C NGG CD     C C PG+ G  CE +C    +G  CE  C C NGG CD ++G+C C+PG+ G+ C++ CP   +G  C + C+C NG  C+  +G C+C  G  G  CE +CP  KYG NC  +C C    +CD   G C CP   +G  C+    +      C Q C C     C+   G+C C  G +G +C Q C  G+FG  C Q+C C   + C+  DG C+C  G  G LC++ C  G YG +C+ KC  C    TC  +TGQCSC  G +   C+
Sbjct:  857 CKCQNGAICDTSNGSCEC--APGWSGKKCDKACAPGTFGKDCSKKC-DCADGMHCDPSDGECICPPGKKGHKCDETCDSGLFGAGCKGI-CSCQNGATCDSVTGSCECRPGWRGKKCDRPCPDGRFGEGCNAICDCTTTNDTSMYNPFVARCDHVTGECRCPAGWTGPDCQTSCPLGRHGEGCRHSCQCS--NGASCDRVTGFCDCPSGFMGKNCESECPEGLWGSNCMKHCLCMHGGECNKENGDC--ECIDGWTGPSCEFLCPFGQFGRNCAQRCNC-KNGASCDRKTGRCECLPGWSGEHCEKSCVSGHYGAKCEETCECENGALCDPISGHCSCQPGWRGKKCNRPCLKGYFGRHCSQSCRCANSKSCDHISGRCQCPKGYAGHSCTELCPDGTFGESCSQKCDCGENSMCDAISGKCFCKPGHSGSDCKSGCVQGRFGPDCNQLCSCENGGVCDSSTGSCVCPPGYIGTKCEIACQSDRFGPTCEKICNCENGGTCDRLTGQCRCLPGFTGMTCNQVCPEGRFGAGCKEKCRCANG-HCNASSGECKCNLGFTGPSCEQSCPSGKYGLNCTLDCECYGQARCDPVQGCCDCPPGRYGSRCQFSCPNGFYGWYCSQSCSCQNGAHCDGADGRCLCPAGFQGDKCEQKCSEGSFGPACSQQCNCGKYK-CDATDGKCICPVGRHGPLCEEECRPGRYGQSCQNKCQ-CFNGATCDARTGQCSCSPGWLGPTCQ 1580          

HSP 4 Score: 333.183 bits (853), Expect = 1.545e-93
Identity = 225/580 (38.79%), Postives = 296/580 (51.03%), Query Frame = 3
Query: 1665 CPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETG--QCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFG-KCE-ACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKESDCRQD 3392
            CP G  GE C  +C  C +   C+     C C   + G  CE +C +      C    C C +GG C  E   C C  G +G  CE  C  G FG NC + C    +   C + TG+C C PGW G  C   C +G +G  C +TC C   N   CDP +G C C+ G+ G  C   C  GYFG  CS SC       C+H +G  QCP    +G     C   CP G  G  C + CDC ENS+ C+  +G C C PG +G  C+  C +G +G  C   C C    +CD  TG C C     G KCE AC S ++GPTC + C+C     CD++ GQC CL G+ G  C++ CPEG +G GC ++C+C  G+C+  SG C+CN G+ G  CE  C  G YG  C   C+C     CD     C C PG +G  C+ SC  G+YG  C   C C NG  CDG  G+C C  G++G  C+++C   ++GP C+Q C C    KC   +G C CP GRHG +CE  C P +YG +C + C C     CD +TG+C+C     G +C+I+  D      R D
Sbjct: 1026 CPLGRHGEGCRHSC-QCSNGASCDRVTGFCDCPSGFMGKNCESECPEGLWGSNCMK-HCLCMHGGECNKENGDCECIDGWTGPSCEFLCPFGQFGRNCAQRCNCK-NGASCDRKTGRCECLPGWSGEHCEKSCVSGHYGAKCEETCECE--NGALCDPISGHCSCQPGWRGKKCNRPCLKGYFGRHCSQSCRCANSKSCDHISGRCQCP----KGYAGHSCTELCPDGTFGESCSQKCDCGENSM-CDAISGKCFCKPGHSGSDCKSGCVQGRFGPDCNQLCSCENGGVCDSSTGSCVCPPGYIGTKCEIACQSDRFGPTCEKICNCENGGTCDRLTGQCRCLPGFTGMTCNQVCPEGRFGAGCKEKCRCANGHCNASSGECKCNLGFTGPSCEQSCPSGKYGLNCTLDCECYGQARCDPVQGCCDCPPGRYGSRCQFSCPNGFYGWYCSQSCSCQNGAHCDGADGRCLCPAGFQGDKCEQKCSEGSFGPACSQQCNC-GKYKCDATDGKCICPVGRHGPLCEEECRPGRYGQSCQNKCQCFNGATCDARTGQCSCSPGWLGPTCQIEMMDPNNVANRGD 1594          

HSP 5 Score: 266.929 bits (681), Expect = 2.765e-72
Identity = 204/571 (35.73%), Postives = 279/571 (48.86%), Query Frame = 3
Query: 1392 KHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQC--PDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINC 3089
            +H C   +    D  +  C CP G+  +  +  C +        G  G  C+       C+C +G    K+N  C+  +  G +       CP G FG  C   C NC +   C+     C C P +SG  CE  C+      +C+   C C+NG  C+  +  C+C PG  G+ C   C +G+FG +C ++C  A +S  C  I+G+C C  G+ G SC  LCP GT+G  CS+ C C +N+   CD  +GKC CK G+ G +C   C  G FG DC+  C  +   +C+  TG C  P         I CQ D      G  C K C+C EN  +C+   G C C PGFTG  C   C +G +G  C+  C+C     C+  +G C C     G    ++CPSGK+G  C  +C+C     CD + G C C  G YG +C   CP G YG  CS+ C C  G +CD   G C C  G+ G+ CE  C EG +G  C ++C C     CD    KC C  G HG  CE+ C  G YG++C+ +CQC NG  CD  +G+C C PGW G  C
Sbjct: 1036 RHSCQCSNGASCDRVTGFCDCPSGFMGKNCESECPE--------GLWGSNCMK-----HCLCMHGGECNKENGDCECID--GWTGPSCEFLCPFGQFGRNCAQRC-NCKNGASCDRKTGRCECLPGWSGEHCEKSCVSGHYGAKCEET-CECENGALCDPISGHCSCQPGWRGKKCNRPCLKGYFGRHCSQSCRCA-NSKSCDHISGRCQCPKGYAGHSCTELCPDGTFGESCSQKCDCGENSM--CDAISGKCFCKPGHSGSDCKSGCVQGRFGPDCNQLCSCENGGVCDSSTGSCVCPPGYIGTKCEIACQSD----RFGPTCEKICNC-ENGGTCDRLTGQCRCLPGFTGMTCNQVCPEGRFGAGCKEKCRCANGH-CNASSGECKCNLGFTGPSCEQSCPSGKYGLNCTLDCECYGQARCDPVQGCCDCPPGRYGSRCQFSCPNGFYGWYCSQSCSCQNGAHCDGADGRCLCPAGFQGDKCEQKCSEGSFGPACSQQCNC-GKYKCDATDGKCICPVGRHGPLCEEECRPGRYGQSCQNKCQCFNGATCDARTGQCSCSPGWLGPTC 1579          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Celegans
Match: Y64G10A.7 (pep chromosome:WBcel235:IV:14291901:14319564:1 gene:WBGene00013416.1 transcript:Y64G10A.7b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y64G10A.7)

HSP 1 Score: 602.053 bits (1551), Expect = 0.000e+0
Identity = 476/1425 (33.40%), Postives = 644/1425 (45.19%), Query Frame = 3
Query:  141 MRFAIIFFLTIQIIPKLSG-----AGSQKLELGMPNVCEVEQRQMIRVRRTVEVPRSKEVKVWKANCRFKGDWCLVHENKSFVEKTETSQIQMVPSIKYECCEGYAELSGYRGCIPKPNCEERIGKYCQNGAFCYQSGYNAK---CICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFI-CSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHK-----------CVPPS------TCIN-DLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQN------------------------TRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCL--QNPSQVECQPLQCHCKNGG---------TCESETLKCNCPPGISGEICEIG-CTEGFFGENCEKNCPTACSSNRCHQ----ITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKT-ICNHETG--QCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCS-ENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTG------------------------------ICYCADVA-----------FGKC------------EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN-CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNG----------GKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKE-SDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVSVI 4007
            M+  I  F  IQ+I + SG        Q+L LG  NVC  E+ +++ ++       +K V+  K  C  K   C V + K+    T     +       ECC G+    G  GC  + NC   +   C NG  C  S +N     C CP GF G  C  D NEC  NNGGCE EC N  G +YC+C PG+E+S +G  C DI+EC  +   CS  CVN PGGFRC CP D+ L  D   C        S + GGC H C   S+  F  C C  G  L +++RSC  VD C DN GGC H C ++   +   C+C PG+ +   D + C DI+EC  KN GC+H C NV+G++ C C  G+Q+G D ++C     E+   C+ GNGGC   C   P+   +C C  G+ L  D   C D    V                CV P+       C++ D G   C C  GY L  +K  C+DI+EC +  G C   CVN  GS  C C  G  L KD KTC++ +                          G  L +D   C       ECL N   C            C C   Y     E  C+   + + +    ++ + K  G         + ES     +  P + G    +  C  GFFG  C+ +C    +  +C      +  KC C  G+ G  C  +C  G WG+ C+  CSC       CDP  G C+C+      +    C  G++G  C+  C  DC    C+   G   CPD    G     C++ CP    G +CR  C C+ ENS  C+E  G C C PG+ G  C+  C+ GL+G  C   C C     CD VTG                               C CADVA            G C            ++C    +GP C   C C     CD+ +G C C  G+YG  CS+ CP G +G  C + C+C  G  CD  +G C C PGW G+ C+  C  G +G  C +KC C +G  CD    +C C PG  G  C+++C  G +G  C+G C C NG  CD ++G C+C PGWRG  CD  CP   +G  CN +C C              +C    G C+CPAG  G  C+ +CP  ++G  C H+C C     CD  TG C CP    G +CE +  +    S+C + C C     CN+  G C+C  G  GP C  +C FG FG +C Q+C C NG  C+   G C CL G++G  C++ C  G YG  C+  C  C     C P +G CSC+ G     C   C  GY+G  C Q+C+C +  SC+  +G CQC  G+ G  C   CP+  +G +C  +C C  NS C+ ++G C C    SG  C+   +
Sbjct:    1 MKILIQLFF-IQLIRQTSGGELVDVQLQELRLGQRNVCPHEEVEIVTLKEPCVQAYTKYVRSRKPGCNGKFQSCAVRQPKTIYFHTYKKVNRTRRHTVAECCPGWVHRPGEAGC-QRANCSADL---CHNGGTCVPSEHNDNEQVCECPVGFTGAKCQYDANECMANNGGCEHECVNTIGTYYCRCWPGFELSGDGNTCSDIDECAVSNGGCSDRCVNSPGGFRCDCPSDLYLHADGRTCGKVTSC--STDNGGCEHECENDSNGEFYRCRCRVGFKLSENKRSCQPVDPCFDNKGGCQHHCTNNHGRA--QCQCYPGFHLSY-DRRSCVDIDEC-AKNNGCEHFCENVKGTYRCKCREGYQLGRDGRTC----EEMLGGCQVGNGGCQHDCYDQPDGGHVCKCRNGYILANDQKLCHDNISTVIHARAPRLWDSYETVTCVTPTDLTCHKLCMHLDSGHVQCFCDDGYELIDSKF-CQDINECHENNGDCSQICVNLAGSVECQCKPGFRLMKDRKTCEDISECSSNNGGCEQICSNQEGGYMCSCEPGFELSEDGHSCHDMN---ECLINNGGCAQLCKNRKGSRRCQCFAGYILAHDEKSCVAASDSADIFSNDIEDYSKVPGLDSIDEVISSIESYPADESPRPLVFGRRRHVKECPNGFFGSTCQLSCSDCQNGGKCSMRGSGLLSKCDCPSGYTGEKCEQICRNGYWGVDCAHKCSCKL-----CDPSTGSCRCEDPEKCSD--GPCPDGFYGSQCNLKCRMDCPNGRCDPVFGYCTCPD----GLYGQSCEKPCPHFTFGKNCRFPCKCARENSEGCDEITGKCRCKPGYYGHHCKRMCSPGLFGAGCAMKCSCPAGIRCDPVTGDCTKKCPAGYQGNLCDQPCPAGYFGYDCEQKCSCADVASPHKSKVCHHVTGTCTCLPGKTGPLCDQSCAPNTYGPNCAHTCSCVNGAKCDESDGSCHCTPGFYGATCSEVCPTGRFGIDCMQLCKCQNGAICDTSNGSCECAPGWSGKKCDKACAPGTFGKDCSKKCDCADGMHCDPSDGECICPPGKKGHKCDETCDSGLFGAGCKGICSCQNGATCDSVTGSCECRPGWRGKKCDRPCPDGRFGEGCNAICDCTTTNDTSMYNPFVARCDHVTGECRCPAGWTGPDCQTSCPLGRHGEGCRHSCQCSNGASCDRVTGFCDCPSGFMGKNCESECPEGLWGSNCMKHCLCMHGGECNKENGDCECIDGWTGPSCEFLCPFGQFGRNCAQRCNCKNGASCDRKTGRCECLPGWSGEHCEKSCVSGHYGAKCEETC-ECENGALCDPISGHCSCQPGWRGKKCNRPCLKGYFGRHCSQSCRCANSKSCDHISGRCQCPKGYAGHSCTELCPDGTFGESCSQKCDCGENSMCDAISGKCFCKPGHSGSDCKSGCV 1394          

HSP 2 Score: 577.4 bits (1487), Expect = 4.109e-179
Identity = 420/1202 (34.94%), Postives = 558/1202 (46.42%), Query Frame = 3
Query:  654 GGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSC-------------------SVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGC--GYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCL----CHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIG-CTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSE-----NSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEK-----------------------------------------------------SCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKE--SDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFC 3992
            G   C+C PG+ +S + ++C+DI+EC +N   C H C N+ G +RC+C     LG D   C   +  C   N GGC H C    D   +C C +G+IL  D++ C                     V      +  C  LC    S  V  C C  GY  ++ D K C+DINEC+  NG C  IC+N+ GS  C C PG+++  D K+C     E    C   NGGC Q C S+     +CSC PGF+L  DG +C D +EC+     C     C N  GS  C C  GY L  ++ +C    +  D        Y  V    S   V  + E+   D    ++        ++  + CP G FG  C  +CS+C + G C+   +G L    C   Y+G  CE  C      V+C   +C CK    C+  T  C C      E C  G C +GF+G  C   C   C + RC  + G C C  G YG SC   CP  T+G  C   C C + N EGCD   GKC+CK GY+G +C   C PG FG  C+  C       C+  TG C  K   G     C + CP G  G DC + C C++      S  C    G C C PG TG  C+  C    YG  C  +C C     CD   G C+C    +G    E CP+G++G  C Q C C     CD  NG C C  G+ G KC K C  G +G+ CSK+C C  G +CDP  G C C PG  G  C+  CD G +G  CK  C C NG TCD     C+C PGW G+ C++                                                     SC +G +G  C   CQC NG  CD ++G CDC  G+ G NC+  CP   +G NC + C C++GG+C+ ENG C+C  G  G  CE  CP  ++G NC   C CK    CD KTG C C     G  CE K+C S    + C + C+C     C+ ++G C C+PG RG +C + C  G FG  C Q CRCAN + C+ + G C C  G+ G  C ++C  G +G +C  KC  C  N  C   +G+C C+ G    DCK  C  G +GP C Q C C +G  C+ STG+C C  G+ G  C+  C ++ +G  C+  C C +   C+ +TG C C    +G  C
Sbjct:  300 GRAQCQCYPGFHLSYDRRSCVDIDECAKN-NGCEHFCENVKGTYRCKCREGYQLGRDGRTCEEMLGGCQVGN-GGCQHDCYDQPDGGHVCKCRNGYILANDQKLCHDNISTVIHARAPRLWDSYETVTCVTPTDLTCHKLCMHLDSGHV-QCFCDDGY--ELIDSKFCQDINECHENNGDCSQICVNLAGSVECQCKPGFRLMKDRKTC-----EDISECSSNNGGCEQIC-SNQEGGYMCSCEPGFELSEDGHSCHDMNECLINNGGCA--QLCKNRKGSRRCQCFAGYILAHDEKSCVAASDSADIFSNDIEDYSKVPGLDSIDEVISSIESYPAD----ESPRPLVFGRRRHVKECPNGFFGSTCQLSCSDCQNGGKCSMRGSGLLSKCDCPSGYTGEKCEQICRNGYWGVDCA-HKCSCK---LCDPSTGSCRCE---DPEKCSDGPCPDGFYGSQCNLKCRMDCPNGRCDPVFGYCTCPDGLYGQSCEKPCPHFTFGKNCRFPCKCARENSEGCDEITGKCRCKPGYYGHHCKRMCSPGLFGAGCAMKCSCPAGIRCDPVTGDCTKKCPAGYQGNLCDQPCPAGYFGYDCEQKCSCADVASPHKSKVCHHVTGTCTCLPGKTGPLCDQSCAPNTYGPNCAHTCSCVNGAKCDESDGSCHCTPGFYGATCSEVCPTGRFGIDCMQLCKCQNGAICDTSNGSCECAPGWSGKKCDKACAPGTFGKDCSKKCDCADGMHCDPSDGECICPPGKKGHKCDETCDSGLFGAGCKGICSCQNGATCDSVTGSCECRPGWRGKKCDRPCPDGRFGEGCNAICDCTTTNDTSMYNPFVARCDHVTGECRCPAGWTGPDCQTSCPLGRHGEGCRHSCQCSNGASCDRVTGFCDCPSGFMGKNCESECPEGLWGSNCMKHCLCMHGGECNKENGDCECIDGWTGPSCEFLCPFGQFGRNCAQRCNCKNGASCDRKTGRCECLPGWSGEHCE-KSCVSGHYGAKCEETCECENGALCDPISGHCSCQPGWRGKKCNRPCLKGYFGRHCSQSCRCANSKSCDHISGRCQCPKGYAGHSCTELCPDGTFGESCSQKC-DCGENSMCDAISGKCFCKPGHSGSDCKSGCVQGRFGPDCNQLCSCENGGVCDSSTGSCVCPPGYIGTKCEIACQSDRFGPTCEKICNCENGGTCDRLTGQCRCLPGFTGMTC 1475          

HSP 3 Score: 520.39 bits (1339), Expect = 2.599e-158
Identity = 420/1210 (34.71%), Postives = 555/1210 (45.87%), Query Frame = 3
Query:  651 DGGFYCKCPPGYEMSENGKNCID-INECIRNRT------------------DCSHECVNLPGG-FRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCY----KVDMELTDPCKY----GNGGCTQFCNS--------SPN------KRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYK-CVNTDGSYRCV---------CPNGETLGKDNKTCQNQ--NTR------------GSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTG-CLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCN--CPPGISGEICEIGCTEGFFGENCEKNCPTA-----CSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCT----------YSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSC-EIKNCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVSVINRL 4016
            DGG  CKC  GY ++ + K C D I+  I  R                    C   C++L  G  +C C     L   +      I+ C   N G C+  CV L+     C C  G  L KDR++C  +  C  NNGGC  +C +     +  C C PG+ +   D   C D+NEC I NGGC  +C N +GS  C C  G+ + HD KSC       D+   D   Y    G     +  +S        SP       +R +  C  GF      L+CSD   C  G    +  S  ++      C CP GY   K +  C +    +D    C  K C  + GS RC          CP+G    + N  C+    N R            G   Q   + CP  TFG+ C F C          D+ TG C C P Y G  C+  C        C  ++C C  G  C+  T  C   CP G  G +C+  C  G+FG +CE+ C  A       S  CH +TG C C PG  G  C   C   T+G  C+ TCSC   N   CD  +G C C  G++G  C   C  G FG+DC   C      IC+   G C  +   G +   C + C  G  G DC K CDC++  + C+  +G C C PG  G +C+  C  GL+G  C+  C C+    CD VTG C C     GK     CP G++G  CN  CDCT          +   CD + G+C C AG+ GP C   CP G +GEGC   CQC  G +CD ++G C C  G+ G+ CE+ C EG +G  C + C C++GG C+     C+C  GW G  CE  C  G +GRNC  RC C NG  CD  +G+C+C+PGW G +C++ C S  YG  C + C+C NG  C P +G C C  G  G  C   C    +G +C  +C C  ++ CD  +G C CPK   G SC E+    +    C Q C C     C+ ++GKC CKPG  G  C   C  G FG DC Q C C NG  C+   G+C+C  G+ G  C+  C    +GP C+  C  C    TC   TGQC C  G     C   CP G +G  C++ C+C +G  CN S+G C+C  GF G  C+  CP+  YG NC   C+C+  + C+PV G C CP    G  C+ S  N  
Sbjct:  382 DGGHVCKCRNGYILANDQKLCHDNISTVIHARAPRLWDSYETVTCVTPTDLTCHKLCMHLDSGHVQCFCDDGYELIDSKF--CQDINECHE-NNGDCSQICVNLAG-SVECQCKPGFRLMKDRKTCEDISECSSNNGGCEQICSNQEGGYM--CSCEPGFELS-EDGHSCHDMNECLINNGGCAQLCKNRKGSRRCQCFAGYILAHDEKSCVAASDSADIFSNDIEDYSKVPGLDSIDEVISSIESYPADESPRPLVFGRRRHVKECPNGFFGSTCQLSCSD---CQNGGKCSMRGSGLLSK-----CDCPSGYTGEKCEQICRNGYWGVDCAHKCSCKLCDPSTGSCRCEDPEKCSDGPCPDGFYGSQCNLKCRMDCPNGRCDPVFGYCTCPDGLYGQSCEKPCPHFTFGKNCRFPCKCARENSEGCDEITGKCRCKPGYYGHHCKRMCSPGLFGAGCA-MKCSCPAGIRCDPVTGDCTKKCPAGYQGNLCDQPCPAGYFGYDCEQKCSCADVASPHKSKVCHHVTGTCTCLPGKTGPLCDQSCAPNTYGPNCAHTCSCV--NGAKCDESDGSCHCTPGFYGATCSEVCPTGRFGIDCMQLCKCQNGAICDTSNGSC--ECAPGWSGKKCDKACAPGTFGKDCSKKCDCAD-GMHCDPSDGECICPPGKKGHKCDETCDSGLFGAGCKGICSCQNGATCDSVTGSCECRPGWRGKKCDRPCPDGRFGEGCNAICDCTTTNDTSMYNPFVARCDHVTGECRCPAGWTGPDCQTSCPLGRHGEGCRHSCQCSNGASCDRVTGFCDCPSGFMGKNCESECPEGLWGSNCMKHCLCMHGGECNKENGDCECIDGWTGPSCEFLCPFGQFGRNCAQRCNCKNGASCDRKTGRCECLPGWSGEHCEKSCVSGHYGAKCEETCECENGALCDPISGHCSCQPGWRGKKCNRPCLKGYFGRHCSQSCRCANSKSCDHISGRCQCPKGYAGHSCTELCPDGTFGESCSQKCDCGENSMCDAISGKCFCKPGHSGSDCKSGCVQGRFGPDCNQLCSCENGGVCDSSTGSCVCPPGYIGTKCEIACQSDRFGPTCEKIC-NCENGGTCDRLTGQCRCLPGFTGMTCNQVCPEGRFGAGCKEKCRCANG-HCNASSGECKCNLGFTGPSCEQSCPSGKYGLNCTLDCECYGQARCDPVQGCCDCPPGRYGSRCQFSCPNGF 1568          

HSP 4 Score: 454.907 bits (1169), Expect = 7.265e-135
Identity = 314/830 (37.83%), Postives = 399/830 (48.07%), Query Frame = 3
Query: 1560 SYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCS----NCMHKGYCNDDQTG-CLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENS---------VSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK-CEA-CPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIK-NCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCE 3995
            + +C CP G         C  +   G       + CP G FG +C   CS       HK       TG C C P  +G +C+  C  N     C    C C NG  C+     C+C PG  G  C   C  G FG +C + C    +   C    G C C PGW G  C   C  GT+G  CSK C C    +  CDP +G+C C  G  G  C   CD G FG  C   C       C+  TG C  +   G     C R CP G  G  C   CDC+  +           C+   G C C  G+TG  C+  C  G +GE C+ SCQC     CD VTG C C     GK CE+ CP G WG  C ++C C +   C++ NG C C+ G+ GP C   CP G +G  C++ C C  G +CD  +G C C PGW GE CE  C  G+YG +C+E C+C NG  CD     C C+PGW G+ C + C  GY+GR+C   C+C N   CD ISG+C C  G+ G +C E CP  T+G +C+Q C C     C   +G C C  G  G  C+  C   ++GP+C   C C+    CD  TG C CP    G  CEI    D     C + C C    +C+++TG+C+C PG  G  C Q+C  G FG  CK+KCRCANG  CN   G C C  GFTG  C+Q C  G YG NC L C  C     C P  G C C  G     C+  CP+G+YG  C Q+C C +GA C+ + G C C +GF G  C+ +C    +G  C  +C C     C+   G C+CP    G  CE
Sbjct:  826 AMKCSCPAGIRCDPVTGDCTKKCPAGYQGNLCDQPCPAGYFGYDCEQKCSCADVASPHKSKVCHHVTGTCTCLPGKTGPLCDQSCAPNTYGPNCAHT-CSCVNGAKCDESDGSCHCTPGFYGATCSEVCPTGRFGIDCMQLCKCQ-NGAICDTSNGSCECAPGWSGKKCDKACAPGTFGKDCSKKCDCADGMH--CDPSDGECICPPGKKGHKCDETCDSGLFGAGCKGICSCQNGATCDSVTGSCECRP--GWRGKKCDRPCPDGRFGEGCNAICDCTTTNDTSMYNPFVARCDHVTGECRCPAGWTGPDCQTSCPLGRHGEGCRHSCQCSNGASCDRVTGFCDCPSGFMGKNCESECPEGLWGSNCMKHCLCMHGGECNKENGDCECIDGWTGPSCEFLCPFGQFGRNCAQRCNCKNGASCDRKTGRCECLPGWSGEHCEKSCVSGHYGAKCEETCECENGALCDPISGHCSCQPGWRGKKCNRPCLKGYFGRHCSQSCRCANSKSCDHISGRCQCPKGYAGHSCTELCPDGTFGESCSQKCDCGENSMCDAISGKCFCKPGHSGSDCKSGCVQGRFGPDCNQLCSCENGGVCDSSTGSCVCPPGYIGTKCEIACQSDRFGPTCEKICNCENGGTCDRLTGQCRCLPGFTGMTCNQVCPEGRFGAGCKEKCRCANGH-CNASSGECKCNLGFTGPSCEQSCPSGKYGLNCTLDC-ECYGQARCDPVQGCCDCPPGRYGSRCQFSCPNGFYGWYCSQSCSCQNGAHCDGADGRCLCPAGFQGDKCEQKCSEGSFGPACSQQCNC-GKYKCDATDGKCICPVGRHGPLCE 1646          

HSP 5 Score: 394.43 bits (1012), Expect = 7.478e-114
Identity = 368/1177 (31.27%), Postives = 517/1177 (43.93%), Query Frame = 3
Query:  342 WCLVHENKSFVEKTETSQIQMVPSIKYECCEGYAELSGYRGCIPKPNCEERIGKYCQNGAFCYQSGYNAKCICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECV-----NLPGGFRCQCPPDMILG--PDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVIT--CKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICL--------NVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCN----SSPNKRAI-------CSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCIN----DLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSN---------RCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK--CEACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN-CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKES-DCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCK 3737
            + L H+ KS V  ++++ I       Y    G   +      I     +E            +    + K  CP GF G+ C    ++C+       +    +     C CP GY     G+ C  I        DC+H+C         G  RC+ P     G  PD      +   C+   +  C +   +   +   C+CPDG       + C      K+    C    ++      IT  C+C+PGY         CK +    +   GC   C          V G     C  G+Q     + C         P  Y    C Q C+    +SP+K  +       C+CLPG      G  C       T    C    +C+N    D     C C  G+       TC ++      TG  G  C+       C C NG      N +C  +   G S +K  + C  GTFG++C   C +C    +C+     C+C P   G  C+  C        C+ + C C+NG TC+S T  C C PG  G+ C+  C +G FGE C   C    +++         RC  +TG+C C  GW G  C   CP G  G GC  +C C  +N   CD   G C C  G+ G NC  +C  G +G +C   C       CN E G C  +   G     C+  CP G  G +C + C+C +N  SC+ K G C C PG++G+ CE  C  G YG +C+ +C+C    LCD ++G C C     GK     C  G +G  C+Q+C C  S  CD I+G+C C  GY G  C++ CP+G +GE CS++C C   + CD ISG C C PG  G  C++ C +G +G  C + C C NGG CD     C C PG+ G  CE +C    +G  CE  C C NGG CD ++G+C C+PG+ G+ C++ CP   +G  C + C+C N G C+  +G C+C  G  G  CE +CP  KYG NC  +C C    +CD   G C CP   +G  C+    +      C Q C C     C+   G+C C  G +G +C Q C  G+FG  C Q+C C   + C+  DG C+C  G  G LC++ C  G YG +C+ KC  C    TC  +TGQCSC  G +   C+
Sbjct:  576 YILAHDEKSCVAASDSADIFSNDIEDYSKVPGLDSIDEVISSIESYPADE------SPRPLVFGRRRHVK-ECPNGFFGSTCQLSCSDCQNGGKCSMRGSGLLS---KCDCPSGY----TGEKCEQICRNGYWGVDCAHKCSCKLCDPSTGSCRCEDPEKCSDGPCPDGF----YGSQCNLKCRMDCPNG--RCDPVFGYCTCPDGLYGQSCEKPCPHFTFGKNCRFPCKCARENSEGCDEITGKCRCKPGYY-----GHHCKRMCSPGLFGAGCAMKCSCPAGIRCDPVTGDCTKKCPAGYQGNLCDQPC---------PAGYFGYDCEQKCSCADVASPHKSKVCHHVTGTCTCLPG----KTGPLCDQSCAPNTYGPNCAHTCSCVNGAKCDESDGSCHCTPGFY----GATCSEVCP----TGRFGIDCMQL-----CKCQNGAICDTSNGSC--ECAPGWSGKKCDKACAPGTFGKDCSKKC-DCADGMHCDPSDGECICPPGKKGHKCDETCDSGLFGAGCKGI-CSCQNGATCDSVTGSCECRPGWRGKKCDRPCPDGRFGEGCNAICDCTTTNDTSMYNPFVARCDHVTGECRCPAGWTGPDCQTSCPLGRHGEGCRHSCQC--SNGASCDRVTGFCDCPSGFMGKNCESECPEGLWGSNCMKHCLCMHGGECNKENGDC--ECIDGWTGPSCEFLCPFGQFGRNCAQRCNC-KNGASCDRKTGRCECLPGWSGEHCEKSCVSGHYGAKCEETCECENGALCDPISGHCSCQPGWRGKKCNRPCLKGYFGRHCSQSCRCANSKSCDHISGRCQCPKGYAGHSCTELCPDGTFGESCSQKCDCGENSMCDAISGKCFCKPGHSGSDCKSGCVQGRFGPDCNQLCSCENGGVCDSSTGSCVCPPGYIGTKCEIACQSDRFGPTCEKICNCENGGTCDRLTGQCRCLPGFTGMTCNQVCPEGRFGAGCKEKCRCAN-GHCNASSGECKCNLGFTGPSCEQSCPSGKYGLNCTLDCECYGQARCDPVQGCCDCPPGRYGSRCQFSCPNGFYGWYCSQSCSCQNGAHCDGADGRCLCPAGFQGDKCEQKCSEGSFGPACSQQCNCGKYK-CDATDGKCICPVGRHGPLCEEECRPGRYGQSCQNKCQ-CFNGATCDARTGQCSCSPGWLGPTCQ 1689          

HSP 6 Score: 332.798 bits (852), Expect = 3.020e-93
Identity = 225/580 (38.79%), Postives = 296/580 (51.03%), Query Frame = 3
Query: 1665 CPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETG--QCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFG-KCE-ACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKESDCRQD 3392
            CP G  GE C  +C  C +   C+     C C   + G  CE +C +      C    C C +GG C  E   C C  G +G  CE  C  G FG NC + C    +   C + TG+C C PGW G  C   C +G +G  C +TC C   N   CDP +G C C+ G+ G  C   C  GYFG  CS SC       C+H +G  QCP    +G     C   CP G  G  C + CDC ENS+ C+  +G C C PG +G  C+  C +G +G  C   C C    +CD  TG C C     G KCE AC S ++GPTC + C+C     CD++ GQC CL G+ G  C++ CPEG +G GC ++C+C  G+C+  SG C+CN G+ G  CE  C  G YG  C   C+C     CD     C C PG +G  C+ SC  G+YG  C   C C NG  CDG  G+C C  G++G  C+++C   ++GP C+Q C C    KC   +G C CP GRHG +CE  C P +YG +C + C C     CD +TG+C+C     G +C+I+  D      R D
Sbjct: 1135 CPLGRHGEGCRHSC-QCSNGASCDRVTGFCDCPSGFMGKNCESECPEGLWGSNCMK-HCLCMHGGECNKENGDCECIDGWTGPSCEFLCPFGQFGRNCAQRCNCK-NGASCDRKTGRCECLPGWSGEHCEKSCVSGHYGAKCEETCECE--NGALCDPISGHCSCQPGWRGKKCNRPCLKGYFGRHCSQSCRCANSKSCDHISGRCQCP----KGYAGHSCTELCPDGTFGESCSQKCDCGENSM-CDAISGKCFCKPGHSGSDCKSGCVQGRFGPDCNQLCSCENGGVCDSSTGSCVCPPGYIGTKCEIACQSDRFGPTCEKICNCENGGTCDRLTGQCRCLPGFTGMTCNQVCPEGRFGAGCKEKCRCANGHCNASSGECKCNLGFTGPSCEQSCPSGKYGLNCTLDCECYGQARCDPVQGCCDCPPGRYGSRCQFSCPNGFYGWYCSQSCSCQNGAHCDGADGRCLCPAGFQGDKCEQKCSEGSFGPACSQQCNC-GKYKCDATDGKCICPVGRHGPLCEEECRPGRYGQSCQNKCQCFNGATCDARTGQCSCSPGWLGPTCQIEMMDPNNVANRGD 1703          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Fly
Match: drpr (gene:FBgn0027594 transcript:FBtr0334080)

HSP 1 Score: 381.333 bits (978), Expect = 2.102e-113
Identity = 266/748 (35.56%), Postives = 367/748 (49.06%), Query Frame = 3
Query: 1929 CTEGFFGE--NCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK--CEACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKR-CPEGLYGEGCSKECQCIYGN---CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEK--CDLKTGECTCPKSAFGLSCEIKNCDSKE--SDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKC--RCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKC-FHNSPCNPVTGHCVCPKKLSGRFCEVSVINR-------------LKLSFI*IFSLEQ*IITSKQIFIIY 4088
            C +G+      C  +C   C   RC     KC C  G+ G +C + CP G +G  CS  C C  N    C+P +G C+C KGY G  C   C  G+FG +CS  C  +    C+H +G+C  +   G     C   CP G  G+ C++ C C +N   C+ + G C C PG+TG  C  KC  G YG  CQ SC+C K   C H+TG C C     G+   + C    +G  C+  CDC     CD+ NG CIC  G+ G KC++R C    YG  C++ C+C   +   C P +G C+C+ GW    C  PC    YG  C+  C C NG  C      C C PGW G  CE+SC  G +G++C  RC C NG  C+  +G+C C  GW+ I CD  C    +G +C +VC C N   C+P+NG C C AG  G+ CE  C   K+G +C   C C       CD   G C C +   G+ CE  NC S     +C + C+C    SC+  +G C C  G  G  C + C  G +G++CK++C       + C+ + G  LC +G+ G+ C+  C  G YGP CKLKC  C     C+  TGQC C  G    +C   CP+  YG  C Q C+C+H   C  + G C C +G+ G  C   CP  FYG +C + C C   N  C+   G CVC    +G  C+  + ++             + L+ + + +L   II +  +FI Y
Sbjct:   87 CCDGYIASAGECVPHCSEPCQHGRCISPE-KCKCDHGYGGPACDINCPPGWYGRNCSMQCDCLNNAV--CEPFSGDCECAKGYTGARCADICPEGFFGANCSEKCRCENGGKCHHVSGEC--QCAPGFTGPLCDMRCPDGKHGAQCQQDCPC-QNDGKCQPETGACMCNPGWTGDVCANKCPVGSYGPGCQESCECYKGAPCHHITGQCECPPGYRGERCFDECQLNTYGFNCSMTCDCANDAMCDRANGTCICNPGWTGAKCAERICEANKYGLDCNRTCECDMEHTDLCHPETGNCQCSIGWSSAQCTRPCTFLRYGPNCELTCNCKNGAKCSPVNGTCLCAPGWRGPTCEESCEPGTFGQDCALRCDCQNGAKCEPETGQCLCTAGWKNIKCDRPCDLNHFGQDCAKVCDCHNNAACNPQNGSCTCAAGWTGERCERKCDTGKFGHDCAQKCQCDFNNSLACDATNGRCVCKQDWGGVHCET-NCRSGYYGENCDKVCRCLNNSSCDPDSGNCICSAGWTGADCAEPCPPGFYGMECKERCPEILHGNKSCDHITGEILCRTGYIGLTCEHPCPAGLYGPGCKLKC-NCEHGGECNHVTGQCQCLPGWTGSNCNESCPTDTYGQGCAQRCRCVHHKVCRKADGMCICETGWSGTRCDEVCPEGFYGEHCMNTCACPSANFQCHAAHG-CVCRSGYTGDNCDELIASQRIADQSENSSRASVALTLV-LMTLFACIIFA--VFIYY 822          

HSP 2 Score: 328.946 bits (842), Expect = 7.496e-95
Identity = 240/699 (34.33%), Postives = 320/699 (45.78%), Query Frame = 3
Query: 1689 ECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRC-ELKCTKGLYGERCQSSCQCRKDR--LCDHVTGICYCADVAFGKCE---ACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQC--HNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNC--ICKATEKCDLKTGECTCPKSAFGLSCEIK-NCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLC-------------------------------------------LSGFTGILCDQVCAK 3620
            EC+ +CS     G C   +  C C   Y G  C+I+C        C  +QC C N   CE  +  C C  G +G  C   C EGFFG NC + C    +  +CH ++G+C C PG+ G  C + CP G  G  C + C C   N   C P+ G C C  G+ G  C  KC  G +G  C  SC       C+H TGQC  +   G     C  +C     G +C  TCDC+ N   C+  NG C C PG+TG +C E  C    YG  C  +C+C  +   LC   TG C C+ + +   +    C   ++GP C   C+C     C  +NG C+C  G+ GP C + C  G +G+ C+  C C  G  C+P +G C C  GW    C+ PCD  ++G  C + C C N   C+     C C  GW GE CE+ C  G +G +C  +CQC  +N   CD  +G+C C   W G++C+  C S  YG NC++VC+CLN   C P++G C C AG  G  C   CPP  YG  C   C  I    + CD  TGE  C     GL+CE           C+  C C     CN VTG+CQC PG  G  C + C    +G  C Q+CRC + + C   DG C+C                                            SG+TG  CD++ A 
Sbjct:   97 ECVPHCSEPCQHGRCISPEK-CKCDHGYGGPACDINCPPGWYGRNCS-MQCDCLNNAVCEPFSGDCECAKGYTGARCADICPEGFFGANCSEKCRCE-NGGKCHHVSGECQCAPGFTGPLCDMRCPDGKHGAQCQQDCPCQ--NDGKCQPETGACMCNPGWTGDVCANKCPVGSYGPGCQESCECYKGAPCHHITGQC--ECPPGYRGERCFDECQLNTYGFNCSMTCDCA-NDAMCDRANGTCICNPGWTGAKCAERICEANKYGLDCNRTCECDMEHTDLCHPETGNCQCS-IGWSSAQCTRPCTFLRYGPNCELTCNCKNGAKCSPVNGTCLCAPGWRGPTCEESCEPGTFGQDCALRCDCQNGAKCEPETGQCLCTAGWKNIKCDRPCDLNHFGQDCAKVCDCHNNAACNPQNGSCTCAAGWTGERCERKCDTGKFGHDCAQKCQCDFNNSLACDATNGRCVCKQDWGGVHCETNCRSGYYGENCDKVCRCLNNSSCDPDSGNCICSAGWTGADCAEPCPPGFYGMECKERCPEILHGNKSCDHITGEILCRTGYIGLTCEHPCPAGLYGPGCKLKCNCEHGGECNHVTGQCQCLPGWTGSNCNESCPTDTYGQGCAQRCRCVHHKVCRKADGMCICETGWSGTRCDEVCPEGFYGEHCMNTCACPSANFQCHAAHGCVCRSGYTGDNCDELIAS 786          

HSP 3 Score: 244.202 bits (622), Expect = 3.417e-66
Identity = 177/504 (35.12%), Postives = 237/504 (47.02%), Query Frame = 3
Query: 1662 RCPKGTFGEECL---------FNCS---NCMHKGYCNDDQTGCLCHPNYSGTIC-EIDCLQNPSQVECQPL-QCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQ-GNNSIGCQRDCPTGGSGSDCRKTCDCS-ENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK--CEACPSGKWGPTCNQNCDCTY--STGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQ 3110
             CP G  GE C          FNCS   +C +   C+     C+C+P ++G  C E  C  N   ++C    +C  ++   C  ET  C C  G S   C   CT   +G NCE  C    +  +C  + G CLC PGW G +C   C  GT+G  C+  C C   N   C+P+ G+C C  G+  + C   CD  +FG DC+  C       CN + G C   TC  G     C+R C TG  G DC + C C   NS++C+  NG C C   + G  CE  C  G YGE C   C+C  +  CD  +G C C+    G    E CP G +G  C + C      +  CD I G+ +C  GY G  C   CP GLYG GC  +C C +G  C+ ++G C+C PGW G  C   C    YG  C ++C+C++   C      C CE GW G  C++ C  G+YG +C   C C +       +  C C  G+ G NCDE   SQ
Sbjct:  290 ECPPGYRGERCFDECQLNTYGFNCSMTCDCANDAMCDRANGTCICNPGWTGAKCAERICEANKYGLDCNRTCECDMEHTDLCHPETGNCQCSIGWSSAQCTRPCTFLRYGPNCELTCNCK-NGAKCSPVNGTCLCAPGWRGPTCEESCEPGTFGQDCALRCDCQ--NGAKCEPETGQCLCTAGWKNIKCDRPCDLNHFGQDCAKVCDCHNNAACNPQNGSC---TCAAGWTGERCERKCDTGKFGHDCAQKCQCDFNNSLACDATNGRCVCKQDWGGVHCETNCRSGYYGENCDKVCRCLNNSSCDPDSGNCICSAGWTGADCAEPCPPGFYGMECKERCPEILHGNKSCDHITGEILCRTGYIGLTCEHPCPAGLYGPGCKLKCNCEHGGECNHVTGQCQCLPGWTGSNCNESCPTDTYGQGCAQRCRCVHHKVCRKADGMCICETGWSGTRCDEVCPEGFYGEHCMNTCACPSANFQCHAAHGCVCRSGYTGDNCDELIASQ 787          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Fly
Match: drpr (gene:FBgn0027594 transcript:FBtr0072799)

HSP 1 Score: 381.333 bits (978), Expect = 5.419e-113
Identity = 266/748 (35.56%), Postives = 367/748 (49.06%), Query Frame = 3
Query: 1929 CTEGFFGE--NCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK--CEACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKR-CPEGLYGEGCSKECQCIYGN---CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEK--CDLKTGECTCPKSAFGLSCEIKNCDSKE--SDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCR--CANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKC-FHNSPCNPVTGHCVCPKKLSGRFCEVSVINR-------------LKLSFI*IFSLEQ*IITSKQIFIIY 4088
            C +G+      C  +C   C   RC     KC C  G+ G +C + CP G +G  CS  C C  N    C+P +G C+C KGY G  C   C  G+FG +CS  C  +    C+H +G+C  +   G     C   CP G  G+ C++ C C +N   C+ + G C C PG+TG  C  KC  G YG  CQ SC+C K   C H+TG C C     G+   + C    +G  C+  CDC     CD+ NG CIC  G+ G KC++R C    YG  C++ C+C   +   C P +G C+C+ GW    C  PC    YG  C+  C C NG  C      C C PGW G  CE+SC  G +G++C  RC C NG  C+  +G+C C  GW+ I CD  C    +G +C +VC C N   C+P+NG C C AG  G+ CE  C   K+G +C   C C       CD   G C C +   G+ CE  NC S     +C + C+C    SC+  +G C C  G  G  C + C  G +G++CK++C       + C+ + G  LC +G+ G+ C+  C  G YGP CKLKC  C     C+  TGQC C  G    +C   CP+  YG  C Q C+C+H   C  + G C C +G+ G  C   CP  FYG +C + C C   N  C+   G CVC    +G  C+  + ++             + L+ + + +L   II +  +FI Y
Sbjct:   87 CCDGYIASAGECVPHCSEPCQHGRCISPE-KCKCDHGYGGPACDINCPPGWYGRNCSMQCDCLNNAV--CEPFSGDCECAKGYTGARCADICPEGFFGANCSEKCRCENGGKCHHVSGEC--QCAPGFTGPLCDMRCPDGKHGAQCQQDCPC-QNDGKCQPETGACMCNPGWTGDVCANKCPVGSYGPGCQESCECYKGAPCHHITGQCECPPGYRGERCFDECQLNTYGFNCSMTCDCANDAMCDRANGTCICNPGWTGAKCAERICEANKYGLDCNRTCECDMEHTDLCHPETGNCQCSIGWSSAQCTRPCTFLRYGPNCELTCNCKNGAKCSPVNGTCLCAPGWRGPTCEESCEPGTFGQDCALRCDCQNGAKCEPETGQCLCTAGWKNIKCDRPCDLNHFGQDCAKVCDCHNNAACNPQNGSCTCAAGWTGERCERKCDTGKFGHDCAQKCQCDFNNSLACDATNGRCVCKQDWGGVHCET-NCRSGYYGENCDKVCRCLNNSSCDPDSGNCICSAGWTGADCAEPCPPGFYGMECKERCPEILHGNKSCDHITGEILCRTGYIGLTCEHPCPAGLYGPGCKLKC-NCEHGGECNHVTGQCQCLPGWTGSNCNESCPTDTYGQGCAQRCRCVHHKVCRKADGMCICETGWSGTRCDEVCPEGFYGEHCMNTCACPSANFQCHAAHG-CVCRSGYTGDNCDELIASQRIADQSENSSRASVALTLV-LMTLFACIIFA--VFIYY 822          

HSP 2 Score: 329.331 bits (843), Expect = 1.730e-94
Identity = 240/699 (34.33%), Postives = 320/699 (45.78%), Query Frame = 3
Query: 1689 ECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRC-ELKCTKGLYGERCQSSCQCRKDR--LCDHVTGICYCADVAFGKCE---ACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQC--HNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNC--ICKATEKCDLKTGECTCPKSAFGLSCEIK-NCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLC-------------------------------------------LSGFTGILCDQVCAK 3620
            EC+ +CS     G C   +  C C   Y G  C+I+C        C  +QC C N   CE  +  C C  G +G  C   C EGFFG NC + C    +  +CH ++G+C C PG+ G  C + CP G  G  C + C C   N   C P+ G C C  G+ G  C  KC  G +G  C  SC       C+H TGQC  +   G     C  +C     G +C  TCDC+ N   C+  NG C C PG+TG +C E  C    YG  C  +C+C  +   LC   TG C C+ + +   +    C   ++GP C   C+C     C  +NG C+C  G+ GP C + C  G +G+ C+  C C  G  C+P +G C C  GW    C+ PCD  ++G  C + C C N   C+     C C  GW GE CE+ C  G +G +C  +CQC  +N   CD  +G+C C   W G++C+  C S  YG NC++VC+CLN   C P++G C C AG  G  C   CPP  YG  C   C  I    + CD  TGE  C     GL+CE           C+  C C     CN VTG+CQC PG  G  C + C    +G  C Q+CRC + + C   DG C+C                                            SG+TG  CD++ A 
Sbjct:   97 ECVPHCSEPCQHGRCISPEK-CKCDHGYGGPACDINCPPGWYGRNCS-MQCDCLNNAVCEPFSGDCECAKGYTGARCADICPEGFFGANCSEKCRCE-NGGKCHHVSGECQCAPGFTGPLCDMRCPDGKHGAQCQQDCPCQ--NDGKCQPETGACMCNPGWTGDVCANKCPVGSYGPGCQESCECYKGAPCHHITGQC--ECPPGYRGERCFDECQLNTYGFNCSMTCDCA-NDAMCDRANGTCICNPGWTGAKCAERICEANKYGLDCNRTCECDMEHTDLCHPETGNCQCS-IGWSSAQCTRPCTFLRYGPNCELTCNCKNGAKCSPVNGTCLCAPGWRGPTCEESCEPGTFGQDCALRCDCQNGAKCEPETGQCLCTAGWKNIKCDRPCDLNHFGQDCAKVCDCHNNAACNPQNGSCTCAAGWTGERCERKCDTGKFGHDCAQKCQCDFNNSLACDATNGRCVCKQDWGGVHCETNCRSGYYGENCDKVCRCLNNSSCDPDSGNCICSAGWTGADCAEPCPPGFYGMECKERCPEILHGNKSCDHITGEILCRTGYIGLTCEHPCPAGLYGPGCKLKCNCEHGGECNHVTGQCQCLPGWTGSNCNESCPTDTYGQGCAQRCRCVHHKVCRKADGMCICETGWSGTRCDEVCPEGFYGEHCMNTCACPSANFQCHAAHGCVCRSGYTGDNCDELIAS 786          

HSP 3 Score: 244.973 bits (624), Expect = 3.880e-66
Identity = 177/504 (35.12%), Postives = 237/504 (47.02%), Query Frame = 3
Query: 1662 RCPKGTFGEECL---------FNCS---NCMHKGYCNDDQTGCLCHPNYSGTIC-EIDCLQNPSQVECQPL-QCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQ-GNNSIGCQRDCPTGGSGSDCRKTCDCS-ENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK--CEACPSGKWGPTCNQNCDCTY--STGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQ 3110
             CP G  GE C          FNCS   +C +   C+     C+C+P ++G  C E  C  N   ++C    +C  ++   C  ET  C C  G S   C   CT   +G NCE  C    +  +C  + G CLC PGW G +C   C  GT+G  C+  C C   N   C+P+ G+C C  G+  + C   CD  +FG DC+  C       CN + G C   TC  G     C+R C TG  G DC + C C   NS++C+  NG C C   + G  CE  C  G YGE C   C+C  +  CD  +G C C+    G    E CP G +G  C + C      +  CD I G+ +C  GY G  C   CP GLYG GC  +C C +G  C+ ++G C+C PGW G  C   C    YG  C ++C+C++   C      C CE GW G  C++ C  G+YG +C   C C +       +  C C  G+ G NCDE   SQ
Sbjct:  290 ECPPGYRGERCFDECQLNTYGFNCSMTCDCANDAMCDRANGTCICNPGWTGAKCAERICEANKYGLDCNRTCECDMEHTDLCHPETGNCQCSIGWSSAQCTRPCTFLRYGPNCELTCNCK-NGAKCSPVNGTCLCAPGWRGPTCEESCEPGTFGQDCALRCDCQ--NGAKCEPETGQCLCTAGWKNIKCDRPCDLNHFGQDCAKVCDCHNNAACNPQNGSC---TCAAGWTGERCERKCDTGKFGHDCAQKCQCDFNNSLACDATNGRCVCKQDWGGVHCETNCRSGYYGENCDKVCRCLNNSSCDPDSGNCICSAGWTGADCAEPCPPGFYGMECKERCPEILHGNKSCDHITGEILCRTGYIGLTCEHPCPAGLYGPGCKLKCNCEHGGECNHVTGQCQCLPGWTGSNCNESCPTDTYGQGCAQRCRCVHHKVCRKADGMCICETGWSGTRCDEVCPEGFYGEHCMNTCACPSANFQCHAAHGCVCRSGYTGDNCDELIASQ 787          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Fly
Match: drpr (gene:FBgn0027594 transcript:FBtr0334079)

HSP 1 Score: 381.333 bits (978), Expect = 7.975e-113
Identity = 266/748 (35.56%), Postives = 367/748 (49.06%), Query Frame = 3
Query: 1929 CTEGFFGE--NCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK--CEACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKR-CPEGLYGEGCSKECQCIYGN---CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEK--CDLKTGECTCPKSAFGLSCEIKNCDSKE--SDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCR--CANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKC-FHNSPCNPVTGHCVCPKKLSGRFCEVSVINR-------------LKLSFI*IFSLEQ*IITSKQIFIIY 4088
            C +G+      C  +C   C   RC     KC C  G+ G +C + CP G +G  CS  C C  N    C+P +G C+C KGY G  C   C  G+FG +CS  C  +    C+H +G+C  +   G     C   CP G  G+ C++ C C +N   C+ + G C C PG+TG  C  KC  G YG  CQ SC+C K   C H+TG C C     G+   + C    +G  C+  CDC     CD+ NG CIC  G+ G KC++R C    YG  C++ C+C   +   C P +G C+C+ GW    C  PC    YG  C+  C C NG  C      C C PGW G  CE+SC  G +G++C  RC C NG  C+  +G+C C  GW+ I CD  C    +G +C +VC C N   C+P+NG C C AG  G+ CE  C   K+G +C   C C       CD   G C C +   G+ CE  NC S     +C + C+C    SC+  +G C C  G  G  C + C  G +G++CK++C       + C+ + G  LC +G+ G+ C+  C  G YGP CKLKC  C     C+  TGQC C  G    +C   CP+  YG  C Q C+C+H   C  + G C C +G+ G  C   CP  FYG +C + C C   N  C+   G CVC    +G  C+  + ++             + L+ + + +L   II +  +FI Y
Sbjct:   87 CCDGYIASAGECVPHCSEPCQHGRCISPE-KCKCDHGYGGPACDINCPPGWYGRNCSMQCDCLNNAV--CEPFSGDCECAKGYTGARCADICPEGFFGANCSEKCRCENGGKCHHVSGEC--QCAPGFTGPLCDMRCPDGKHGAQCQQDCPC-QNDGKCQPETGACMCNPGWTGDVCANKCPVGSYGPGCQESCECYKGAPCHHITGQCECPPGYRGERCFDECQLNTYGFNCSMTCDCANDAMCDRANGTCICNPGWTGAKCAERICEANKYGLDCNRTCECDMEHTDLCHPETGNCQCSIGWSSAQCTRPCTFLRYGPNCELTCNCKNGAKCSPVNGTCLCAPGWRGPTCEESCEPGTFGQDCALRCDCQNGAKCEPETGQCLCTAGWKNIKCDRPCDLNHFGQDCAKVCDCHNNAACNPQNGSCTCAAGWTGERCERKCDTGKFGHDCAQKCQCDFNNSLACDATNGRCVCKQDWGGVHCET-NCRSGYYGENCDKVCRCLNNSSCDPDSGNCICSAGWTGADCAEPCPPGFYGMECKERCPEILHGNKSCDHITGEILCRTGYIGLTCEHPCPAGLYGPGCKLKC-NCEHGGECNHVTGQCQCLPGWTGSNCNESCPTDTYGQGCAQRCRCVHHKVCRKADGMCICETGWSGTRCDEVCPEGFYGEHCMNTCACPSANFQCHAAHG-CVCRSGYTGDNCDELIASQRIADQSENSSRASVALTLV-LMTLFACIIFA--VFIYY 822          

HSP 2 Score: 328.946 bits (842), Expect = 2.481e-94
Identity = 240/698 (34.38%), Postives = 320/698 (45.85%), Query Frame = 3
Query: 1689 ECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRC-ELKCTKGLYGERCQSSCQCRKDR--LCDHVTGICYCADVAFGKCE---ACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQC--HNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNC--ICKATEKCDLKTGECTCPKSAFGLSCEIK-NCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLC-------------------------------------------LSGFTGILCDQVCA 3617
            EC+ +CS     G C   +  C C   Y G  C+I+C        C  +QC C N   CE  +  C C  G +G  C   C EGFFG NC + C    +  +CH ++G+C C PG+ G  C + CP G  G  C + C C   N   C P+ G C C  G+ G  C  KC  G +G  C  SC       C+H TGQC  +   G     C  +C     G +C  TCDC+ N   C+  NG C C PG+TG +C E  C    YG  C  +C+C  +   LC   TG C C+ + +   +    C   ++GP C   C+C     C  +NG C+C  G+ GP C + C  G +G+ C+  C C  G  C+P +G C C  GW    C+ PCD  ++G  C + C C N   C+     C C  GW GE CE+ C  G +G +C  +CQC  +N   CD  +G+C C   W G++C+  C S  YG NC++VC+CLN   C P++G C C AG  G  C   CPP  YG  C   C  I    + CD  TGE  C     GL+CE           C+  C C     CN VTG+CQC PG  G  C + C    +G  C Q+CRC + + C   DG C+C                                            SG+TG  CD++ A
Sbjct:   97 ECVPHCSEPCQHGRCISPEK-CKCDHGYGGPACDINCPPGWYGRNCS-MQCDCLNNAVCEPFSGDCECAKGYTGARCADICPEGFFGANCSEKCRCE-NGGKCHHVSGECQCAPGFTGPLCDMRCPDGKHGAQCQQDCPCQ--NDGKCQPETGACMCNPGWTGDVCANKCPVGSYGPGCQESCECYKGAPCHHITGQC--ECPPGYRGERCFDECQLNTYGFNCSMTCDCA-NDAMCDRANGTCICNPGWTGAKCAERICEANKYGLDCNRTCECDMEHTDLCHPETGNCQCS-IGWSSAQCTRPCTFLRYGPNCELTCNCKNGAKCSPVNGTCLCAPGWRGPTCEESCEPGTFGQDCALRCDCQNGAKCEPETGQCLCTAGWKNIKCDRPCDLNHFGQDCAKVCDCHNNAACNPQNGSCTCAAGWTGERCERKCDTGKFGHDCAQKCQCDFNNSLACDATNGRCVCKQDWGGVHCETNCRSGYYGENCDKVCRCLNNSSCDPDSGNCICSAGWTGADCAEPCPPGFYGMECKERCPEILHGNKSCDHITGEILCRTGYIGLTCEHPCPAGLYGPGCKLKCNCEHGGECNHVTGQCQCLPGWTGSNCNESCPTDTYGQGCAQRCRCVHHKVCRKADGMCICETGWSGTRCDEVCPEGFYGEHCMNTCACPSANFQCHAAHGCVCRSGYTGDNCDELIA 785          

HSP 3 Score: 244.588 bits (623), Expect = 4.876e-66
Identity = 177/504 (35.12%), Postives = 237/504 (47.02%), Query Frame = 3
Query: 1662 RCPKGTFGEECL---------FNCS---NCMHKGYCNDDQTGCLCHPNYSGTIC-EIDCLQNPSQVECQPL-QCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQ-GNNSIGCQRDCPTGGSGSDCRKTCDCS-ENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK--CEACPSGKWGPTCNQNCDCTY--STGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQ 3110
             CP G  GE C          FNCS   +C +   C+     C+C+P ++G  C E  C  N   ++C    +C  ++   C  ET  C C  G S   C   CT   +G NCE  C    +  +C  + G CLC PGW G +C   C  GT+G  C+  C C   N   C+P+ G+C C  G+  + C   CD  +FG DC+  C       CN + G C   TC  G     C+R C TG  G DC + C C   NS++C+  NG C C   + G  CE  C  G YGE C   C+C  +  CD  +G C C+    G    E CP G +G  C + C      +  CD I G+ +C  GY G  C   CP GLYG GC  +C C +G  C+ ++G C+C PGW G  C   C    YG  C ++C+C++   C      C CE GW G  C++ C  G+YG +C   C C +       +  C C  G+ G NCDE   SQ
Sbjct:  290 ECPPGYRGERCFDECQLNTYGFNCSMTCDCANDAMCDRANGTCICNPGWTGAKCAERICEANKYGLDCNRTCECDMEHTDLCHPETGNCQCSIGWSSAQCTRPCTFLRYGPNCELTCNCK-NGAKCSPVNGTCLCAPGWRGPTCEESCEPGTFGQDCALRCDCQ--NGAKCEPETGQCLCTAGWKNIKCDRPCDLNHFGQDCAKVCDCHNNAACNPQNGSC---TCAAGWTGERCERKCDTGKFGHDCAQKCQCDFNNSLACDATNGRCVCKQDWGGVHCETNCRSGYYGENCDKVCRCLNNSSCDPDSGNCICSAGWTGADCAEPCPPGFYGMECKERCPEILHGNKSCDHITGEILCRTGYIGLTCEHPCPAGLYGPGCKLKCNCEHGGECNHVTGQCQCLPGWTGSNCNESCPTDTYGQGCAQRCRCVHHKVCRKADGMCICETGWSGTRCDEVCPEGFYGEHCMNTCACPSANFQCHAAHGCVCRSGYTGDNCDELIASQ 787          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Fly
Match: frac (gene:FBgn0035798 transcript:FBtr0290277)

HSP 1 Score: 164.081 bits (414), Expect = 3.052e-40
Identity = 126/386 (32.64%), Postives = 175/386 (45.34%), Query Frame = 3
Query:  657 GFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSS--------------------------------------------SVITCKCRPGYAIDVND---------------------VKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLD-YTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTC 1616
             F C CP GY       +C DI+EC  +   CSH C N PGG++CQCP  + L  +   C+   + C+  N  GC   C  L+    +C+C +G  L  D +SC  VD C  NNGGC  +C++ P S                                               TC C PGYA+ +++                        C DI+EC++ NG C H C N  G F C C  G+ +  D ++C  +D      C   NG C+Q C + P   A C+C  GF+L  DG  C+D DEC      C     CIN LG++ C C  GY L K+K++C D+DEC    +GGC ++C+N  G++ C CP G  L  D ++C
Sbjct:  534 SFSCICPTGYR--SEAFSCQDIDECAEDTHLCSHTCQNTPGGYQCQCPEGLNLV-EEYTCLA-ENLCE-VNNNGCEQIC--LTARGGVCACREGFRLSADGKSCEDVDECLVNNGGCQQVCRNLPGSYGCICAAGYELLKLDGIRGYCFDIDECSQRTHGCSDQMLCENLNGSYTCLCPPGYALGLDNHIVTSLNSSFITDSTSSETPSAHTCLDIDECSLANGNCSHFCQNEPGGFQCACPLGYALSEDMRTCQDIDE-----CLDSNGQCSQLCLNQPGGFA-CACETGFELTPDGFGCADIDECSQDYGNCS--DICINLLGTHACACERGYELAKDKLSCLDVDECAGLLSGGCSHECINKAGTFECGCPLGYILNDDGRSC 904          

HSP 2 Score: 145.206 bits (365), Expect = 2.057e-34
Identity = 121/386 (31.35%), Postives = 168/386 (43.52%), Query Frame = 3
Query:  657 GFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDM-ILGPDRINCIPF-IHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRR----------------------SCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDEC---VTG--KHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCE-----------------------------------DIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQN 1622
            G  C C  G+ +S +GK+C D++EC+ N   C   C NLPG + C C     +L  D I    F I  C     G       +  +  + C CP G+ L  D                        +C  +D C   NG CSH CQ++P      C C  GYA+   D++ C+DI+EC   NG C  +CLN  G F C C  G+++  D   C  +D      C    G C+  C +     A C+C  G++L  D L+C D DEC   ++G   H+C      IN  G++ C CP+GY L  +  +C                                    DIDEC    GGC ++C NT+GS++C CP G  L  D KTCQ+
Sbjct:  612 GGVCACREGFRLSADGKSCEDVDECLVNNGGCQQVCRNLPGSYGCICAAGYELLKLDGIRGYCFDIDECSQRTHGCSDQMLCENLNGSYTCLCPPGYALGLDNHIVTSLNSSFITDSTSSETPSAHTCLDIDECSLANGNCSHFCQNEPGG--FQCACPLGYALS-EDMRTCQDIDECLDSNGQCSQLCLNQPGGFACACETGFELTPDGFGCADIDE-----CSQDYGNCSDICINLLGTHA-CACERGYELAKDKLSCLDVDECAGLLSGGCSHEC------INKAGTFECGCPLGYILNDDGRSCSPALVGCPPGTQRSADGCAPIECNPGYTLGSDDKCVDIDECQKQNGGCSHRCSNTEGSFKCSCPPGYELDSDQKTCQD 982          

HSP 3 Score: 144.436 bits (363), Expect = 3.040e-34
Identity = 123/358 (34.36%), Postives = 164/358 (45.81%), Query Frame = 3
Query:  654 GGFYCKCPPGYEMSENGK-----NCIDINECIRNRTDCSHECVNLP-GGFRCQCPPDMILGPDRINCIPFIHPCDSANKGG---CTHHCVKLSD-MRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFK-LEADGLT--CSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRL----------------------RKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQN 1622
            G F C C  GY + E+ +     +C D+     NRT C+HEC +LP G +RC CP    L  D+ +C+    PC S  KG        C+   D   F C CP G+    +  SC  +D C ++   CSH CQ+ P      C+C  G  +++ +   C   N C + N GC+ ICL   G  +C C  G+++  D KSC  VD      C   NGGC Q C + P     C C  G++ L+ DG+   C D DEC    H C     C N  GSY C CP GY L                        +  TC DIDEC    G C + C N  G ++C CP G  L +D +TCQ+
Sbjct:  439 GSFRCTCVEGYHLLEDQRSCALDSCTDLENPQLNRTRCAHECQDLPEGSYRCVCPKGYELSEDQHSCLVQESPC-STEKGVEKCSPGTCLASEDNTSFSCICPTGY--RSEAFSCQDIDECAEDTHLCSHTCQNTPGG--YQCQCPEG--LNLVEEYTCLAENLCEVNNNGCEQICLTARGG-VCACREGFRLSADGKSCEDVDE-----CLVNNGGCQQVCRNLPGSYG-CICAAGYELLKLDGIRGYCFDIDECSQRTHGCSDQMLCENLNGSYTCLCPPGYALGLDNHIVTSLNSSFITDSTSSETPSAHTCLDIDECSLANGNCSHFCQNEPGGFQCACPLGYALSEDMRTCQD 782          

HSP 4 Score: 117.087 bits (292), Expect = 7.374e-26
Identity = 84/229 (36.68%), Postives = 113/229 (49.34%), Query Frame = 3
Query:  654 GGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKD-NNGGCSHLCQSDP--------------------SSSVITC--------------KCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVD 1235
            GGF C CP GY +SE+ + C DI+EC+ +   CS  C+N PGGF C C     L PD   C   I  C S + G C+  C+ L      C+C  G+ L KD+ SC  VD C    +GGCSH C +                      S +++ C              +C PGY +  +D  +C DI+EC  +NGGC H C N EGSF C C PG+++  D K+C  +D
Sbjct:  761 GGFQCACPLGYALSEDMRTCQDIDECLDSNGQCSQLCLNQPGGFACACETGFELTPDGFGCAD-IDEC-SQDYGNCSDICINLLGTH-ACACERGYELAKDKLSCLDVDECAGLLSGGCSHECINKAGTFECGCPLGYILNDDGRSCSPALVGCPPGTQRSADGCAPIECNPGYTLGSDD--KCVDIDECQKQNGGCSHRCSNTEGSFKCSCPPGYELDSDQKTCQDID 984          

HSP 5 Score: 108.612 bits (270), Expect = 3.002e-23
Identity = 89/280 (31.79%), Postives = 131/280 (46.79%), Query Frame = 3
Query:  984 CKDNNGGCSHLCQS----DPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDM----ELTDPCK------YGNGGCTQFCNSSPNKRAIC----------------------SCLPGFKLEADGLTCSDEDEC-VTG----KHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTG------GCGYKCVNT-DGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGT 1679
            C ++NGGC+H+C+     D +  +  C CR GY +D ND   C DI+EC   NGGC  IC N+ G + C C  G+ +    KSC  ++     EL+  C+       G+  C +    +P    +                       +C  GF+L ADG  C D +EC V G     +  V    C N +GS+ CTC  GY L +++ +C  +D C D          C ++C +  +GSYRCVCP G  L +D  +C  Q +  S+ +K   +C  GT
Sbjct:  248 CGEDNGGCAHICKRLLYPDENQPINKCDCREGYTLDPNDYASCLDIDECLESNGGCSEICENLPGEYKCSCQEGYYLDESGKSCVDINECANPELSSNCQGACENLPGSYRCVEPLEENPEITEVVENPIEKTNEVPVNVSESQPAGKTCNSGFQLSADGTDCQDINECEVDGPEDLDNNAVCQQKCENTIGSFRCTCVEGYHLLEDQRSCA-LDSCTDLENPQLNRTRCAHECQDLPEGSYRCVCPKGYELSEDQHSCLVQESPCST-EKGVEKCSPGT 525          

HSP 6 Score: 105.916 bits (263), Expect = 1.820e-22
Identity = 105/337 (31.16%), Postives = 150/337 (44.51%), Query Frame = 3
Query:  666 CKCPPGYEMSENG-KNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVD-LCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNI-------KNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVD--MELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTC-SDEDECVT--GKHKCVPPSTCI--NDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQN 1628
            C C  GY +  N   +C+DI+EC+ +   CS  C NLPG ++C C     L     +C+      +      C   C  L    + C  P    L+++     VV+   +  N    ++ +S P+       C  G+ +   D   C+DINEC +        N  CQ  C N  GSF C C  G+ +  D +SC  +D   +L +P +     C   C   P     C C  G++L  D  +C   E  C T  G  KC  P TC+   D  S+ C CP GY  R    +C+DIDEC + T  C + C NT G Y+C CP G  L ++  TC  +N
Sbjct:  274 CDCREGYTLDPNDYASCLDIDECLESNGGCSEICENLPGEYKCSCQEGYYLDESGKSCVDINECANPELSSNCQGACENLPG-SYRCVEP----LEENPEITEVVENPIEKTNEVPVNVSESQPAGKT----CNSGFQLSA-DGTDCQDINECEVDGPEDLDNNAVCQQKCENTIGSFRCTCVEGYHLLEDQRSC-ALDSCTDLENP-QLNRTRCAHECQDLPEGSYRCVCPKGYELSEDQHSCLVQESPCSTEKGVEKCS-PGTCLASEDNTSFSCICPTGY--RSEAFSCQDIDECAEDTHLCSHTCQNTPGGYQCQCPEGLNLVEE-YTCLAEN 594          

HSP 7 Score: 54.299 bits (129), Expect = 9.165e-7
Identity = 26/56 (46.43%), Postives = 37/56 (66.07%), Query Frame = 3
Query:  651 DGGFYCKCPPGYEMSENGKNCIDINECIRNRTDC-SHECVNLPGGFRCQCPPDMIL 815
            +G F C CPPGYE+  + K C DI+EC +++T C +  C+N  GGFRC+ P   +L
Sbjct:  960 EGSFKCSCPPGYELDSDQKTCQDIDECDQDKTSCITGTCINEIGGFRCEFPKFPVL 1015          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Fly
Match: frac (gene:FBgn0035798 transcript:FBtr0301222)

HSP 1 Score: 164.081 bits (414), Expect = 3.052e-40
Identity = 126/386 (32.64%), Postives = 175/386 (45.34%), Query Frame = 3
Query:  657 GFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSS--------------------------------------------SVITCKCRPGYAIDVND---------------------VKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLD-YTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTC 1616
             F C CP GY       +C DI+EC  +   CSH C N PGG++CQCP  + L  +   C+   + C+  N  GC   C  L+    +C+C +G  L  D +SC  VD C  NNGGC  +C++ P S                                               TC C PGYA+ +++                        C DI+EC++ NG C H C N  G F C C  G+ +  D ++C  +D      C   NG C+Q C + P   A C+C  GF+L  DG  C+D DEC      C     CIN LG++ C C  GY L K+K++C D+DEC    +GGC ++C+N  G++ C CP G  L  D ++C
Sbjct:  534 SFSCICPTGYR--SEAFSCQDIDECAEDTHLCSHTCQNTPGGYQCQCPEGLNLV-EEYTCLA-ENLCE-VNNNGCEQIC--LTARGGVCACREGFRLSADGKSCEDVDECLVNNGGCQQVCRNLPGSYGCICAAGYELLKLDGIRGYCFDIDECSQRTHGCSDQMLCENLNGSYTCLCPPGYALGLDNHIVTSLNSSFITDSTSSETPSAHTCLDIDECSLANGNCSHFCQNEPGGFQCACPLGYALSEDMRTCQDIDE-----CLDSNGQCSQLCLNQPGGFA-CACETGFELTPDGFGCADIDECSQDYGNCS--DICINLLGTHACACERGYELAKDKLSCLDVDECAGLLSGGCSHECINKAGTFECGCPLGYILNDDGRSC 904          

HSP 2 Score: 145.206 bits (365), Expect = 2.057e-34
Identity = 121/386 (31.35%), Postives = 168/386 (43.52%), Query Frame = 3
Query:  657 GFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDM-ILGPDRINCIPF-IHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRR----------------------SCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDEC---VTG--KHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCE-----------------------------------DIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQN 1622
            G  C C  G+ +S +GK+C D++EC+ N   C   C NLPG + C C     +L  D I    F I  C     G       +  +  + C CP G+ L  D                        +C  +D C   NG CSH CQ++P      C C  GYA+   D++ C+DI+EC   NG C  +CLN  G F C C  G+++  D   C  +D      C    G C+  C +     A C+C  G++L  D L+C D DEC   ++G   H+C      IN  G++ C CP+GY L  +  +C                                    DIDEC    GGC ++C NT+GS++C CP G  L  D KTCQ+
Sbjct:  612 GGVCACREGFRLSADGKSCEDVDECLVNNGGCQQVCRNLPGSYGCICAAGYELLKLDGIRGYCFDIDECSQRTHGCSDQMLCENLNGSYTCLCPPGYALGLDNHIVTSLNSSFITDSTSSETPSAHTCLDIDECSLANGNCSHFCQNEPGG--FQCACPLGYALS-EDMRTCQDIDECLDSNGQCSQLCLNQPGGFACACETGFELTPDGFGCADIDE-----CSQDYGNCSDICINLLGTHA-CACERGYELAKDKLSCLDVDECAGLLSGGCSHEC------INKAGTFECGCPLGYILNDDGRSCSPALVGCPPGTQRSADGCAPIECNPGYTLGSDDKCVDIDECQKQNGGCSHRCSNTEGSFKCSCPPGYELDSDQKTCQD 982          

HSP 3 Score: 144.436 bits (363), Expect = 3.040e-34
Identity = 123/358 (34.36%), Postives = 164/358 (45.81%), Query Frame = 3
Query:  654 GGFYCKCPPGYEMSENGK-----NCIDINECIRNRTDCSHECVNLP-GGFRCQCPPDMILGPDRINCIPFIHPCDSANKGG---CTHHCVKLSD-MRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFK-LEADGLT--CSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRL----------------------RKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQN 1622
            G F C C  GY + E+ +     +C D+     NRT C+HEC +LP G +RC CP    L  D+ +C+    PC S  KG        C+   D   F C CP G+    +  SC  +D C ++   CSH CQ+ P      C+C  G  +++ +   C   N C + N GC+ ICL   G  +C C  G+++  D KSC  VD      C   NGGC Q C + P     C C  G++ L+ DG+   C D DEC    H C     C N  GSY C CP GY L                        +  TC DIDEC    G C + C N  G ++C CP G  L +D +TCQ+
Sbjct:  439 GSFRCTCVEGYHLLEDQRSCALDSCTDLENPQLNRTRCAHECQDLPEGSYRCVCPKGYELSEDQHSCLVQESPC-STEKGVEKCSPGTCLASEDNTSFSCICPTGY--RSEAFSCQDIDECAEDTHLCSHTCQNTPGG--YQCQCPEG--LNLVEEYTCLAENLCEVNNNGCEQICLTARGG-VCACREGFRLSADGKSCEDVDE-----CLVNNGGCQQVCRNLPGSYG-CICAAGYELLKLDGIRGYCFDIDECSQRTHGCSDQMLCENLNGSYTCLCPPGYALGLDNHIVTSLNSSFITDSTSSETPSAHTCLDIDECSLANGNCSHFCQNEPGGFQCACPLGYALSEDMRTCQD 782          

HSP 4 Score: 117.087 bits (292), Expect = 7.374e-26
Identity = 84/229 (36.68%), Postives = 113/229 (49.34%), Query Frame = 3
Query:  654 GGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKD-NNGGCSHLCQSDP--------------------SSSVITC--------------KCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVD 1235
            GGF C CP GY +SE+ + C DI+EC+ +   CS  C+N PGGF C C     L PD   C   I  C S + G C+  C+ L      C+C  G+ L KD+ SC  VD C    +GGCSH C +                      S +++ C              +C PGY +  +D  +C DI+EC  +NGGC H C N EGSF C C PG+++  D K+C  +D
Sbjct:  761 GGFQCACPLGYALSEDMRTCQDIDECLDSNGQCSQLCLNQPGGFACACETGFELTPDGFGCAD-IDEC-SQDYGNCSDICINLLGTH-ACACERGYELAKDKLSCLDVDECAGLLSGGCSHECINKAGTFECGCPLGYILNDDGRSCSPALVGCPPGTQRSADGCAPIECNPGYTLGSDD--KCVDIDECQKQNGGCSHRCSNTEGSFKCSCPPGYELDSDQKTCQDID 984          

HSP 5 Score: 108.612 bits (270), Expect = 3.002e-23
Identity = 89/280 (31.79%), Postives = 131/280 (46.79%), Query Frame = 3
Query:  984 CKDNNGGCSHLCQS----DPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDM----ELTDPCK------YGNGGCTQFCNSSPNKRAIC----------------------SCLPGFKLEADGLTCSDEDEC-VTG----KHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTG------GCGYKCVNT-DGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGT 1679
            C ++NGGC+H+C+     D +  +  C CR GY +D ND   C DI+EC   NGGC  IC N+ G + C C  G+ +    KSC  ++     EL+  C+       G+  C +    +P    +                       +C  GF+L ADG  C D +EC V G     +  V    C N +GS+ CTC  GY L +++ +C  +D C D          C ++C +  +GSYRCVCP G  L +D  +C  Q +  S+ +K   +C  GT
Sbjct:  248 CGEDNGGCAHICKRLLYPDENQPINKCDCREGYTLDPNDYASCLDIDECLESNGGCSEICENLPGEYKCSCQEGYYLDESGKSCVDINECANPELSSNCQGACENLPGSYRCVEPLEENPEITEVVENPIEKTNEVPVNVSESQPAGKTCNSGFQLSADGTDCQDINECEVDGPEDLDNNAVCQQKCENTIGSFRCTCVEGYHLLEDQRSCA-LDSCTDLENPQLNRTRCAHECQDLPEGSYRCVCPKGYELSEDQHSCLVQESPCST-EKGVEKCSPGT 525          

HSP 6 Score: 105.916 bits (263), Expect = 1.820e-22
Identity = 105/337 (31.16%), Postives = 150/337 (44.51%), Query Frame = 3
Query:  666 CKCPPGYEMSENG-KNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVD-LCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNI-------KNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVD--MELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTC-SDEDECVT--GKHKCVPPSTCI--NDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQN 1628
            C C  GY +  N   +C+DI+EC+ +   CS  C NLPG ++C C     L     +C+      +      C   C  L    + C  P    L+++     VV+   +  N    ++ +S P+       C  G+ +   D   C+DINEC +        N  CQ  C N  GSF C C  G+ +  D +SC  +D   +L +P +     C   C   P     C C  G++L  D  +C   E  C T  G  KC  P TC+   D  S+ C CP GY  R    +C+DIDEC + T  C + C NT G Y+C CP G  L ++  TC  +N
Sbjct:  274 CDCREGYTLDPNDYASCLDIDECLESNGGCSEICENLPGEYKCSCQEGYYLDESGKSCVDINECANPELSSNCQGACENLPG-SYRCVEP----LEENPEITEVVENPIEKTNEVPVNVSESQPAGKT----CNSGFQLSA-DGTDCQDINECEVDGPEDLDNNAVCQQKCENTIGSFRCTCVEGYHLLEDQRSC-ALDSCTDLENP-QLNRTRCAHECQDLPEGSYRCVCPKGYELSEDQHSCLVQESPCSTEKGVEKCS-PGTCLASEDNTSFSCICPTGY--RSEAFSCQDIDECAEDTHLCSHTCQNTPGGYQCQCPEGLNLVEE-YTCLAEN 594          

HSP 7 Score: 54.299 bits (129), Expect = 9.165e-7
Identity = 26/56 (46.43%), Postives = 37/56 (66.07%), Query Frame = 3
Query:  651 DGGFYCKCPPGYEMSENGKNCIDINECIRNRTDC-SHECVNLPGGFRCQCPPDMIL 815
            +G F C CPPGYE+  + K C DI+EC +++T C +  C+N  GGFRC+ P   +L
Sbjct:  960 EGSFKCSCPPGYELDSDQKTCQDIDECDQDKTSCITGTCINEIGGFRCEFPKFPVL 1015          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Zebrafish
Match: megf6a (multiple EGF-like-domains 6a [Source:ZFIN;Acc:ZDB-GENE-090312-12])

HSP 1 Score: 716.457 bits (1848), Expect = 0.000e+0
Identity = 445/1196 (37.21%), Postives = 592/1196 (49.50%), Query Frame = 3
Query:  672 CPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQN------------------------------------------TRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCS------------------------------------------ENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK--CEACPSGKWGPTCNQNCDCTYSTG-CDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN-CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKES-DCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFC 3992
            C  GY     G    DI+EC  +   C H CVN  G + C+C P   L  D   CI  +    S N GGC H CV+LS + F C C  G+ L  D + C + + C + NGGC HLC+SD     + C C  G+ + V D K C+D+NEC      C H C N  GSF C C+PG+++G D + CY+++ME+ + C   NGGC+  C        +CSC  G++L  D  TC D +EC  G   C     C N  G Y C C  GYRL  +   C+D+DEC    GGC + C NT GSY C C  G  LG+D  +C +                                             R  S   +   C  GTFG +C   C +C + GYCN +   C C   ++G +C   C +      C    C C+NGGTC+  + KC CPPG++G++C+ GC +G +G++C K C  A ++ RCH+  G CLC PG YG  CHL CP  ++G GCS  C C Q N   C  ++G C CK GY G  C  +CD G++G  C   C       C+  +GQC  +   G +   C R+CP G  G  C + CDC                                           +N   C+ +NG C C+PGF G  C+  C  G +G  C   C C+ +  C HVTG+C C D   G    +AC +G+WGP C   CDC  S G CD + G C C AGY GP+C ++CP+G +G+ C   CQC  G  C+ +SG C C  GW G  CE PC EG++G +C++KC+CLNGG C      CQC  GW G  C  +C  G +G  C   C+CHN G CD   G+C+C  GW G +C++ C +  YG  CNQ C C NGG C   +G C C +G  G  CEL C    +G +C H C C     CD  +G C CP    G  CE           C++ C+C    +C+ +TG C C  G RG  C ++C  G++G  C  +C+C +G  CN V G C C +G TG  C+++C  G +G NC   C     N+ CHP TG C C  G     C+ +C +G YGP C+Q CQC++   C  STG C C  GF G  C   CP   YG +C     C   +  +P+TG CVC     GR C
Sbjct:   39 CFNGYHAYNTGHQGADIDECQVHNGGCQHRCVNTRGSYYCECNPGFRLHVDGRTCIAVLSC--SVNNGGCEHECVQLSPVHFQCRCRRGYQLTADGKRCRLRNPCVEKNGGCVHLCRSD--GGRVVCSCHQGFMLAV-DQKSCEDVNECETGLAACAHSCRNTPGSFSCICNPGYELGSDGRKCYRIEMEIVNTCDSDNGGCSHRCQHGV-LGPVCSCNHGYQLAEDLKTCLDLEECEEGTSCC--EQDCTNYPGGYECYCRAGYRLNADGCGCDDVDECASDRGGCEHTCQNTAGSYHCFCRFGYRLGEDRHSCISLQRSVEELPGPVVVERPLLHLALLQDYPQPLERYHDYEEDSFGELRAESTFAEKFVCLNGTFGHDCSLTCDDCSNGGYCNAEGDACDCPDGWTGILCNQTCPEGTFGKNCS-FTCKCRNGGTCDPISGKCRCPPGVNGDLCQDGCPKGMYGKHCNKKCNCA-NNGRCHRTYGACLCDPGLYGRFCHLPCPKWSYGSGCSSECQCVQQNTLECHRRHGTCVCKPGYQGKTCNRECDSGFYGPGCRLKCQCPAGVSCHPMSGQCQRQCPAGLHGEHCDRECPMGQFGVGCTQFCDCKGAPCNSVTGKCHCPAGQTGQHCEKECEEGRWGLGCAESCPSCDNGGVCDRQNGTCVCSPGFMGNLCQNVCPDGHFGLSCLLRCSCQNEGKCHHVTGLCVCKDGWMGPNCAKACVAGRWGPNCANQCDCRSSVGSCDPVIGLCHCEAGYMGPRCDQKCPQGFFGQSCQHRCQCENGAVCEHVSGACTCLAGWTGTYCEKPCPEGFHGLECQQKCQCLNGGRCHPVTGGCQCPSGWVGPVCNATCEAGTFGPACSQTCRCHNNGTCDPADGRCECGAGWTGSSCEQECSAGLYGVGCNQHCLCQNGGSCDRISGHCTCVSGWTGVACELECAAGHFGMDCQHKCECVNGGVCDRHSGRCLCPAGWTGTHCETACTQGFYGPGCKERCRCDHNAACHHITGTCLCPAGWRGTHCEKVCLPGSYGKRCAHRCQCPHGTSCNHVTGQCGCPAGLTGSGCERMCQSGTFGVNCNQVCQCSELNQLCHPVTGVCYCAPGYYGSKCETECEAGRYGPNCEQECQCLNNGVCKSSTGTCSCPPGFIGPNCNITCPLGRYGQDCAGVSLCGEGARSDPLTGRCVCRAGQRGRDC 1224          

HSP 2 Score: 548.125 bits (1411), Expect = 2.837e-170
Identity = 424/1227 (34.56%), Postives = 563/1227 (45.88%), Query Frame = 3
Query:  651 DGG-FYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINC----IPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDM---ELTDPCKYGNGGCTQFCNS---SPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCIN-DLGSY------LCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQ----NPSQVECQ-----PLQCHCKNGG----------TCESE----------TLKCNCPPGIS----GEICEIGCTEGFFGENCEKNCPTA-----------CSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTC-SCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK-CEA-CPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIY-GNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKE--SDCRQDCQCS-IKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCAN-------------------------------------------GEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCE 3995
            DGG   C C  G+ ++ + K+C D+NEC      C+H C N PG F C C P   LG D   C    +  ++ CDS N GGC+H C +   +  +CSC  G+ L +D ++C  ++ C++    C   C + P      C CR GY ++  D   C D++EC    GGC+H C N  GS+ C C  G+++G D  SC  +     EL  P                  P +R        F       T +++  C+ G        TC +   G Y       C CP G+       TC +        G  G  C     S+ C C NG T    +  C+        L +D   CPKG +G+ C   C NC + G C+     CLC P   G  C + C +    +    ECQ      L+CH ++G           TC  E           LKC CP G+S       C+  C  G  GE+C++ CP             C    C+ +TGKC C  G  G  C   C  G WG+GC+++C SC+      CD +NG C C  G+ G  C   C  G+FGL C   C    +  C+H TG C  K   G     C + C  G  G +C   CDC  +  SC+   G+CHC  G+ G RC+ KC +G +G+ CQ  CQC    +C+HV+G C C     G  CE  CP G  G  C Q C C     C  + G C C +G+ GP C+  C  G +G  CS+ C+C   G CDP  G C C  GW G  CE  C  G YG  C + C C NGG+CD     C C  GW G  CE  CA G++G +C+ +C+C NGG+CD  SG+C C  GW G +C+  C    YGP C + C+C +   CH   G C CPAG  G  CE  C P  YG  C H C C     C+  TG+C CP    G  CE + C S     +C Q CQCS + + C+ VTG C C PG  G +C   CE G +G +C+Q+C+C N                                           G   +P+ G C+C +G  G  C + CA+GW+G NC  +C  C+    C   TG CSC  G     C+  CP G YG  C + C C + ++C+  TG C C  GFYG LCQ  CP  F+G  CQ  C C  N+PC+P TG C+CP    G  CE
Sbjct:  155 DGGRVVCSCHQGFMLAVDQKSCEDVNECETGLAACAHSCRNTPGSFSCICNPGYELGSDGRKCYRIEMEIVNTCDSDN-GGCSHRC-QHGVLGPVCSCNHGYQLAEDLKTCLDLEECEEGTSCCEQDCTNYPGG--YECYCRAGYRLNA-DGCGCDDVDECASDRGGCEHTCQNTAGSYHCFCRFGYRLGEDRHSCISLQRSVEELPGPVVVERPLLHLALLQDYPQPLERYHDYEEDSFGELRAESTFAEKFVCLNGTFGHDCSLTCDDCSNGGYCNAEGDACDCPDGWTGILCNQTCPE--------GTFGKNC-----SFTCKCRNGGTCDPISGKCRCPPGVNGDLCQDG--CPKGMYGKHCNKKC-NCANNGRCHRTYGACLCDPGLYGRFCHLPCPKWSYGSGCSSECQCVQQNTLECHRRHGTCVCKPGYQGKTCNRECDSGFYGPGCRLKCQCPAGVSCHPMSGQCQRQCPAGLHGEHCDRECPMGQFGVGCTQFCDCKGAPCNSVTGKCHCPAGQTGQHCEKECEEGRWGLGCAESCPSCDNGGV--CDRQNGTCVCSPGFMGNLCQNVCPDGHFGLSCLLRCSCQNEGKCHHVTGLCVCK--DGWMGPNCAKACVAGRWGPNCANQCDCRSSVGSCDPVIGLCHCEAGYMGPRCDQKCPQGFFGQSCQHRCQCENGAVCEHVSGACTCLAGWTGTYCEKPCPEGFHGLECQQKCQCLNGGRCHPVTGGCQCPSGWVGPVCNATCEAGTFGPACSQTCRCHNNGTCDPADGRCECGAGWTGSSCEQECSAGLYGVGCNQHCLCQNGGSCDRISGHCTCVSGWTGVACELECAAGHFGMDCQHKCECVNGGVCDRHSGRCLCPAGWTGTHCETACTQGFYGPGCKERCRCDHNAACHHITGTCLCPAGWRGTHCEKVCLPGSYGKRCAHRCQCPHGTSCNHVTGQCGCPAGLTGSGCE-RMCQSGTFGVNCNQVCQCSELNQLCHPVTGVCYCAPGYYGSKCETECEAGRYGPNCEQECQCLNNGVCKSSTGTCSCPPGFIGPNCNITCPLGRYGQDCAGVSLCGEGARSDPLTGRCVCRAGQRGRDCGKGCAEGWFGENCDQRC-NCSNGGVCDALTGHCSCTLGWTGDTCEEVCPRGRYGSDCSEVCDCKNNSTCDRVTGVCLCSPGFYGHLCQHACPVGFHGHRCQLLCDCGANAPCDPETGRCLCPAGYQGLRCE 1354          

HSP 3 Score: 461.84 bits (1187), Expect = 1.333e-138
Identity = 373/1178 (31.66%), Postives = 504/1178 (42.78%), Query Frame = 3
Query:  654 GGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKC----RPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCY---KVDMEL-TDPCKYGNGG--CTQFCNSSPNKR-----AICSCLPGFKLEADGLTCSDED--ECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTC-QGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN-CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGK-CHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIK-NCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQ---------------------------------FRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVSVINRLK 4019
            GG+ C C  GY ++ +G  C D++EC  +R  C H C N  G + C C     LG DR +CI      +             L  +  +   P       D    S  +L  ++      +C +       +  C      GY     D   C D     + N  C         SF C C  G         C     V+ +L  D C  G  G  C + CN + N R       C C PG       L C         + + +CV  +T         C C  GY+ +     C+       Y  GC  KC          CP G +    +  CQ Q   G   +   R CP G FG  C   C        CN     C C    +G  CE +C +    + C      C NGG C+ +   C C PG  G +C+  C +G FG +C   C    +  +CH +TG C+C  GW G +C   C  G WG  C+  C C +++   CDP  G C C+ GY G  C  KC  G+FG  C   C  +   +C H +G C   TC  G     C++ CP G  G +C++ C C  N   C    G C C  G+ G  C   C  G +G  C  +C+C  +  CD   G C C     G    + C +G +G  CNQ+C C     CD+I+G C C++G+ G  C   C  G +G  C  +C+C+ G  CD  SG C C  GW G  CE  C +G+YG  CKE+C+C +   C      C C  GW G  CEK C  G YG+ C  RCQC +G  C+ ++G+C C  G  G  C+  C S T+G NCNQVCQC    + CHP  G+C C  G +G  CE  C   +YGPNC   C C     C   TG C+CP    G +C I         DC     C      + +TG+C C+ G RG  C + C  G FG +C Q+C C+NG  C+ + G C C  G+TG  C++VC +G YG +C   C  C  N TC   TG C C  G   + C+  CP G++G  CQ  C C   A C+P TG C C +G+ G  C+                                   C  N +G +C  RC+C +   C+P  G C C     G  C+  +++  K
Sbjct:  285 GGYECYCRAGYRLNADGCGCDDVDECASDRGGCEHTCQNTAGSYHCFCRFGYRLGEDRHSCISLQRSVEELPGPVVVER--PLLHLALLQDYPQPLERYHDYEEDSFGELRAESTFAEKFVCLNGTFGHDCSLTCDDCSNGGYCNAEGDACDCPDGWTGILCNQTCPEGTFGKNCSFTCKCRNGGTCDPISGKCRCPPGVNGDLCQDGCPKGMYGKHCNKKCNCANNGRCHRTYGACLCDPGLYGRFCHLPCPKWSYGSGCSSECQCVQQNTLECHRRHGTCVCKPGYQGKTCNRECDSGF----YGPGCRLKCQ---------CPAGVSCHPMSGQCQRQCPAGLHGEHCDRECPMGQFGVGCTQFCD--CKGAPCNSVTGKCHCPAGQTGQHCEKECEEGRWGLGCAESCPSCDNGGVCDRQNGTCVCSPGFMGNLCQNVCPDGHFGLSCLLRCSCQ-NEGKCHHVTGLCVCKDGWMGPNCAKACVAGRWGPNCANQCDC-RSSVGSCDPVIGLCHCEAGYMGPRCDQKCPQGFFGQSCQHRCQCENGAVCEHVSGAC---TCLAGWTGTYCEKPCPEGFHGLECQQKCQCL-NGGRCHPVTGGCQCPSGWVGPVCNATCEAGTFGPACSQTCRCHNNGTCDPADGRCECGAGWTGSSCEQECSAGLYGVGCNQHCLCQNGGSCDRISGHCTCVSGWTGVACELECAAGHFGMDCQHKCECVNGGVCDRHSGRCLCPAGWTGTHCETACTQGFYGPGCKERCRCDHNAACHHITGTCLCPAGWRGTHCEKVCLPGSYGKRCAHRCQCPHGTSCNHVTGQCGCPAGLTGSGCERMCQSGTFGVNCNQVCQCSELNQLCHPVTGVCYCAPGYYGSKCETECEAGRYGPNCEQECQCLNNGVCKSSTGTCSCPPGFIGPNCNITCPLGRYGQDCAGVSLCGEGARSDPLTGRCVCRAGQRGRDCGKGCAEGWFGENCDQRCNCSNGGVCDALTGHCSCTLGWTGDTCEEVCPRGRYGSDCSEVC-DCKNNSTCDRVTGVCLCSPGFYGHLCQHACPVGFHGHRCQLLCDCGANAPCDPETGRCLCPAGYQGLRCERGADECDCDGDTPCDPINGRCLCAPGKTGSRCDIGCGVNRFGPDCSQRCECLNGGQCDPRNGRCTCLNGWIGPSCQQGLLSASK 1438          

HSP 4 Score: 371.703 bits (953), Expect = 1.057e-106
Identity = 253/720 (35.14%), Postives = 344/720 (47.78%), Query Frame = 3
Query: 1659 RRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTC-QGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFG-KCE-ACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN--CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTC-------------------------------------------DIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNK 3674
            + C  G +G  C   C      G C+     C C   Y G  C+  C Q      CQ  +C C+NG  CE  +  C C  G +G  CE  C EGF G  C++ C    +  RCH +TG C C  GW G  C+  C  GT+G  CS+TC C+ N    CDP +G+C+C  G+ G +C  +C  G +G+ C+  C       C+  +G C   TC  G   + C+ +C  G  G DC+  C+C    V C+  +G C C  G+TG  CE  CT+G YG  C+  C+C  +  C H+TG C C     G  CE  C  G +G  C   C C + T C+ + GQC C AG  G  C + C  G +G  C++ CQC   N  C P++G+C C PG++G  CE  C+ G YG  C+++C+CLN G C                                           D    +C C  G  G  C K CA G++G NC+ RC C NGG+CD ++G C C  GW G  C+E CP   YG +C++VC C N   C    G+C C  G +G +C+  CP   +G  C   C C A   CD +TG C CP    GL CE      + +D   +C C     C+ + G+C C PG  G +C   C    FG DC Q+C C NG  C+P +G C CL+G             W GP+C+   L  +++K
Sbjct:  751 KACVAGRWGPNCANQCDCRSSVGSCDPVIGLCHCEAGYMGPRCDQKCPQGFFGQSCQ-HRCQCENGAVCEHVSGACTCLAGWTGTYCEKPCPEGFHGLECQQKCQCL-NGGRCHPVTGGCQCPSGWVGPVCNATCEAGTFGPACSQTCRCHNNGT--CDPADGRCECGAGWTGSSCEQECSAGLYGVGCNQHCLCQNGGSCDRISGHC---TCVSGWTGVACELECAAGHFGMDCQHKCECVNGGV-CDRHSGRCLCPAGWTGTHCETACTQGFYGPGCKERCRCDHNAACHHITGTCLCPAGWRGTHCEKVCLPGSYGKRCAHRCQCPHGTSCNHVTGQCGCPAGLTGSGCERMCQSGTFGVNCNQVCQCSELNQLCHPVTGVCYCAPGYYGSKCETECEAGRYGPNCEQECQCLNNGVCKSSTGTCSCPPGFIGPNCNITCPLGRYGQDCAGVSLCGEGARSDPLTGRCVCRAGQRGRDCGKGCAEGWFGENCDQRCNCSNGGVCDALTGHCSCTLGWTGDTCEEVCPRGRYGSDCSEVCDCKNNSTCDRVTGVCLCSPGFYGHLCQHACPVGFHGHRCQLLCDCGANAPCDPETGRCLCPAGYQGLRCE------RGAD---ECDCDGDTPCDPINGRCLCAPGKTGSRCDIGCGVNRFGPDCSQRCECLNGGQCDPRNGRCTCLNG-------------WIGPSCQQGLLSASKSK 1440          

HSP 5 Score: 222.631 bits (566), Expect = 3.175e-58
Identity = 258/905 (28.51%), Postives = 364/905 (40.22%), Query Frame = 3
Query:  492 RIGKYCQNGAFCYQSGYNAKCICPKGFLGTFCDKDLXXXXXXXXXXX------XXXXXIDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQ-------CPPDMI------LGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSS---SVITCKCRPGYAIDVNDVKQCKDI------NECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYK--VDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCIN----DLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQC-IYGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDE 3095
            R+   C  G  C+      +  CP G  G  CD++    +   G  +        C ++ G   C CP G    + G++C    E  R    C+  C +   G  C        C P  +      + PD    +  +  C   N+G C H       +  +C C DG +     ++C       +    C   C+S   S    +  C C  GY     D K  +        + C  +NG    +C +V G+  C C  GW   +  K C +    +E    C+  NGG              C C  G+     G  C+   E  T    C     C N    D     C C  G+       +CE       Y  GC         +  C+C NG +  + +  C      G +       C  G FG +C   C  C++ G C+     CLC   ++GT CE  C Q      C+  +C C +   C   T  C CP G  G  CE  C  G +G+ C   C        C+ +TG+C C  G  GS C  +C +GT+G+ C++ C C++ N + C P  G C C  GY+G  C  +C+ G +G +C   C      +C   TG C      G     C   CP G  G DC     C E + S +   G C C  G  G+ C   C +G +GE C   C C    +CD +TG C C     G    E CP G++G  C++ CDC  ++ CD++ G C+C  G+YG  C   CP G +G  C   C C     CDP +G C C  G+ G  CE   DE          C C     CD    +C C PG  G  C+  C V  +G +C  RC+C NGG CD  +G+C C+ GW G +C +
Sbjct:  589 RLKCQCPAGVSCHPMSGQCQRQCPAGLHGEHCDRECPMGQFGVGCTQFCDCKGAPCNSVTG--KCHCPAG----QTGQHCEKECEEGRWGLGCAESCPSCDNGGVCDRQNGTCVCSPGFMGNLCQNVCPDGHFGLSCLLRCSCQNEGKCHH-------VTGLCVCKDGWMGPNCAKACVAGRWGPNCANQCD--CRSSVGSCDPVIGLCHCEAGYMGPRCDQKCPQGFFGQSCQHRCQCENGA---VCEHVSGA--CTCLAGWTGTYCEKPCPEGFHGLECQQKCQCLNGG------RCHPVTGGCQCPSGWV----GPVCNATCEAGTFGPACSQTCRCHNNGTCDPADGRCECGAGW----TGSSCEQECSAGLYGVGC---------NQHCLCQNGGSCDRISGHC--TCVSGWTGVACELECAAGHFGMDCQHKCE-CVNGGVCDRHSGRCLCPAGWTGTHCETACTQGFYGPGCKE-RCRCDHNAACHHITGTCLCPAGWRGTHCEKVCLPGSYGKRCAHRCQCP-HGTSCNHVTGQCGCPAGLTGSGCERMCQSGTFGVNCNQVCQCSELN-QLCHPVTGVCYCAPGYYGSKCETECEAGRYGPNCEQECQCLNNGVCKSSTGTCSCPP--GFIGPNCNITCPLGRYGQDCAGVSLCGEGARS-DPLTGRCVCRAGQRGRDCGKGCAEGWFGENCDQRCNCSNGGVCDALTGHCSCTLGWTGDTCEEVCPRGRYGSDCSEVCDCKNNSTCDRVTGVCLCSPGFYGHLCQHACPVGFHGHRCQLLCDCGANAPCDPETGRCLCPAGYQGLRCERGADE----------CDCDGDTPCDPINGRCLCAPGKTGSRCDIGCGVNRFGPDCSQRCECLNGGQCDPRNGRCTCLNGWIGPSCQQ 1431          

HSP 6 Score: 109.768 bits (273), Expect = 1.419e-23
Identity = 136/499 (27.25%), Postives = 183/499 (36.67%), Query Frame = 3
Query: 1317 CSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLR---------------KNKMTCEDIDECLDYTGGC-------GYKC--VNTDGSY------RCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEI-------------------------------------------GCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCP---------------------DKTCQ----------GNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSS 2501
            C+C+ G+   A  L C+     +  +HKC   +  + D  S  C CP G+                  K +  C+    C   TG C       G  C  V   GSY      RC CP+G +   ++ T Q     G +     R C  GTFG  C   C        C+     C C P Y G+ CE +C        C+  +C C N G C+S T  C+CPPG  G  C I                                           GC EG+FGENC++ C  + +   C  +TG C C  GW G +C  +CP G +G  CS+ C C  N+   CD   G C C  G++G  C + C  G+ G  C   C       C+ ETG+C                      D  C           G     C   C     G DC + C+C  N   C+ +NG C C  G+ G  C+         +R  SS
Sbjct:  954 CTCVSGWTGVACELECAAGHFGMDCQHKCECVNGGVCDRHSGRCLCPAGWTGTHCETACTQGFYGPGCKERCRCDHNAACHHITGTCLCPAGWRGTHCEKVCLPGSYGKRCAHRCQCPHGTSC--NHVTGQCGCPAGLTGSGCERMCQSGTFGVNCNQVCQCSELNQLCHPVTGVCYCAPGYYGSKCETECEAGRYGPNCEQ-ECQCLNNGVCKSSTGTCSCPPGFIGPNCNITCPLGRYGQDCAGVSLCGEGARSDPLTGRCVCRAGQRGRDCGKGCAEGWFGENCDQRCNCS-NGGVCDALTGHCSCTLGWTGDTCEEVCPRGRYGSDCSEVCDCKNNST--CDRVTGVCLCSPGFYGHLCQHACPVGFHGHRCQLLCDCGANAPCDPETGRCLCPAGYQGLRCERGADECDCDGDTPCDPINGRCLCAPGKTGSRCDIGCGVNRFGPDCSQRCECL-NGGQCDPRNGRCTCLNGWIGPSCQQGLLSASKSKRKDSS 1445          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Zebrafish
Match: megf6a (multiple EGF-like-domains 6a [Source:ZFIN;Acc:ZDB-GENE-090312-12])

HSP 1 Score: 711.835 bits (1836), Expect = 0.000e+0
Identity = 445/1196 (37.21%), Postives = 591/1196 (49.41%), Query Frame = 3
Query:  672 CPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQN------------------------------------------TRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCS------------------------------------------ENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK--CEACPSGKWGPTCNQNCDCTYSTG-CDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN-CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKES-DCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFC 3992
            C  GY     G    DI+EC  +   C H CVN  G + C+C P   L  D   CI  +    S N GGC H CV+LS + F C C  G+ L  D + C + + C + NGGC HLC+SD     + C C  G+ + V D K C+D+NEC      C H C N  GSF C C+PG+++G D + CY+++ME+ + C   NGGC+  C        +CSC  G++L  D  TC D +EC  G   C     C N  G Y C C  GYRL  +   C+D+DEC    GGC + C NT GSY C C  G  LG+D  +C +                                             R  S   +   C  GTFG +C   C +C + GYCN +   C C   ++G +C   C +      C    C C+NGGTC+  + KC CPPG++G++C+ GC +G +G++C K C  A ++ RCH+  G CLC PG YG  CHL CP  ++G GCS  C C Q N   C  ++G C CK GY G  C  +CD G++G  C   C       C+  +GQC  +   G +   C R+CP G  G  C + CDC                                           +N   C+ +NG C C+PGF G  C+  C  G +G  C   C C+ +  C HVTG+C C D   G    +AC +G+WGP C   CDC  S G CD + G C C AGY GP+C ++CP+G +G+ C   CQC  G  C+ +SG C C  GW G  CE PC EG++G +C++KC+CLNGG C      CQC  GW G     SC  G +G  C   C+CHN G CD   G+C+C  GW G +C++ C +  YG  CNQ C C NGG C   +G C C +G  G  CEL C    +G +C H C C     CD  +G C CP    G  CE           C++ C+C    +C+ +TG C C  G RG  C ++C  G++G  C  +C+C +G  CN V G C C +G TG  C+++C  G +G NC   C     N+ CHP TG C C  G     C+ +C +G YGP C+Q CQC++   C  STG C C  GF G  C   CP   YG +C     C   +  +P+TG CVC     GR C
Sbjct:   39 CFNGYHAYNTGHQGADIDECQVHNGGCQHRCVNTRGSYYCECNPGFRLHVDGRTCIAVLSC--SVNNGGCEHECVQLSPVHFQCRCRRGYQLTADGKRCRLRNPCVEKNGGCVHLCRSD--GGRVVCSCHQGFMLAV-DQKSCEDVNECETGLAACAHSCRNTPGSFSCICNPGYELGSDGRKCYRIEMEIVNTCDSDNGGCSHRCQHGV-LGPVCSCNHGYQLAEDLKTCLDLEECEEGTSCC--EQDCTNYPGGYECYCRAGYRLNADGCGCDDVDECASDRGGCEHTCQNTAGSYHCFCRFGYRLGEDRHSCISLQRSVEELPGPVVVERPLLHLALLQDYPQPLERYHDYEEDSFGELRAESTFAEKFVCLNGTFGHDCSLTCDDCSNGGYCNAEGDACDCPDGWTGILCNQTCPEGTFGKNCS-FTCKCRNGGTCDPISGKCRCPPGVNGDLCQDGCPKGMYGKHCNKKCNCA-NNGRCHRTYGACLCDPGLYGRFCHLPCPKWSYGSGCSSECQCVQQNTLECHRRHGTCVCKPGYQGKTCNRECDSGFYGPGCRLKCQCPAGVSCHPMSGQCQRQCPAGLHGEHCDRECPMGQFGVGCTQFCDCKGAPCNSVTGKCHCPAGQTGQHCEKECEEGRWGLGCAESCPSCDNGGVCDRQNGTCVCSPGFMGNLCQNVCPDGHFGLSCLLRCSCQNEGKCHHVTGLCVCKDGWMGPNCAKACVAGRWGPNCANQCDCRSSVGSCDPVIGLCHCEAGYMGPRCDQKCPQGFFGQSCQHRCQCENGAVCEHVSGACTCLAGWTGTYCEKPCPEGFHGLECQQKCQCLNGGRCHPVTGGCQCPSGWVGPV---SCEAGTFGPACSQTCRCHNNGTCDPADGRCECGAGWTGSSCEQECSAGLYGVGCNQHCLCQNGGSCDRISGHCTCVSGWTGVACELECAAGHFGMDCQHKCECVNGGVCDRHSGRCLCPAGWTGTHCETACTQGFYGPGCKERCRCDHNAACHHITGTCLCPAGWRGTHCEKVCLPGSYGKRCAHRCQCPHGTSCNHVTGQCGCPAGLTGSGCERMCQSGTFGVNCNQVCQCSELNQLCHPVTGVCYCAPGYYGSKCETECEAGRYGPNCEQECQCLNNGVCKSSTGTCSCPPGFIGPNCNITCPLGRYGQDCAGVSLCGEGARSDPLTGRCVCRAGQRGRDC 1221          

HSP 2 Score: 535.798 bits (1379), Expect = 5.573e-166
Identity = 423/1237 (34.20%), Postives = 568/1237 (45.92%), Query Frame = 3
Query:  651 DGG-FYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINC----IPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDM---ELTDPCKYGNGGCTQFCNS---SPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCIN-DLGSY------LCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQ----NPSQVECQ-----PLQCHCKNGG----------TCESE----------TLKCNCPPGIS----GEICEIGCTEGFFGENCEKNCPTA-----------CSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTC-SCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK-CEA-CPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIY-GNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKE--SDCRQDCQCS-IKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCAN-------------------------------------------GEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDC-KGQ-CPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVSV-INRL 4016
            DGG   C C  G+ ++ + K+C D+NEC      C+H C N PG F C C P   LG D   C    +  ++ CDS N GGC+H C +   +  +CSC  G+ L +D ++C  ++ C++    C   C + P      C CR GY ++  D   C D++EC    GGC+H C N  GS+ C C  G+++G D  SC  +     EL  P                  P +R        F       T +++  C+ G        TC +   G Y       C CP G+       TC +        G  G  C     S+ C C NG T    +  C+        L +D   CPKG +G+ C   C NC + G C+     CLC P   G  C + C +    +    ECQ      L+CH ++G           TC  E           LKC CP G+S       C+  C  G  GE+C++ CP             C    C+ +TGKC C  G  G  C   C  G WG+GC+++C SC+      CD +NG C C  G+ G  C   C  G+FGL C   C    +  C+H TG C  K   G     C + C  G  G +C   CDC  +  SC+   G+CHC  G+ G RC+ KC +G +G+ CQ  CQC    +C+HV+G C C     G  CE  CP G  G  C Q C C     C  + G C C +G+ GP     C  G +G  CS+ C+C   G CDP  G C C  GW G  CE  C  G YG  C + C C NGG+CD     C C  GW G  CE  CA G++G +C+ +C+C NGG+CD  SG+C C  GW G +C+  C    YGP C + C+C +   CH   G C CPAG  G  CE  C P  YG  C H C C     C+  TG+C CP    G  CE + C S     +C Q CQCS + + C+ VTG C C PG  G +C   CE G +G +C+Q+C+C N                                           G   +P+ G C+C +G  G  C + CA+GW+G NC  +C  C+    C   TG CSC  G     C +GQ CP G YG  C + C C + ++C+  TG C C  GFYG LCQ  C    +GA+C HRC C  ++PC+P+ G C+C    +G  C++   +NR 
Sbjct:  155 DGGRVVCSCHQGFMLAVDQKSCEDVNECETGLAACAHSCRNTPGSFSCICNPGYELGSDGRKCYRIEMEIVNTCDSDN-GGCSHRC-QHGVLGPVCSCNHGYQLAEDLKTCLDLEECEEGTSCCEQDCTNYPGG--YECYCRAGYRLNA-DGCGCDDVDECASDRGGCEHTCQNTAGSYHCFCRFGYRLGEDRHSCISLQRSVEELPGPVVVERPLLHLALLQDYPQPLERYHDYEEDSFGELRAESTFAEKFVCLNGTFGHDCSLTCDDCSNGGYCNAEGDACDCPDGWTGILCNQTCPE--------GTFGKNC-----SFTCKCRNGGTCDPISGKCRCPPGVNGDLCQDG--CPKGMYGKHCNKKC-NCANNGRCHRTYGACLCDPGLYGRFCHLPCPKWSYGSGCSSECQCVQQNTLECHRRHGTCVCKPGYQGKTCNRECDSGFYGPGCRLKCQCPAGVSCHPMSGQCQRQCPAGLHGEHCDRECPMGQFGVGCTQFCDCKGAPCNSVTGKCHCPAGQTGQHCEKECEEGRWGLGCAESCPSCDNGGV--CDRQNGTCVCSPGFMGNLCQNVCPDGHFGLSCLLRCSCQNEGKCHHVTGLCVCK--DGWMGPNCAKACVAGRWGPNCANQCDCRSSVGSCDPVIGLCHCEAGYMGPRCDQKCPQGFFGQSCQHRCQCENGAVCEHVSGACTCLAGWTGTYCEKPCPEGFHGLECQQKCQCLNGGRCHPVTGGCQCPSGWVGPV---SCEAGTFGPACSQTCRCHNNGTCDPADGRCECGAGWTGSSCEQECSAGLYGVGCNQHCLCQNGGSCDRISGHCTCVSGWTGVACELECAAGHFGMDCQHKCECVNGGVCDRHSGRCLCPAGWTGTHCETACTQGFYGPGCKERCRCDHNAACHHITGTCLCPAGWRGTHCEKVCLPGSYGKRCAHRCQCPHGTSCNHVTGQCGCPAGLTGSGCE-RMCQSGTFGVNCNQVCQCSELNQLCHPVTGVCYCAPGYYGSKCETECEAGRYGPNCEQECQCLNNGVCKSSTGTCSCPPGFIGPNCNITCPLGRYGQDCAGVSLCGEGARSDPLTGRCVCRAGQRGRDCGKGCAEGWFGENCDQRC-NCSNGGVCDALTGHCSCTLGWTGDTCEEGQMCPRGRYGSDCSEVCDCKNNSTCDRVTGVCLCSPGFYGHLCQHECELGTFGADCVHRCDCDGDTPCDPINGRCLCAPGKTGSRCDIGCGVNRF 1361          

HSP 3 Score: 454.907 bits (1169), Expect = 2.722e-136
Identity = 367/1150 (31.91%), Postives = 495/1150 (43.04%), Query Frame = 3
Query:  654 GGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKC----RPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCY---KVDMEL-TDPCKYGNGG--CTQFCNSSPNKR-----AICSCLPGFKLEADGLTCSDED--ECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTC-QGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN-CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGK-CHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIK-NCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCD--QVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVSVINRLKLSF 4028
            GG+ C C  GY ++ +G  C D++EC  +R  C H C N  G + C C     LG DR +CI      +             L  +  +   P       D    S  +L  ++      +C +       +  C      GY     D   C D     + N  C         SF C C  G         C     V+ +L  D C  G  G  C + CN + N R       C C PG       L C         + + +CV  +T         C C  GY+ +     C+       Y  GC  KC          CP G +    +  CQ Q   G   +   R CP G FG  C   C        CN     C C    +G  CE +C +    + C      C NGG C+ +   C C PG  G +C+  C +G FG +C   C    +  +CH +TG C+C  GW G +C   C  G WG  C+  C C +++   CDP  G C C+ GY G  C  KC  G+FG  C   C  +   +C H +G C   TC  G     C++ CP G  G +C++ C C  N   C    G C C  G+ G    + C  G +G  C  +C+C  +  CD   G C C     G    + C +G +G  CNQ+C C     CD+I+G C C++G+ G  C   C  G +G  C  +C+C+ G  CD  SG C C  GW G  CE  C +G+YG  CKE+C+C +   C      C C  GW G  CEK C  G YG+ C  RCQC +G  C+ ++G+C C  G  G  C+  C S T+G NCNQVCQC    + CHP  G+C C  G +G  CE  C   +YGPNC   C C     C   TG C+CP    G +C I         DC     C      + +TG+C C+ G RG  C + C  G FG +C Q+C C+NG  C+ + G C C  G+TG  C+  Q+C +G YG +C   C  C  N TC   TG C C  G   + C+ +C  G +G  C   C C     C+P  G C C  G  G+ C   C  N +G +C  RC+C +   C+P  G C C     G  C+          +
Sbjct:  285 GGYECYCRAGYRLNADGCGCDDVDECASDRGGCEHTCQNTAGSYHCFCRFGYRLGEDRHSCISLQRSVEELPGPVVVER--PLLHLALLQDYPQPLERYHDYEEDSFGELRAESTFAEKFVCLNGTFGHDCSLTCDDCSNGGYCNAEGDACDCPDGWTGILCNQTCPEGTFGKNCSFTCKCRNGGTCDPISGKCRCPPGVNGDLCQDGCPKGMYGKHCNKKCNCANNGRCHRTYGACLCDPGLYGRFCHLPCPKWSYGSGCSSECQCVQQNTLECHRRHGTCVCKPGYQGKTCNRECDSGF----YGPGCRLKCQ---------CPAGVSCHPMSGQCQRQCPAGLHGEHCDRECPMGQFGVGCTQFCD--CKGAPCNSVTGKCHCPAGQTGQHCEKECEEGRWGLGCAESCPSCDNGGVCDRQNGTCVCSPGFMGNLCQNVCPDGHFGLSCLLRCSCQ-NEGKCHHVTGLCVCKDGWMGPNCAKACVAGRWGPNCANQCDC-RSSVGSCDPVIGLCHCEAGYMGPRCDQKCPQGFFGQSCQHRCQCENGAVCEHVSGAC---TCLAGWTGTYCEKPCPEGFHGLECQQKCQCL-NGGRCHPVTGGCQCPSGWVGP---VSCEAGTFGPACSQTCRCHNNGTCDPADGRCECGAGWTGSSCEQECSAGLYGVGCNQHCLCQNGGSCDRISGHCTCVSGWTGVACELECAAGHFGMDCQHKCECVNGGVCDRHSGRCLCPAGWTGTHCETACTQGFYGPGCKERCRCDHNAACHHITGTCLCPAGWRGTHCEKVCLPGSYGKRCAHRCQCPHGTSCNHVTGQCGCPAGLTGSGCERMCQSGTFGVNCNQVCQCSELNQLCHPVTGVCYCAPGYYGSKCETECEAGRYGPNCEQECQCLNNGVCKSSTGTCSCPPGFIGPNCNITCPLGRYGQDCAGVSLCGEGARSDPLTGRCVCRAGQRGRDCGKGCAEGWFGENCDQRCNCSNGGVCDALTGHCSCTLGWTGDTCEEGQMCPRGRYGSDCSEVC-DCKNNSTCDRVTGVCLCSPGFYGHLCQHECELGTFGADCVHRCDCDGDTPCDPINGRCLCAPGKTGSRCDIGCGVNRFGPDCSQRCECLNGGQCDPRNGRCTCLNGWIGPSCQQGTFTTTASHW 1407          

HSP 4 Score: 311.612 bits (797), Expect = 1.467e-86
Identity = 345/1143 (30.18%), Postives = 462/1143 (40.42%), Query Frame = 3
Query:  246 EQRQMIRVRRTVE-VPRSKEVKVWKANCRFKGDWCLVHENKSFVEKTETSQIQMVPSIKYECCEGYAELSGYRGCIPKPNCEERIGKYCQNGAFCYQSGYNAKCICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIH------PCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVI------TCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSC-YKVDMELTD---PCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSD-EDECVTGKH---------KCVPPSTCINDLGSYLCT-----------CPVGYRLRKNKMTC--EDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQ-NTRGSSLQKDPR----RCPKGTFGEECLFNC------SNCMHK------GYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSN-RCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYC-ADVAFGKCE-ACPSGKWGPTCNQNCDCT-YSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCI-YGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDE--RCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIK-NCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQ 3479
            ++   I ++R+VE +P    V+    +     D+    E     E+    +++   +      E +  L+G  G      C++     C NG +C   G    C CP G+ G  C++                          CP G      GKNC    +C RN   C       P   +C+CPP +     +  C   ++       C+ AN G C             C C  G       R C +         GCS  CQ    +++       TC C+PGY       K C    +      GC+  C    G     CHP    G   + C   +  E  D   P      GCTQFC+    K A C+ + G      G T    E EC  G+           C     C    G+ +C+           CP G+      + C  ++  +C   TG C    V  DG     C      G+    C NQ + R S    DP      C  G  G  C   C       +C H+        C      C C   ++GT CE  C +    +ECQ  +C C NGG C   T  C CP G  G    + C  G FG  C + C   C +N  C    G+C C  GW GSSC   C  G +G+GC++ C C   N   CD  +G C C  G+ GV C  +C  G+FG+DC   C      +C+  +G+C      G     C+  C  G  G  C++ C C  N+ +C    G C C  G+ G  CE  C  G YG+RC   CQC     C+HVTG C C A +    CE  C SG +G  CNQ C C+  +  C  + G C C  GYYG KC   C  G YG  C +ECQC+  G C   +G C C PG+ G  C   C  G YG  C     C  G   D    +C C  G  G  C K CA G++G NC+ RC C NGG+CD ++G C C  GW G  C+E   CP   YG +C++VC C N   C    G+C C  G +G +C+  C    +G +C+H C C     CD   G C C     G  C+I    +    DC Q C+C     C+   G+C C  G  GP C Q
Sbjct:  341 DRHSCISLQRSVEELPGPVVVERPLLHLALLQDYPQPLERYHDYEEDSFGELRAESTFA----EKFVCLNGTFGHDCSLTCDD-----CSNGGYCNAEG--DACDCPDGWTGILCNQ-------------------------TCPEG----TFGKNCSFTCKC-RNGGTCD------PISGKCRCPPGVNGDLCQDGCPKGMYGKHCNKKCNCANNGRCHR-------TYGACLCDPGLY----GRFCHLPCPKWSYGSGCSSECQCVQQNTLECHRRHGTCVCKPGY-----QGKTCNRECDSGFYGPGCRLKCQCPAGV---SCHP--MSGQCQRQCPAGLHGEHCDRECPMGQFGVGCTQFCDC---KGAPCNSVTGKCHCPAGQTGQHCEKECEEGRWGLGCAESCPSCDNGGVCDRQNGTCVCSPGFMGNLCQNVCPDGHFGLSCLLRCSCQNEGKCHHVTGLC----VCKDGWMGPNCAKACVAGRWGPNCANQCDCRSSVGSCDPVIGLCHCEAGYMGPRCDQKCPQGFFGQSCQHRCQCENGAVCEHVSGACTCLAGWTGTYCEKPCPEGFHGLECQQ-KCQCLNGGRCHPVTGGCQCPSGWVG---PVSCEAGTFGPACSQTC--RCHNNGTCDPADGRCECGAGWTGSSCEQECSAGLYGVGCNQHCLC--QNGGSCDRISGHCTCVSGWTGVACELECAAGHFGMDCQHKCECVNGGVCDRHSGRCLCPA--GWTGTHCETACTQGFYGPGCKERCRCDHNA-ACHHITGTCLCPAGWRGTHCEKVCLPGSYGKRCAHRCQCPHGTSCNHVTGQCGCPAGLTGSGCERMCQSGTFGVNCNQVCQCSELNQLCHPVTGVCYCAPGYYGSKCETECEAGRYGPNCEQECQCLNNGVCKSSTGTCSCPPGFIGPNCNITCPLGRYGQDCAGVSLCGEGARSDPLTGRCVCRAGQRGRDCGKGCAEGWFGENCDQRCNCSNGGVCDALTGHCSCTLGWTGDTCEEGQMCPRGRYGSDCSEVCDCKNNSTCDRVTGVCLCSPGFYGHLCQHECELGTFGADCVHRCDCDGDTPCDPINGRCLCAPGKTGSRCDIGCGVNRFGPDCSQRCECLNGGQCDPRNGRCTCLNGWIGPSCQQ 1397          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Zebrafish
Match: megf6b (multiple EGF-like-domains 6b [Source:ZFIN;Acc:ZDB-GENE-101112-3])

HSP 1 Score: 697.197 bits (1798), Expect = 0.000e+0
Identity = 443/1204 (36.79%), Postives = 593/1204 (49.25%), Query Frame = 3
Query:  669 KCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTC-------------------------------------------QNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCS------------------------------------------ENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTG-CDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCI-YGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKE--SDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHC----VCPKKLSGRFCE 3995
            +C  GY     G    DI+EC  +   C H CVN  G + CQC     L  D   CI  +  C   N GGC H CV+ +     C C   + LD D + C++V+ C + NGGCS +C  D + +   C+C PGY +   D K C+DI+EC +    C H C N  GSF+C C   +++G D K CY+++ME+ + C + NGGC+  C  S     +CSC  G++L+ D  TC D +ECV G   C     C N  G Y C C  GYRL  +  +C+DIDECL   GGC + C+N+ GS++C C  G  L +D ++C                                                R  S   +   C   +FG +C  +C +C++ G CN  +  C C   ++G +C   C +      C  L C CKNGG C+  +  C CPPG+SGE+C+ GC +G +G+ C K C  A ++ RCH+  G CLC PG YG  CHL CP   +G GCS+ C C Q N   C   +G C CK GY G  C  +C+ G+FG  C   C       C+H TG C  K   G     C +DC  G  G  C ++CDCS                                          EN   C+ +NG C C+PGF G+ C+  C  G +G  CQ  C C     C+ V+G C C     G    + C +G+WG  C   CDC  + G CD   G+C C AG+ G +C ++CP G +G GC   CQC    +CD + G C C  GW G  CE PC +G+YG  C++KC CLNGG CD    +C C+ GW G  C ++C  G++G +C   C CHN   CD +SG+C+C  GW G  C +RCP+  +G  C   C C NG  C PE+G C CP+G  G  C+L CP  ++G +C   C C    +CD +TG C CP    G  CE   C+       C   CQC     C+ V+G+C C  G RG +C + C  G+FG DC Q+C C +G  C+ V G C C  GFTG  C+  C  G +G +C   C    RN+ CHP TG C C  G     C+  CP G YG  C+  C+C++G  C   +G+CQC +GF GA C   CP   YG +C H   C      +P TG C    VCP    G  C 
Sbjct:   38 QCFHGYSRFNMGYWIPDIDECQVHNGGCQHTCVNTRGSYHCQCNAGSRLHVDGRTCIA-VQSCGVGN-GGCEHFCVQQTAGHVQCRCRPDYRLDADGKHCTLVNPCAEQNGGCSQMCHRDGAQA--RCECHPGYQL-AEDGKTCEDIDECALGQTDCAHGCRNTRGSFMCVCSAAYELGVDGKQCYRIEMEIVNSCDHDNGGCSHHCEHS-TAGPLCSCNEGYQLDHDHKTCVDINECVDGSSCC--EHDCTNYPGGYECYCTAGYRLNTDGCSCDDIDECLAVNGGCDHACLNSAGSFQCSCRRGYRLDEDRRSCILMEESVEALSSGQTVNKPGPGPQLTILQDFDQILEKYEDYEDDTGELRAESTLAEKFICLNDSFGVDCSLSCEDCVNGGVCNKHRNACDCPDGWTGVVCNETCPEGWFGRNCS-LLCKCKNGGVCDPVSGSCRCPPGVSGELCQDGCPKGLYGKFCNKRCNCA-NNGRCHRTYGACLCDPGLYGRFCHLPCPKWMFGPGCSEECQCVQQNTIECHRHHGDCICKPGYRGHTCKDECESGFFGSACENKCSCPPGVTCDHVTGACQPKCPAGKTGDKCDQDCVEGRFGIGCSQSCDCSGAPCDKVTGQCTCPAGTFGKRCEKECPEGRWGLGCQEWCPVCENGGRCDRRNGTCVCSPGFIGRLCQNSCPAGRFGVGCQLRCVCDLGVRCNPVSGRCSCPPGWTGHNCRKVCDAGRWGLDCESVCDCRNADGVCDAQTGRCHCEAGFTGARCDQKCPAGSFGPGCKHRCQCENQASCDHVGGACTCKTGWTGTFCEKPCPQGFYGLDCQQKCVCLNGGLCDHVSGQCFCKAGWIGTRCNQTCPAGWFGVSCSQTCVCHNNSSCDAVSGQCECGAGWTGDTCSQRCPAGVFGDGCVHRCLCQNGASCDPESGHCFCPSGWTGAACQLECPAGRFGSDCQDRCECVNGAQCDGQTGRCVCPPGWTGERCE-NECERGWFGVGCEDRCQCDHGAVCHHVSGQCLCPAGWRGRRCEKACLPGSFGQDCVQRCSCPSGSSCHHVTGHCGCAPGFTGDGCEHSCLPGTFGQDCNQVCQCSERNQLCHPVTGVCYCAPGFTGLKCEQTCPQGLYGSGCEHQCECLNGGVCLSDSGSCQCPAGFIGAQCNQTCPAGRYGLDCAHVSACGTGVRNDPATGRCTAHQVCPPGWFGSGCS 1230          

HSP 2 Score: 474.167 bits (1219), Expect = 5.428e-143
Identity = 396/1224 (32.35%), Postives = 534/1224 (43.63%), Query Frame = 3
Query:  654 GGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPF------IHPCDSANKGGCTHHCVKLSDM-------------------------RFIC--------------SCPDGHILDKDRRSCSVVD----------------------LCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDI------NECNIKNGGCQHICLNVEGSFICD-------CH---PGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTG--------KHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGC---GYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN-CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQC-HNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECT----CPKSAFGLSCEIKNCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVSVINRLK 4019
            GG+ C C  GY ++ +G +C DI+EC+     C H C+N  G F+C C     L  DR +CI        +    + NK G       L D                          +FIC               C +G + +K R +C   D                      LCK  NGG       DP S   +C+C PG + ++      K +        CN  N G    C    G+ +CD       CH   P W  G       +   + T  C   +G C               C PG++    G TC  +DEC +G        K  C P  TC +  G+    CP G    K    C +    +  +  C   G  C    G  +C CP G T GK                +  + CP+G +G  C   C  C + G C+     C+C P + G +C+  C      V CQ L+C C  G  C   + +C+CPPG +G  C   C  G +G +CE  C    +   C   TG+C C  G+ G+ C   CP G++G GC   C C   N   CD   G C CK G+ G  C   C  G++GLDC   C      +C+H +GQC  K   G     C + CP G  G  C +TC C  NS SC+  +G C C  G+TG  C  +C  G++G+ C   C C+    CD  +G C+C     G      CP+G++G  C   C+C     CD   G+C+C  G+ G +C   C  G +G GC   CQC +G  C  +SG C C  GW G  CE  C  G +G  C ++C C +G +C      C C PG+ G+ CE SC  G +G++C   CQC     LC  ++G C C PG+ G+ C++ CP   YG  C   C+CLNGG C  ++G CQCPAG  G  C  TCP  +YG +C H   C    + D  TG CT    CP   FG            S C Q C CS +  C+ V+G C C  G  G  C + C  G+FG DC  +C C N   C+ V G+C C  G+ G LC+  C  G +G  C+ +C  C    +CHP TGQC C AG+    C+  C  G +G  C Q+C C  GASC+P +G C C SG  G  C   C  N +G +C   C+C + + C+   G C C     G  C  S    L 
Sbjct:  285 GGYECYCTAGYRLNTDGCSCDDIDECLAVNGGCDHACLNSAGSFQCSCRRGYRLDEDRRSCILMEESVEALSSGQTVNKPGPGPQLTILQDFDQILEKYEDYEDDTGELRAESTLAEKFICLNDSFGVDCSLSCEDCVNGGVCNKHRNACDCPDGWTGVVCNETCPEGWFGRNCSLLCKCKNGG-----VCDPVSG--SCRCPPGVSGELCQDGCPKGLYGKFCNKRCNCANNG---RCHRTYGACLCDPGLYGRFCHLPCPKWMFGPGCSEECQCVQQNTIECHRHHGDCI--------------CKPGYR----GHTC--KDECESGFFGSACENKCSCPPGVTCDHVTGACQPKCPAGKTGDKCDQDCVEGRFGIGCSQSCDCSGAPCDKVTG--QCTCPAG-TFGK----------------RCEKECPEGRWGLGCQEWCPVCENGGRCDRRNGTCVCSPGFIGRLCQNSCPAGRFGVGCQ-LRCVCDLGVRCNPVSGRCSCPPGWTGHNCRKVCDAGRWGLDCESVCDCRNADGVCDAQTGRCHCEAGFTGARCDQKCPAGSFGPGCKHRCQCE--NQASCDHVGGACTCKTGWTGTFCEKPCPQGFYGLDCQQKCVCLNGGLCDHVSGQCFCKA--GWIGTRCNQTCPAGWFGVSCSQTCVCHNNS-SCDAVSGQCECGAGWTGDTCSQRCPAGVFGDGCVHRCLCQNGASCDPESGHCFCPSGWTGAACQLECPAGRFGSDCQDRCECVNGAQCDGQTGRCVCPPGWTGERCENECERGWFGVGCEDRCQCDHGAVCHHVSGQCLCPAGWRGRRCEKACLPGSFGQDCVQRCSCPSGSSCHHVTGHCGCAPGFTGDGCEHSCLPGTFGQDCNQVCQCSERNQLCHPVTGVCYCAPGFTGLKCEQTCPQGLYGSGCEHQCECLNGGVCLSDSGSCQCPAGFIGAQCNQTCPAGRYGLDCAHVSACGTGVRNDPATGRCTAHQVCPPGWFG------------SGCSQRCDCSNRGVCDGVSGNCSCALGWTGKHCDKECPDGSFGPDCSLQCSCQNNSTCDRVTGSCHCRPGYYGHLCEHACPAGLFGSGCQQQC-DCMNGASCHPDTGQCVCPAGVHGPRCQHVCAQGRFGVNCSQSCDCADGASCDPVSGRCVCPSGKTGVRCDSDCSVNRFGPDCSLLCECENGAQCDSRNGRCFCLSGWIGFTCSQSAPPELN 1440          

HSP 3 Score: 350.517 bits (898), Expect = 1.787e-99
Identity = 291/958 (30.38%), Postives = 426/958 (44.47%), Query Frame = 3
Query: 1245 TDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTG----KHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITG----KCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCD------PKNGKCKCKKGYHGVNCLYKCDPGYFGLDC--------------SFSCPEDCKTICN-HETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN---CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQ--CEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQ-CLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKES--DCRQDCQC-SIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEV 3998
             D C+  NGGC   C ++      C C  G +L  DG TC     C  G    +H CV  +      G   C C   YRL  +   C  ++ C +  GGC   C       RC C                   G  L +D + C      +EC    ++C H          C+C   Y   +    C +   ++      C   NGG         +C    +G +C   C EG+  ++  K C      N C   +      C  +PG Y   C       T G  C     C   N  GCD        + +C C++GY        C      ++                 +  +D   I   +E  +      +  +++  +  C     G DC  +C+   N   C +    C C  G+TG  C   C +G +G  C   C+C+   +CD V+G C C     G+   + CP G +G  CN+ C+C  +  C +  G C+C  G YG  C   CP+ ++G GCS+ECQC+  N   C    G C C PG+ G  C++ C+ G++G  C+ KC C  G TCD     CQ  C  G  G+ C++ C  G +G  C   C C +G  CD ++G+C C  G  G  C++ CP   +G  C + C  C NGG+C   NG C C  G  G +C+ +CP  ++G  C   C+C    +C+  +G C+CP    G +C  K CD+     DC   C C +    C+  TG+C C+ G  G +C Q C  G+FG  CK +C+C N   C+ V G C C +G+TG  C++ C +G+YG +C+ KC VC     C   +GQC C+AG I   C   CP+G++G  C Q C C + +SC+  +G C+C +G+ G  C  RCP   +G  C HRC C + + C+P +GHC CP   +G  C++
Sbjct:   55 IDECQVHNGGCQHTCVNTRGSYH-CQCNAGSRLHVDGRTCIAVQSCGVGNGGCEHFCVQQTA-----GHVQCRCRPDYRLDADGKHCTLVNPCAEQNGGCSQMCHRDGAQARCEC-----------------HPGYQLAEDGKTCEDI---DECALGQTDCAHGCRNTRGSFMCVCSAAYELGVDGKQCYRIEMEI---VNSCDHDNGGCSH------HCEHSTAGPLCS--CNEGYQLDHDHKTCVDI---NECVDGSSCCEHDCTNYPGGYECYCTAGYRLNTDGCSCDDIDECLAVN-GGCDHACLNSAGSFQCSCRRGYRLDEDRRSCILMEESVEALSSGQTVNKPGPGPQLTILQDFDQILEKYEDYEDDTGELRAESTLAEKFICLNDSFGVDCSLSCEDCVNGGVCNKHRNACDCPDGWTGVVCNETCPEGWFGRNCSLLCKCKNGGVCDPVSGSCRCPPGVSGELCQDGCPKGLYGKFCNKRCNCANNGRCHRTYGACLCDPGLYGRFCHLPCPKWMFGPGCSEECQCVQQNTIECHRHHGDCICKPGYRGHTCKDECESGFFGSACENKCSCPPGVTCDHVTGACQPKCPAGKTGDKCDQDCVEGRFGIGCSQSCDC-SGAPCDKVTGQCTCPAGTFGKRCEKECPEGRWGLGCQEWCPVCENGGRCDRRNGTCVCSPGFIGRLCQNSCPAGRFGVGCQLRCVCDLGVRCNPVSGRCSCPPGWTGHNCR-KVCDAGRWGLDCESVCDCRNADGVCDAQTGRCHCEAGFTGARCDQKCPAGSFGPGCKHRCQCENQASCDHVGGACTCKTGWTGTFCEKPCPQGFYGLDCQQKC-VCLNGGLCDHVSGQCFCKAGWIGTRCNQTCPAGWFGVSCSQTCVCHNNSSCDAVSGQCECGAGWTGDTCSQRCPAGVFGDGCVHRCLCQNGASCDPESGHCFCPSGWTGAACQL 968          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Zebrafish
Match: BX004787.2 (multiple EGF-like-domains 6a [Source:NCBI gene;Acc:565108])

HSP 1 Score: 676.011 bits (1743), Expect = 0.000e+0
Identity = 420/1143 (36.75%), Postives = 576/1143 (50.39%), Query Frame = 3
Query:  720 INECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQN------------------------------------------TRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSC-QCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQC--IYGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIK-NCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMH-GASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVS 4001
            +  C  +   C H CVN  G + C+C P   L  D   CI  +    S N GGC H CV+LS + F C C  G+ L  D + C + + C + NGGC HLC+SD     + C C  G+ + + D + C+D+NEC      C H C N  GSF C C+PG+++G D + CY+++ME+ + C   NGGC+  C        +CSC  G++L  D  TC D +EC  G   C     C N  G Y C C  GYRL  +   C+D+DEC    GGC + C NT GSY C C  G  LG+D  +C +                                             R  S   +   C  GTFG +C   C +C + GYCN +   C C   ++G +C   C +      C    C C+NGGTC+  + KC CPPG++G++C+ GC +G +G++C K C  A ++ RCH+  G CLC PG YG  CHL CP  ++G GCS  C C Q N   C  ++G C CK GY G  C  +CD G++G  C   C       C+  +GQC  +   G +   C R+CP G  G  C + CDC      C    G CHC  G TG+ CE +C +G +G  C  SC  C    +CD   G C C+    G      CP G +G +C   C C     C  + G C+C  G+ GP C+K C  G +G  C+ +C C    G+CDP+ G C C  G+ G  C+  C +G++G  C+ +C+C NG  C+     C C  GW G +CEK C  G++G  C+ +CQC NGG C  ++G C C  GW G      C + T+GP C+Q C+C N G C P +G C+C AG  G  CE  C    YG  C  +C+C+    CD  +G CTC     G++CE++        DC+  C+C     C++ +G+C C  G  G  C   C  G +GL CK++CRC +   C+ + GTCLC +G+ G  C++VC  G YG  C  +C  C    +C+  TGQC C AGL    C+  C SG +G  C Q CQC      C+P TG C C  G+YG+ C+  C    YG NC+  C+C +N  C   TG C CP    G  C ++
Sbjct:   51 LKNCQVHNGGCQHRCVNTRGSYYCECNPGFRLHVDGRTCIAVLSC--SVNNGGCEHECVQLSPVHFQCRCRRGYQLTADGKRCRLRNPCVEKNGGCVHLCRSD--GGRVVCSCHQGFMLAM-DQRSCEDVNECETGLAACAHSCRNTPGSFSCICNPGYELGSDGRKCYRIEMEIVNTCDSDNGGCSHRCQHGV-LGPVCSCNHGYQLAEDLKTCLDLEECEEGTSCC--EQDCTNYPGGYECYCRAGYRLNADGCGCDDVDECASDRGGCEHTCQNTAGSYHCFCRFGYRLGEDRHSCISLQQSVEELPGPVVVERPLLHLALLQDYPQPLERYHDYEEDSFGELRAESTFAEKFVCLNGTFGHDCSLTCDDCSNGGYCNAEGDACDCPDGWTGILCNQTCPEGTFGKNCS-FTCKCRNGGTCDPISGKCRCPPGVNGDLCQDGCPKGMYGKHCNKKCNCA-NNGRCHRTYGACLCDPGLYGRFCHLPCPKWSYGSGCSSECQCVQQNTLECHRRHGTCVCKPGYQGKTCNRECDSGFYGPGCRLKCQCPAGVSCHPMSGQCQRQCPAGLHGEHCDRECPMGQFGVGCTQFCDC--KGAPCNSVTGKCHCPAGQTGQHCEKECEEGRWGLGCAESCPSCDNGGVCDRQNGTCVCSPGFMGNLCQNVCPDGHFGLSCLLRCSCQNEGKCHHVTGLCVCKDGWMGPNCAKACVAGRWGPNCANQCDCRSSVGSCDPVIGQCHCEAGYMGPRCDQKCPKGFFGQSCQHRCQCENGAACEHVSGACTCLAGWTGTYCEKPCPEGFHGLECQQKCQCLNGGRCHPVTGGCQCPSGWVG---PVSCEAGTFGPACSQTCRCHNNGTCDPADGRCECGAGWTGSRCEQECSAGLYGVGCNQHCLCQNGGSCDRISGHCTCVSGWTGVACELECAAGHFGMDCQHKCECVNGGLCDRHSGRCLCPAGWTGTHCETACTQGFYGLGCKERCRCDHNAACHHITGTCLCPAGWRGTHCEKVCLPGSYGKRCAHRCQ-CPHGTSCNHVTGQCGCPAGLTGSGCERMCQSGTFGVNCNQVCQCSELNQLCHPVTGVCYCAPGYYGSKCETECEAGRYGPNCEQECQCLNNGVCKSSTGTCSCPPGFIGPNCNIT 1177          

HSP 2 Score: 656.366 bits (1692), Expect = 0.000e+0
Identity = 428/1168 (36.64%), Postives = 584/1168 (50.00%), Query Frame = 3
Query:  654 GGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNL-PGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVK----QCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVC---PNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCS------------------------------------------ENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK--CEACPSGKWGPTCNQNCDCTYSTG-CDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKES-DCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFC 3992
            G +YC+C PG+ +  +G+ CI +  C  N   C HECV L P  F+C+C     L  D   C    +PC   N GGC H C +    R +CSC  G +L  D+RSC  V+ C+     C+H C++ P S   +C C PGY +  +  K    + + +N C+  NGGC H C +     +C C+ G+Q+  D K+C  +D+E    C+ G   C Q C + P     C C  G++L ADG  C D DEC + +  C    TC N  GSY C C  GYRL +++ +C  + + ++     G   V     +  +    P       D +       R  S   +   C  GTFG +C   C +C + GYCN +   C C   ++G +C   C +      C    C C+NGGTC+  + KC CPPG++G++C+ GC +G +G++C K C  A ++ RCH+  G CLC PG YG  CHL CP  ++G GCS  C C Q N   C  ++G C CK GY G  C  +CD G++G  C   C       C+  +GQC  +   G +   C R+CP G  G  C + CDC                                           +N   C+ +NG C C+PGF G  C+  C  G +G  C   C C+ +  C HVTG+C C D   G    +AC +G+WGP C   CDC  S G CD + GQC C AGY GP+C ++CP+G +G+ C   CQC  G  C+ +SG C C  GW G  CE PC EG++G +C++KC+CLNGG C      CQC  GW G     SC  G +G  C   C+CHN G CD   G+C+C  GW G  C++ C +  YG  CNQ C C NGG C   +G C C +G  G  CEL C    +G +C H C C     CD  +G C CP    G  CE           C++ C+C    +C+ +TG C C  G RG  C ++C  G++G  C  +C+C +G  CN V G C C +G TG  C+++C  G +G NC   C     N+ CHP TG C C  G     C+ +C +G YGP C+Q CQC++   C  STG C C  GF G  C   CP   YG +C     C   +  +P+TG CVC     GR C
Sbjct:   70 GSYYCECNPGFRLHVDGRTCIAVLSCSVNNGGCEHECVQLSPVHFQCRCRRGYQLTADGKRC-RLRNPCVEKN-GGCVHLC-RSDGGRVVCSCHQGFMLAMDQRSCEDVNECETGLAACAHSCRNTPGS--FSCICNPGYELGSDGRKCYRIEMEIVNTCDSDNGGCSHRCQHGVLGPVCSCNHGYQLAEDLKTC--LDLE---ECEEGTSCCEQDCTNYPGGYE-CYCRAGYRLNADGCGCDDVDECASDRGGC--EHTCQNTAGSYHCFCRFGYRLGEDRHSCISLQQSVEELP--GPVVVERPLLHLALLQDYPQPLERYHDYEEDSFGELRAESTFAEKFVCLNGTFGHDCSLTCDDCSNGGYCNAEGDACDCPDGWTGILCNQTCPEGTFGKNCS-FTCKCRNGGTCDPISGKCRCPPGVNGDLCQDGCPKGMYGKHCNKKCNCA-NNGRCHRTYGACLCDPGLYGRFCHLPCPKWSYGSGCSSECQCVQQNTLECHRRHGTCVCKPGYQGKTCNRECDSGFYGPGCRLKCQCPAGVSCHPMSGQCQRQCPAGLHGEHCDRECPMGQFGVGCTQFCDCKGAPCNSVTGKCHCPAGQTGQHCEKECEEGRWGLGCAESCPSCDNGGVCDRQNGTCVCSPGFMGNLCQNVCPDGHFGLSCLLRCSCQNEGKCHHVTGLCVCKDGWMGPNCAKACVAGRWGPNCANQCDCRSSVGSCDPVIGQCHCEAGYMGPRCDQKCPKGFFGQSCQHRCQCENGAACEHVSGACTCLAGWTGTYCEKPCPEGFHGLECQQKCQCLNGGRCHPVTGGCQCPSGWVGPV---SCEAGTFGPACSQTCRCHNNGTCDPADGRCECGAGWTGSRCEQECSAGLYGVGCNQHCLCQNGGSCDRISGHCTCVSGWTGVACELECAAGHFGMDCQHKCECVNGGLCDRHSGRCLCPAGWTGTHCETACTQGFYGLGCKERCRCDHNAACHHITGTCLCPAGWRGTHCEKVCLPGSYGKRCAHRCQCPHGTSCNHVTGQCGCPAGLTGSGCERMCQSGTFGVNCNQVCQCSELNQLCHPVTGVCYCAPGYYGSKCETECEAGRYGPNCEQECQCLNNGVCKSSTGTCSCPPGFIGPNCNITCPLGRYGQDCFGVSLCGEGARSDPLTGRCVCRAGQRGRDC 1217          

HSP 3 Score: 524.242 bits (1349), Expect = 7.429e-162
Identity = 411/1171 (35.10%), Postives = 542/1171 (46.29%), Query Frame = 3
Query:  651 DGG-FYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINC----IPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDM---ELTDPCKYGNGGCTQFCNS---SPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCIN-DLGSY------LCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQ----NPSQVECQ-----PLQCHCKNGG----------TCESE----------TLKCNCPPGIS----GEICEIGCTEGFFGENCEKNCPTA-----------CSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTC-SCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK-CEA-CPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIY-GNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKE--SDCRQDCQCS-IKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGH 3956
            DGG   C C  G+ ++ + ++C D+NEC      C+H C N PG F C C P   LG D   C    +  ++ CDS N GGC+H C +   +  +CSC  G+ L +D ++C  ++ C++    C   C + P      C CR GY ++  D   C D++EC    GGC+H C N  GS+ C C  G+++G D  SC  +     EL  P                  P +R        F       T +++  C+ G        TC +   G Y       C CP G+       TC +        G  G  C     S+ C C NG T    +  C+        L +D   CPKG +G+ C   C NC + G C+     CLC P   G  C + C +    +    ECQ      L+CH ++G           TC  E           LKC CP G+S       C+  C  G  GE+C++ CP             C    C+ +TGKC C  G  G  C   C  G WG+GC+++C SC+      CD +NG C C  G+ G  C   C  G+FGL C   C    +  C+H TG C  K   G     C + C  G  G +C   CDC  +  SC+   G CHC  G+ G RC+ KC KG +G+ CQ  CQC     C+HV+G C C     G  CE  CP G  G  C Q C C     C  + G C C +G+ GP     C  G +G  CS+ C+C   G CDP  G C C  GW G  CE  C  G YG  C + C C NGG+CD     C C  GW G  CE  CA G++G +C+ +C+C NGGLCD  SG+C C  GW G +C+  C    YG  C + C+C +   CH   G C CPAG  G  CE  C P  YG  C H C C     C+  TG+C CP    G  CE + C S     +C Q CQCS + + C+ VTG C C PG  G +C   CE G +G +C+Q+C+C N   C    GTC C  GF G  C+  C  G YG +C     +C       P TG+C C AG    DC   C  G++G  C Q C C +G  C+  TG C C  G+ G  C+  CP   YG++C   C C +NS C+ VTG+
Sbjct:  151 DGGRVVCSCHQGFMLAMDQRSCEDVNECETGLAACAHSCRNTPGSFSCICNPGYELGSDGRKCYRIEMEIVNTCDSDN-GGCSHRC-QHGVLGPVCSCNHGYQLAEDLKTCLDLEECEEGTSCCEQDCTNYPGG--YECYCRAGYRLNA-DGCGCDDVDECASDRGGCEHTCQNTAGSYHCFCRFGYRLGEDRHSCISLQQSVEELPGPVVVERPLLHLALLQDYPQPLERYHDYEEDSFGELRAESTFAEKFVCLNGTFGHDCSLTCDDCSNGGYCNAEGDACDCPDGWTGILCNQTCPE--------GTFGKNC-----SFTCKCRNGGTCDPISGKCRCPPGVNGDLCQDG--CPKGMYGKHCNKKC-NCANNGRCHRTYGACLCDPGLYGRFCHLPCPKWSYGSGCSSECQCVQQNTLECHRRHGTCVCKPGYQGKTCNRECDSGFYGPGCRLKCQCPAGVSCHPMSGQCQRQCPAGLHGEHCDRECPMGQFGVGCTQFCDCKGAPCNSVTGKCHCPAGQTGQHCEKECEEGRWGLGCAESCPSCDNGGV--CDRQNGTCVCSPGFMGNLCQNVCPDGHFGLSCLLRCSCQNEGKCHHVTGLCVCK--DGWMGPNCAKACVAGRWGPNCANQCDCRSSVGSCDPVIGQCHCEAGYMGPRCDQKCPKGFFGQSCQHRCQCENGAACEHVSGACTCLAGWTGTYCEKPCPEGFHGLECQQKCQCLNGGRCHPVTGGCQCPSGWVGPV---SCEAGTFGPACSQTCRCHNNGTCDPADGRCECGAGWTGSRCEQECSAGLYGVGCNQHCLCQNGGSCDRISGHCTCVSGWTGVACELECAAGHFGMDCQHKCECVNGGLCDRHSGRCLCPAGWTGTHCETACTQGFYGLGCKERCRCDHNAACHHITGTCLCPAGWRGTHCEKVCLPGSYGKRCAHRCQCPHGTSCNHVTGQCGCPAGLTGSGCE-RMCQSGTFGVNCNQVCQCSELNQLCHPVTGVCYCAPGYYGSKCETECEAGRYGPNCEQECQCLNNGVCKSSTGTCSCPPGFIGPNCNITCPLGRYGQDC-FGVSLCGEGARSDPLTGRCVCRAGQRGRDCGKGCAEGWFGENCDQRCNCSNGGVCDALTGHCSCTLGWTGDTCEEVCPRGRYGSDCSEVCDCKNNSTCDRVTGY 1291          

HSP 4 Score: 382.104 bits (980), Expect = 1.380e-110
Identity = 346/1155 (29.96%), Postives = 466/1155 (40.35%), Query Frame = 3
Query:  654 GGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKC----RPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCY---KVDMEL-TDPCKYGNGG--CTQFCNSSPNKR-----AICSCLPGFKLEADGLTCSDED--ECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTC-QGNNSIGCQRDCPTGGSGSDCRKTCDCS---------------------------------------ENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFG-KCEA-CPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIY-GNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHN-GGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKE--SDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQ-------------------------------------------------MCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQA 3782
            GG+ C C  GY ++ +G  C D++EC  +R  C H C N  G + C C     LG DR +CI      +             L  +  +   P       D    S  +L  ++      +C +       +  C      GY     D   C D     + N  C         SF C C  G         C     V+ +L  D C  G  G  C + CN + N R       C C PG       L C         + + +CV  +T         C C  GY+ +     C+       Y  GC  KC          CP G +    +  CQ Q   G   +   R CP G FG  C   C        CN     C C    +G  CE +C +    + C      C NGG C+ +   C C PG  G +C+  C +G FG +C   C    +  +CH +TG C+C  GW G +C   C  G WG  C+  C C +++   CDP  G+C C+ GY G  C  KC  G+FG  C   C  +    C H +G C   TC  G     C++ CP G  G +C++ C C                                         N+ +C+  +G C C  G+TG RCE +C+ GLYG  C   C C+    CD ++G C C     G  CE  C +G +G  C   C+C     CD+ +G+C+C AG+ G  C   C +G YG GC + C+C +   C  I+G C C  GW G  CE  C  G YG +C  +C+C +G +C+    +C C  G  G  CE+ C  G +G NC   CQC     LC  ++G C C PG+ G  C+  C +  YGPNC Q CQCLN G C    G C CP G  G  C +TCP  +YG +C    +C    + D  TG C C     G  C  K C       +C Q C CS    C+ +TG C C  G  G  C +                                                 +CE G FG DC  +C C    PC+P++G CLC  G TG  CD  C    +GP+C  +C   N  + C P+ G+C+C  G I             GP CQQ 
Sbjct:  281 GGYECYCRAGYRLNADGCGCDDVDECASDRGGCEHTCQNTAGSYHCFCRFGYRLGEDRHSCISLQQSVEELPGPVVVER--PLLHLALLQDYPQPLERYHDYEEDSFGELRAESTFAEKFVCLNGTFGHDCSLTCDDCSNGGYCNAEGDACDCPDGWTGILCNQTCPEGTFGKNCSFTCKCRNGGTCDPISGKCRCPPGVNGDLCQDGCPKGMYGKHCNKKCNCANNGRCHRTYGACLCDPGLYGRFCHLPCPKWSYGSGCSSECQCVQQNTLECHRRHGTCVCKPGYQGKTCNRECDSGF----YGPGCRLKCQ---------CPAGVSCHPMSGQCQRQCPAGLHGEHCDRECPMGQFGVGCTQFCD--CKGAPCNSVTGKCHCPAGQTGQHCEKECEEGRWGLGCAESCPSCDNGGVCDRQNGTCVCSPGFMGNLCQNVCPDGHFGLSCLLRCSCQ-NEGKCHHVTGLCVCKDGWMGPNCAKACVAGRWGPNCANQCDC-RSSVGSCDPVIGQCHCEAGYMGPRCDQKCPKGFFGQSCQHRCQCENGAACEHVSGAC---TCLAGWTGTYCEKPCPEGFHGLECQQKCQCLNGGRCHPVTGGCQCPSGWVGPVSCEAGTFGPACSQTCRCHNNGTCDPADGRCECGAGWTGSRCEQECSAGLYGVGCNQHCLCQNGGSCDRISGHCTCVSGWTGVACELECAAGHFGMDCQHKCECVNGGLCDRHSGRCLCPAGWTGTHCETACTQGFYGLGCKERCRCDHNAACHHITGTCLCPAGWRGTHCEKVCLPGSYGKRCAHRCQCPHGTSCNHVTGQCGCPAGLTGSGCERMCQSGTFGVNCNQVCQCSELNQLCHPVTGVCYCAPGYYGSKCETECEAGRYGPNCEQECQCLNNGVCKSSTGTCSCPPGFIGPNCNITCPLGRYGQDCFGVSLCGEGARSDPLTGRCVCRAGQRGRDCG-KGCAEGWFGENCDQRCNCSNGGVCDALTGHCSCTLGWTGDTCEEVCPRGRYGSDCSEVCDCKNNSTCDRVTGYIFIKTVIIYCIVLYCIVLYCICELGTFGPDCVHRCDCDGDTPCDPINGRCLCAPGKTGSRCDIGCGVNRFGPDCSQRCECLNGGQ-CDPRNGRCTCLNGWI-------------GPSCQQG 1398          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Zebrafish
Match: zgc:158328 (zgc:158328 [Source:ZFIN;Acc:ZDB-GENE-070112-1202])

HSP 1 Score: 452.21 bits (1162), Expect = 1.071e-140
Identity = 310/856 (36.21%), Postives = 434/856 (50.70%), Query Frame = 3
Query:  189 LSGAGSQKLELGMPNVCEVEQRQMIRVRRTVEVPRSKEVKVWKANCRFKGDWCLVHENKSFVEKTETSQIQMVPSIKYECCEGYAELSGYRGCIPKPNCEERI--GKYCQNGAFCYQSGYNAKCICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTR------------GSSLQKDPRRCPKGTF---------------------------------------------------GEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEK--NCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYC 2555
            + GA S  L+  MPNVCE ++  M+ V++      ++ VKVW+  C  +  WC+ +E ++           M     + CC G+ +    RGC+       R+     C NG  C ++  +  C CP+GF GT C  D+NEC  +NGGCE  CCN  G ++CKCP G ++ ++GK+C DI+EC      C   CVN  G + C+C     +  D   CI  ++ C S   GGC H CV L + ++ C C   + L +D + C + D CKD+NGGCS +C     + ++ C CR G+ +  ND+++C+DI+EC      C H C+N+ GSF C C+PG+++G D K CY+++ME+ + C+  NGGC+  C  + +   +CSC  G++L  D  TC D DEC  G+  C     C N  G Y C C  GY    N  TC+DIDEC+  T GC   CVN+ GSY C C  G  L  D K+C     R            GS ++ +    P   F                                                   G++C  +C +C++ G C  ++  C+C P ++G IC   C +     EC  L C CKNGG C+  T KC CPPG+ G  CE GC +GF+G  C +  NCP   ++  CH++ G CLC PG YG  CHL CP  + G GCS+ C C Q N   CDP+ G C CK GYHG  C   CD GYFG+ C   C       C+ +TG+C      G +   CQ  C  G  G+ C   C C+ N+VSCE  +G C C  G+TG+ C+ +C  G +GE C   C C++   CDHVTG C C
Sbjct:    1 MIGAASLDLQPDMPNVCEEQEMSMLGVKQPCVQAFTRLVKVWRQGCSSQ-RWCVGYERRTGYYTVYKQAYNMEMQTVFRCCPGWMQRGEERGCL------HRVCSSGTCFNGGKCSETS-DHLCQCPEGFEGTRCQYDINECAVSNGGCEGTCCNSIGSYFCKCPGGSKLRDDGKSCQDIDECEEMNGGCQQTCVNTLGSYHCECSEGFRIHADARTCIA-VNSC-SVKNGGCEHKCVDLGNEQYKCECRSNYQLKRDGKHCELKDPCKDHNGGCSQICTD--VNGLVQCSCRTGFTL-ANDLRRCEDIDECVSGQTKCAHGCVNIPGSFRCVCNPGFELGADGKQCYRIEMEIVNGCEKNNGGCSHRCEHTTSG-PLCSCNQGYQLAEDLKTCIDMDECENGEACC--SHFCKNYPGGYECGCRPGY--TPNGCTCDDIDECVSETSGCSQYCVNSLGSYECFCQVGFRLDYDQKSCSPLYQREVEQEEEDEDLFGSEVEPEVLHLPNLLFRRPPQLLHYTAALHRPYDDDTHSYYPEDTHDPEHREELTTISKSMCETGVFGDDCSVSCEDCVNGGVCAAEKDRCVCPPGWTGLICNDTCPEGTYGAECNSL-CVCKNGGRCDPVTGKCLCPPGVHGLHCENGCPQGFYGRLCRRRCNCP---NNGHCHRLYGGCLCTPGLYGKFCHLPCPKWSHGAGCSEECECVQENSLSCDPQMGTCLCKPGYHGDRCQTDCDDGYFGVGCHGLCNCSDGKSCDPKTGECQRMCPAGYHGEKCQMVCEAGFWGAGCANVCQCASNAVSCESSSGRCVCESGYTGQHCDKRCPAGFFGELCAQPCVCKQGHQCDHVTGKCEC 834          

HSP 2 Score: 189.119 bits (479), Expect = 1.256e-48
Identity = 115/307 (37.46%), Postives = 159/307 (51.79%), Query Frame = 3
Query: 2970 CAVGYYGRNCEGRCQ-CHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCD-SKESDCRQDCQCSIKKS--CNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTC--LCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFR 3872
            C  G +G +C   C+ C NGG+C     +C C PGW G+ C++ CP  TYG  CN +C C NGG+C P  G C CP G HG  CE  CP   YG  C   C C     C    G C C    +G  C +     S  + C ++C+C  + S  C+   G C CKPG  G +C   C+ G FG+ C   C C++G+ C+P  G C  +C +G+ G  C  VC  G++G  C   C   +   +C   +G+C CE+G     C  +CP+G++G LC Q C C  G  C+  TG C+C  G++G  C+ R
Sbjct:  540 CETGVFGDDCSVSCEDCVNGGVCAAEKDRCVCPPGWTGLICNDTCPEGTYGAECNSLCVCKNGGRCDPVTGKCLCPPGVHGLHCENGCPQGFYGRLCRRRCNCPNNGHCHRLYGGCLCTPGLYGKFCHLPCPKWSHGAGCSEECECVQENSLSCDPQMGTCLCKPGYHGDRCQTDCDDGYFGVGCHGLCNCSDGKSCDPKTGECQRMCPAGYHGEKCQMVCEAGFWGAGCANVCQCASNAVSCESSSGRCVCESGYTGQHCDKRCPAGFFGELCAQPCVCKQGHQCDHVTGKCECPPGYHGNQCEKR 846          

HSP 3 Score: 176.022 bits (445), Expect = 1.878e-44
Identity = 123/326 (37.73%), Postives = 161/326 (49.39%), Query Frame = 3
Query: 2826 ICENPCDEGYYGDQCKEKCK-CLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCIC--KATEKCDLKTGECTCPKSAFGLSCEIKNCDSKE--SDCRQDCQCSIKKSCNQVTGKCQ--CKPGLRGPQCLQMCEFGNFGLDCKQKCRCA-NGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQ 3779
            I ++ C+ G +GD C   C+ C+NGG C     +C C PGW G  C  +C  G YG  C   C C NGG CD ++GKC C PG  G++C+  CP   YG  C + C C N G CH   G C C  G +G  C L CP   +G  C   C C  + +  CD + G C C     G  C+  +CD       C   C CS  KSC+  TG+CQ  C  G  G +C  +CE G +G  C   C+CA N   C    G C+C SG+TG  CD+ C  G++G  C   C VC +   C   TG+C             +CP GY+G  C++
Sbjct:  535 ISKSMCETGVFGDDCSVSCEDCVNGGVCAAEKDRCVCPPGWTGLICNDTCPEGTYGAECNSLCVCKNGGRCDPVTGKCLCPPGVHGLHCENGCPQGFYGRLCRRRCNCPNNGHCHRLYGGCLCTPGLYGKFCHLPCPKWSHGAGCSEECECVQENSLSCDPQMGTCLCKPGYHGDRCQT-DCDDGYFGVGCHGLCNCSDGKSCDPKTGECQRMCPAGYHGEKCQMVCEAGFWGAGCANVCQCASNAVSCESSSGRCVCESGYTGQHCDKRCPAGFFGELCAQPC-VCKQGHQCDHVTGKC-------------ECPPGYHGNQCEK 845          

HSP 4 Score: 175.637 bits (444), Expect = 2.653e-44
Identity = 121/306 (39.54%), Postives = 151/306 (49.35%), Query Frame = 3
Query: 2715 CPEGLYGEGCSKECQ-CIYGN-CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCL--NGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGEC--TCPKSAFGLSCEIK-NCDSKESDCRQDCQC-SIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQ 3608
            C  G++G+ CS  C+ C+ G  C      C C PGW G IC + C EG YG +C   C C NGG CD    KC C PG HG  CE  C  G+YGR C  RC C N G C  + G C C PG  G  C   CP  ++G  C++ C+C+  N   C P+ G C C  G HGD C+  C    +G  C   C C   + CD KTGEC   CP    G  C++        + C   CQC S   SC   +G+C C+ G  G  C + C  G FG  C Q C C  G  C+ V G C C  G+ G  C++
Sbjct:  540 CETGVFGDDCSVSCEDCVNGGVCAAEKDRCVCPPGWTGLICNDTCPEGTYGAECNSLCVCKNGGRCDPVTGKCLCPPGVHGLHCENGCPQGFYGRLCRRRCNCPNNGHCHRLYGGCLCTPGLYGKFCHLPCPKWSHGAGCSEECECVQENSLSCDPQMGTCLCKPGYHGDRCQTDCDDGYFGVGCHGLCNCSDGKSCDPKTGECQRMCPAGYHGEKCQMVCEAGFWGAGCANVCQCASNAVSCESSSGRCVCESGYTGQHCDKRCPAGFFGELCAQPCVCKQGHQCDHVTGKCECPPGYHGNQCEK 845          

HSP 5 Score: 167.162 bits (422), Expect = 1.148e-41
Identity = 118/307 (38.44%), Postives = 151/307 (49.19%), Query Frame = 3
Query: 3099 CPSQTYGPNCNQVCQ-CLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDS--KESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCA--NGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCS--CEAGLINYDCKGQCPSGYYGPLCQQACQCMHGA-SCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCE 3995
            C +  +G +C+  C+ C+NGG C  E   C CP G  G +C  TCP   YG  C   C+CK   +CD  TG+C CP    GL CE   C        CR+ C C     C+++ G C C PGL G  C   C   + G  C ++C C   N   C+P  GTCLC  G+ G  C   C  G++G  C   C  C+  K+C P+TG+C   C AG     C+  C +G++G  C   CQC   A SC  S+G C C SG+ G  C  RCP  F+G  C   C C     C+ VTG C CP    G  CE
Sbjct:  540 CETGVFGDDCSVSCEDCVNGGVCAAEKDRCVCPPGWTGLICNDTCPEGTYGAECNSLCVCKNGGRCDPVTGKCLCPPGVHGLHCE-NGCPQGFYGRLCRRRCNCPNNGHCHRLYGGCLCTPGLYGKFCHLPCPKWSHGAGCSEECECVQENSLSCDPQMGTCLCKPGYHGDRCQTDCDDGYFGVGCHGLC-NCSDGKSCDPKTGECQRMCPAGYHGEKCQMVCEAGFWGAGCANVCQCASNAVSCESSSGRCVCESGYTGQHCDKRCPAGFFGELCAQPCVCKQGHQCDHVTGKCECPPGYHGNQCE 844          

HSP 6 Score: 165.236 bits (417), Expect = 4.111e-41
Identity = 116/311 (37.30%), Postives = 160/311 (51.45%), Query Frame = 3
Query: 2196 CDPGYFGLDCSFSCPEDCKT--ICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKCEACPSGKW--GPTCNQNCDCTY--STGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICR--CNPGWHGEICENPCDEGYYGDQCKEKCKCL-NGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDER 3098
            C+ G FG DCS SC EDC    +C  E  +C      G   + C   CP G  G++C   C C +N   C+   G C C PG  G  CE  C +G YG  C+  C C  +  C  + G C C    +GK    P  KW  G  C++ C+C    S  CD   G C+C  GY+G +C   C +G +G GC   C C  G +CDP +G C+  C  G+HGE C+  C+ G++G  C   C+C  N  +C+    +C CE G+ G+ C+K C  G++G  C   C C  G  CD ++GKC+C PG+ G  C++R
Sbjct:  540 CETGVFGDDCSVSC-EDCVNGGVCAAEKDRCVCPP--GWTGLICNDTCPEGTYGAECNSLCVC-KNGGRCDPVTGKCLCPPGVHGLHCENGCPQGFYGRLCRRRCNCPNNGHCHRLYGGCLCTPGLYGKFCHLPCPKWSHGAGCSEECECVQENSLSCDPQMGTCLCKPGYHGDRCQTDCDDGYFGVGCHGLCNCSDGKSCDPKTGECQRMCPAGYHGEKCQMVCEAGFWGAGCANVCQCASNAVSCESSSGRCVCESGYTGQHCDKRCPAGFFGELCAQPCVCKQGHQCDHVTGKCECPPGYHGNQCEKR 846          

HSP 7 Score: 115.931 bits (289), Expect = 1.423e-25
Identity = 107/379 (28.23%), Postives = 157/379 (41.42%), Query Frame = 3
Query: 2922 KCQCEPGWHGEFCEKSCAVGY-------------YGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDER---CPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCD-SKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNK-TCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQ--CLSGFYGALCQFRCPNNFYGANCQHRCKCFHNS-PCNPVTGHCVCPKKLSGRFCE 3995
            +C C+ G+  ++ +KSC+  Y             +G   E         L                   D+     P  T+ P   +    ++   C           G  GD C ++C       +C++  +C A +        C CP    GL C     + +  ++C   C C     C+ VTGKC C PG+ G  C   C  G +G  C+++C C N   C+ + G CLC  G  G  C   C K  +G  C  +C     N  +C PQ G C C+ G     C+  C  GY+G  C   C C  G SC+P TG CQ  C +G++G  CQ  C   F+GA C + C+C  N+  C   +G CVC    +G+ C+
Sbjct:  444 ECFCQVGFRLDYDQKSCSPLYQREVEQEEEDEDLFGSEVEPEVLHLPNLLFRRPPQLLHYTAALHRPYDDDTHSYYPEDTHDPEHREELTTISKSMCE---------TGVFGDDCSVSC------EDCVNGGVCAAEKD------RCVCPPGWTGLICNDTCPEGTYGAECNSLCVCKNGGRCDPVTGKCLCPPGVHGLHCENGCPQGFYGRLCRRRCNCPNNGHCHRLYGGCLCTPGLYGKFCHLPCPKWSHGAGCSEECECVQENSLSCDPQMGTCLCKPGYHGDRCQTDCDDGYFGVGCHGLCNCSDGKSCDPKTGECQRMCPAGYHGEKCQMVCEAGFWGAGCANVCQCASNAVSCESSSGRCVCESGYTGQHCD 801          

HSP 8 Score: 110.538 bits (275), Expect = 6.301e-24
Identity = 66/176 (37.50%), Postives = 86/176 (48.86%), Query Frame = 3
Query: 3480 MCEFGNFGLDCKQKCR-CANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNS--PCNPVTGHCVCPKKLSGRFCEV 3998
            MCE G FG DC   C  C NG  C      C+C  G+TG++C+  C +G YG  C   C VC     C P TG+C C  G+    C+  CP G+YG LC++ C C +   C+   G C C  G YG  C   CP   +GA C   C+C   +   C+P  G C+C     G  C+ 
Sbjct:  539 MCETGVFGDDCSVSCEDCVNGGVCAAEKDRCVCPPGWTGLICNDTCPEGTYGAECNSLC-VCKNGGRCDPVTGKCLCPPGVHGLHCENGCPQGFYGRLCRRRCNCPNNGHCHRLYGGCLCTPGLYGKFCHLPCPKWSHGAGCSEECECVQENSLSCDPQMGTCLCKPGYHGDRCQT 713          

HSP 9 Score: 88.1965 bits (217), Expect = 4.960e-17
Identity = 47/135 (34.81%), Postives = 65/135 (48.15%), Query Frame = 3
Query: 3594 ILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEV 3998
             +   +C  G +G +C + C  C     C  +  +C C  G     C   CP G YG  C   C C +G  C+P TG C C  G +G  C+  CP  FYG  C+ RC C +N  C+ + G C+C   L G+FC +
Sbjct:  534 TISKSMCETGVFGDDCSVSCEDCVNGGVCAAEKDRCVCPPGWTGLICNDTCPEGTYGAECNSLCVCKNGGRCDPVTGKCLCPPGVHGLHCENGCPQGFYGRLCRRRCNCPNNGHCHRLYGGCLCTPGLYGKFCHL 668          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Xenopus
Match: unc5b (unc-5 netrin receptor B [Source:Xenbase;Acc:XB-GENE-6046963])

HSP 1 Score: 745.347 bits (1923), Expect = 0.000e+0
Identity = 463/1155 (40.09%), Postives = 603/1155 (52.21%), Query Frame = 3
Query:  681 GYEMSENGKNCI-DINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQN--TRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETG----QCPD---------------------KTCQ-----------------GNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTG-CDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN-CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIK-NCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCE 3995
            G+ +S    N + +++EC  +   C H CVN PG + C+C P   L  D  +CIP ++ C  AN GGC H CV+++   + C C   + L +D + C + + C   NGGC H C +D     + C C PGY + V D K C+DINEC      C H CLN  GSF C C PG+++G D K CY+++ME+ + C+  NGGC+  C    N   +C C  GF+L+ DG TC D DEC  G   C     C N+ G Y C C  GYRL  +   C+D+DEC    GGC   C N  GS++C CP G  L  D+K+C  +    +   + K  R      FG +C   C +C + G CN+++ GC+C   ++G IC   C +      C  L+C+CKNG TC+  T KC CP G+SGE CE GC +G++G++C+K C  A S  RCH+I G CLC PG YG  CHL CP  T+G GCS+ C C Q N   CD K G C CK G+HG  C  KCD G++G+ C   C      +C+H  G    QCP+                     KTC                  G   + C +DCP G  G+ C++ C   EN+ +C    G C C PG+TG  C+  C  G +G+ CQ  C C+ +  CD V+G C C     G     AC SG WG  C   C+C+ S G CD + GQC+C +GY G  C ++C EG YG  C   CQC  G  CD +SG C C  GW G  CE PC +G+YG  C   C+C NG  CD     C C  GW G  C + C    YG NCE  C C NG  C+ ISG+C C PGW G+ C + C    YG NC Q C C NGGKC    G C C  G  G  CE+ C P  YG  CL NC C+    C+ +TG C C     G  C+      +    C + C+C    SCN +TG C C  G RG  C + C  G++G  C + C C +G  CN + G C C  GFTG  CDQ C  G YG NC+  C     ++ CHP TG+C C  G    +C+ +C  G+YGP C++ C C +G  C  +TG C C  G+ GA C   CP   YG  C H C C     CN VTG C+CP   +G+ CE
Sbjct:   68 GFFISTVPINTVYNVDECQTHNGGCQHRCVNTPGSYHCECKPGFRLHSDSRSCIP-VYSCSVAN-GGCEHDCVQVTVAHYQCRCRHNYQLKEDGKHCELTNPCSSRNGGCMHQCNND--GGFVRCSCHPGYRLSV-DGKSCEDINECLTGLAMCAHSCLNTRGSFHCSCSPGYELGADGKQCYRIEMEIINSCEINNGGCSHQCKHI-NAGPLCLCPQGFELDTDGKTCIDTDECTNGASCC--QQECSNNPGGYECLCYSGYRLNPDGCGCDDVDECSLNNGGCEQLCENLIGSFQCSCPLGYRLDGDSKSCLGKFPCIKFLRVTKYMRTAAAENFGPDCTLTCDDCKNGGTCNEEEDGCMCQEGWTGLICNQTCPEGTFGQNCS-LKCNCKNGATCDPITGKCRCPQGVSGEFCEDGCPKGYYGKSCKKKCNCA-SKGRCHRIHGACLCDPGLYGRYCHLACPKWTYGPGCSEECQCVQRNTLECDKKEGLCTCKPGFHGEYCQKKCDVGFYGMGCKNKCSCPHGVLCDHTNGRCQKQCPEGYQGDNCDQECPEGTFGMNCVKTCACGGAPCNHVSGICICPAGKIGLDCAKDCPVGHWGAGCQEICPMCENNGTCNPATGECTCTPGYTGSLCKEICPAGWHGQGCQMRCACQNNGQCDPVSGRCTCPPGWTGHNCRTACDSGHWGTDCLNPCNCSNSDGSCDSVTGQCVCESGYIGLNCDQKCAEGWYGSDCRHPCQCDNGAVCDHVSGACTCAAGWRGTFCELPCPDGFYGTDCANHCQCSNGAHCDHVSGSCTCLAGWTGTTCSQKCQENRYGNNCEETCNCFNGASCNHISGECVCSPGWTGVTCRQACLEGFYGLNCLQQCICRNGGKCDHVTGRCSCQKGWTGLACEIECTPGTYGDGCLQNCNCQNGGVCERETGRCLCHAGWIGELCQTACPAGTFGVKCAERCKCRHGASCNHITGMCDCPAGWRGKHCDKPCLPGSYGEKCVELCTCPHGTACNHITGECGCPPGFTGNGCDQTCIPGTYGLNCEKACQCPGEHQNCHPVTGECVCAPGYHGENCQLKCSHGHYGPNCEKDCTCKNGGHCEATTGMCHCQPGYVGADCSTVCPTGRYGKGCAHVCHCGPRGTCNHVTGKCICPPGRTGQNCE 1212          

HSP 2 Score: 513.842 bits (1322), Expect = 1.029e-157
Identity = 374/1052 (35.55%), Postives = 512/1052 (48.67%), Query Frame = 3
Query:  975 VDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVE-GSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTC-----EDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPL-QCHCKNGG---TCESE--TLKCNCPPGISGEICEIGCTEGF-------------------FGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCP-DKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSE-NSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICY--CADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIY--GNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNG-GLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKE-SDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVSVI 4007
            VD C+ +NGGC H C + P S    C+C+PG+ +  +D + C  +  C++ NGGC+H C+ V    + C C   +Q+  D K C     ELT+PC   NGGC   CN+       CSC PG++L  DG +C D +EC+TG   C    +C+N  GS+ C+C  GY L  +   C     E I+ C    GGC ++C + +    C+CP G  L  D KTC +                     +EC    S C  +   N     CLC+  Y           NP    C  + +C   NGG    CE+   + +C+CP G   +     C   F                   FG +C   C    +   C++    C+C  GW G  C+  CP GT+G  CS  C+C   N   CDP  GKC+C +G  G  C   C  GY+G  C   C    K  C+   G C  D    G     C   CP    G  C + C C + N++ C++K G+C C PGF G+ C+ KC  G YG  C++ C C    LCDH  G C   C +   G    + CP G +G  C + C C  +  C+ ++G CIC AG  G  C+K CP G +G GC + C      G C+P +G C C PG+ G +C+  C  G++G  C+ +C C N G CD    +C C PGW G  C  +C  G++G +C   C C N  G CD ++G+C C  G+ G+NCD++C    YG +C   CQC NG  C   +G C C AG  G  CEL CP   YG +C ++C C     CD  +G CTC     G +C  K  +++  ++C + C C    SCN ++G+C C PG  G  C Q C  G +GL+C Q+C C NG  C+ V G C C  G+TG+ C+  C  G YG  C   C  C     C  +TG+C C AG I   C+  CP+G +G  C + C+C HGASCN  TG C C +G+ G  C   C    YG  C   C C H + CN +TG C CP   +G  C+ + I
Sbjct:   82 VDECQTHNGGCQHRCVNTPGS--YHCECKPGFRLH-SDSRSCIPVYSCSVANGGCEHDCVQVTVAHYQCRCRHNYQLKEDGKHC-----ELTNPCSSRNGGCMHQCNND-GGFVRCSCHPGYRLSVDGKSCEDINECLTGLAMCA--HSCLNTRGSFHCSCSPGYELGADGKQCYRIEMEIINSCEINNGGCSHQCKHINAGPLCLCPQGFELDTDGKTCIDT--------------------DECTNGASCCQQECSNNPGGYECLCYSGYR---------LNPDGCGCDDVDECSLNNGGCEQLCENLIGSFQCSCPLGYRLDGDSKSCLGKFPCIKFLRVTKYMRTAAAENFGPDCTLTCDDCKNGGTCNEEEDGCMCQEGWTGLICNQTCPEGTFGQNCSLKCNCK--NGATCDPITGKCRCPQGVSGEFCEDGCPKGYYGKSCKKKCNCASKGRCHRIHGACLCDPGLYGRY---CHLACPKWTYGPGCSEECQCVQRNTLECDKKEGLCTCKPGFHGEYCQKKCDVGFYGMGCKNKCSCPHGVLCDHTNGRCQKQCPEGYQGDNCDQECPEGTFGMNCVKTCACGGAP-CNHVSGICICPAGKIGLDCAKDCPVGHWGAGCQEICPMCENNGTCNPATGECTCTPGYTGSLCKEICPAGWHGQGCQMRCACQNNGQCDPVSGRCTCPPGWTGHNCRTACDSGHWGTDCLNPCNCSNSDGSCDSVTGQCVCESGYIGLNCDQKCAEGWYGSDCRHPCQCDNGAVCDHVSGACTCAAGWRGTFCELPCPDGFYGTDCANHCQCSNGAHCDHVSGSCTCLAGWTGTTCSQKCQENRYGNNCEETCNCFNGASCNHISGECVCSPGWTGVTCRQACLEGFYGLNCLQQCICRNGGKCDHVTGRCSCQKGWTGLACEIECTPGTYGDGCLQNC-NCQNGGVCERETGRCLCHAGWIGELCQTACPAGTFGVKCAERCKCRHGASCNHITGMCDCPAGWRGKHCDKPCLPGSYGEKCVELCTCPHGTACNHITGECGCPPGFTGNGCDQTCI 1086          

HSP 3 Score: 496.508 bits (1277), Expect = 2.681e-151
Identity = 399/1186 (33.64%), Postives = 531/1186 (44.77%), Query Frame = 3
Query:  648 IDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSC-------SVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCY---KVDMELTD---PCKYGNGGCTQFCNSSPNKR-----AICSCLPGFKLEADGLTCSD-------EDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSN-RCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQ-GNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN-CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGK-CHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKESD-CRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQV----------------------------CAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFC-EVSVINRLKL 4022
            I+ G  C CP G+E+  +GK CID +EC    + C  EC N PGG+ C C     L PD   C   +  C S N GGC   C  L    F CSCP G+ LD D +SC         + + K      +     D + +   CK   G   +  D   C++     I N  C         S  C+C  G         C     V  E  +   P  Y    C + CN +   R       C C PG       L C          +EC     +CV  +T   D    LCTC  G+     +  C+         G  G  C N     +C CP+G      N  CQ Q   G       + CP+GTFG  C+  C+       CN     C+C     G  C  DC        CQ +   C+N GTC   T +C C PG +G +C+  C  G+ G+ C+  C  AC +N +C  ++G+C C PGW G +C   C +G WG  C   C+C+ N+   CD   G+C C+ GY G+NC  KC  G++G DC   C  D   +C+H +G C   TC  G     C+  CP G  G+DC   C CS N   C+  +G C C  G+TG  C  KC +  YG  C+ +C C     C+H++G C C+    G    +AC  G +G  C Q C C     CD + G+C C  G+ G  C   C  G YG+GC + C C  G  C+  +G C C+ GW GE+C+  C  G +G +C E+CKC +G +C+     C C  GW G+ C+K C  G YG  C   C C +G  C+ I+G+C C PG+ G  CD+ C   TYG NC + CQC    + CHP  G C C  G HG+ C+L C    YGPNC  +C CK    C+  TG C C     G  C       +    C   C C  + +CN VTGKC C PG  G  C   C  G +G  C+ +C C +   C+ V G C C+ G+ G  C+ V                            C  G++G NC   C  C    TC P TG C C AG     C+  C  G YG  C + C+C   A C+  TG C C  G  GA C   C  + +G NC   C+C  NS CN + G C+C     G  C EVS+ + + +
Sbjct:  269 INAGPLCLCPQGFELDTDGKTCIDTDECTNGASCCQQECSNNPGGYECLCYSGYRLNPDGCGCDD-VDEC-SLNNGGCEQLCENLIG-SFQCSCPLGYRLDGDSKSCLGKFPCIKFLRVTKYMRTAAAENFGPDCTLTCDDCK-NGGTCNEEEDGCMCQEGWTGLICNQTCPEGTFGQNCSLKCNCKNGATCDPITGKCRCPQGVSGEFCEDGCPKGYYGKSCKKKCNCASKGRCHRIHGACLCDPGLYGRYCHLACPKWTYGPGCSEEC-----QCVQRNTLECDKKEGLCTCKPGFHGEYCQKKCD--------VGFYGMGCKN-----KCSCPHGVLCDHTNGRCQKQCPEGYQGDNCDQECPEGTFGMNCVKTCA--CGGAPCNHVSGICICPAGKIGLDCAKDCPVGHWGAGCQEICPMCENNGTCNPATGECTCTPGYTGSLCKEICPAGWHGQGCQMRC--ACQNNGQCDPVSGRCTCPPGWTGHNCRTACDSGHWGTDCLNPCNCS-NSDGSCDSVTGQCVCESGYIGLNCDQKCAEGWYGSDCRHPCQCDNGAVCDHVSGAC---TCAAGWRGTFCELPCPDGFYGTDCANHCQCS-NGAHCDHVSGSCTCLAGWTGTTCSQKCQENRYGNNCEETCNCFNGASCNHISGECVCSPGWTGVTCRQACLEGFYGLNCLQQCICRNGGKCDHVTGRCSCQKGWTGLACEIECTPGTYGDGCLQNCNCQNGGVCERETGRCLCHAGWIGELCQTACPAGTFGVKCAERCKCRHGASCNHITGMCDCPAGWRGKHCDKPCLPGSYGEKCVELCTCPHGTACNHITGECGCPPGFTGNGCDQTCIPGTYGLNCEKACQCPGEHQNCHPVTGECVCAPGYHGENCQLKCSHGHYGPNCEKDCTCKNGGHCEATTGMCHCQPGYVGADCSTVCPTGRYGKGCAHVCHCGPRGTCNHVTGKCICPPGRTGQNCENRCSGGKYGAGCQMECACQSNGTCDMVTGACHCVKGYYGAACEHVTIYWAAGGLFGLLCLLEIPGQSSLVFTACPPGFHGDNCGELC-TCENGATCDPVTGTCLCPAGFYGDKCQKGCEKGTYGEKCNRLCECEGNAPCDAVTGECICPPGRTGASCDLECRIDRFGPNCTLSCECSWNSQCNSMNGGCICLNGFIGPTCQEVSLCSLVPV 1422          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Xenopus
Match: unc5b (unc-5 netrin receptor B [Source:Xenbase;Acc:XB-GENE-6046963])

HSP 1 Score: 733.791 bits (1893), Expect = 0.000e+0
Identity = 488/1256 (38.85%), Postives = 648/1256 (51.59%), Query Frame = 3
Query:  279 VEVPRSKEVKVWKANCRFKGDWCLVHENKSFVEKTETSQIQMVPSIKYECCEGYAELSGYRGCIPKPNCEERIGKYCQNGAFCYQSGYNAKCICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSL--QKDPRR----------------------------------------CPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK-CEA-CPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGL-CDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCE-IKNCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQ------------CPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQF 3869
            V    S+ VKVWK  C  +  WC+ +E ++    T  +   M      +CC G+++ +G  GC     C   +   C NG  C   G + +C CP GF G  C  D+NECE NNGGCE +CCN  G FYCKC  G+ + E+GK C D++EC  +   C H CVN PG + C+C P   L  D  +CIP ++ C  AN GGC H CV+++   + C C   + L +D + C + + C   NGGC H C +D     + C C PGY + V D K C+DINEC      C H CLN  GSF C C PG+++G D K CY+++ME+ + C+  NGGC+  C    N   +C C  GF+L+ DG TC D DEC  G   C     C N+ G Y C C  GYRL  +   C+D+DEC    GGC   C N  GS++C CP G  L  D+K+C     +   L  Q+   R                                        C  G+FG +C   C +C + G CN+++ GC+C   ++G IC   C +      C  L+C+CKNG TC+  T KC CP G+SGE CE GC +G++G++C+K C  A S  RCH+I G CLC PG YG  CHL CP  T+G GCS+ C C Q N   CD K G C CK G+HG  C  KCD G++G+ C   C      +C+H  G+C  +  +G     C + C +G  G+DC   C+CS +  SC+   G C C  G+ G  C+ KC +G YG  C+  CQC    +CDHV+G C CA    G  CE  CP G +G  C  +C C+    CD ++G C CLAG+ G  CS+ C EG YG  C ++C C  G  CD ++G C C  GW G  C+ PC  G YG++C E C C +G  C+    +C C PG+ G  C+++C  G YG NCE  CQC      C  ++G+C C PG+ G NC  +C    YGPNC + C C NGG C    GMC C  G  G  C   CP  +YG  C H C C     C+  TG+C CP    G +CE + + +    DC+Q C C     CN V G C C  G +GP C + C  G +G  C+ +C C +   C+ V G C C+ G+ G  C+  C  G++G NC   C  C    TC P TG C C AG     C+              C  G YG  C + C+C   A C+  TG C C  G  GA C  
Sbjct:    1 VIQAFSRMVKVWKQGCAGQ-MWCVGYERRTAYYITYRTVYSMDYKSVNKCCPGWSQRNGEAGCHYTA-CTTGV---CFNGGNC-ADGSSQQCFCPAGFQGPRCQYDVNECENNNGGCEVQCCNTIGSFYCKCSDGHSLKEDGKTCQDVDECQTHNGGCQHRCVNTPGSYHCECKPGFRLHSDSRSCIP-VYSCSVAN-GGCEHDCVQVTVAHYQCRCRHNYQLKEDGKHCELTNPCSSRNGGCMHQCNND--GGFVRCSCHPGYRLSV-DGKSCEDINECLTGLAMCAHSCLNTRGSFHCSCSPGYELGADGKQCYRIEMEIINSCEINNGGCSHQCKHI-NAGPLCLCPQGFELDTDGKTCIDTDECTNGASCC--QQECSNNPGGYECLCYSGYRLNPDGCGCDDVDECSLNNGGCEQLCENLIGSFQCSCPLGYRLDGDSKSCLAITHQAEVLPGQRPIVRSLPQVTLLRDEFAQFFDEDYDDEEIQPCSFLTEFLLVLLVCFGGSFGPDCTLTCDDCKNGGTCNEEEDGCMCQEGWTGLICNQTCPEGTFGQNCS-LKCNCKNGATCDPITGKCRCPQGVSGEFCEDGCPKGYYGKSCKKKCNCA-SKGRCHRIHGACLCDPGLYGRYCHLACPKWTYGPGCSEECQCVQRNTLECDKKEGLCTCKPGFHGEYCQKKCDVGFYGMGCKNKCSCPHGVLCDHTNGRCQKQCPEGYQGDNCDQACDSGHWGTDCLNPCNCSNSDGSCDSVTGQCVCESGYIGLNCDQKCAEGWYGSDCRHPCQCDNGAVCDHVSGACTCAAGWRGTFCELPCPDGFYGTDCANHCQCSNGAHCDHVSGSCTCLAGWTGTTCSQTCLEGFYGLNCLQQCICRNGGKCDHVTGRCSCQKGWTGLHCDKPCLPGSYGEKCVELCTCPHGTACNHITGECGCPPGFTGNGCDQTCIPGTYGLNCEKACQCPGEHQNCHPVTGECVCAPGYHGENCQLKCSHGHYGPNCEKDCTCKNGGHCEATTGMCHCQPGYVGADCSTVCPTGRYGKGCAHVCHCGPRGTCNHVTGKCICPPGRTGQNCENMCSRNYFGEDCKQRCTCKNGGMCNPVDGSCTCGLGWQGPTCEEGCSGGKYGAGCQMECACQSNGTCDMVTGACHCVKGYYGAACEHACPPGFHGDNCGELC-TCENGATCDPVTGTCLCPAGFYGDKCQKAIVCTISCHFLSGCEKGTYGEKCNRLCECEGNAPCDAVTGECICPPGRTGASCDL 1239          

HSP 2 Score: 431.024 bits (1107), Expect = 9.013e-129
Identity = 273/713 (38.29%), Postives = 365/713 (51.19%), Query Frame = 3
Query: 1923 IGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCP-DKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSE-NSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICY--CADVAFGKC--EACPSGKWGPTCNQNCDCTYSTG-CDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN-CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKAT-EKCDLKTGECTCPKSAFGLSCEIK-NCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVSVINRLKLSFI 4031
            + C  G FG +C   C    +   C++    C+C  GW G  C+  CP GT+G  CS  C+C   N   CDP  GKC+C +G  G  C   C  GY+G  C   C    K  C+   G C  D    G     C   CP    G  C + C C + N++ C++K G+C C PGF G+ C+ KC  G YG  C++ C C    LCDH  G C   C +   G    +AC SG WG  C   C+C+ S G CD + GQC+C +GY G  C ++C EG YG  C   CQC  G  CD +SG C C  GW G  CE PC +G+YG  C   C+C NG  CD     C C  GW G  C ++C  G+YG NC  +C C NGG CD ++G+C C  GW G++CD+ C   +YG  C ++C C +G  C+   G C CP G  G+ C+ TC P  YG NC   C C    + C   TGEC C     G +C++K +      +C +DC C     C   TG C C+PG  G  C  +C  G +G  C   C C     CN V G C+C  G TG  C+ +C++ ++G +CK +C  C     C+P  G C+C  G     C+  C  G YG  CQ  C C    +C+  TGAC C+ G+YGA C+  CP  F+G NC   C C + + C+PVTG C+CP    G  C+ +++  +   F+
Sbjct:  489 LVCFGGSFGPDCTLTCDDCKNGGTCNEEEDGCMCQEGWTGLICNQTCPEGTFGQNCSLKCNCK--NGATCDPITGKCRCPQGVSGEFCEDGCPKGYYGKSCKKKCNCASKGRCHRIHGACLCDPGLYGRY---CHLACPKWTYGPGCSEECQCVQRNTLECDKKEGLCTCKPGFHGEYCQKKCDVGFYGMGCKNKCSCPHGVLCDHTNGRCQKQCPEGYQGDNCDQACDSGHWGTDCLNPCNCSNSDGSCDSVTGQCVCESGYIGLNCDQKCAEGWYGSDCRHPCQCDNGAVCDHVSGACTCAAGWRGTFCELPCPDGFYGTDCANHCQCSNGAHCDHVSGSCTCLAGWTGTTCSQTCLEGFYGLNCLQQCICRNGGKCDHVTGRCSCQKGWTGLHCDKPCLPGSYGEKCVELCTCPHGTACNHITGECGCPPGFTGNGCDQTCIPGTYGLNCEKACQCPGEHQNCHPVTGECVCAPGYHGENCQLKCSHGHYGPNCEKDCTCKNGGHCEATTGMCHCQPGYVGADCSTVCPTGRYGKGCAHVCHCGPRGTCNHVTGKCICPPGRTGQNCENMCSRNYFGEDCKQRC-TCKNGGMCNPVDGSCTCGLGWQGPTCEEGCSGGKYGAGCQMECACQSNGTCDMVTGACHCVKGYYGAACEHACPPGFHGDNCGELCTCENGATCDPVTGTCLCPAGFYGDKCQKAIVCTISCHFL 1195          

HSP 3 Score: 94.3597 bits (233), Expect = 1.168e-18
Identity = 52/145 (35.86%), Postives = 75/145 (51.72%), Query Frame = 3
Query: 3567 CLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVS 4001
            C  L+ F  +L   VC  G +GP+C L C  C    TC+ +   C C+ G     C   CP G +G  C   C C +GA+C+P TG C+C  G  G  C+  CP  +YG +C+ +C C     C+ + G C+C   L GR+C ++
Sbjct:  478 CSFLTEFLLVL--LVCFGGSFGPDCTLTCDDCKNGGTCNEEEDGCMCQEGWTGLICNQTCPEGTFGQNCSLKCNCKNGATCDPITGKCRCPQGVSGEFCEDGCPKGYYGKSCKKKCNCASKGRCHRIHGACLCDPGLYGRYCHLA 620          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Xenopus
Match: unc5b (unc-5 netrin receptor B [Source:Xenbase;Acc:XB-GENE-6046963])

HSP 1 Score: 721.85 bits (1862), Expect = 0.000e+0
Identity = 477/1313 (36.33%), Postives = 635/1313 (48.36%), Query Frame = 3
Query:  294 SKEVKVWKANCRFKGDWCLVHENKSFVEKTETSQIQMVPSIKYECCEGYAELSGYRGCIPKPNCEERIGKYCQNGAFCYQSGYNAKCICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQ-----------------------------------NTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSC-QCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIY--GNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPP---DKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKESD-CRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQ--------------------------FRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVSVINRLKL 4022
            S+ VKVWK  C  +  WC+ +E ++    T  +   M      +CC G+++ +G  G      C   +   C NG  C   G + +C CP GF G  C                                           D++EC  +   C H CVN PG + C+C P   L  D  +CIP ++ C  AN GGC H CV+++   + C C   + L +D + C + + C   NGGC H C +D     + C C PGY + V D K C+DINEC      C H CLN  GSF C C PG+++G D K CY+++ME+ + C+  NGGC+  C    N   +C C  GF+L+ DG TC D DEC  G   C     C N+ G Y C C  GYRL  +   C+D+DEC    GGC   C N  GS++C CP G  L  D+K+C  +                                     RG     +   C  G+FG +C   C +C + G CN+++ GC+C   ++G IC   C +      C  L+C+CKNG TC+  T KC CP G+SGE CE GC +G++G++C+K C  A S  RCH+I G CLC PG YG  CHL CP  T+G GCS+ C C Q N   CD K G C CK G+HG  C  KCD G++G+ C   C      +C+H  G+C  +  +G     C ++CP G  G +C KTC C      C   +GIC C  G  G  C   C  G +G  CQ  C  C  +  C+  TG C C     G    E CP+G  G  C   C C  +  CD ++G+C C  G+ G  C   C  G +G  C   C C    G+CD ++G C C  G+ G  C+  C EG+YG  C+  C+C NG  CD     C C  GW G FCE  C  G+YG +C   CQC NG  CD +SG C C+ GW G  C ++C    YG NC + C C NG  C+  +G C C   R+     LT P      YG NCL  CIC+   KCD  TG C+C K   GL+CEI+       D C Q+C C     C + TG+C C  G  G  C   C  G++G  C + C C +G  CN + G C C  GFTG  CDQ C  G YG NC+  C     ++ CHP TG+C C  G    +C+ +C  G+YGP C++ C C +G  C  +TG C C  G+ GA C                             CP  F+G NC   C C + + C+PVTG C+CP    G  C+   ++ + L
Sbjct:    6 SRMVKVWKQGCAGQ-MWCVGYERRTAYYITYRTVYSMDYKSVNKCCPGWSQRNGEAG----SACTTGV---CFNGGNC-ADGSSQQCFCPAGFQGPRCQ-----------------------------------------YDVDECQTHNGGCQHRCVNTPGSYHCECKPGFRLHSDSRSCIP-VYSCSVAN-GGCEHDCVQVTVAHYQCRCRHNYQLKEDGKHCELTNPCSSRNGGCMHQCNND--GGFVRCSCHPGYRLSV-DGKSCEDINECLTGLAMCAHSCLNTRGSFHCSCSPGYELGADGKQCYRIEMEIINSCEINNGGCSHQCKHI-NAGPLCLCPQGFELDTDGKTCIDTDECTNGASCC--QQECSNNPGGYECLCYSGYRLNPDGCGCDDVDECSLNNGGCEQLCENLIGSFQCSCPLGYRLDGDSKSCLAEVLPGQRPIVRSLPQVTLLRDEFAQFFDEDYDDEEAEARGEHTLSESFVCFGGSFGPDCTLTCDDCKNGGTCNEEEDGCMCQEGWTGLICNQTCPEGTFGQNCS-LKCNCKNGATCDPITGKCRCPQGVSGEFCEDGCPKGYYGKSCKKKCNCA-SKGRCHRIHGACLCDPGLYGRYCHLACPKWTYGPGCSEECQCVQRNTLECDKKEGLCTCKPGFHGEYCQKKCDVGFYGMGCKNKCSCPHGVLCDHTNGRCQKQCPEGYQGDNCDQECPEGTFGMNCVKTCACG--GAPCNHVSGICICPAGKIGLDCAKDCPVGHWGAGCQEICPMCENNGTCNPATGECTCTPGYTGSLCKEICPAGWHGQGCQMRCACQNNGQCDPVSGRCTCPPGWTGHNCRTACDSGHWGTDCLNPCNCSNSDGSCDSVTGQCVCESGYIGLNCDQKCAEGWYGSDCRHPCQCDNGAVCDHVSGACTCAAGWRGTFCELPCPDGFYGTDCANHCQCSNGAHCDHVSGSCTCLAGWTGTTCSQKCQENRYGNNCEETCNCFNGASCNHISGECVCKITRNILFFSLTFPAGLRSFYGLNCLQQCICRNGGKCDHVTGRCSCQKGWTGLACEIECTPGTYGDGCLQNCNCQNGGVCERETGRCLCHAGWIGELCQTACLPGSYGEKCVELCTCPHGTACNHITGECGCPPGFTGNGCDQTCIPGTYGLNCEKACQCPGEHQNCHPVTGECVCAPGYHGENCQLKCSHGHYGPNCEKDCTCKNGGHCEATTGMCHCQPGYVGADCSTGKLQKVFSHQNIMEINTETLLSLVFTACPPGFHGDNCGELCTCENGATCDPVTGTCLCPAGFYGDKCQKGQVSCMCL 1256          

HSP 2 Score: 281.952 bits (720), Expect = 7.167e-77
Identity = 239/798 (29.95%), Postives = 335/798 (41.98%), Query Frame = 3
Query: 1305 KRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCT--CPVGYRLRKNKMTCEDIDECLDYTGGC---GYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTC-QGNNSIGCQRDCPTGGSGSDCRKTCDCS---------------------------------------------ENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCI--YGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEK--------------------------SCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDER----------------------------CPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCE---IKNC 3362
            K  +C+C PGF  E     C      +  K+KC  P   + D  +  C   CP GY+       C +    ++    C   G  C +  G   C+CP G+               G    KD   CP G +G  C   C  C + G CN     C C P Y+G++C+  C        CQ ++C C+N G C+  + +C CPPG +G  C   C  G +G +C   C  + S   C  +TG+C+C  G+ G +C   C  G +G  C   C C+  N   CD  +G C C  G+ G  C   C  G++G DC+  C       C+H +G C   TC  G     C + C     G++C +TC+C                                               N   C+   G C C  G+TG  CE++CT G YG+ C  +C C+   +C+  TG C C     G+    AC  G +G  C + C C + T C+ I G+C C  G+ G  C + C  G YG  C K CQC   + NC P++G C C PG+HGE C+  C  G+YG  C++ C C NGG C+     C C+PG+ G  C                            +C  G++G NC   C C NG  CD ++G C C  G+ G  C +                             C   TYG  CN++C+C     C    G C CP GR G  C+L C  D++GPNC  +C C    +C+   G C C     G +C+   ++NC
Sbjct:  596 KEGLCTCKPGFHGEYCQKKCDVGFYGMGCKNKCSCPHGVLCDHTNGRCQKQCPEGYQGDNCDQECPEGTFGMNCVKTCACGGAPCNHVSGI--CICPAGKI--------------GLDCAKD---CPVGHWGAGCQEICPMCENNGTCNPATGECTCTPGYTGSLCKEICPAGWHGQGCQ-MRCACQNNGQCDPVSGRCTCPPGWTGHNCRTACDSGHWGTDCLNPCNCSNSDGSCDSVTGQCVCESGYIGLNCDQKCAEGWYGSDCRHPCQCD--NGAVCDHVSGACTCAAGWRGTFCELPCPDGFYGTDCANHCQCSNGAHCDHVSGSC---TCLAGWTGTTCSQKCQENRYGNNCEETCNCFNGASCNHISGECVCKITRNILFFSLTFPAGLRSFYGLNCLQQCICRNGGKCDHVTGRCSCQKGWTGLACEIECTPGTYGDGCLQNCNCQNGGVCERETGRCLCHAGWIGELCQTACLPGSYGEKCVELCTCPHGTACNHITGECGCPPGFTGNGCDQTCIPGTYGLNCEKACQCPGEHQNCHPVTGECVCAPGYHGENCQLKCSHGHYGPNCEKDCTCKNGGHCEATTGMCHCQPGYVGADCSTGKLQKVFSHQNIMEINTETLLSLVFTACPPGFHGDNCGELCTCENGATCDPVTGTCLCPAGFYGDKCQKGQVSCMCLHGHSLLVMAIVCTISCHFLSGCEKGTYGEKCNRLCECEGNAPCDAVTGECICPPGRTGASCDLECRIDRFGPNCTLSCECSWNSQCNSMNGGCICLNGFIGPTCQEGKLQNC 1368          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Xenopus
Match: unc5b (unc-5 netrin receptor B [Source:Xenbase;Acc:XB-GENE-6046963])

HSP 1 Score: 659.833 bits (1701), Expect = 0.000e+0
Identity = 430/1157 (37.17%), Postives = 571/1157 (49.35%), Query Frame = 3
Query:  279 VEVPRSKEVKVWKANCRFKGDWCLVHENKSFVEKTETSQIQMVPSIKYECCEGYAELSGYRGCIPKPN-CEERIGKYCQNGAFCYQSGYNAKCICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQ-----------------------------------NTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSC-QCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIY--GNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPP---DKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKESD-CRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVC 3614
            V    S+ VKVWK  C  +  WC+ +E ++    T  +   M      +CC G+++ +G  GC    N CE   G            G   +C                              N  G FYCKC  G+ + E+GK C D++EC  +   C H CVN PG + C+C P   L  D  +CIP ++ C  AN GGC H CV+++   + C C   + L +D + C + + C   NGGC H C +D     + C C PGY + V D K C+DINEC      C H CLN  GSF C C PG+++G D K CY+++ME+ + C+  NGGC+  C    N   +C C  GF+L+ DG TC D DEC  G   C     C N+ G Y C C  GYRL  +   C+D+DEC    GGC   C N  GS++C CP G  L  D+K+C  +                                     RG     +   C  G+FG +C   C +C + G CN+++ GC+C   ++G IC   C +      C  L+C+CKNG TC+  T KC CP G+SGE CE GC +G++G++C+K C  A S  RCH+I G CLC PG YG  CHL CP  T+G GCS+ C C Q N   CD K G C CK G+HG  C  KCD G++G+ C   C      +C+H  G+C  +  +G     C ++CP G  G +C KTC C      C   +GIC C  G  G  C   C  G +G  CQ  C  C  +  C+  TG C C     G    E CP+G  G  C   C C  +  CD ++G+C C  G+ G  C   C  G +G  C   C C    G+CD ++G C C  G+ G  C+  C EG+YG  C+  C+C NG  CD     C C  GW G FCE  C  G+YG +C   CQC NG  CD +SG C C+ GW G  C ++C    YG NC + C C NG  C+  +G C C   R+     LT P      YG NCL  CIC+   KCD  TG C+C K   GL+CEI+       D C Q+C C     C + TG+C C  G  G  C   C  G FG+ C ++C+C +G  CN + G C C +G+ G  CD+ C
Sbjct:    1 VIQAFSRMVKVWKQGCAGQ-MWCVGYERRTAYYITYRTVYSMDYKSVNKCCPGWSQRNGEAGCHYNVNECENNNG------------GCEVQCC-----------------------------NTIGSFYCKCSDGHSLKEDGKTCQDVDECQTHNGGCQHRCVNTPGSYHCECKPGFRLHSDSRSCIP-VYSCSVAN-GGCEHDCVQVTVAHYQCRCRHNYQLKEDGKHCELTNPCSSRNGGCMHQCNND--GGFVRCSCHPGYRLSV-DGKSCEDINECLTGLAMCAHSCLNTRGSFHCSCSPGYELGADGKQCYRIEMEIINSCEINNGGCSHQC-KHINAGPLCLCPQGFELDTDGKTCIDTDECTNGASCC--QQECSNNPGGYECLCYSGYRLNPDGCGCDDVDECSLNNGGCEQLCENLIGSFQCSCPLGYRLDGDSKSCLAEVLPGQRPIVRSLPQVTLLRDEFAQFFDEDYDDEEAEARGEHTLSESFVCFGGSFGPDCTLTCDDCKNGGTCNEEEDGCMCQEGWTGLICNQTCPEGTFGQNCS-LKCNCKNGATCDPITGKCRCPQGVSGEFCEDGCPKGYYGKSCKKKCNCA-SKGRCHRIHGACLCDPGLYGRYCHLACPKWTYGPGCSEECQCVQRNTLECDKKEGLCTCKPGFHGEYCQKKCDVGFYGMGCKNKCSCPHGVLCDHTNGRCQKQCPEGYQGDNCDQECPEGTFGMNCVKTCACG--GAPCNHVSGICICPAGKIGLDCAKDCPVGHWGAGCQEICPMCENNGTCNPATGECTCTPGYTGSLCKEICPAGWHGQGCQMRCACQNNGQCDPVSGRCTCPPGWTGHNCRTACDSGHWGTDCLNPCNCSNSDGSCDSVTGQCVCESGYIGLNCDQKCAEGWYGSDCRHPCQCDNGAVCDHVSGACTCAAGWRGTFCELPCPDGFYGTDCANHCQCSNGAHCDHVSGSCTCLAGWTGTTCSQKCQENRYGNNCEETCNCFNGASCNHISGECVCKITRNILFFSLTFPAGLRSFYGLNCLQQCICRNGGKCDHVTGRCSCQKGWTGLACEIECTPGTYGDGCLQNCNCQNGGVCERETGRCLCHAGWIGELCQTACPAGTFGVKCAERCKCRHGASCNHITGMCDCPAGWRGKHCDKRC 1103          

HSP 2 Score: 475.322 bits (1222), Expect = 4.172e-146
Identity = 367/1075 (34.14%), Postives = 504/1075 (46.88%), Query Frame = 3
Query:  867 NKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVE-GSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTC-----EDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGC----LCHPNYSGTICEIDCLQNPSQVECQ-PLQCHCK-NGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRC-HQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQC--RKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCI--CLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKC-KCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNG-GKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDS-KESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKG---WYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVSVINRL 4016
            N GGC   C   +   F C C DGH L +D ++C  VD C+ +NGGC H C + P S    C+C+PG+ +  +D + C  +  C++ NGGC+H C+ V    + C C   +Q+  D K C     ELT+PC   NGGC   CN+       CSC PG++L  DG +C D +EC+TG   C    +C+N  GS+ C+C  GY L  +   C     E I+ C    GGC ++C + +    C+CP G  L  D KTC + +   +      + C     G ECL     C      N D  GC     C  N  G  CE  C       +C  PL      +  +C +E L    P  I   + ++      F +  +++     +  R  H ++   +CF G +G  C L C               +  N   C+ +   C C++G+ G+ C   C  G FG +CS  C       C+  TG+C  +  QG +   C+  CP G  G  C+K C+C+     C   +G C C PG  G+ C L C K  YG  C   CQC  R    CD   G+C C     G+   + C  G +G  C   C C +   CD  NG+C   C  GY G  C + CPEG +G  C K C C    C+ +SGIC C  G  G  C   C  G++G  C+E C  C N GTC+    +C C PG+ G  C++ C  G++G+ C+ RC C N G CD +SG+C C PGW G NC   C S  +G +C   C C N  G C    G C C +G  G  C+  C    YG +C H C C     CD  +G CTC     G  CE+   D    +DC   CQCS    C+ V+G C C  G  G  C Q C+   +G +C++ C C NG  CN + G C+C      +        G   +YG NC  +C +C     C   TG+CSC+ G     C+ +C  G YG  C Q C C +G  C   TG C C +G+ G LCQ  CP   +G  C  RCKC H + CN +TG C CP    G+ C+   ++ +
Sbjct:   72 NNGGCEVQCCN-TIGSFYCKCSDGHSLKEDGKTCQDVDECQTHNGGCQHRCVNTPGS--YHCECKPGFRLH-SDSRSCIPVYSCSVANGGCEHDCVQVTVAHYQCRCRHNYQLKEDGKHC-----ELTNPCSSRNGGCMHQCNND-GGFVRCSCHPGYRLSVDGKSCEDINECLTGLAMCA--HSCLNTRGSFHCSCSPGYELGADGKQCYRIEMEIINSCEINNGGCSHQCKHINAGPLCLCPQGFELDTDGKTCIDTDECTNGASCCQQECSNNPGGYECL-----CYSGYRLNPDGCGCDDVDECSLNNGG--CEQLCENLIGSFQCSCPLGYRLDGDSKSCLAEVLPGQRP--IVRSLPQVTLLRDEFAQFFDEDYDDEEAEARGEHTLSESFVCFGGSFGPDCTLTCD--------------DCKNGGTCNEEEDGCMCQEGWTGLICNQTCPEGTFGQNCSLKCNCKNGATCDPITGKC--RCPQGVSGEFCEDGCPKGYYGKSCKKKCNCASKG-RCHRIHGACLCDPGLYGRYCHLACPKWTYGPGCSEECQCVQRNTLECDKKEGLCTCKPGFHGEYCQKKCDVGFYGMGCKNKCSCPHGVLCDHTNGRCQKQCPEGYQGDNCDQECPEGTFGMNCVKTCACGGAPCNHVSGICICPAGKIGLDCAKDCPVGHWGAGCQEICPMCENNGTCNPATGECTCTPGYTGSLCKEICPAGWHGQGCQMRCACQNNGQCDPVSGRCTCPPGWTGHNCRTACDSGHWGTDCLNPCNCSNSDGSCDSVTGQCVCESGYIGLNCDQKCAEGWYGSDCRHPCQCDNGAVCDHVSGACTCAAGWRGTFCELPCPDGFYGTDCANHCQCSNGAHCDHVSGSCTCLAGWTGTTCSQKCQENRYGNNCEETCNCFNGASCNHISGECVCKITRNILFFSLTFPAGLRSFYGLNCLQQC-ICRNGGKCDHVTGRCSCQKGWTGLACEIECTPGTYGDGCLQNCNCQNGGVCERETGRCLCHAGWIGELCQTACPAGTFGVKCAERCKCRHGASCNHITGMCDCPAGWRGKHCDKRCLSPV 1107          

HSP 3 Score: 412.535 bits (1059), Expect = 4.935e-123
Identity = 348/1091 (31.90%), Postives = 480/1091 (44.00%), Query Frame = 3
Query: 1053 KCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTG----KHKCVPPST------------------------------------CINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNT-----------------------------RGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPL-QCHCKNGG---TCESE--TLKCNCPPG--------------------ISGEICEIGCTEGFFGENCEKNCPTACSSNRC-HQITGKCLCFPGWYGSSCHL------------------LCPTGTWGIGCSKTC-----------SCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCP-DKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSE-NSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGIC--YCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIY--GNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNG-GLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKE-SDCRQDCQCSIKKSCNQVTGKCQCKP-------GLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGAN 3899
            KC PG++    +     ++NEC   NGGC+  C N  GSF C C  G  +  D K+C  V     D C+  NGGC   C ++P     C C PGF+L +D  +C     C       +H CV  +                                     C ND G   C+C  GYRL  +  +CEDI+ECL     C + C+NT GS+ C C  G  LG D K C                                  +G  L  D + C      +EC    S C  +   N     CLC+  Y           NP    C  + +C   NGG    CE+   + +C+CP G                    I   + ++      F +  +++     +  R  H ++   +CF G +G  C L                  +C  G  G+ C++TC            CN  N   CDP  GKC+C +G  G  C   C  GY+G  C   C    K  C+   G C  D    G     C   CP    G  C + C C + N++ C++K G+C C PGF G+ C+ KC  G YG  C++ C C    LCDH  G C   C +   G    + CP G +G  C + C C  +  C+ ++G CIC AG  G  C+K CP G +G GC + C      G C+P +G C C PG+ G +C+  C  G++G  C+ +C C N G CD    +C C PGW G  C  +C  G++G +C   C C N  G CD ++G+C C  G+ G+NCD++C    YG +C   CQC NG  C   +G C C AG  G  CEL CP   YG +C ++C C     CD  +G CTC     G +C  K  +++  ++C + C C    SCN ++G+C CK         L  P  L+      +GL+C Q+C C NG  C+ V G C C  G+TG+ C+  C  G YG  C   C  C     C  +TG+C C AG I   C+  CP+G +G  C + C+C HGASCN  TG C C +G+ G  C  RC +  + A 
Sbjct:   48 KCCPGWSQRNGEAGCHYNVNECENNNGGCEVQCCNTIGSFYCKCSDGHSLKEDGKTCQDV-----DECQTHNGGCQHRCVNTPGSYH-CECKPGFRLHSDSRSCIPVYSCSVANGGCEHDCVQVTVAHYQCRCRHNYQLKEDGKHCELTNPCSSRNGGCMHQCNNDGGFVRCSCHPGYRLSVDGKSCEDINECLTGLAMCAHSCLNTRGSFHCSCSPGYELGADGKQCYRIEMEIINSCEINNGGCSHQCKHINAGPLCLCPQGFELDTDGKTCID---TDECTNGASCCQQECSNNPGGYECLCYSGYR---------LNPDGCGCDDVDECSLNNGGCEQLCENLIGSFQCSCPLGYRLDGDSKSCLAEVLPGQRPIVRSLPQVTLLRDEFAQFFDEDYDDEEAEARGEHTLSESFVCFGGSFGPDCTLTCDDCKNGGTCNEEEDGCMCQEGWTGLICNQTCPEGTFGQNCSLKCNCKNGATCDPITGKCRCPQGVSGEFCEDGCPKGYYGKSCKKKCNCASKGRCHRIHGACLCDPGLYGRY---CHLACPKWTYGPGCSEECQCVQRNTLECDKKEGLCTCKPGFHGEYCQKKCDVGFYGMGCKNKCSCPHGVLCDHTNGRCQKQCPEGYQGDNCDQECPEGTFGMNCVKTCACGGAP-CNHVSGICICPAGKIGLDCAKDCPVGHWGAGCQEICPMCENNGTCNPATGECTCTPGYTGSLCKEICPAGWHGQGCQMRCACQNNGQCDPVSGRCTCPPGWTGHNCRTACDSGHWGTDCLNPCNCSNSDGSCDSVTGQCVCESGYIGLNCDQKCAEGWYGSDCRHPCQCDNGAVCDHVSGACTCAAGWRGTFCELPCPDGFYGTDCANHCQCSNGAHCDHVSGSCTCLAGWTGTTCSQKCQENRYGNNCEETCNCFNGASCNHISGECVCKITRNILFFSLTFPAGLR----SFYGLNCLQQCICRNGGKCDHVTGRCSCQKGWTGLACEIECTPGTYGDGCLQNC-NCQNGGVCERETGRCLCHAGWIGELCQTACPAGTFGVKCAERCKCRHGASCNHITGMCDCPAGWRGKHCDKRCLSPVHSAT 1111          

HSP 4 Score: 375.17 bits (962), Expect = 1.333e-109
Identity = 307/936 (32.80%), Postives = 412/936 (44.02%), Query Frame = 3
Query:  651 DGGFY-CKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINC----IPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLT------CSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTC-EDIDECLDYTGGCGYKCVNT--------DGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVEC-QPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFG--------------------------------ENCEKNCPT-----------ACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQ-GNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK-CEA-CPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-----------------------------------------------NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTY 3116
            DGGF  C C PGY +S +GK+C DINEC+     C+H C+N  G F C C P   LG D   C    +  I+ C+  N GGC+H C K  +   +C CP G  LD D ++C   D C +    C   C ++P      C C  GY ++  D   C D++EC++ NGGC+ +C N+ GSF C C  G+++  D KSC    +                    P +R I   LP   L  D           DE+    G+H       C    GS+   C +     KN  TC E+ D C+   G  G  C  T        + S +C C NG T   D  T + +  +G S +     CPKG +G+ C   C NC  KG C+     CLC P   G  C + C +      C +  QC  +N   C+ +   C C PG  GE C+  C  GF+G                                +NC++ CP            AC    C+ ++G C+C  G  G  C   CP G WG GC + C   +NN   C+P  G+C C  GY G  C   C  G+ G  C   C       C+  +G+C   TC  G     C+  C +G  G+DC   C+CS +  SC+   G C C  G+ G  C+ KC +G YG  C+  CQC    +CDHV+G C CA    G  CE  CP G +G  C  +C C+    CD ++G C CLAG+ G  CS++C E  YG  C + C C  G                                                CD ++G C C  GW G  CE  C  G YGD C + C C NGG C+    +C C  GW GE C+ +C  G +G  C  RC+C +G  C+ I+G CDC  GWRG +CD+RC S  +
Sbjct:  207 DGGFVRCSCHPGYRLSVDGKSCEDINECLTGLAMCAHSCLNTRGSFHCSCSPGYELGADGKQCYRIEMEIINSCE-INNGGCSHQC-KHINAGPLCLCPQGFELDTDGKTCIDTDECTNGASCCQQECSNNPGG--YECLCYSGYRLNP-DGCGCDDVDECSLNNGGCEQLCENLIGSFQCSCPLGYRLDGDSKSCLAEVL--------------------PGQRPIVRSLPQVTLLRDEFAQFFDEDYDDEEAEARGEHTLSESFVCFG--GSFGPDCTLTCDDCKNGGTCNEEEDGCMCQEGWTGLICNQTCPEGTFGQNCSLKCNCKNGATC--DPITGKCRCPQGVSGEFCEDGCPKGYYGKSCKKKC-NCASKGRCHRIHGACLCDPGLYGRYCHLACPKWTYGPGCSEECQCVQRNTLECDKKEGLCTCKPGFHGEYCQKKCDVGFYGMGCKNKCSCPHGVLCDHTNGRCQKQCPEGYQGDNCDQECPEGTFGMNCVKTCACGGAPCNHVSGICICPAGKIGLDCAKDCPVGHWGAGCQEICPMCENNGT-CNPATGECTCTPGYTGSLCKEICPAGWHGQGCQMRCACQNNGQCDPVSGRC---TCPPGWTGHNCRTACDSGHWGTDCLNPCNCSNSDGSCDSVTGQCVCESGYIGLNCDQKCAEGWYGSDCRHPCQCDNGAVCDHVSGACTCAAGWRGTFCELPCPDGFYGTDCANHCQCSNGAHCDHVSGSCTCLAGWTGTTCSQKCQENRYGNNCEETCNCFNGASCNHISGECVCKITRNILFFSLTFPAGLRSFYGLNCLQQCICRNGGKCDHVTGRCSCQKGWTGLACEIECTPGTYGDGCLQNCNCQNGGVCERETGRCLCHAGWIGELCQTACPAGTFGVKCAERCKCRHGASCNHITGMCDCPAGWRGKHCDKRCLSPVH 1108          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Xenopus
Match: MEGF11 (multiple EGF-like-domains 11 [Source:NCBI gene;Acc:100490321])

HSP 1 Score: 419.468 bits (1077), Expect = 3.066e-126
Identity = 271/700 (38.71%), Postives = 348/700 (49.71%), Query Frame = 3
Query: 1929 CTEGFF--GENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK--CEACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKR-CPEGLYGEGCSKECQCIYGN---CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCE-IKNCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKC-RCANGE-PCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCE 3995
            C  G++  G+ C   C   C   RC      C C PGW G+ C   C +  WG  CS  C C   N   C+P  G C C  GY G  C   CDPG +G  C   C       C+H TG+C      G     C+  CP G  G+ C   C C    V C    G C C  G+TG  C   C  G +G  C   CQC     CD ++G C CA    G+   E CP G +G  C + CDC     C  ING C+C  G+ G  C +R CPEGLYG  C+K C C   N   C P+SG C C  GW G  CE PC  G+YG+ C++ C C NG  CD    +C C PG+ G+ C   CA G +G +C   C C N   C  + G C C  GW+G++C   C S T+G NCNQ C CLN   C P +G C C  G  G++C+  C    YG +CL +C C   + C+  +G C C     G+ C+ + N     S+C   C C    SC+   G C+C PG RG  C ++C  G +G  C Q C +C +   PC+ V G C CL GF G LC+QVC  G +G  C   C  C+ N TC+P  G C C  G I  DC  +CP G +GP C   C C + A C+   G C+C  G+ G  C  RCP+ FYG +C + C+C + + C+ +TG C C    +G  CE
Sbjct:   76 CCPGYYESGDFCIPLCTEECVHGRCVS-PDTCHCEPGWGGADCSSGCDSEHWGPHCSNRCQCQ--NEALCNPITGACVCSDGYRGWRCEDWCDPGTYGKACQLRCQCQNGATCDHRTGEC--HCAPGYTGAFCEELCPPGSHGALCELRCPCQNGGV-CHHVTGDCSCPAGWTGTVCAQPCPSGRFGVNCSQECQCHNGGQCDPLSGRCQCAAGYTGERCQEECPVGTYGFQCAERCDCQNGAKCYHINGACLCEPGFKGILCEERVCPEGLYGLKCNKNCPCNLTNTRGCHPLSGECTCRAGWSGLYCEEPCRPGFYGEGCQQLCSCHNGADCDSMTGRCICAPGYTGQDCSAPCATGTFGADCLSVCNCQNDAACSPVDGLCVCREGWQGLDCSIPCSSGTWGLNCNQSCLCLNDASCSPMDGSCTCAPGWMGELCDQPCLDGTYGMDCLEHCDCSHADGCNPVSGHCHCLAGWTGIHCDNLCNQGYWGSNCSMTCHCENGGSCSPEDGSCECAPGYRGALCQRICAAGFYGHQCSQTCPQCVHFSGPCHHVTGHCDCLPGFFGPLCNQVCPSGRFGKGCAEIC-SCSNNATCNPVDGSCQCYPGWIGIDCSDECPFGLWGPDCSHTCNCHNEAECSAYDGECKCTPGWTGLYCTQRCPSAFYGKDCANVCQCHNGADCDHITGQCTCRTGFTGNHCE 768          

HSP 2 Score: 350.517 bits (898), Expect = 1.598e-101
Identity = 257/752 (34.18%), Postives = 360/752 (47.87%), Query Frame = 3
Query: 1308 RAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLR------KNKMTCEDIDECLDYTGGC-------GYKCVN--TDGSY------RCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCH-LLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKC-KCLN-GGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIK-NCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQ 3479
            R    C PG+    D       +ECV G+  CV P TC  + G     C  G           N+  C++   C   TG C       G++C +    G+Y      RC C NG T   D++T +     G +       CP G+ G  C   C  C + G C+     C C   ++GT+C   C      V C   +C C NGG C+  + +C C  G +GE C+  C  G +G  C + C    +  +C+ I G CLC PG+ G  C   +CP G +G+ C+K C CN  N  GC P +G+C C+ G+ G+ C   C PG++G  C   C       C+  TG+C      G     C   C TG  G+DC   C+C +N  +C   +G+C C  G+ G  C + C+ G +G  C  SC C  D  C  + G C CA    G+   + C  G +G  C ++CDC+++ GC+ ++G C CLAG+ G  C   C +G +G  CS  C C  G +C P  G C C PG+ G +C+  C  G+YG QC + C +C++  G C      C C PG+ G  C + C  G +G+ C   C C N   C+ + G C C PGW GI+C + CP   +GP+C+  C C N  +C   +G C+C  G  G  C   CP   YG +C + C C     CD  TG+CTC     G  CE K    +    CRQ C+C    +C+ VTG C C PG +G +C Q
Sbjct:   71 RRRSQCCPGYYESGDFCIPLCTEECVHGR--CVSPDTCHCEPGWGGADCSSGCDSEHWGPHCSNRCQCQNEALCNPITGACVCSDGYRGWRCEDWCDPGTYGKACQLRCQCQNGATC--DHRTGECHCAPGYTGAFCEELCPPGSHGALCELRCP-CQNGGVCHHVTGDCSCPAGWTGTVCAQPCPSGRFGVNCSQ-ECQCHNGGQCDPLSGRCQCAAGYTGERCQEECPVGTYGFQCAERCDCQ-NGAKCYHINGACLCEPGFKGILCEERVCPEGLYGLKCNKNCPCNLTNTRGCHPLSGECTCRAGWSGLYCEEPCRPGFYGEGCQQLCSCHNGADCDSMTGRC--ICAPGYTGQDCSAPCATGTFGADCLSVCNC-QNDAACSPVDGLCVCREGWQGLDCSIPCSSGTWGLNCNQSCLCLNDASCSPMDGSCTCAPGWMGELCDQPCLDGTYGMDCLEHCDCSHADGCNPVSGHCHCLAGWTGIHCDNLCNQGYWGSNCSMTCHCENGGSCSPEDGSCECAPGYRGALCQRICAAGFYGHQCSQTCPQCVHFSGPCHHVTGHCDCLPGFFGPLCNQVCPSGRFGKGCAEICSCSNNATCNPVDGSCQCYPGWIGIDCSDECPFGLWGPDCSHTCNCHNEAECSAYDGECKCTPGWTGLYCTQRCPSAFYGKDCANVCQCHNGADCDHITGQCTCRTGFTGNHCEQKCPPGTFGYGCRQLCECLNNATCDHVTGTCYCNPGFKGIRCDQ 812          

HSP 3 Score: 283.108 bits (723), Expect = 2.364e-78
Identity = 241/753 (32.01%), Postives = 348/753 (46.22%), Query Frame = 3
Query: 1047 TCKCRPGY-AIDVNDVKQCKDI-----NECNIKNGGCQHICLNVEGSFIC-DCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCN-----SSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKH--------KCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEID-CLQNPSQVEC-QPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQ-GNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNC-DCTYSTG-CDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCI-YGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCE 3221
            TC C PG+   D +     +       N C  +N   + +C  + G+ +C D + GW+             +  DP  YG   C   C      +  ++   C C PG+     G  C  E+ C  G H         C     C +  G   C+CP G+        C         +G  G  C     S  C C NG      +  C  Q   G + ++    CP GT+G +C   C +C +   C      CLC P + G +CE   C +    ++C +   C+  N   C   + +C C  G SG  CE  C  GF+GE C++ C     ++ C  +TG+C+C PG+ G  C   C TGT+G  C   C+C   N   C P +G C C++G+ G++C   C  G +GL+C+ SC       C+   G C   TC  G     C + C  G  G DC + CDCS ++  C   +G CHC  G+TG  C+  C +G +G  C  +C C     C    G C CA    G      C +G +G  C+Q C  C + +G C  + G C CL G++GP C++ CP G +G+GC++ C C     C+P+ G C+C PGW G  C + C  G +G  C   C C N   C  +  +C+C PGW G +C + C   +YG++C   CQCHNG  CD I+G+C C  G+ G +C+++CP  T+G  C Q+C+CLN   C    G C C  G  G  C+
Sbjct:  105 TCHCEPGWGGADCSSGCDSEHWGPHCSNRCQCQN---EALCNPITGACVCSDGYRGWRC-----------EDWCDPGTYGK-ACQLRCQCQNGATCDHRTGECHCAPGYT----GAFC--EELCPPGSHGALCELRCPCQNGGVCHHVTGD--CSCPAGWTGTVCAQPCP--------SGRFGVNC-----SQECQCHNGGQCDPLSGRC--QCAAGYTGERCQEECPVGTYGFQCAERC-DCQNGAKCYHINGACLCEPGFKGILCEERVCPEGLYGLKCNKNCPCNLTNTRGCHPLSGECTCRAGWSGLYCEEPCRPGFYGEGCQQLCSCHNGAD-CDSMTGRCICAPGYTGQDCSAPCATGTFGADCLSVCNC--QNDAACSPVDGLCVCREGWQGLDCSIPCSSGTWGLNCNQSCLCLNDASCSPMDGSC---TCAPGWMGELCDQPCLDGTYGMDCLEHCDCS-HADGCNPVSGHCHCLAGWTGIHCDNLCNQGYWGSNCSMTCHCENGGSCSPEDGSCECAPGYRGALCQRICAAGFYGHQCSQTCPQCVHFSGPCHHVTGHCDCLPGFFGPLCNQVCPSGRFGKGCAEICSCSNNATCNPVDGSCQCYPGWIGIDCSDECPFGLWGPDCSHTCNCHNEAECSAYDGECKCTPGWTGLYCTQRCPSAFYGKDCANVCQCHNGADCDHITGQCTCRTGFTGNHCEQKCPPGTFGYGCRQLCECLNNATCDHVTGTCYCNPGFKGIRCD 811          

HSP 4 Score: 257.299 bits (656), Expect = 8.653e-70
Identity = 259/826 (31.36%), Postives = 354/826 (42.86%), Query Frame = 3
Query:  669 KCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGG--CSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICD-CHPGWQIG--------HDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCS-NCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSC-QCRK-DRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCI-YGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDE 3095
            +C PGY   E+G  CI +         C+ ECV+     RC       + PD  +C P     D ++     H     S+    C C +  + +    +C    +C D   G  C   C  DP +    C+ R           QC++   C+ + G C H      G+F  + C PG             +   C+ V  + + P  +    C Q C   P+ R              G+ CS E +C  G  +C P S          C C  GY   + +  C          G  G++C       RC C NG      N  C  +      L ++ R CP+G +G +C  NC  N  +   C+     C C   +SG  CE  C        CQ L C C NG  C+S T +C C PG +G+ C   C  G FG +C   C    +   C  + G C+C  GW G  C + C +GTWG+ C+++C C   N   C P +G C C  G+ G  C   C  G +G+DC   C       CN  +G C      G   I C   C  G  GS+C  TC C EN  SC  ++G C CAPG+ G  C+  C  G YG +C  +C QC      C HVTG C C    FG    + CPSG++G  C + C C+ +  C+ ++G C C  G+ G  CS  CP GL+G  CS  C C     C    G C+C PGW G  C   C   +YG  C   C+C NG  CD    +C C  G+ G  CE+ C  G +G  C   C+C N   CD ++G C C PG++GI CD+
Sbjct:   75 QCCPGY--YESGDFCIPL---------CTEECVH----GRC-------VSPDTCHCEPGWGGADCSSGCDSEHWGPHCSNR---CQCQNEALCNPITGAC----VCSDGYRGWRCEDWC--DPGTYGKACQLR----------CQCQNGATCDHRTGEC-HCAPGYTGAFCEELCPPGSHGALCELRCPCQNGGVCHHVTGDCSCPAGWTGTVCAQPC---PSGRF-------------GVNCSQECQCHNGG-QCDPLSG--------RCQCAAGYTGERCQEECP--------VGTYGFQCAE-----RCDCQNGAKCYHINGACLCEPGFKGILCEE-RVCPEGLYGLKCNKNCPCNLTNTRGCHPLSGECTCRAGWSGLYCEEPCRPGFYGEGCQQL-CSCHNGADCDSMTGRCICAPGYTGQDCSAPCATGTFGADCLSVCNCQ-NDAACSPVDGLCVCREGWQGLDCSIPCSSGTWGLNCNQSCLC--LNDASCSPMDGSCTCAPGWMGELCDQPCLDGTYGMDCLEHCDCSHADGCNPVSGHC--HCLAGWTGIHCDNLCNQGYWGSNCSMTCHC-ENGGSCSPEDGSCECAPGYRGALCQRICAAGFYGHQCSQTCPQCVHFSGPCHHVTGHCDCLPGFFGPLCNQVCPSGRFGKGCAEICSCSNNATCNPVDGSCQCYPGWIGIDCSDECPFGLWGPDCSHTCNCHNEAECSAYDGECKCTPGWTGLYCTQRCPSAFYGKDCANVCQCHNGADCDHITGQCTCRTGFTGNHCEQKCPPGTFGYGCRQLCECLNNATCDHVTGTCYCNPGFKGIRCDQ 812          

HSP 5 Score: 150.214 bits (378), Expect = 7.143e-36
Identity = 96/252 (38.10%), Postives = 125/252 (49.60%), Query Frame = 3
Query: 3267 CICKATEKCD----LKTGECTCPKSAFGLSCEIKNCDSKE--SDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVSV 4004
            CI   TE+C     +    C C     G  C    CDS+     C   CQC  +  CN +TG C C  G RG +C   C+ G +G  C+ +C+C NG  C+   G C C  G+TG  C+++C  G +G  C+L+C  C     CH  TG CSC AG     C   CPSG +G  C Q CQC +G  C+P +G CQC +G+ G  CQ  CP   YG  C  RC C + + C  + G C+C     G  CE  V
Sbjct:   87 CIPLCTEECVHGRCVSPDTCHCEPGWGGADCS-SGCDSEHWGPHCSNRCQCQNEALCNPITGACVCSDGYRGWRCEDWCDPGTYGKACQLRCQCQNGATCDHRTGECHCAPGYTGAFCEELCPPGSHGALCELRC-PCQNGGVCHHVTGDCSCPAGWTGTVCAQPCPSGRFGVNCSQECQCHNGGQCDPLSGRCQCAAGYTGERCQEECPVGTYGFQCAERCDCQNGAKCYHINGACLCEPGFKGILCEERV 336          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Mouse
Match: Megf6 (multiple EGF-like-domains 6 [Source:MGI Symbol;Acc:MGI:1919351])

HSP 1 Score: 748.814 bits (1932), Expect = 0.000e+0
Identity = 481/1379 (34.88%), Postives = 650/1379 (47.14%), Query Frame = 3
Query:  132 KYEMRFAIIFFLTIQIIPKLSGAGSQKLEL-GMPNVCEVEQRQMIRVRRTVEVPRSKEVKVWKANCRFKGDWCLVHENKSFVEKTETSQIQMVPSIKYECCEGYAELSGYRGCIPKPNCEERIGKYCQNGAFCYQSGYNAKCICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQN-------------------------------------------QNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCS------------------------------------------ENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTG-CDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKES-DCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCE 3995
            +   R   +  L +  +P  S     +     MP+VC  ++  ++  R+      S+ V VW++ C  +  WC+  E ++    +            + CC G+++  G  GC+   +        C N         N  C  P                         CCN  GGFYC+CPPGY++  +GK C D++EC  +   C H CVN PG + C+C P   L  D   C+  I  C   N GGC H CV+L+  +  C C   + L +D R C     C D NGGC H CQ      +  C C PGY +   D K C+D++EC +    C H CLN +GSF C CH G+++G D + CY+++ME+ + C+ GNGGC+  C+ + +   +C+C  G++L+ D  TC D D+C            C N  G Y C+C  GYRL  +   CED+DEC     GC + C N  GS++C C  G  L +D + C                                                RG     +   C   +FG +C   C +C + G C     GC C   ++G IC   C  +     C    C C+NGGTC+  +  C CPPG+SG  CE GC +GF+G++C K C  A +  RCH++ G CLC PG YG  CHL CP   +G GCS+ C C Q++   C+ K+G C CK G+ G  C  +C+PG FG  C   C       C+  +G+C  +   G     C ++CP G  G +C  +C C                                           E+  SC+ + G C C PGF G RC+  C  G +G  CQ  C C  D  C   TG C CA    G     AC SG WGP C   C+C+   G CD ++G C+C AGY GP+C + C +G +G GC ++C+C +G  CD +SG C C  GW G  CE+ C  G++G  C   C C  G  CD     C C  G  G  C ++C    +G NC   C C NG  CD + G+C C PGW G  C + CP+  YG NC   C C NGG C P  G C CP G  G  CE  C P  +G  C  NC C     CD  TG C CP    G  C+           C + C C    +C+ VTG C C PG RG  C Q C  G FG  C Q+C C  G  C+ V G C C  GFTG  C+Q C  G +G +C+  C        CHP +G C C AG    DC+ +CPSG YGP C+Q C+C++G +C+P+TGAC C +GF GA C   CP   +G +C H C C   + C+PV+G C+CP   +G  CE
Sbjct:    8 RASWRVVALTLLLLPAVPAASQPLPPRPLQPSMPHVCAEQKLTLVGHRQPCVQAFSRVVPVWRSGCGQQA-WCVGQERRTVYYMSYRQVYATEARTVFRCCPGWSQKPGQEGCLSDVD-------ECANA--------NGGCEGP-------------------------CCNTVGGFYCRCPPGYQLQGDGKTCQDVDECRSHNGGCQHRCVNTPGSYLCECKPGFRLHTDGRTCL-AISSCTLGN-GGCQHQCVQLTVTQHRCQCRPQYQLQEDGRRCVRRSPCADGNGGCMHTCQE--LRGLAHCGCHPGYQL-AADRKACEDVDECALGLAQCAHGCLNTQGSFKCVCHAGYELGADGRQCYRIEMEIVNSCEAGNGGCSHGCSHT-STGPLCTCPRGYELDEDQKTCIDIDDCANSP---CCQQVCANTPGGYECSCFAGYRLNTDGCGCEDVDECASGHSGCEHHCSNLAGSFQCFCEAGYRLDEDRRGCTPLEESVVDLDGQLPFVRPLPHIAVLGDELPQLFQDDYGAEEEAVAELRGEHTLTEKFVCLDHSFGHDCSLTCDDCRNGGTCFPGLDGCDCPEGWTGIICNETCPPDTFGKNCSS-PCICQNGGTCDPVSGACRCPPGVSGAHCEDGCPKGFYGKHCRKKCHCA-NRGRCHRLYGACLCDPGLYGRFCHLACPPWAFGPGCSEDCLCEQSHTRSCNSKDGSCSCKAGFQGERCEAECEPGSFGPGCRNRCTCRPGVACDPVSGECRTQCPPGYQGEDCGQECPVGTFGVNCSGSCSCVGAPCHRVTGECLCPPGKTGEDCGADCPEGRWGLGCQEICPACEHGASCDPETGTCLCLPGFVGSRCQDACPAGWFGTGCQMRCACANDGHCHPATGRCSCAPGWTGLSCQRACDSGHWGPDCIHPCNCSAGHGNCDAVSGLCLCEAGYEGPQCEQWCRQGYFGPGCEQKCRCEHGATCDHVSGACTCPAGWRGSFCEHACPAGFFGLDCGSACNCSAGAPCDAVTGSCICPAGRWGPHCAQTCPPLTFGLNCSQICTCFNGASCDPVLGQCHCAPGWMGPTCLQACPAGLYGKNCQHSCLCRNGGNCDPILGQCTCPEGWTGLACENECLPGHHGAGCRLNCSCLNGGTCDRLTGHCRCPTGWTGDKCQSPCVSGMFGVHCEEHCACRKGATCHHVTGACLCPPGWRGSHCEQACPRGWFGEACAQRCHCPPGASCHHVSGECHCPPGFTGPGCEQACQPGTFGKDCEHPCQCPGETWACHPASGACVCAAGYHGTDCQQRCPSGRYGPGCEQICKCLNGGTCDPATGACYCPAGFLGADCSLACPQGRFGPSCAHVCTCGQGAACDPVSGTCICPPGKTGGHCE 1334          

HSP 2 Score: 572.778 bits (1475), Expect = 2.373e-178
Identity = 415/1228 (33.79%), Postives = 570/1228 (46.42%), Query Frame = 3
Query:  648 IDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINC----IPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVT---GKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTC-EDIDECLDYTGGCGYKCVNT--------DGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEI-------------DCLQNPS-----------------------QVECQPL--------QCHCKNGGTCESETLKC--NCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCA---------------------------------DVAFGKCEACPSGKWGP-------------TCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKA-TEKCDLKTGECTCPKSAFGLSCEIKNCDSKE--SDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCE 3995
            + G  +C C PGY+++ + K C D++EC      C+H C+N  G F+C C     LG D   C    +  ++ C++ N GGC+H C   S    +C+CP G+ LD+D+++C  +D C  N+  C  +C + P      C C  GY ++ +    C+D++EC   + GC+H C N+ GSF C C  G+++  D + C  ++  + D       G   F    P+   +   LP    +  G     E+E V    G+H       C++   S+   C +     +N  TC   +D C    G  G  C  T        + S  C+C NG T    +  C+       +  +D   CPKG +G+ C   C +C ++G C+     CLC P   G  C +             DCL   S                       + EC+P         +C C+ G  C+  + +C   CPPG  GE C   C  G FG NC  +C  +C    CH++TG+CLC PG  G  C   CP G WG+GC + C   ++    CDP+ G C C  G+ G  C   C  G+FG  C   C       C+  TG+C      G   + CQR C +G  G DC   C+CS    +C+  +G+C C  G+ G +CE  C +G +G  C+  C+C     CDHV+G C C                                  D   G C  CP+G+WGP              C+Q C C     CD + GQC C  G+ GP C + CP GLYG+ C   C C  G NCDPI G C C  GW G  CEN C  G++G  C+  C CLNGGTCD     C+C  GW G+ C+  C  G +G +CE  C C  G  C  ++G C C PGWRG +C++ CP   +G  C Q C C  G  CH  +G C CP G  G  CE  C P  +G +C H C C   T  C   +G C C     G  C+ + C S      C Q C+C    +C+  TG C C  G  G  C   C  G FG  C   C C  G  C+PV GTC+C  G TG  C++ C +  +G  C+ KC  C     CH   G CSC  G +   C+  CP+G YG  C   C C +  SC P++GAC C  GFYG  C+  CP  F+G+ CQ  C+C   +PC+PV+G C+CP    G+FCE
Sbjct:  264 LRGLAHCGCHPGYQLAADRKACEDVDECALGLAQCAHGCLNTQGSFKCVCHAGYELGADGRQCYRIEMEIVNSCEAGN-GGCSHGCSHTSTGP-LCTCPRGYELDEDQKTCIDIDDCA-NSPCCQQVCANTPGG--YECSCFAGYRLNTDGCG-CEDVDECASGHSGCEHHCSNLAGSFQCFCEAGYRLDEDRRGCTPLEESVVD-----LDGQLPFVRPLPHIAVLGDELPQLFQDDYGA----EEEAVAELRGEHTLTEKFVCLDH--SFGHDCSLTCDDCRNGGTCFPGLDGCDCPEGWTGIICNETCPPDTFGKNCSSPCICQNGGTCDPVSGACRCPPGVSGAHCED--GCPKGFYGKHCRKKC-HCANRGRCHRLYGACLCDPGLYGRFCHLACPPWAFGPGCSEDCLCEQSHTRSCNSKDGSCSCKAGFQGERCEAECEPGSFGPGCRNRCTCRPGVACDPVSGECRTQCPPGYQGEDCGQECPVGTFGVNCSGSC--SCVGAPCHRVTGECLCPPGKTGEDCGADCPEGRWGLGCQEICPACEHGAS-CDPETGTCLCLPGFVGSRCQDACPAGWFGTGCQMRCACANDGHCHPATGRC--SCAPGWTGLSCQRACDSGHWGPDCIHPCNCSAGHGNCDAVSGLCLCEAGYEGPQCEQWCRQGYFGPGCEQKCRCEHGATCDHVSGACTCPAGWRGSFCEHACPAGFFGLDCGSACNCSAGAPCDAVTGSC-ICPAGRWGPHCAQTCPPLTFGLNCSQICTCFNGASCDPVLGQCHCAPGWMGPTCLQACPAGLYGKNCQHSCLCRNGGNCDPILGQCTCPEGWTGLACENECLPGHHGAGCRLNCSCLNGGTCDRLTGHCRCPTGWTGDKCQSPCVSGMFGVHCEEHCACRKGATCHHVTGACLCPPGWRGSHCEQACPRGWFGEACAQRCHCPPGASCHHVSGECHCPPGFTGPGCEQACQPGTFGKDCEHPCQCPGETWACHPASGACVCAAGYHGTDCQ-QRCPSGRYGPGCEQICKCLNGGTCDPATGACYCPAGFLGADCSLACPQGRFGPSCAHVCTCGQGAACDPVSGTCICPPGKTGGHCERGCPQDRFGKGCEHKC-ACRNGGLCHATNGSCSCPLGWMGPHCEHACPAGRYGAACLLECSCQNNGSCEPTSGACLCGPGFYGQACEDTCPAGFHGSGCQRVCECQQGAPCDPVSGRCLCPAGFHGQFCE 1463          

HSP 3 Score: 452.595 bits (1163), Expect = 1.527e-134
Identity = 322/917 (35.11%), Postives = 420/917 (45.80%), Query Frame = 3
Query: 1278 TQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCV--PPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGC---GYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFG-KCE-ACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQC-HNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNC--DSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCE 3995
            T+ CNS   K   CSC  GF+ E     C         +++C   P   C    G     CP GY+       C      ++ +G C   G  C    G   C+CP G+T              G     D   CP+G +G  C   C  C H   C+ +   CLC P + G+ C+  C        CQ ++C C N G C   T +C+C PG +G  C+  C  G +G +C   C  +     C  ++G CLC  G+ G  C   C  G +G GC + C C       CD  +G C C  G+ G  C + C  G+FGLDC  +C       C+  TG C      G     C + CP    G +C + C C  N  SC+   G CHCAPG+ G  C   C  GLYG+ CQ SC CR    CD + G C C +   G  CE  C  G  G  C  NC C     CD++ G C C  G+ G KC   C  G++G  C + C C  G  C  ++G C C PGW G  CE  C  G++G+ C ++C C  G +C     +C C PG+ G  CE++C  G +G++CE  CQC      C   SG C C  G+ G +C +RCPS  YGP C Q+C+CLNGG C P  G C CPAG  G  C L CP  ++GP+C H C C     CD  +G C CP    G  CE + C  D     C   C C     C+   G C C  G  GP C   C  G +G  C  +C C N   C P  G CLC  GF G  C+  C  G++G  C+  C  C +   C P +G+C C AG     C+  C  G++G  C Q C C  G  C+P +G C C  G  G  C   C    +G  C  RC C   + C+P++G C C    +G  C 
Sbjct:  663 TRSCNS---KDGSCSCKAGFQGERCEAECEPGSFGPGCRNRCTCRPGVACDPVSGECRTQCPPGYQGEDCGQECPVGTFGVNCSGSCSCVGAPCHRVTG--ECLCPPGKT--------------GEDCGAD---CPEGRWGLGCQEICPACEHGASCDPETGTCLCLPGFVGSRCQDACPAGWFGTGCQ-MRCACANDGHCHPATGRCSCAPGWTGLSCQRACDSGHWGPDCIHPCNCSAGHGNCDAVSGLCLCEAGYEGPQCEQWCRQGYFGPGCEQKCRCEHGAT--CDHVSGACTCPAGWRGSFCEHACPAGFFGLDCGSACNCSAGAPCDAVTGSCICPA--GRWGPHCAQTCPPLTFGLNCSQICTCF-NGASCDPVLGQCHCAPGWMGPTCLQACPAGLYGKNCQHSCLCRNGGNCDPILGQCTCPEGWTGLACENECLPGHHGAGCRLNCSCLNGGTCDRLTGHCRCPTGWTGDKCQSPCVSGMFGVHCEEHCACRKGATCHHVTGACLCPPGWRGSHCEQACPRGWFGEACAQRCHCPPGASCHHVSGECHCPPGFTGPGCEQACQPGTFGKDCEHPCQCPGETWACHPASGACVCAAGYHGTDCQQRCPSGRYGPGCEQICKCLNGGTCDPATGACYCPAGFLGADCSLACPQGRFGPSCAHVCTCGQGAACDPVSGTCICPPGKTGGHCE-RGCPQDRFGKGCEHKCACRNGGLCHATNGSCSCPLGWMGPHCEHACPAGRYGAACLLECSCQNNGSCEPTSGACLCGPGFYGQACEDTCPAGFHGSGCQRVC-ECQQGAPCDPVSGRCLCPAGFHGQFCERGCKPGFFGDGCLQQCNCPTGVPCDPISGLCLCPPGRAGTTCDLDCRRGRFGPGCALRCDCGGGADCDPISGQCHCVDSYTGPTCR 1549          

HSP 4 Score: 330.487 bits (846), Expect = 2.061e-92
Identity = 271/806 (33.62%), Postives = 348/806 (43.18%), Query Frame = 3
Query: 1134 GCQHICLNVEGSFICD-------CHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPN-----KRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCIN-----DLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQ-NQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRL-CDHVTGICYCADVAFGK--CEACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN-CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKES-DCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQM 3482
            GCQ IC   E    CD       C PG+       +C         P  +   GC   C  + +         CSC PG+     GL+C    +       C+ P  C       D  S LC C  GY   + +  C             GY         +C C +G T    +  C      RGS  +     CP G FG +C   C NC     C+     C+C     G  C   C      + C  + C C NG +C+    +C+C PG  G  C   C  G +G+NC+ +C      N C  I G+C C  GW G +C   C  G  G GC   CSC   N   CD   G C+C  G+ G  C   C  G FG+ C   C       C+H TG C      G     C++ CP G  G  C + C C   + SC   +G CHC PGFTG  CE  C  G +G+ C+  CQC  +   C   +G C CA    G    + CPSG++GP C Q C C     CD   G C C AG+ G  CS  CP+G +G  C+  C C  G  CDP+SG C C PG  G  CE  C +  +G  C+ KC C NGG C      C C  GW G  CE +C  G YG  C   C C N G C+  SG C C PG+ G  C++ CP+  +G  C +VC+C  G  C P +G C CPAG HG  CE  C P  +G  CL  C C     CD  +G C CP    G +C++     +    C   C C     C+ ++G+C C     GP C ++
Sbjct:  783 GCQEICPACEHGASCDPETGTCLCLPGFVGSRCQDAC---------PAGWFGTGCQMRCACANDGHCHPATGRCSCAPGWT----GLSCQRACDSGHWGPDCIHPCNCSAGHGNCDAVSGLCLCEAGYEGPQCEQWCRQ-----------GY--FGPGCEQKCRCEHGATCDHVSGACTCPAGWRGSFCE---HACPAGFFGLDCGSAC-NCSAGAPCDAVTGSCICPAGRWGPHCAQTCPPLTFGLNCSQI-CTCFNGASCDPVLGQCHCAPGWMGPTCLQACPAGLYGKNCQHSCLCRNGGN-CDPILGQCTCPEGWTGLACENECLPGHHGAGCRLNCSCL--NGGTCDRLTGHCRCPTGWTGDKCQSPCVSGMFGVHCEEHCACRKGATCHHVTGACLCPP--GWRGSHCEQACPRGWFGEACAQRCHCPPGA-SCHHVSGECHCPPGFTGPGCEQACQPGTFGKDCEHPCQCPGETWACHPASGACVCAAGYHGTDCQQRCPSGRYGPGCEQICKCLNGGTCDPATGACYCPAGFLGADCSLACPQGRFGPSCAHVCTCGQGAACDPVSGTCICPPGKTGGHCERGCPQDRFGKGCEHKCACRNGGLCHATNGSCSCPLGWMGPHCEHACPAGRYGAACLLECSCQNNGSCEPTSGACLCGPGFYGQACEDTCPAGFHGSGCQRVCECQQGAPCDPVSGRCLCPAGFHGQFCERGCKPGFFGDGCLQQCNCPTGVPCDPISGLCLCPPGRAGTTCDLDCRRGRFGPGCALRCDCGGGADCDPISGQCHCVDSYTGPTCREV 1551          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Mouse
Match: Megf6 (multiple EGF-like-domains 6 [Source:MGI Symbol;Acc:MGI:1919351])

HSP 1 Score: 641.343 bits (1653), Expect = 0.000e+0
Identity = 419/1164 (36.00%), Postives = 562/1164 (48.28%), Query Frame = 3
Query:  681 GYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQN-------------------------------------------QNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSC-QCRKDRLCDHVTGICYCADVAFG-KCE-ACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCI--YGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKE--SDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFR---------CPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCE 3995
            GY +S N +   D++EC  +   C H CVN PG + C+C P   L  D   C+  I  C   N GGC H CV+L+  +  C C   + L +D R C     C D NGGC H CQ      +  C C PGY +   D K C+D++EC +    C H CLN +GSF C CH G+++G D + CY+++ME+ + C+ GNGGC+  C+ + +   +C+C  G++L+ D  TC D D+C            C N  G Y C+C  GYRL  +   CED+DEC     GC + C N  GS++C C  G  L +D + C                                                RG     +   C   +FG +C   C +C + G C     GC C   ++G IC   C  +     C    C C+NGGTC+  +  C CPPG+SG  CE GC +GF+G++C K C  A +  RCH++ G CLC PG YG  CHL CP   +G GCS+ C C Q++   C+ K+G C CK G+ G  C  +C+PG FG  C   C       C+  +G+C  +   G     C ++CP G  G +C  +C C      C    G C C PG TG+ C   C +G +G  CQ  C  C     CD  TG C C     G +C+ ACP+G +G  C   C C     C    G+C C  G+ G  C + C  G +G  C   C C   +GNCD +SG+C C  G+ G  CE  C +GY+G  C++KC+C +G TCD     C C  GW G FCE +C  G++G +C   C C  G  CD ++G C C  G  G +C ++C    +G  C   C CLNGG C    G C+CP G  GD C+  CP   +G  C   C C     C   +GEC CP    G  CE + C S      C Q C+C    +C+  TG C C  G  G  C   C  G FG  C   C C  G  C+PV GTC+C  G TG  C++ C +  +G  C+ KC  C     CH   G CSC  G +   C+  CP+G YG  C   C C +  SC P++GAC C  GFYG  C+ R         C    +G  C  RC C   + C+P++G C C    +G  C 
Sbjct:   44 GYPVSTNDQR-PDVDECRSHNGGCQHRCVNTPGSYLCECKPGFRLHTDGRTCL-AISSCTLGN-GGCQHQCVQLTVTQHRCQCRPQYQLQEDGRRCVRRSPCADGNGGCMHTCQE--LRGLAHCGCHPGYQL-AADRKACEDVDECALGLAQCAHGCLNTQGSFKCVCHAGYELGADGRQCYRIEMEIVNSCEAGNGGCSHGCSHT-STGPLCTCPRGYELDEDQKTCIDIDDCANSP---CCQQVCANTPGGYECSCFAGYRLNTDGCGCEDVDECASGHSGCEHHCSNLAGSFQCFCEAGYRLDEDRRGCTPLEESVVDLDGQLPFVRPLPHIAVLGDELPQLFQDDYGAEEEAVAELRGEHTLTEKFVCLDHSFGHDCSLTCDDCRNGGTCFPGLDGCDCPEGWTGIICNETCPPDTFGKNCSS-PCICQNGGTCDPVSGACRCPPGVSGAHCEDGCPKGFYGKHCRKKCHCA-NRGRCHRLYGACLCDPGLYGRFCHLACPPWAFGPGCSEDCLCEQSHTRSCNSKDGSCSCKAGFQGERCEAECEPGSFGPGCRNRCTCRPGVACDPVSGECRTQCPPGYQGEDCGQECPVGTFGVNCSGSCSCV--GAPCHRVTGECLCPPGKTGEDCGADCPEGRWGLGCQEICPACEHGASCDPETGTCLCLPGFVGSRCQDACPAGWFGTGCQMRCACANDGHCHPATGRCSCAPGWTGLSCQRACDSGHWGPDCIHPCNCSAGHGNCDAVSGLCLCEAGYEGPQCEQWCRQGYFGPGCEQKCRCEHGATCDHVSGACTCPAGWRGSFCEHACPAGFFGLDCGSACNCSAGAPCDAVTGSCICPAGRWGPHCAQKCLPGHHGAGCRLNCSCLNGGTCDRLTGHCRCPTGWTGDKCQSPCPRGWFGEACAQRCHCPPGASCHHVSGECHCPPGFTGPGCE-QGCPSGRYGPGCEQICKCLNGGTCDPATGACYCPAGFLGADCSLACPQGRFGPSCAHVCTCGQGAACDPVSGTCICPPGKTGGHCERGCPQDRFGKGCEHKC-ACRNGGLCHATNGSCSCPLGWMGPHCEHACPAGRYGAACLLECSCQNNGSCEPTSGACLCGPGFYGQACEDRRAGTTCDLDCRRGRFGPGCALRCDCGGGADCDPISGQCHCVDSYTGPTCR 1191          

HSP 2 Score: 337.806 bits (865), Expect = 2.652e-96
Identity = 232/628 (36.94%), Postives = 305/628 (48.57%), Query Frame = 3
Query: 2163 KGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETG----QCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDC--TYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICR--CNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRC-QCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATE-KCDLKTGECTCPKSAFGLSCEIKNCDSKE--SDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVS 4001
            +G H +   + C    FG DCS +C +DC+       G     CP    +G   I C   CP    G +C   C C +N  +C+  +G C C PG +G  CE  C KG YG+ C+  C C     C  + G C C    +G+    ACP   +GP C+++C C  +++  C+  +G C C AG+ G +C   C  G +G GC   C C  G  CDP+SG CR  C PG+ GE C   C  G +G  C   C C+ G  C     +C C PG  GE C   C  G +G  C+  C  C +G  CD  +G C C+PG+ G  C + CP+  +G  C   C C N G CHP  G C C  G  G  C+  C    +GP+C+H C C A    CD  +G C C     G  CE + C        C Q C+C    +C+ V+G C C  G RG  C   C  G FGLDC   C C+ G PC+ V G+C+C +G  G  C Q C  G +G  C+L C  C    TC   TG C C  G     C+  CP G++G  C Q C C  GASC+  +G C C  GF G  C+  CP+  YG  C+  CKC +   C+P TG C CP    G  C ++
Sbjct:  394 RGEHTLTEKFVCLDHSFGHDCSLTC-DDCRNGGTCFPGLDGCDCP----EGWTGIICNETCPPDTFGKNCSSPCIC-QNGGTCDPVSGACRCPPGVSGAHCEDGCPKGFYGKHCRKKCHCANRGRCHRLYGACLCDPGLYGRFCHLACPPWAFGPGCSEDCLCEQSHTRSCNSKDGSCSCKAGFQGERCEAECEPGSFGPGCRNRCTCRPGVACDPVSGECRTQCPPGYQGEDCGQECPVGTFGVNCSGSCSCV-GAPCHRVTGECLCPPGKTGEDCGADCPEGRWGLGCQEICPACEHGASCDPETGTCLCLPGFVGSRCQDACPAGWFGTGCQMRCACANDGHCHPATGRCSCAPGWTGLSCQRACDSGHWGPDCIHPCNCSAGHGNCDAVSGLCLCEAGYEGPQCE-QWCRQGYFGPGCEQKCRCEHGATCDHVSGACTCPAGWRGSFCEHACPAGFFGLDCGSACNCSAGAPCDAVTGSCICPAGRWGPHCAQKCLPGHHGAGCRLNC-SCLNGGTCDRLTGHCRCPTGWTGDKCQSPCPRGWFGEACAQRCHCPPGASCHHVSGECHCPPGFTGPGCEQGCPSGRYGPGCEQICKCLNGGTCDPATGACYCPAGFLGADCSLA 1012          

HSP 3 Score: 171.785 bits (434), Expect = 1.167e-42
Identity = 229/773 (29.62%), Postives = 297/773 (38.42%), Query Frame = 3
Query:  534 SGYNAKCICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGFYCK-----CPPGYEMSENGKNCIDINECIR--NRTDCSHECVNLPGGFRC--QCPPDMILGP---DRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVI-TCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICD-------CHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPN-----KRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCIN-----DLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQ-NQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEK--NCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQC---PDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK-CE----------ACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSK 2711
            SG + +  CPKGF G  C K  +             C  D G Y +     CPP        ++C+      R  N  D S  C     G RC  +C P    GP   +R  C P +  CD  + G C               CP G+  +   + C V     + +G CS  C   P   V   C C PG        + C           GCQ IC   E    CD       C PG+       +C         P  +   GC   C  + +         CSC PG+     GL+C    +       C+ P  C       D  S LC C  GY   + +  C             GY         +C C +G T    +  C      RGS  +     CP G FG +C   C NC     C+     C+C     G  C   CL       C+ L C C NGGTC+  T  C CP G +G+ C+  C  G+FGE C +  +CP   S   CH ++G+C C PG+ G  C   CP+G +G GC + C C   N   CDP  G C C  G+ G +C   C  G FG  C+  C       C+  +G C   P KT        C+R CP    G  C   C C  N   C   NG C C  G+ G  CE  C  G YG  C   C C+ +  C+  +G C C    +G+ CE           C  G++GP C   CDC     CD I+GQC C+  Y GP C +
Sbjct:  484 SGAHCEDGCPKGFYGKHCRKKCHCANRGRCHRLYGACLCDPGLYGRFCHLACPPWAFGPGCSEDCLCEQSHTRSCNSKDGSCSCKAGFQGERCEAECEPGS-FGPGCRNRCTCRPGV-ACDPVS-GECRTQ------------CPPGYQGEDCGQECPVGTFGVNCSGSCS--CVGAPCHRVTGECLCPPG-----KTGEDCGADCPEGRWGLGCQEICPACEHGASCDPETGTCLCLPGFVGSRCQDAC---------PAGWFGTGCQMRCACANDGHCHPATGRCSCAPGWT----GLSCQRACDSGHWGPDCIHPCNCSAGHGNCDAVSGLCLCEAGYEGPQCEQWCRQ-----------GY--FGPGCEQKCRCEHGATCDHVSGACTCPAGWRGSFCE---HACPAGFFGLDCGSAC-NCSAGAPCDAVTGSCICPAGRWGPHCAQKCLPGHHGAGCR-LNCSCLNGGTCDRLTGHCRCPTGWTGDKCQSPCPRGWFGEACAQRCHCPPGAS---CHHVSGECHCPPGFTGPGCEQGCPSGRYGPGCEQICKC--LNGGTCDPATGACYCPAGFLGADCSLACPQGRFGPSCAHVCTCGQGAACDPVSGTCICPPGKT-----GGHCERGCPQDRFGKGCEHKCAC-RNGGLCHATNGSCSCPLGWMGPHCEHACPAGRYGAACLLECSCQNNGSCEPTSGACLCGPGFYGQACEDRRAGTTCDLDCRRGRFGPGCALRCDCGGGADCDPISGQCHCVDSYTGPTCRE 1192          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Mouse
Match: Megf11 (multiple EGF-like-domains 11 [Source:MGI Symbol;Acc:MGI:1920951])

HSP 1 Score: 441.81 bits (1135), Expect = 8.833e-135
Identity = 283/700 (40.43%), Postives = 350/700 (50.00%), Query Frame = 3
Query: 1929 CTEGFF--GENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFG-KC-EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKR-CPEGLYGEGCSKECQCIYGN---CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKES-DCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKC-RCANGE-PCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCE 3995
            C  G++  G+ C   C   C   RC      C C PGW G  C   C +  WG  CS  C C   N   C+P  G C C  G+ G  C   C PG  G  C   C       C+  TG+C      G   + C+  CP G  G+ C   C C +N  +C    G C C PG+TG  C   C  G +G+ C   C C     CDHVTG C+C     G +C E CP G +G  C+Q CDC     C    G C C  GY GP C +R CPEGL+G GC+  C C   N   C P++G C C PGW G  C   C  GYYG+ C+  C C NG  C      C C PG+ GE C   CA G YG NC   C C NGG C  + G C C  GW+G++C   CPS T+G NCN+ C C NG  C P +G C C  G  GD CEL CP   +G NC  +C C   + CD  TG C C     G+ C+      +   +C   C C    SC+   G C+C PG RGP C ++C  G +G  C Q C  C +   PC+ + G C CL GF+G LC+QVCA G +G +C   C  C  N TC P  G C C  G I  DC   CPSG++G  C   C C +GASC+   GAC C  G+ G  C  RCP+ F+G +C H C+C + + C+ +TG C C    SGR CE
Sbjct:   87 CCPGYYENGDFCIPLCTEECMHGRCVS-PDTCHCEPGWGGPDCSSGCDSEHWGPHCSNRCQCQ--NGALCNPITGACVCAPGFRGWRCEELCAPGTHGKGCQLLCQCHHGASCDPRTGEC--LCAPGYTGVYCEELCPPGSHGAHCELRCPC-QNGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPCHHGGQCDHVTGQCHCTAGYMGDRCQEECPFGTFGFLCSQRCDCHNGGQCSPATGACECEPGYKGPSCQERLCPEGLHGPGCTLPCPCDTENTISCHPVTGACTCQPGWSGHYCNESCPAGYYGNGCQLPCTCQNGADCHSITGSCTCAPGFMGEVCAVPCAAGTYGPNCSSVCSCSNGGTCSPVDGSCTCREGWQGLDCSLPCPSGTWGLNCNETCICANGAACSPFDGSCACTPGWLGDSCELPCPDGTFGLNCSEHCDCSHADGCDPVTGHCCCLAGWTGIRCDSTCPPGRWGPNCSVSCSCENGGSCSPEDGSCECAPGFRGPLCQRICPPGFYGHGCAQPCPLCVHSRGPCHHISGICECLPGFSGALCNQVCAGGHFGQDCAQLC-SCANNGTCSPIDGSCQCFPGWIGKDCSQACPSGFWGSACFHTCSCHNGASCSAEDGACHCTPGWTGLFCTQRCPSAFFGKDCGHICQCQNGASCDHITGKCTCRTGFSGRHCE 779          

HSP 2 Score: 394.43 bits (1012), Expect = 2.164e-117
Identity = 280/737 (37.99%), Postives = 348/737 (47.22%), Query Frame = 3
Query: 1683 GEECLFNCSN-CMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRC-ELKCTKGLYGERCQSSCQCRKDRL--CDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNC-ICKATE-KCDLKTGECTCPKSAFGLSC-EIKNCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALC 3863
            G+ C+  C+  CMH G C    T C C P + G  C   C        C   +C C+NG  C   T  C C PG  G  CE  C  G  G+ C+  C     ++ C   TG+CLC PG+ G  C  LCP G+ G  C   C C   N   C    G+C C  G+ G  C   C PG FG +CS  CP      C+H TGQC      G     CQ +CP G  G  C + CDC  N   C    G C C PG+ G  C E  C +GL+G  C   C C  +    C  VTG C C     G    E+CP+G +G  C   C C     C  I G C C  G+ G  C+  C  G YG  CS  C C  G  C P+ G C C  GW G  C  PC  G +G  C E C C NG  C  F   C C PGW G+ CE  C  G +G NC   C C +   CD ++G C C+ GW GI CD  CP   +GPNC+  C C NGG C PE+G C+C  G  G +C+  CPP  YG  C   C +C  +   C   +G C C     G  C ++        DC Q C C+   +C+ + G CQC PG  G  C Q C  G +G  C   C C NG  C+  DG C C  G+TG+ C Q C   ++G +C   C  C    +C   TG+C+C  G     C+ +C  G +G  CQQ C+CM+ A+C+  TG C C  GF G  C
Sbjct:   95 GDFCIPLCTEECMH-GRCVSPDT-CHCEPGWGGPDCSSGCDSEHWGPHCS-NRCQCQNGALCNPITGACVCAPGFRGWRCEELCAPGTHGKGCQLLCQCHHGAS-CDPRTGECLCAPGYTGVYCEELCPPGSHGAHCELRCPCQ--NGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPCHHGGQCDHVTGQC--HCTAGYMGDRCQEECPFGTFGFLCSQRCDC-HNGGQCSPATGACECEPGYKGPSCQERLCPEGLHGPGCTLPCPCDTENTISCHPVTGACTCQPGWSGHYCNESCPAGYYGNGCQLPCTCQNGADCHSITGSCTCAPGFMGEVCAVPCAAGTYGPNCSSVCSCSNGGTCSPVDGSCTCREGWQGLDCSLPCPSGTWGLNCNETCICANGAACSPFDGSCACTPGWLGDSCELPCPDGTFGLNCSEHCDCSHADGCDPVTGHCCCLAGWTGIRCDSTCPPGRWGPNCSVSCSCENGGSCSPEDGSCECAPGFRGPLCQRICPPGFYGHGCAQPCPLCVHSRGPCHHISGICECLPGFSGALCNQVCAGGHFGQDCAQLCSCANNGTCSPIDGSCQCFPGWIGKDCSQACPSGFWGSACFHTCSCHNGASCSAEDGACHCTPGWTGLFCTQRCPSAFFGKDCGHICQ-CQNGASCDHITGKCTCRTGFSGRHCEQRCAPGTFGYGCQQLCECMNNATCDHVTGTCYCSPGFKGIRC 821          

HSP 3 Score: 392.119 bits (1006), Expect = 1.261e-116
Identity = 267/696 (38.36%), Postives = 339/696 (48.71%), Query Frame = 3
Query: 1560 SYRCVCPNGETLGKDNKTCQ-NQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYK-CDPGYFGLDCSFSCPEDCKTI--CNHETGQCPDKTCQ-GNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK--CEACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN-CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQ--CHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSK--ESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQV 3611
            S RC C NG         C      RG   ++    C  GT G+ C   C  C H   C+     CLC P Y+G  CE  C        C+ L+C C+NGGTC   T +C CPPG +G +C   C  G FG+NC ++CP      +C  +TG+C C  G+ G  C   CP GT+G  CS+ C C+  N   C P  G C+C+ GY G +C  + C  G  G  C+  CP D +    C+  TG C   TCQ G +   C   CP G  G+ C+  C C +N   C    G C CAPGF G+ C + C  G YG  C S C C     C  V G C C +   G      CPSG WG  CN+ C C     C   +G C C  G+ G  C   CP+G +G  CS+ C C + + CDP++G C C  GW G  C++ C  G +G  C   C C NGG+C      C+C PG+ G  C++ C  G+YG  C   C    H+ G C  ISG C+C+PG+ G  C++ C    +G +C Q+C C N G C P +G CQC  G  G  C   CP   +G  C H C C     C  + G C C     GL C  + C S     DC   CQC    SC+ +TGKC C+ G  G  C Q C  G FG  C+Q C C N   C+ V GTC C  GF GI CDQ 
Sbjct:  142 SNRCQCQNGALCNPITGACVCAPGFRGWRCEE---LCAPGTHGKGCQLLC-QCHHGASCDPRTGECLCAPGYTGVYCEELCPPGSHGAHCE-LRCPCQNGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPCH-HGGQCDHVTGQCHCTAGYMGDRCQEECPFGTFGFLCSQRCDCH--NGGQCSPATGACECEPGYKGPSCQERLCPEGLHGPGCTLPCPCDTENTISCHPVTGAC---TCQPGWSGHYCNESCPAGYYGNGCQLPCTC-QNGADCHSITGSCTCAPGFMGEVCAVPCAAGTYGPNCSSVCSCSNGGTCSPVDGSCTCREGWQGLDCSLPCPSGTWGLNCNETCICANGAACSPFDGSCACTPGWLGDSCELPCPDGTFGLNCSEHCDCSHADGCDPVTGHCCCLAGWTGIRCDSTCPPGRWGPNCSVSCSCENGGSCSPEDGSCECAPGFRGPLCQRICPPGFYGHGCAQPCPLCVHSRGPCHHISGICECLPGFSGALCNQVCAGGHFGQDCAQLCSCANNGTCSPIDGSCQCFPGWIGKDCSQACPSGFWGSACFHTCSCHNGASCSAEDGACHCTPGWTGLFC-TQRCPSAFFGKDCGHICQCQNGASCDHITGKCTCRTGFSGRHCEQRCAPGTFGYGCQQLCECMNNATCDHVTGTCYCSPGFKGIRCDQA 824          

HSP 4 Score: 365.155 bits (936), Expect = 6.688e-107
Identity = 264/699 (37.77%), Postives = 327/699 (46.78%), Query Frame = 3
Query: 1680 FGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQ-----GNNSIGCQ-RDCPTGGSGSDCRKTCDC-SENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKCEACP--SGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN-CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQ-CLNG-GKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSK--ESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDC 3734
            +G  C   C  C +   CN     C+C P + G  CE  C        CQ L C C +G +C+  T +C C PG +G  CE  C  G  G +CE  CP   +   CH ITG+C C PGW G+ C   CP GT+G  CS+ C C+      CD   G+C C  GY G  C  +C  G FG  CS  C  DC     H  GQC   T       G     CQ R CP G  G  C   C C +EN++SC    G C C PG++G  C   C  G YG  CQ  C C+    C  +TG C CA    G+  A P  +G +GP C+  C C+    C  ++G C C  G+ G  CS  CP G +G  C++ C C  G  C P  G C C PGW G+ CE PC +G +G  C E C C +   CD     C C  GW G  C+ +C  G +G NC   C C NGG C    G C+C PG+RG  C   CP   YG  C Q C  C++  G CH  +G+C+C  G  G +C   C    +G +C   C C     C    G C C     G  C  + C S    S C   C C    SC+   G C C PG  G  C Q C    FG DC   C+C NG  C+ + G C C +GF+G  C+Q CA G +G  C+  C  C  N TC   TG C C  G     C
Sbjct:  137 WGPHCSNRC-QCQNGALCNPITGACVCAPGFRGWRCEELCAPGTHGKGCQ-LLCQCHHGASCDPRTGECLCAPGYTGVYCEELCPPGSHGAHCELRCPCQ-NGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPCHHGGQ--CDHVTGQCHCTAGYMGDRCQEECPFGTFGFLCSQRC--DC-----HNGGQCSPATGACECEPGYKGPSCQERLCPEGLHGPGCTLPCPCDTENTISCHPVTGACTCQPGWSGHYCNESCPAGYYGNGCQLPCTCQNGADCHSITGSCTCAPGFMGEVCAVPCAAGTYGPNCSSVCSCSNGGTCSPVDGSCTCREGWQGLDCSLPCPSGTWGLNCNETCICANGAACSPFDGSCACTPGWLGDSCELPCPDGTFGLNCSEHCDCSHADGCDPVTGHCCCLAGWTGIRCDSTCPPGRWGPNCSVSCSCENGGSCSPEDGSCECAPGFRGPLCQRICPPGFYGHGCAQPCPLCVHSRGPCHHISGICECLPGFSGALCNQVCAGGHFGQDCAQLCSCANNGTCSPIDGSCQCFPGWIGKDCS-QACPSGFWGSACFHTCSCHNGASCSAEDGACHCTPGWTGLFCTQRCPSAFFGKDCGHICQCQNGASCDHITGKCTCRTGFSGRHCEQRCAPGTFGYGCQQLC-ECMNNATCDHVTGTCYCSPGFKGIRC 821          

HSP 5 Score: 268.47 bits (685), Expect = 1.154e-73
Identity = 159/418 (38.04%), Postives = 216/418 (51.67%), Query Frame = 3
Query: 2757 QCIYGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIK-NCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQ-MCEFGNFGLDCKQKCRC--ANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEV 3998
            +C++G C      C C PGW G  C + CD  ++G  C  +C+C NG  C+     C C PG+ G  CE+ CA G +G+ C+  CQCH+G  CD  +G+C C PG+ G+ C+E CP  ++G +C   C C NGG CH   G C CP G  G VC   CPP  +G NC  +C C    +CD  TG+C C     G  C+ +    +    C Q C C     C+  TG C+C+PG +GP C + +C  G  G  C   C C   N   C+PV G C C  G++G  C++ C  G+YG  C+L C  C     CH  TG C+C  G +   C   C +G YGP C   C C +G +C+P  G+C C  G+ G  C   CP+  +G NC   C C + + C+P  G C C     G  CE+
Sbjct:  105 ECMHGRCVSPD-TCHCEPGWGGPDCSSGCDSEHWGPHCSNRCQCQNGALCNPITGACVCAPGFRGWRCEELCAPGTHGKGCQLLCQCHHGASCDPRTGECLCAPGYTGVYCEELCPPGSHGAHCELRCPCQNGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPCHHGGQCDHVTGQCHCTAGYMGDRCQEECPFGTFGFLCSQRCDCHNGGQCSPATGACECEPGYKGPSCQERLCPEGLHGPGCTLPCPCDTENTISCHPVTGACTCQPGWSGHYCNESCPAGYYGNGCQLPC-TCQNGADCHSITGSCTCAPGFMGEVCAVPCAAGTYGPNCSSVCSCSNGGTCSPVDGSCTCREGWQGLDCSLPCPSGTWGLNCNETCICANGAACSPFDGSCACTPGWLGDSCEL 520          

HSP 6 Score: 254.603 bits (649), Expect = 4.068e-69
Identity = 157/390 (40.26%), Postives = 201/390 (51.54%), Query Frame = 3
Query: 2850 GYY--GDQCKEKC--KCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIK-NCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILC-DQVCAKGWYGPNCKLKCLVCNRNK-TCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEV 3998
            GYY  GD C   C  +C++G    +    C CEPGW G  C   C   ++G +C  RCQC NG LC+ I+G C C PG+RG  C+E C   T+G  C  +CQC +G  C P  G C C  G  G  CE  CPP  +G +C   C C+    C   TGEC CP    G  C       +   +C QDC C     C+ VTG+C C  G  G +C + C FG FG  C Q+C C NG  C+P  G C C  G+ G  C +++C +G +GP C L C     N  +CHP TG C+C+ G   + C   CP+GYYG  CQ  C C +GA C+  TG+C C  GF G +C   C    YG NC   C C +   C+PV G C C +   G  C +
Sbjct:   90 GYYENGDFCIPLCTEECMHGRC--VSPDTCHCEPGWGGPDCSSGCDSEHWGPHCSNRCQCQNGALCNPITGACVCAPGFRGWRCEELCAPGTHGKGCQLLCQCHHGASCDPRTGECLCAPGYTGVYCEELCPPGSHGAHCELRCPCQNGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPCHHGGQCDHVTGQCHCTAGYMGDRCQEECPFGTFGFLCSQRCDCHNGGQCSPATGACECEPGYKGPSCQERLCPEGLHGPGCTLPCPCDTENTISCHPVTGACTCQPGWSGHYCNESCPAGYYGNGCQLPCTCQNGADCHSITGSCTCAPGFMGEVCAVPCAAGTYGPNCSSVCSCSNGGTCSPVDGSCTCREGWQGLDCSL 477          

HSP 7 Score: 241.891 bits (616), Expect = 4.900e-65
Identity = 161/444 (36.26%), Postives = 213/444 (47.97%), Query Frame = 3
Query: 1659 RRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCD-CSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK--CEACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAV 2978
              CP G +G  C   C+ C +   C+     C C P + G +C + C        C  + C C NGGTC      C C  G  G  C + C  G +G NC + C  A +   C    G C C PGW G SC L CP GT+G+ CS+ C C+    +GCDP  G C C  G+ G+ C   C PG +G +CS SC  +    C+ E G C  +   G     CQR CP G  G  C + C  C  +   C   +GIC C PGF+G  C   C  G +G+ C   C C  +  C  + G C C     GK   +ACPSG WG  C   C C     C   +G C C  G+ G  C++RCP   +G+ C   CQC  G +CD I+G C C  G+ G  CE  C  G +G  C++ C+C+N  TCD     C C PG+ G  C+++  +
Sbjct:  391 ESCPAGYYGNGCQLPCT-CQNGADCHSITGSCTCAPGFMGEVCAVPCAAGTYGPNCSSV-CSCSNGGTCSPVDGSCTCREGWQGLDCSLPCPSGTWGLNCNETCICA-NGAACSPFDGSCACTPGWLGDSCELPCPDGTFGLNCSEHCDCSHA--DGCDPVTGHCCCLAGWTGIRCDSTCPPGRWGPNCSVSCSCENGGSCSPEDGSC--ECAPGFRGPLCQRICPPGFYGHGCAQPCPLCVHSRGPCHHISGICECLPGFSGALCNQVCAGGHFGQDCAQLCSCANNGTCSPIDGSCQCFPGWIGKDCSQACPSGFWGSACFHTCSCHNGASCSAEDGACHCTPGWTGLFCTQRCPSAFFGKDCGHICQCQNGASCDHITGKCTCRTGFSGRHCEQRCAPGTFGYGCQQLCECMNNATCDHVTGTCYCSPGFKGIRCDQAALM 827          

HSP 8 Score: 170.244 bits (430), Expect = 2.527e-42
Identity = 199/708 (28.11%), Postives = 286/708 (40.40%), Query Frame = 3
Query:  507 CQNGAFCYQSGYNAKCICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDL-------CKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICL-NVEGSF-------ICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQ--FCNSSPNKRAI---CSCLPGFKLEADGLTCS--DEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQ-NQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPT-ACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCA 2558
            C +GA C       +C+C  G+ G +C++                          CPPG     +G +C     C    T     C ++ G   C CPP          C P     + +    C HH  +   +   C C  G++ D+ +  C            C  +NGG     Q  P++    C+C PGY       + C +     +   GC   C  + E +         C C PGW   + ++SC         P  Y   GC     C +  +  +I   C+C PGF  E   + C+        +    C    TC    GS  CTC  G++     + C         +G  G  C  T     C+C NG      + +C       G S +     CP GTFG  C  +C +C H   C+     C C   ++G  C+  C        C  + C C+NGG+C  E   C C PG  G +C+  C  GF+G  C + CP    S   CH I+G C C PG+ G+ C+ +C  G +G  C++ CSC  N    C P +G C+C  G+ G +C   C  G++G  C  +C       C+ E G C      G   + C + CP+   G DC   C C +N  SC+   G C C  GF+G+ CE +C  G +G  CQ  C+C  +  CDHVTG CYC+
Sbjct:  190 CHHGASC--DPRTGECLCAPGYTGVYCEE-------------------------LCPPG----SHGAHCELRCPCQNGGT-----CHHITG--ECACPPGWTGAVCAQPCPPGTFGQNCSQDCPC-HHGGQCDHVTGQCHCTAGYMGDRCQEECPFGTFGFLCSQRCDCHNGG-----QCSPATGA--CECEPGYKGPSCQERLCPE----GLHGPGCTLPCPCDTENTISCHPVTGACTCQPGWSGHYCNESC---------PAGYYGNGCQLPCTCQNGADCHSITGSCTCAPGFMGEVCAVPCAAGTYGPNCSSVCSCSNGGTCSPVDGS--CTCREGWQGLDCSLPCP--------SGTWGLNCNET-----CICANGAACSPFDGSCACTPGWLGDSCELP---CPDGTFGLNCSEHC-DCSHADGCDPVTGHCCCLAGWTGIRCDSTCPPGRWGPNCS-VSCSCENGGSCSPEDGSCECAPGFRGPLCQRICPPGFYGHGCAQPCPLCVHSRGPCHHISGICECLPGFSGALCNQVCAGGHFGQDCAQLCSCANNGT--CSPIDGSCQCFPGWIGKDCSQACPSGFWGSACFHTCSCHNGASCSAEDGAC--HCTPGWTGLFCTQRCPSAFFGKDCGHICQC-QNGASCDHITGKCTCRTGFSGRHCEQRCAPGTFGYGCQQLCECMNNATCDHVTGTCYCS 813          

HSP 9 Score: 160.229 bits (404), Expect = 3.908e-39
Identity = 108/291 (37.11%), Postives = 147/291 (50.52%), Query Frame = 3
Query: 3141 QCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCE-IKNCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFR-CPNNFYGANCQHRCKC--FHNSPCNPVTGHCVCPKKLSGRFCEVS 4001
            +C++G    P+   C C  G  G  C   C  + +GP+C + C C+    C+  TG C C     G  CE +    +    C+  CQC    SC+  TG+C C PG  G  C ++C  G+ G  C+ +C C NG  C+ + G C C  G+TG +C Q C  G +G NC   C  C+    C   TGQC C AG +   C+ +CP G +G LC Q C C +G  C+P+TGAC+C  G+ G  CQ R CP   +G  C   C C   +   C+PVTG C C    SG +C  S
Sbjct:  105 ECMHGRCVSPDT--CHCEPGWGGPDCSSGCDSEHWGPHCSNRCQCQNGALCNPITGACVCAPGFRGWRCEELCAPGTHGKGCQLLCQCHHGASCDPRTGECLCAPGYTGVYCEELCPPGSHGAHCELRCPCQNGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDC-PCHHGGQCDHVTGQCHCTAGYMGDRCQEECPFGTFGFLCSQRCDCHNGGQCSPATGACECEPGYKGPSCQERLCPEGLHGPGCTLPCPCDTENTISCHPVTGACTCQPGWSGHYCNES 392          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Mouse
Match: Megf11 (multiple EGF-like-domains 11 [Source:MGI Symbol;Acc:MGI:1920951])

HSP 1 Score: 441.039 bits (1133), Expect = 5.621e-134
Identity = 283/700 (40.43%), Postives = 350/700 (50.00%), Query Frame = 3
Query: 1929 CTEGFF--GENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFG-KC-EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKR-CPEGLYGEGCSKECQCIYGN---CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKES-DCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKC-RCANGE-PCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCE 3995
            C  G++  G+ C   C   C   RC      C C PGW G  C   C +  WG  CS  C C   N   C+P  G C C  G+ G  C   C PG  G  C   C       C+  TG+C      G   + C+  CP G  G+ C   C C +N  +C    G C C PG+TG  C   C  G +G+ C   C C     CDHVTG C+C     G +C E CP G +G  C+Q CDC     C    G C C  GY GP C +R CPEGL+G GC+  C C   N   C P++G C C PGW G  C   C  GYYG+ C+  C C NG  C      C C PG+ GE C   CA G YG NC   C C NGG C  + G C C  GW+G++C   CPS T+G NCN+ C C NG  C P +G C C  G  GD CEL CP   +G NC  +C C   + CD  TG C C     G+ C+      +   +C   C C    SC+   G C+C PG RGP C ++C  G +G  C Q C  C +   PC+ + G C CL GF+G LC+QVCA G +G +C   C  C  N TC P  G C C  G I  DC   CPSG++G  C   C C +GASC+   GAC C  G+ G  C  RCP+ F+G +C H C+C + + C+ +TG C C    SGR CE
Sbjct:   87 CCPGYYENGDFCIPLCTEECMHGRCVS-PDTCHCEPGWGGPDCSSGCDSEHWGPHCSNRCQCQ--NGALCNPITGACVCAPGFRGWRCEELCAPGTHGKGCQLLCQCHHGASCDPRTGEC--LCAPGYTGVYCEELCPPGSHGAHCELRCPC-QNGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPCHHGGQCDHVTGQCHCTAGYMGDRCQEECPFGTFGFLCSQRCDCHNGGQCSPATGACECEPGYKGPSCQERLCPEGLHGPGCTLPCPCDTENTISCHPVTGACTCQPGWSGHYCNESCPAGYYGNGCQLPCTCQNGADCHSITGSCTCAPGFMGEVCAVPCAAGTYGPNCSSVCSCSNGGTCSPVDGSCTCREGWQGLDCSLPCPSGTWGLNCNETCICANGAACSPFDGSCACTPGWLGDSCELPCPDGTFGLNCSEHCDCSHADGCDPVTGHCCCLAGWTGIRCDSTCPPGRWGPNCSVSCSCENGGSCSPEDGSCECAPGFRGPLCQRICPPGFYGHGCAQPCPLCVHSRGPCHHISGICECLPGFSGALCNQVCAGGHFGQDCAQLC-SCANNGTCSPIDGSCQCFPGWIGKDCSQACPSGFWGSACFHTCSCHNGASCSAEDGACHCTPGWTGLFCTQRCPSAFFGKDCGHICQCQNGASCDHITGKCTCRTGFSGRHCE 779          

HSP 2 Score: 393.275 bits (1009), Expect = 1.273e-116
Identity = 280/737 (37.99%), Postives = 348/737 (47.22%), Query Frame = 3
Query: 1683 GEECLFNCSN-CMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRC-ELKCTKGLYGERCQSSCQCRKDRL--CDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNC-ICKATE-KCDLKTGECTCPKSAFGLSC-EIKNCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALC 3863
            G+ C+  C+  CMH G C    T C C P + G  C   C        C   +C C+NG  C   T  C C PG  G  CE  C  G  G+ C+  C     ++ C   TG+CLC PG+ G  C  LCP G+ G  C   C C   N   C    G+C C  G+ G  C   C PG FG +CS  CP      C+H TGQC      G     CQ +CP G  G  C + CDC  N   C    G C C PG+ G  C E  C +GL+G  C   C C  +    C  VTG C C     G    E+CP+G +G  C   C C     C  I G C C  G+ G  C+  C  G YG  CS  C C  G  C P+ G C C  GW G  C  PC  G +G  C E C C NG  C  F   C C PGW G+ CE  C  G +G NC   C C +   CD ++G C C+ GW GI CD  CP   +GPNC+  C C NGG C PE+G C+C  G  G +C+  CPP  YG  C   C +C  +   C   +G C C     G  C ++        DC Q C C+   +C+ + G CQC PG  G  C Q C  G +G  C   C C NG  C+  DG C C  G+TG+ C Q C   ++G +C   C  C    +C   TG+C+C  G     C+ +C  G +G  CQQ C+CM+ A+C+  TG C C  GF G  C
Sbjct:   95 GDFCIPLCTEECMH-GRCVSPDT-CHCEPGWGGPDCSSGCDSEHWGPHCS-NRCQCQNGALCNPITGACVCAPGFRGWRCEELCAPGTHGKGCQLLCQCHHGAS-CDPRTGECLCAPGYTGVYCEELCPPGSHGAHCELRCPCQ--NGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPCHHGGQCDHVTGQC--HCTAGYMGDRCQEECPFGTFGFLCSQRCDC-HNGGQCSPATGACECEPGYKGPSCQERLCPEGLHGPGCTLPCPCDTENTISCHPVTGACTCQPGWSGHYCNESCPAGYYGNGCQLPCTCQNGADCHSITGSCTCAPGFMGEVCAVPCAAGTYGPNCSSVCSCSNGGTCSPVDGSCTCREGWQGLDCSLPCPSGTWGLNCNETCICANGAACSPFDGSCACTPGWLGDSCELPCPDGTFGLNCSEHCDCSHADGCDPVTGHCCCLAGWTGIRCDSTCPPGRWGPNCSVSCSCENGGSCSPEDGSCECAPGFRGPLCQRICPPGFYGHGCAQPCPLCVHSRGPCHHISGICECLPGFSGALCNQVCAGGHFGQDCAQLCSCANNGTCSPIDGSCQCFPGWIGKDCSQACPSGFWGSACFHTCSCHNGASCSAEDGACHCTPGWTGLFCTQRCPSAFFGKDCGHICQ-CQNGASCDHITGKCTCRTGFSGRHCEQRCAPGTFGYGCQQLCECMNNATCDHVTGTCYCSPGFKGIRC 821          

HSP 3 Score: 391.349 bits (1004), Expect = 6.533e-116
Identity = 267/696 (38.36%), Postives = 339/696 (48.71%), Query Frame = 3
Query: 1560 SYRCVCPNGETLGKDNKTCQ-NQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYK-CDPGYFGLDCSFSCPEDCKTI--CNHETGQCPDKTCQ-GNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK--CEACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN-CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQ--CHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSK--ESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQV 3611
            S RC C NG         C      RG   ++    C  GT G+ C   C  C H   C+     CLC P Y+G  CE  C        C+ L+C C+NGGTC   T +C CPPG +G +C   C  G FG+NC ++CP      +C  +TG+C C  G+ G  C   CP GT+G  CS+ C C+  N   C P  G C+C+ GY G +C  + C  G  G  C+  CP D +    C+  TG C   TCQ G +   C   CP G  G+ C+  C C +N   C    G C CAPGF G+ C + C  G YG  C S C C     C  V G C C +   G      CPSG WG  CN+ C C     C   +G C C  G+ G  C   CP+G +G  CS+ C C + + CDP++G C C  GW G  C++ C  G +G  C   C C NGG+C      C+C PG+ G  C++ C  G+YG  C   C    H+ G C  ISG C+C+PG+ G  C++ C    +G +C Q+C C N G C P +G CQC  G  G  C   CP   +G  C H C C     C  + G C C     GL C  + C S     DC   CQC    SC+ +TGKC C+ G  G  C Q C  G FG  C+Q C C N   C+ V GTC C  GF GI CDQ 
Sbjct:  142 SNRCQCQNGALCNPITGACVCAPGFRGWRCEE---LCAPGTHGKGCQLLC-QCHHGASCDPRTGECLCAPGYTGVYCEELCPPGSHGAHCE-LRCPCQNGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPCH-HGGQCDHVTGQCHCTAGYMGDRCQEECPFGTFGFLCSQRCDCH--NGGQCSPATGACECEPGYKGPSCQERLCPEGLHGPGCTLPCPCDTENTISCHPVTGAC---TCQPGWSGHYCNESCPAGYYGNGCQLPCTC-QNGADCHSITGSCTCAPGFMGEVCAVPCAAGTYGPNCSSVCSCSNGGTCSPVDGSCTCREGWQGLDCSLPCPSGTWGLNCNETCICANGAACSPFDGSCACTPGWLGDSCELPCPDGTFGLNCSEHCDCSHADGCDPVTGHCCCLAGWTGIRCDSTCPPGRWGPNCSVSCSCENGGSCSPEDGSCECAPGFRGPLCQRICPPGFYGHGCAQPCPLCVHSRGPCHHISGICECLPGFSGALCNQVCAGGHFGQDCAQLCSCANNGTCSPIDGSCQCFPGWIGKDCSQACPSGFWGSACFHTCSCHNGASCSAEDGACHCTPGWTGLFC-TQRCPSAFFGKDCGHICQCQNGASCDHITGKCTCRTGFSGRHCEQRCAPGTFGYGCQQLCECMNNATCDHVTGTCYCSPGFKGIRCDQA 824          

HSP 4 Score: 363.999 bits (933), Expect = 3.584e-106
Identity = 264/699 (37.77%), Postives = 327/699 (46.78%), Query Frame = 3
Query: 1680 FGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQ-----GNNSIGCQ-RDCPTGGSGSDCRKTCDC-SENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKCEACP--SGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN-CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQ-CLNG-GKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSK--ESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDC 3734
            +G  C   C  C +   CN     C+C P + G  CE  C        CQ L C C +G +C+  T +C C PG +G  CE  C  G  G +CE  CP   +   CH ITG+C C PGW G+ C   CP GT+G  CS+ C C+      CD   G+C C  GY G  C  +C  G FG  CS  C  DC     H  GQC   T       G     CQ R CP G  G  C   C C +EN++SC    G C C PG++G  C   C  G YG  CQ  C C+    C  +TG C CA    G+  A P  +G +GP C+  C C+    C  ++G C C  G+ G  CS  CP G +G  C++ C C  G  C P  G C C PGW G+ CE PC +G +G  C E C C +   CD     C C  GW G  C+ +C  G +G NC   C C NGG C    G C+C PG+RG  C   CP   YG  C Q C  C++  G CH  +G+C+C  G  G +C   C    +G +C   C C     C    G C C     G  C  + C S    S C   C C    SC+   G C C PG  G  C Q C    FG DC   C+C NG  C+ + G C C +GF+G  C+Q CA G +G  C+  C  C  N TC   TG C C  G     C
Sbjct:  137 WGPHCSNRC-QCQNGALCNPITGACVCAPGFRGWRCEELCAPGTHGKGCQ-LLCQCHHGASCDPRTGECLCAPGYTGVYCEELCPPGSHGAHCELRCPCQ-NGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPCHHGGQ--CDHVTGQCHCTAGYMGDRCQEECPFGTFGFLCSQRC--DC-----HNGGQCSPATGACECEPGYKGPSCQERLCPEGLHGPGCTLPCPCDTENTISCHPVTGACTCQPGWSGHYCNESCPAGYYGNGCQLPCTCQNGADCHSITGSCTCAPGFMGEVCAVPCAAGTYGPNCSSVCSCSNGGTCSPVDGSCTCREGWQGLDCSLPCPSGTWGLNCNETCICANGAACSPFDGSCACTPGWLGDSCELPCPDGTFGLNCSEHCDCSHADGCDPVTGHCCCLAGWTGIRCDSTCPPGRWGPNCSVSCSCENGGSCSPEDGSCECAPGFRGPLCQRICPPGFYGHGCAQPCPLCVHSRGPCHHISGICECLPGFSGALCNQVCAGGHFGQDCAQLCSCANNGTCSPIDGSCQCFPGWIGKDCS-QACPSGFWGSACFHTCSCHNGASCSAEDGACHCTPGWTGLFCTQRCPSAFFGKDCGHICQCQNGASCDHITGKCTCRTGFSGRHCEQRCAPGTFGYGCQQLC-ECMNNATCDHVTGTCYCSPGFKGIRC 821          

HSP 5 Score: 268.085 bits (684), Expect = 2.543e-73
Identity = 159/418 (38.04%), Postives = 216/418 (51.67%), Query Frame = 3
Query: 2757 QCIYGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIK-NCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQ-MCEFGNFGLDCKQKCRC--ANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEV 3998
            +C++G C      C C PGW G  C + CD  ++G  C  +C+C NG  C+     C C PG+ G  CE+ CA G +G+ C+  CQCH+G  CD  +G+C C PG+ G+ C+E CP  ++G +C   C C NGG CH   G C CP G  G VC   CPP  +G NC  +C C    +CD  TG+C C     G  C+ +    +    C Q C C     C+  TG C+C+PG +GP C + +C  G  G  C   C C   N   C+PV G C C  G++G  C++ C  G+YG  C+L C  C     CH  TG C+C  G +   C   C +G YGP C   C C +G +C+P  G+C C  G+ G  C   CP+  +G NC   C C + + C+P  G C C     G  CE+
Sbjct:  105 ECMHGRCVSPD-TCHCEPGWGGPDCSSGCDSEHWGPHCSNRCQCQNGALCNPITGACVCAPGFRGWRCEELCAPGTHGKGCQLLCQCHHGASCDPRTGECLCAPGYTGVYCEELCPPGSHGAHCELRCPCQNGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPCHHGGQCDHVTGQCHCTAGYMGDRCQEECPFGTFGFLCSQRCDCHNGGQCSPATGACECEPGYKGPSCQERLCPEGLHGPGCTLPCPCDTENTISCHPVTGACTCQPGWSGHYCNESCPAGYYGNGCQLPC-TCQNGADCHSITGSCTCAPGFMGEVCAVPCAAGTYGPNCSSVCSCSNGGTCSPVDGSCTCREGWQGLDCSLPCPSGTWGLNCNETCICANGAACSPFDGSCACTPGWLGDSCEL 520          

HSP 6 Score: 254.603 bits (649), Expect = 6.993e-69
Identity = 157/390 (40.26%), Postives = 201/390 (51.54%), Query Frame = 3
Query: 2850 GYY--GDQCKEKC--KCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIK-NCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILC-DQVCAKGWYGPNCKLKCLVCNRNK-TCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEV 3998
            GYY  GD C   C  +C++G    +    C CEPGW G  C   C   ++G +C  RCQC NG LC+ I+G C C PG+RG  C+E C   T+G  C  +CQC +G  C P  G C C  G  G  CE  CPP  +G +C   C C+    C   TGEC CP    G  C       +   +C QDC C     C+ VTG+C C  G  G +C + C FG FG  C Q+C C NG  C+P  G C C  G+ G  C +++C +G +GP C L C     N  +CHP TG C+C+ G   + C   CP+GYYG  CQ  C C +GA C+  TG+C C  GF G +C   C    YG NC   C C +   C+PV G C C +   G  C +
Sbjct:   90 GYYENGDFCIPLCTEECMHGRC--VSPDTCHCEPGWGGPDCSSGCDSEHWGPHCSNRCQCQNGALCNPITGACVCAPGFRGWRCEELCAPGTHGKGCQLLCQCHHGASCDPRTGECLCAPGYTGVYCEELCPPGSHGAHCELRCPCQNGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPCHHGGQCDHVTGQCHCTAGYMGDRCQEECPFGTFGFLCSQRCDCHNGGQCSPATGACECEPGYKGPSCQERLCPEGLHGPGCTLPCPCDTENTISCHPVTGACTCQPGWSGHYCNESCPAGYYGNGCQLPCTCQNGADCHSITGSCTCAPGFMGEVCAVPCAAGTYGPNCSSVCSCSNGGTCSPVDGSCTCREGWQGLDCSL 477          

HSP 7 Score: 241.506 bits (615), Expect = 1.144e-64
Identity = 161/444 (36.26%), Postives = 213/444 (47.97%), Query Frame = 3
Query: 1659 RRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCD-CSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK--CEACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAV 2978
              CP G +G  C   C+ C +   C+     C C P + G +C + C        C  + C C NGGTC      C C  G  G  C + C  G +G NC + C  A +   C    G C C PGW G SC L CP GT+G+ CS+ C C+    +GCDP  G C C  G+ G+ C   C PG +G +CS SC  +    C+ E G C  +   G     CQR CP G  G  C + C  C  +   C   +GIC C PGF+G  C   C  G +G+ C   C C  +  C  + G C C     GK   +ACPSG WG  C   C C     C   +G C C  G+ G  C++RCP   +G+ C   CQC  G +CD I+G C C  G+ G  CE  C  G +G  C++ C+C+N  TCD     C C PG+ G  C+++  +
Sbjct:  391 ESCPAGYYGNGCQLPCT-CQNGADCHSITGSCTCAPGFMGEVCAVPCAAGTYGPNCSSV-CSCSNGGTCSPVDGSCTCREGWQGLDCSLPCPSGTWGLNCNETCICA-NGAACSPFDGSCACTPGWLGDSCELPCPDGTFGLNCSEHCDCSHA--DGCDPVTGHCCCLAGWTGIRCDSTCPPGRWGPNCSVSCSCENGGSCSPEDGSC--ECAPGFRGPLCQRICPPGFYGHGCAQPCPLCVHSRGPCHHISGICECLPGFSGALCNQVCAGGHFGQDCAQLCSCANNGTCSPIDGSCQCFPGWIGKDCSQACPSGFWGSACFHTCSCHNGASCSAEDGACHCTPGWTGLFCTQRCPSAFFGKDCGHICQCQNGASCDHITGKCTCRTGFSGRHCEQRCAPGTFGYGCQQLCECMNNATCDHVTGTCYCSPGFKGIRCDQAALM 827          

HSP 8 Score: 169.088 bits (427), Expect = 7.678e-42
Identity = 199/708 (28.11%), Postives = 286/708 (40.40%), Query Frame = 3
Query:  507 CQNGAFCYQSGYNAKCICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDL-------CKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICL-NVEGSF-------ICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQ--FCNSSPNKRAI---CSCLPGFKLEADGLTCS--DEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQ-NQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPT-ACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCA 2558
            C +GA C       +C+C  G+ G +C++                          CPPG     +G +C     C    T     C ++ G   C CPP          C P     + +    C HH  +   +   C C  G++ D+ +  C            C  +NGG     Q  P++    C+C PGY       + C +     +   GC   C  + E +         C C PGW   + ++SC         P  Y   GC     C +  +  +I   C+C PGF  E   + C+        +    C    TC    GS  CTC  G++     + C         +G  G  C  T     C+C NG      + +C       G S +     CP GTFG  C  +C +C H   C+     C C   ++G  C+  C        C  + C C+NGG+C  E   C C PG  G +C+  C  GF+G  C + CP    S   CH I+G C C PG+ G+ C+ +C  G +G  C++ CSC  N    C P +G C+C  G+ G +C   C  G++G  C  +C       C+ E G C      G   + C + CP+   G DC   C C +N  SC+   G C C  GF+G+ CE +C  G +G  CQ  C+C  +  CDHVTG CYC+
Sbjct:  190 CHHGASC--DPRTGECLCAPGYTGVYCEE-------------------------LCPPG----SHGAHCELRCPCQNGGT-----CHHITG--ECACPPGWTGAVCAQPCPPGTFGQNCSQDCPC-HHGGQCDHVTGQCHCTAGYMGDRCQEECPFGTFGFLCSQRCDCHNGG-----QCSPATGA--CECEPGYKGPSCQERLCPE----GLHGPGCTLPCPCDTENTISCHPVTGACTCQPGWSGHYCNESC---------PAGYYGNGCQLPCTCQNGADCHSITGSCTCAPGFMGEVCAVPCAAGTYGPNCSSVCSCSNGGTCSPVDGS--CTCREGWQGLDCSLPCP--------SGTWGLNCNET-----CICANGAACSPFDGSCACTPGWLGDSCELP---CPDGTFGLNCSEHC-DCSHADGCDPVTGHCCCLAGWTGIRCDSTCPPGRWGPNCS-VSCSCENGGSCSPEDGSCECAPGFRGPLCQRICPPGFYGHGCAQPCPLCVHSRGPCHHISGICECLPGFSGALCNQVCAGGHFGQDCAQLCSCANNGT--CSPIDGSCQCFPGWIGKDCSQACPSGFWGSACFHTCSCHNGASCSAEDGAC--HCTPGWTGLFCTQRCPSAFFGKDCGHICQC-QNGASCDHITGKCTCRTGFSGRHCEQRCAPGTFGYGCQQLCECMNNATCDHVTGTCYCS 813          

HSP 9 Score: 159.458 bits (402), Expect = 6.475e-39
Identity = 108/291 (37.11%), Postives = 147/291 (50.52%), Query Frame = 3
Query: 3141 QCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCE-IKNCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFR-CPNNFYGANCQHRCKC--FHNSPCNPVTGHCVCPKKLSGRFCEVS 4001
            +C++G    P+   C C  G  G  C   C  + +GP+C + C C+    C+  TG C C     G  CE +    +    C+  CQC    SC+  TG+C C PG  G  C ++C  G+ G  C+ +C C NG  C+ + G C C  G+TG +C Q C  G +G NC   C  C+    C   TGQC C AG +   C+ +CP G +G LC Q C C +G  C+P+TGAC+C  G+ G  CQ R CP   +G  C   C C   +   C+PVTG C C    SG +C  S
Sbjct:  105 ECMHGRCVSPDT--CHCEPGWGGPDCSSGCDSEHWGPHCSNRCQCQNGALCNPITGACVCAPGFRGWRCEELCAPGTHGKGCQLLCQCHHGASCDPRTGECLCAPGYTGVYCEELCPPGSHGAHCELRCPCQNGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDC-PCHHGGQCDHVTGQCHCTAGYMGDRCQEECPFGTFGFLCSQRCDCHNGGQCSPATGACECEPGYKGPSCQERLCPEGLHGPGCTLPCPCDTENTISCHPVTGACTCQPGWSGHYCNES 392          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Mouse
Match: Megf11 (multiple EGF-like-domains 11 [Source:MGI Symbol;Acc:MGI:1920951])

HSP 1 Score: 432.18 bits (1110), Expect = 1.213e-130
Identity = 282/710 (39.72%), Postives = 352/710 (49.58%), Query Frame = 3
Query: 1929 CTEGFF--GENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFG-KC-EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKR-CPEGLYGEGCSKECQCIYGN---CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKES-DCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKC-RCANGE-PCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVSVINRLKLS 4025
            C  G++  G+ C   C   C   RC      C C PGW G  C   C +  WG  CS  C C   N   C+P  G C C  G+ G  C   C PG  G  C   C       C+  TG+C      G   + C+  CP G  G+ C   C C +N  +C    G C C PG+TG  C   C  G +G+ C   C C     CDHVTG C+C     G +C E CP G +G  C+Q CDC     C    G C C  GY GP C +R CPEGL+G GC+  C C   N   C P++G C C PGW G  C   C  GYYG+ C+  C C NG  C      C C PG+ GE C   CA G YG NC   C C NGG C  + G C C  GW+G++C   CPS T+G NCN+ C C NG  C P +G C C  G  GD CEL CP   +G NC  +C C   + CD  TG C C     G+ C+      +   +C   C C    SC+   G C+C PG RGP C ++C  G +G  C Q C  C +   PC+ + G C CL GF+G LC+QVCA G +G +C   C  C  N TC P  G C C  G I  DC   CPS ++G  C   CQC +GASC+  TG C C +GF G  C+ RC    +G  CQ  C+C +N+ C+ VTG C C     G  C+ + +   +L+
Sbjct:   87 CCPGYYENGDFCIPLCTEECMHGRCVS-PDTCHCEPGWGGPDCSSGCDSEHWGPHCSNRCQCQ--NGALCNPITGACVCAPGFRGWRCEELCAPGTHGKGCQLLCQCHHGASCDPRTGEC--LCAPGYTGVYCEELCPPGSHGAHCELRCPC-QNGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPCHHGGQCDHVTGQCHCTAGYMGDRCQEECPFGTFGFLCSQRCDCHNGGQCSPATGACECEPGYKGPSCQERLCPEGLHGPGCTLPCPCDTENTISCHPVTGACTCQPGWSGHYCNESCPAGYYGNGCQLPCTCQNGADCHSITGSCTCAPGFMGEVCAVPCAAGTYGPNCSSVCSCSNGGTCSPVDGSCTCREGWQGLDCSLPCPSGTWGLNCNETCICANGAACSPFDGSCACTPGWLGDSCELPCPDGTFGLNCSEHCDCSHADGCDPVTGHCCCLAGWTGIRCDSTCPPGRWGPNCSVSCSCENGGSCSPEDGSCECAPGFRGPLCQRICPPGFYGHGCAQPCPLCVHSRGPCHHISGICECLPGFSGALCNQVCAGGHFGQDCAQLC-SCANNGTCSPIDGSCQCFPGWIGKDCSQGCPSAFFGKDCGHICQCQNGASCDHITGKCTCRTGFSGRHCEQRCAPGTFGYGCQQLCECMNNATCDHVTGTCYCSPGFKGIRCDQAALMMDELN 789          

HSP 2 Score: 352.829 bits (904), Expect = 4.255e-102
Identity = 236/616 (38.31%), Postives = 310/616 (50.32%), Query Frame = 3
Query: 1665 CPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYK-CDPGYFGLDCSFSCPEDCKTI--CNHETGQCPDKTCQ-GNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK--CEACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN-CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQ--CHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIK-NCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQM 3482
            C  GT G+ C   C  C H   C+     CLC P Y+G  CE  C        C+ L+C C+NGGTC   T +C CPPG +G +C   C  G FG+NC ++CP      +C  +TG+C C  G+ G  C   CP GT+G  CS+ C C  +N   C P  G C+C+ GY G +C  + C  G  G  C+  CP D +    C+  TG C   TCQ G +   C   CP G  G+ C+  C C +N   C    G C CAPGF G+ C + C  G YG  C S C C     C  V G C C +   G      CPSG WG  CN+ C C     C   +G C C  G+ G  C   CP+G +G  CS+ C C + + CDP++G C C  GW G  C++ C  G +G  C   C C NGG+C      C+C PG+ G  C++ C  G+YG  C   C    H+ G C  ISG C+C+PG+ G  C++ C    +G +C Q+C C N G C P +G CQC  G  G  C   CP   +G +C H C C+    CD  TG+CTC     G  CE +    +    C+Q C+C    +C+ VTG C C PG +G +C Q 
Sbjct:  175 CAPGTHGKGCQLLC-QCHHGASCDPRTGECLCAPGYTGVYCEELCPPGSHGAHCE-LRCPCQNGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPCH-HGGQCDHVTGQCHCTAGYMGDRCQEECPFGTFGFLCSQRCDC--HNGGQCSPATGACECEPGYKGPSCQERLCPEGLHGPGCTLPCPCDTENTISCHPVTGAC---TCQPGWSGHYCNESCPAGYYGNGCQLPCTC-QNGADCHSITGSCTCAPGFMGEVCAVPCAAGTYGPNCSSVCSCSNGGTCSPVDGSCTCREGWQGLDCSLPCPSGTWGLNCNETCICANGAACSPFDGSCACTPGWLGDSCELPCPDGTFGLNCSEHCDCSHADGCDPVTGHCCCLAGWTGIRCDSTCPPGRWGPNCSVSCSCENGGSCSPEDGSCECAPGFRGPLCQRICPPGFYGHGCAQPCPLCVHSRGPCHHISGICECLPGFSGALCNQVCAGGHFGQDCAQLCSCANNGTCSPIDGSCQCFPGWIGKDCSQGCPSAFFGKDCGHICQCQNGASCDHITGKCTCRTGFSGRHCEQRCAPGTFGYGCQQLCECMNNATCDHVTGTCYCSPGFKGIRCDQA 781          

HSP 3 Score: 229.565 bits (584), Expect = 6.701e-61
Identity = 232/715 (32.45%), Postives = 306/715 (42.80%), Query Frame = 3
Query: 1005 CSHLCQSDPSSSVITCKCRPGY-AIDVNDVKQCKDI-----NECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCN-----SSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKH--------KCVPPSTCINDLGSYLCTCPVGYRLR---------------KNKMTCEDIDECLDYTGGC-------GYKC-----VNTDG---SYRCVCPNGETLGKDNKTCQ-NQNTRGSSLQKDPRRCPKGTFGEECLFNCS-NCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSS-NRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQ-CRKDR-LCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAV 2978
            C+  C      S  TC C PG+   D +     +       N C  +NG    +C  + G+  C C PG++        ++ + EL  P  +G  GC   C      S   +   C C PG+     G+ C  E+ C  G H         C    TC +  G   C CP G+                       C    +C   TG C       G +C       T G   S RC C NG         C+     +G S Q+  R CP+G  G  C   C  +  +   C+     C C P +SG  C   C        CQ L C C+NG  C S T  C C PG  GE+C + C  G +G NC   C  +CS+   C  + G C C  GW G  C L CP+GTWG+ C++TC C   N   C P +G C C  G+ G +C   C  G FGL+CS  C       C+  TG C      G   I C   CP G  G +C  +C C EN  SC  ++G C CAPGF G  C+  C  G YG  C   C  C   R  C H++GIC C     G    + C  G +G  C Q C C  +  C  I+G C C  G+ G  CS+ CP   +G+ C   CQC  G +CD I+G C C  G+ G  CE  C  G +G  C++ C+C+N  TCD     C C PG+ G  C+++  +
Sbjct:  102 CTEECMHGRCVSPDTCHCEPGWGGPDCSSGCDSEHWGPHCSNRCQCQNGA---LCNPITGA--CVCAPGFRG-------WRCE-ELCAPGTHGK-GCQLLCQCHHGASCDPRTGECLCAPGYT----GVYC--EELCPPGSHGAHCELRCPCQNGGTCHHITGE--CACPPGWTGAVCAQPCPPGTFGQNCSQDCPCHHGGQCDHVTGQCHCTAGYMGDRCQEECPFGTFGFLCSQRCDCHNGGQCSPATGACECEPGYKGPSCQE--RLCPEGLHGPGCTLPCPCDTENTISCHPVTGACTCQPGWSGHYCNESCPAGYYGNGCQ-LPCTCQNGADCHSITGSCTCAPGFMGEVCAVPCAAGTYGPNCSSVC--SCSNGGTCSPVDGSCTCREGWQGLDCSLPCPSGTWGLNCNETCIC--ANGAACSPFDGSCACTPGWLGDSCELPCPDGTFGLNCSEHCDCSHADGCDPVTGHC--CCLAGWTGIRCDSTCPPGRWGPNCSVSCSC-ENGGSCSPEDGSCECAPGFRGPLCQRICPPGFYGHGCAQPCPLCVHSRGPCHHISGICECLPGFSGALCNQVCAGGHFGQDCAQLCSCANNGTCSPIDGSCQCFPGWIGKDCSQGCPSAFFGKDCGHICQCQNGASCDHITGKCTCRTGFSGRHCEQRCAPGTFGYGCQQLCECMNNATCDHVTGTCYCSPGFKGIRCDQAALM 784          

HSP 4 Score: 146.747 bits (369), Expect = 5.932e-35
Identity = 221/850 (26.00%), Postives = 326/850 (38.35%), Query Frame = 3
Query:  141 MRFAIIFFLTIQIIPKLSGAGSQKLELGMPNVCEVEQRQMIRVRRTVEVPRSKEVKVWKANCRFKGDWCLVHENKSFVEKTETSQIQMVPSIKYECCEGYAELSGYRGCIPK------------------------PNCE-----ERIGKYC------QNGAFCYQSGYNAKCICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGF------YCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGF------RCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDL-------CKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICL-NVEGSF-------ICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQ--FCNSSPNKRAI---CSCLPGFKLEA---------DGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQ-NQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPT-ACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCE 2456
            M  + +  L   +   L+      L    PNVC   +   + V+ +   P  +   ++   C    +W     ++   +      ++ +   + +CC GY E   +  CIP                         P+C      E  G +C      QNGA C  +     C+C  GF G  C+ +L     +  GC+  C    G         C C PGY     G  C ++     +   C   C    GG        C CPP          C P     + +    C HH  +   +   C C  G++ D+ +  C            C  +NGG     Q  P++    C+C PGY       + C +     +   GC   C  + E +         C C PGW   + ++SC         P  Y   GC     C +  +  +I   C+C PGF  E           G  CS    C  G        TC    GS  CTC  G++     + C         +G  G  C  T     C+C NG      + +C       G S +     CP GTFG  C  +C +C H   C+     C C   ++G  C+  C        C  + C C+NGG+C  E   C C PG  G +C+  C  GF+G  C + CP    S   CH I+G C C PG+ G+ C+ +C  G +G  C++ CSC  N    C P +G C+C  G+ G +C   C   +FG DC   C       C+H TG+C  +T  G +   C++ C  G  G  C++ C+C  N+ +C+   G C+C+PGF G RC+
Sbjct:    1 MAPSAVGLLVFLLQAALA------LNPEDPNVCSHWESYAVTVQESYAHPFDQ---IYYTRCADILNWFKCTRHRISYKTAYRRGLRTMYRRRSQCCPGYYENGDF--CIPLCTEECMHGRCVSPDTCHCEPGWGGPDCSSGCDSEHWGPHCSNRCQCQNGALC--NPITGACVCAPGFRGWRCE-ELCAPGTHGKGCQLLCQCHHGASCDPRTGECLCAPGY----TGVYCEELCPPGSHGAHCELRCPCQNGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPC-HHGGQCDHVTGQCHCTAGYMGDRCQEECPFGTFGFLCSQRCDCHNGG-----QCSPATGA--CECEPGYKGPSCQERLCPE----GLHGPGCTLPCPCDTENTISCHPVTGACTCQPGWSGHYCNESC---------PAGYYGNGCQLPCTCQNGADCHSITGSCTCAPGFMGEVCAVPCAAGTYGPNCSSVCSCSNG-------GTCSPVDGS--CTCREGWQGLDCSLPCP--------SGTWGLNCNET-----CICANGAACSPFDGSCACTPGWLGDSCELP---CPDGTFGLNCSEHC-DCSHADGCDPVTGHCCCLAGWTGIRCDSTCPPGRWGPNCS-VSCSCENGGSCSPEDGSCECAPGFRGPLCQRICPPGFYGHGCAQPCPLCVHSRGPCHHISGICECLPGFSGALCNQVCAGGHFGQDCAQLCSCANNGT--CSPIDGSCQCFPGWIGKDCSQGCPSAFFGKDCGHICQCQNGASCDHITGKCTCRT--GFSGRHCEQRCAPGTFGYGCQQLCECM-NNATCDHVTGTCYCSPGFKGIRCD 779          
BLAST of Multiple epidermal growth factor domains protein 6 vs. UniProt/SwissProt
Match: sp|O88281|MEGF6_RAT (Multiple epidermal growth factor-like domains protein 6 OS=Rattus norvegicus OX=10116 GN=Megf6 PE=1 SV=1)

HSP 1 Score: 748.429 bits (1931), Expect = 0.000e+0
Identity = 483/1355 (35.65%), Postives = 650/1355 (47.97%), Query Frame = 3
Query:  207 QKLELGMPNVCEVEQRQMIRVRRTVEVPRSKEVKVWKANCRFKGDWCLVHENKSFVEKTETSQIQMVPSIKYECCEGYAELSGYRGCIPKPNCEERIGKYCQNGAFCYQSGYNAKCICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQN--------------------------------------------TRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCS------------------------------------------ENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTG-CDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN-CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKE--SDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCE 3995
            + L+  MP+VC  ++  ++  R+      S+ V VW+     +  WC+  E ++    +            + CC G+++  G  GC+                                         D++EC   NGGCE  CCN  GGFYC+CPPGY++  +GK C D++EC  +   C H CVN PG + C+C P   L  D   C+  I  C   N GGC H CV+L+  +  C C   + L +D R C     C + NGGC H+CQ      +  C C PGY +   D K C+D++EC +    C H CLN +GSF C CH G+++G D + CY+++ME+ + C+ GNGGC+  C+ + +   +C+C  G++L+ D  TC D D+C            C N  G Y C+C  GYRL  +   CED+DEC    GGC + C N  GS++C C  G  L +D + C +                                               RG     +   C   +FG +C   C +C + G C   Q GC C   ++G IC   C  +     C    C C+NGGTC+     C CPPG+SG  CE GC +GF+G++C K C  A +  RCH++ G CLC PG YG  CHL CP   +G GCS+ C C Q++   C+PK+G C CK G+ G  C  +C+ G+FG  C   C       C+  +G+C  +   G     C ++CP G  G +C  +C C                                           E+  SC  + G C C PGF G RC+  C+ G YG  CQ  C C  D  CD  TG C CA    G     AC SG WGP C   C+C+   G CD ++G C+C AGY GP+C + C +G YG  C ++C+C +G  CD +SG C C  GW G  CE+ C  G++G  C   C C  G  CD     C C  G  G  C +SC    +G NC   C C NG  CD ++G+C C PGW G  C + CP   YG NC   C C NGG+C P  G C CP G  G  CE  C P  Y   C  NC C     CD  TG C CP    G  C+  +C S      C + C C    SC+ VTG C C PG RGP C Q C  G FG  C Q+C C     C+ V G C C  GFTG+ C+Q C  G +G +C+  C        C P +G C+C AG     C  +CPSG YGP C+  C+C++G +C+P+TGAC C +GF GA C   CP   +G +C H C C   + C+PV+G C+C    +G  CE
Sbjct:   34 RPLQPSMPHVCAEQKLTLVGHRQPCVQAFSRIVPVWRRTGCAQQAWCIGQERRTVYYMSYRQVYATEARTVFRCCPGWSQKPGQEGCL----------------------------------------SDVDECASANGGCEGPCCNTVGGFYCRCPPGYQLQGDGKTCQDVDECRAHNGGCQHRCVNTPGSYLCECKPGFRLHTDGRTCL-AISSCTLGN-GGCQHQCVQLTVTQHRCQCRPQYQLQEDGRRCVRRSPCAEGNGGCMHICQE--LRGLAHCGCHPGYQL-AADRKTCEDVDECALGLAQCAHGCLNTQGSFKCVCHAGYELGADGRQCYRIEMEIVNSCEAGNGGCSHGCSHT-STGPLCTCPRGYELDEDQKTCIDIDDCANSP---CCQQACANTPGGYECSCFAGYRLNTDGCGCEDVDECASGHGGCEHHCSNLAGSFQCFCEAGYRLDEDRRGCTSLEESVVDLDGRLPFVRPLPHIAVLRDELPRLFQDDYGAEEEAAAAELRGEHTLTEKFVCLDHSFGHDCSLTCDDCRNGGTCFPGQDGCDCPEGWTGIICNETCPPDTFGKNCSS-PCTCQNGGTCDPVLGACRCPPGVSGAHCEDGCPKGFYGKHCRKKCHCA-NRGRCHRLYGACLCDPGLYGRFCHLACPPWAFGPGCSEDCLCEQSHTRSCNPKDGSCSCKAGFQGERCQAECESGFFGPGCRHRCTCQPGVACDPVSGECRTQCPPGYQGEDCGQECPVGTFGVNCSGSCSCVGAPCHRVTGECLCPPGKTGEDCGADCPEGRWGLGCQEICPACEHGASCNPETGTCLCLPGFVGSRCQDTCSAGWYGTGCQIRCACANDGHCDPTTGRCSCAPGWTGLSCQRACDSGHWGPDCIHPCNCSAGHGNCDAVSGLCLCEAGYEGPRCEQSCRQGYYGPSCEQKCRCEHGAACDHVSGACTCPAGWRGSFCEHACPAGFFGLDCDSACNCSAGAPCDAVTGSCICPAGRWGPRCAQSCPPLTFGLNCSQICTCFNGASCDSVTGQCHCAPGWMGPTCLQACPPGLYGKNCQHSCLCRNGGRCDPILGQCTCPEGWTGLACENECLPGHYAAGCQLNCSCLHGGICDRLTGHCLCPAGWTGDKCQ-SSCVSGTFGVHCEEHCACRKGASCHHVTGACFCPPGWRGPHCEQACPRGWFGEACAQRCLCPTNASCHHVTGECRCPPGFTGLSCEQACQPGTFGKDCEHLCQCPGETWACDPASGVCTCAAGYHGTGCLQRCPSGRYGPGCEHICKCLNGGTCDPATGACYCPAGFLGADCSLACPQGRFGPSCAHVCACRQGAACDPVSGACICSPGKTGVRCE 1336          

HSP 2 Score: 573.933 bits (1478), Expect = 6.903e-178
Identity = 411/1222 (33.63%), Postives = 566/1222 (46.32%), Query Frame = 3
Query:  648 IDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINC----IPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTC-EDIDECLDYTGGCGYKCVNT--------DGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEI-------------DCLQNPS-----------------------QVECQP--------LQCHCKNGGTCESETLKC--NCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK-CE-ACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIK-NCDSKESDCRQDCQCSIKK-SCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCL--------------VCNRNKT----------------------------CHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCE 3995
            + G  +C C PGY+++ + K C D++EC      C+H C+N  G F+C C     LG D   C    +  ++ C++ N GGC+H C   S    +C+CP G+ LD+D+++C  +D C  N+  C   C + P      C C  GY ++ +    C+D++EC   +GGC+H C N+ GSF C C  G+++  D + C  ++  + D       G   F    P+   +   LP    +  G         + G+H       C++   S+   C +     +N  TC    D C    G  G  C  T        + S  C C NG T       C+       +  +D   CPKG +G+ C   C +C ++G C+     CLC P   G  C +             DCL   S                       Q EC+          +C C+ G  C+  + +C   CPPG  GE C   C  G FG NC  +C  +C    CH++TG+CLC PG  G  C   CP G WG+GC + C   ++    C+P+ G C C  G+ G  C   C  G++G  C   C       C+  TG+C      G   + CQR C +G  G DC   C+CS    +C+  +G+C C  G+ G RCE  C +G YG  C+  C+C     CDHV+G C C     G  CE ACP+G +G  C+  C+C+    CD + G CIC AG +GP+C++ CP   +G  CS+ C C  G +CD ++G C C PGW G  C   C  G YG  C+  C C NGG CD    +C C  GW G  CE  C  G+Y   C+  C C +GG+CD ++G C C  GW G  C   C S T+G +C + C C  G  CH   G C CP G  G  CE  CP   +G  C   C+C     C   TGEC CP    GLSCE      +   DC   CQC  +  +C+  +G C C  G  G  CLQ C  G +G  C+  C+C NG  C+P  G C C +GF G  C   C +G +GP+C   C               +C+  KT                            CH   G CSC  G +   C+  CP+G YG  C   C C +  SC P+TGAC C  GFYG  C+  CP+ F+G  CQ  C+C   +PC+PV+G C+CP    G+FCE
Sbjct:  265 LRGLAHCGCHPGYQLAADRKTCEDVDECALGLAQCAHGCLNTQGSFKCVCHAGYELGADGRQCYRIEMEIVNSCEAGN-GGCSHGCSHTSTGP-LCTCPRGYELDEDQKTCIDIDDCA-NSPCCQQACANTPGG--YECSCFAGYRLNTDGCG-CEDVDECASGHGGCEHHCSNLAGSFQCFCEAGYRLDEDRRGCTSLEESVVD-----LDGRLPFVRPLPHIAVLRDELPRLFQDDYGAEEEAAAAELRGEHTLTEKFVCLDH--SFGHDCSLTCDDCRNGGTCFPGQDGCDCPEGWTGIICNETCPPDTFGKNCSSPCTCQNGGTCDPVLGACRCPPGVSGAHCED--GCPKGFYGKHCRKKC-HCANRGRCHRLYGACLCDPGLYGRFCHLACPPWAFGPGCSEDCLCEQSHTRSCNPKDGSCSCKAGFQGERCQAECESGFFGPGCRHRCTCQPGVACDPVSGECRTQCPPGYQGEDCGQECPVGTFGVNCSGSC--SCVGAPCHRVTGECLCPPGKTGEDCGADCPEGRWGLGCQEICPACEHGAS-CNPETGTCLCLPGFVGSRCQDTCSAGWYGTGCQIRCACANDGHCDPTTGRC--SCAPGWTGLSCQRACDSGHWGPDCIHPCNCSAGHGNCDAVSGLCLCEAGYEGPRCEQSCRQGYYGPSCEQKCRCEHGAACDHVSGACTCPAGWRGSFCEHACPAGFFGLDCDSACNCSAGAPCDAVTGSCICPAGRWGPRCAQSCPPLTFGLNCSQICTCFNGASCDSVTGQCHCAPGWMGPTCLQACPPGLYGKNCQHSCLCRNGGRCDPILGQCTCPEGWTGLACENECLPGHYAAGCQLNCSCLHGGICDRLTGHCLCPAGWTGDKCQSSCVSGTFGVHCEEHCACRKGASCHHVTGACFCPPGWRGPHCEQACPRGWFGEACAQRCLCPTNASCHHVTGECRCPPGFTGLSCEQACQPGTFGKDCEHLCQCPGETWACDPASGVCTCAAGYHGTGCLQRCPSGRYGPGCEHICKCLNGGTCDPATGACYCPAGFLGADCSLACPQGRFGPSCAHVCACRQGAACDPVSGACICSPGKTGVRCEHGCPQDRFGKGCELKCACRNGGLCHATNGSCSCPLGWMGPHCEHACPAGRYGAACLLECFCQNNGSCEPTTGACLCGPGFYGQACEHSCPSGFHGPGCQRVCECQQGAPCDPVSGQCLCPAGFHGQFCE 1465          

HSP 3 Score: 458.373 bits (1178), Expect = 1.220e-135
Identity = 321/908 (35.35%), Postives = 418/908 (46.04%), Query Frame = 3
Query: 1305 KRAICSCLPGFKLEADGLTCSDEDECVTGKHKCV--PPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGC---GYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFG-KCE-ACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCH-NGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNC--DSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCE 3995
            K   CSC  GF+ E     C         +H+C   P   C    G     CP GY+       C      ++ +G C   G  C    G   C+CP G+T              G     D   CP+G +G  C   C  C H   CN +   CLC P + G+ C+  C        CQ ++C C N G C+  T +C+C PG +G  C+  C  G +G +C   C  +     C  ++G CLC  G+ G  C   C  G +G  C + C C       CD  +G C C  G+ G  C + C  G+FGLDC  +C       C+  TG C      G     C + CP    G +C + C C  N  SC+   G CHCAPG+ G  C   C  GLYG+ CQ SC CR    CD + G C C +   G  CE  C  G +   C  NC C +   CD++ G C+C AG+ G KC   C  G +G  C + C C  G +C  ++G C C PGW G  CE  C  G++G+ C ++C C    +C     +C+C PG+ G  CE++C  G +G++CE  CQC      CD  SG C C  G+ G  C +RCPS  YGP C  +C+CLNGG C P  G C CPAG  G  C L CP  ++GP+C H C C+    CD  +G C C     G+ CE   C  D     C   C C     C+   G C C  G  GP C   C  G +G  C  +C C N   C P  G CLC  GF G  C+  C  G++GP C+  C  C +   C P +GQC C AG     C+  C SG +G  C Q C C  G  C+P +G C C  G  GA C   C    +G  C  RC C   + C+P++G C C     G  C 
Sbjct:  671 KDGSCSCKAGFQGERCQAECESGFFGPGCRHRCTCQPGVACDPVSGECRTQCPPGYQGEDCGQECPVGTFGVNCSGSCSCVGAPCHRVTG--ECLCPPGKT--------------GEDCGAD---CPEGRWGLGCQEICPACEHGASCNPETGTCLCLPGFVGSRCQDTCSAGWYGTGCQ-IRCACANDGHCDPTTGRCSCAPGWTGLSCQRACDSGHWGPDCIHPCNCSAGHGNCDAVSGLCLCEAGYEGPRCEQSCRQGYYGPSCEQKCRCEHG--AACDHVSGACTCPAGWRGSFCEHACPAGFFGLDCDSACNCSAGAPCDAVTGSCICPA--GRWGPRCAQSCPPLTFGLNCSQICTCF-NGASCDSVTGQCHCAPGWMGPTCLQACPPGLYGKNCQHSCLCRNGGRCDPILGQCTCPEGWTGLACENECLPGHYAAGCQLNCSCLHGGICDRLTGHCLCPAGWTGDKCQSSCVSGTFGVHCEEHCACRKGASCHHVTGACFCPPGWRGPHCEQACPRGWFGEACAQRCLCPTNASCHHVTGECRCPPGFTGLSCEQACQPGTFGKDCEHLCQCPGETWACDPASGVCTCAAGYHGTGCLQRCPSGRYGPGCEHICKCLNGGTCDPATGACYCPAGFLGADCSLACPQGRFGPSCAHVCACRQGAACDPVSGACICSPGKTGVRCE-HGCPQDRFGKGCELKCACRNGGLCHATNGSCSCPLGWMGPHCEHACPAGRYGAACLLECFCQNNGSCEPTTGACLCGPGFYGQACEHSCPSGFHGPGCQRVC-ECQQGAPCDPVSGQCLCPAGFHGQFCEKGCESGSFGDGCLQQCNCHTGVPCDPISGLCLCPPGRTGAACDLDCRRGRFGPGCALRCDCGGGADCDPISGQCHCVDSYMGPTCR 1551          

HSP 4 Score: 333.183 bits (853), Expect = 2.024e-92
Identity = 228/627 (36.36%), Postives = 302/627 (48.17%), Query Frame = 3
Query: 2163 KGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDC--TYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICR--CNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRC-QCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATE-KCDLKTGECTCPKSAFGLSCEIKNCDSKE--SDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVSVIN 4010
            +G H +   + C    FG DCS +C +DC+       GQ      +G   I C   CP    G +C   C C +N  +C+   G C C PG +G  CE  C KG YG+ C+  C C     C  + G C C    +G+    ACP   +GP C+++C C  +++  C+  +G C C AG+ G +C   C  G +G GC   C C  G  CDP+SG CR  C PG+ GE C   C  G +G  C   C C+ G  C     +C C PG  GE C   C  G +G  C+  C  C +G  C+  +G C C+PG+ G  C + C +  YG  C   C C N G C P  G C C  G  G  C+  C    +GP+C+H C C A    CD  +G C C     G  CE ++C        C Q C+C    +C+ V+G C C  G RG  C   C  G FGLDC   C C+ G PC+ V G+C+C +G  G  C Q C    +G NC   C  C    +C   TGQC C  G +   C   CP G YG  CQ +C C +G  C+P  G C C  G+ G  C+  C    Y A CQ  C C H   C+ +TGHC+CP   +G  C+ S ++
Sbjct:  504 RGEHTLTEKFVCLDHSFGHDCSLTC-DDCRNGGTCFPGQDGCDCPEGWTGIICNETCPPDTFGKNCSSPCTC-QNGGTCDPVLGACRCPPGVSGAHCEDGCPKGFYGKHCRKKCHCANRGRCHRLYGACLCDPGLYGRFCHLACPPWAFGPGCSEDCLCEQSHTRSCNPKDGSCSCKAGFQGERCQAECESGFFGPGCRHRCTCQPGVACDPVSGECRTQCPPGYQGEDCGQECPVGTFGVNCSGSCSCV-GAPCHRVTGECLCPPGKTGEDCGADCPEGRWGLGCQEICPACEHGASCNPETGTCLCLPGFVGSRCQDTCSAGWYGTGCQIRCACANDGHCDPTTGRCSCAPGWTGLSCQRACDSGHWGPDCIHPCNCSAGHGNCDAVSGLCLCEAGYEGPRCE-QSCRQGYYGPSCEQKCRCEHGAACDHVSGACTCPAGWRGSFCEHACPAGFFGLDCDSACNCSAGAPCDAVTGSCICPAGRWGPRCAQSCPPLTFGLNCSQIC-TCFNGASCDSVTGQCHCAPGWMGPTCLQACPPGLYGKNCQHSCLCRNGGRCDPILGQCTCPEGWTGLACENECLPGHYAAGCQLNCSCLHGGICDRLTGHCLCPAGWTGDKCQSSCVS 1125          
BLAST of Multiple epidermal growth factor domains protein 6 vs. UniProt/SwissProt
Match: sp|Q80V70|MEGF6_MOUSE (Multiple epidermal growth factor-like domains protein 6 OS=Mus musculus OX=10090 GN=Megf6 PE=2 SV=3)

HSP 1 Score: 748.429 bits (1931), Expect = 0.000e+0
Identity = 481/1379 (34.88%), Postives = 650/1379 (47.14%), Query Frame = 3
Query:  132 KYEMRFAIIFFLTIQIIPKLSGAGSQKLEL-GMPNVCEVEQRQMIRVRRTVEVPRSKEVKVWKANCRFKGDWCLVHENKSFVEKTETSQIQMVPSIKYECCEGYAELSGYRGCIPKPNCEERIGKYCQNGAFCYQSGYNAKCICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQN-------------------------------------------QNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCS------------------------------------------ENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTG-CDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKES-DCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCE 3995
            +   R   +  L +  +P  S     +     MP+VC  ++  ++  R+      S+ V VW++ C  +  WC+  E ++    +            + CC G+++  G  GC+   +        C N         N  C  P                         CCN  GGFYC+CPPGY++  +GK C D++EC  +   C H CVN PG + C+C P   L  D   C+  I  C   N GGC H CV+L+  +  C C   + L +D R C     C D NGGC H CQ      +  C C PGY +   D K C+D++EC +    C H CLN +GSF C CH G+++G D + CY+++ME+ + C+ GNGGC+  C+ + +   +C+C  G++L+ D  TC D D+C            C N  G Y C+C  GYRL  +   CED+DEC     GC + C N  GS++C C  G  L +D + C                                                RG     +   C   +FG +C   C +C + G C     GC C   ++G IC   C  +     C    C C+NGGTC+  +  C CPPG+SG  CE GC +GF+G++C K C  A +  RCH++ G CLC PG YG  CHL CP   +G GCS+ C C Q++   C+ K+G C CK G+ G  C  +C+PG FG  C   C       C+  +G+C  +   G     C ++CP G  G +C  +C C                                           E+  SC+ + G C C PGF G RC+  C  G +G  CQ  C C  D  C   TG C CA    G     AC SG WGP C   C+C+   G CD ++G C+C AGY GP+C + C +G +G GC ++C+C +G  CD +SG C C  GW G  CE+ C  G++G  C   C C  G  CD     C C  G  G  C ++C    +G NC   C C NG  CD + G+C C PGW G  C + CP+  YG NC   C C NGG C P  G C CP G  G  CE  C P  +G  C  NC C     CD  TG C CP    G  C+           C + C C    +C+ VTG C C PG RG  C Q C  G FG  C Q+C C  G  C+ V G C C  GFTG  C+Q C  G +G +C+  C        CHP +G C C AG    DC+ +CPSG YGP C+Q C+C++G +C+P+TGAC C +GF GA C   CP   +G +C H C C   + C+PV+G C+CP   +G  CE
Sbjct:    8 RASWRVVALTLLLLPAVPAASQPLPPRPLQPSMPHVCAEQKLTLVGHRQPCVQAFSRVVPVWRSGCGQQA-WCVGQERRTVYYMSYRQVYATEARTVFRCCPGWSQKPGQEGCLSDVD-------ECANA--------NGGCEGP-------------------------CCNTVGGFYCRCPPGYQLQGDGKTCQDVDECRSHNGGCQHRCVNTPGSYLCECKPGFRLHTDGRTCL-AISSCTLGN-GGCQHQCVQLTVTQHRCQCRPQYQLQEDGRRCVRRSPCADGNGGCMHTCQE--LRGLAHCGCHPGYQL-AADRKACEDVDECALGLAQCAHGCLNTQGSFKCVCHAGYELGADGRQCYRIEMEIVNSCEAGNGGCSHGCSHT-STGPLCTCPRGYELDEDQKTCIDIDDCANSP---CCQQVCANTPGGYECSCFAGYRLNTDGCGCEDVDECASGHSGCEHHCSNLAGSFQCFCEAGYRLDEDRRGCTPLEESVVDLDGQLPFVRPLPHIAVLGDELPQLFQDDYGAEEEAVAELRGEHTLTEKFVCLDHSFGHDCSLTCDDCRNGGTCFPGLDGCDCPEGWTGIICNETCPPDTFGKNCSS-PCICQNGGTCDPVSGACRCPPGVSGAHCEDGCPKGFYGKHCRKKCHCA-NRGRCHRLYGACLCDPGLYGRFCHLACPPWAFGPGCSEDCLCEQSHTRSCNSKDGSCSCKAGFQGERCEAECEPGSFGPGCRNRCTCRPGVACDPVSGECRTQCPPGYQGEDCGQECPVGTFGVNCSGSCSCVGAPCHRVTGECLCPPGKTGEDCGADCPEGRWGLGCQEICPACEHGASCDPETGTCLCLPGFVGSRCQDACPAGWFGTGCQMRCACANDGHCHPATGRCSCAPGWTGLSCQRACDSGHWGPDCIHPCNCSAGHGNCDAVSGLCLCEAGYEGPQCEQWCRQGYFGPGCEQKCRCEHGATCDHVSGACTCPAGWRGSFCEHACPAGFFGLDCGSACNCSAGAPCDAVTGSCICPAGRWGPHCAQTCPPLTFGLNCSQICTCFNGASCDPVLGQCHCAPGWMGPTCLQACPAGLYGKNCQHSCLCRNGGSCDPILGQCTCPEGWTGLACENECLPGHHGAGCRLNCSCLNGGTCDRLTGHCRCPAGWTGDKCQSPCVSGMFGVHCEEHCACRKGATCHHVTGACLCPPGWRGSHCEQACPRGWFGEACAQRCHCPPGASCHHVSGECHCPPGFTGPGCEQACQPGTFGKDCEHPCQCPGETWACHPASGACVCAAGYHGTDCQQRCPSGRYGPGCEQICKCLNGGTCDPATGACYCPAGFLGADCSLACPQGRFGPSCAHVCTCGQGAACDPVSGTCICPPGKTGGHCE 1334          

HSP 2 Score: 571.237 bits (1471), Expect = 5.712e-177
Identity = 414/1228 (33.71%), Postives = 570/1228 (46.42%), Query Frame = 3
Query:  648 IDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINC----IPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVT---GKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTC-EDIDECLDYTGGCGYKCVNT--------DGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEI-------------DCLQNPS-----------------------QVECQPL--------QCHCKNGGTCESETLKC--NCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCA---------------------------------DVAFGKCEACPSGKWGP-------------TCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKA-TEKCDLKTGECTCPKSAFGLSCEIKNCDSKE--SDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCE 3995
            + G  +C C PGY+++ + K C D++EC      C+H C+N  G F+C C     LG D   C    +  ++ C++ N GGC+H C   S    +C+CP G+ LD+D+++C  +D C  N+  C  +C + P      C C  GY ++ +    C+D++EC   + GC+H C N+ GSF C C  G+++  D + C  ++  + D       G   F    P+   +   LP    +  G     E+E V    G+H       C++   S+   C +     +N  TC   +D C    G  G  C  T        + S  C+C NG T    +  C+       +  +D   CPKG +G+ C   C +C ++G C+     CLC P   G  C +             DCL   S                       + EC+P         +C C+ G  C+  + +C   CPPG  GE C   C  G FG NC  +C  +C    CH++TG+CLC PG  G  C   CP G WG+GC + C   ++    CDP+ G C C  G+ G  C   C  G+FG  C   C       C+  TG+C      G   + CQR C +G  G DC   C+CS    +C+  +G+C C  G+ G +CE  C +G +G  C+  C+C     CDHV+G C C                                  D   G C  CP+G+WGP              C+Q C C     CD + GQC C  G+ GP C + CP GLYG+ C   C C  G +CDPI G C C  GW G  CEN C  G++G  C+  C CLNGGTCD     C+C  GW G+ C+  C  G +G +CE  C C  G  C  ++G C C PGWRG +C++ CP   +G  C Q C C  G  CH  +G C CP G  G  CE  C P  +G +C H C C   T  C   +G C C     G  C+ + C S      C Q C+C    +C+  TG C C  G  G  C   C  G FG  C   C C  G  C+PV GTC+C  G TG  C++ C +  +G  C+ KC  C     CH   G CSC  G +   C+  CP+G YG  C   C C +  SC P++GAC C  GFYG  C+  CP  F+G+ CQ  C+C   +PC+PV+G C+CP    G+FCE
Sbjct:  264 LRGLAHCGCHPGYQLAADRKACEDVDECALGLAQCAHGCLNTQGSFKCVCHAGYELGADGRQCYRIEMEIVNSCEAGN-GGCSHGCSHTSTGP-LCTCPRGYELDEDQKTCIDIDDCA-NSPCCQQVCANTPGG--YECSCFAGYRLNTDGCG-CEDVDECASGHSGCEHHCSNLAGSFQCFCEAGYRLDEDRRGCTPLEESVVD-----LDGQLPFVRPLPHIAVLGDELPQLFQDDYGA----EEEAVAELRGEHTLTEKFVCLDH--SFGHDCSLTCDDCRNGGTCFPGLDGCDCPEGWTGIICNETCPPDTFGKNCSSPCICQNGGTCDPVSGACRCPPGVSGAHCED--GCPKGFYGKHCRKKC-HCANRGRCHRLYGACLCDPGLYGRFCHLACPPWAFGPGCSEDCLCEQSHTRSCNSKDGSCSCKAGFQGERCEAECEPGSFGPGCRNRCTCRPGVACDPVSGECRTQCPPGYQGEDCGQECPVGTFGVNCSGSC--SCVGAPCHRVTGECLCPPGKTGEDCGADCPEGRWGLGCQEICPACEHGAS-CDPETGTCLCLPGFVGSRCQDACPAGWFGTGCQMRCACANDGHCHPATGRC--SCAPGWTGLSCQRACDSGHWGPDCIHPCNCSAGHGNCDAVSGLCLCEAGYEGPQCEQWCRQGYFGPGCEQKCRCEHGATCDHVSGACTCPAGWRGSFCEHACPAGFFGLDCGSACNCSAGAPCDAVTGSC-ICPAGRWGPHCAQTCPPLTFGLNCSQICTCFNGASCDPVLGQCHCAPGWMGPTCLQACPAGLYGKNCQHSCLCRNGGSCDPILGQCTCPEGWTGLACENECLPGHHGAGCRLNCSCLNGGTCDRLTGHCRCPAGWTGDKCQSPCVSGMFGVHCEEHCACRKGATCHHVTGACLCPPGWRGSHCEQACPRGWFGEACAQRCHCPPGASCHHVSGECHCPPGFTGPGCEQACQPGTFGKDCEHPCQCPGETWACHPASGACVCAAGYHGTDCQ-QRCPSGRYGPGCEQICKCLNGGTCDPATGACYCPAGFLGADCSLACPQGRFGPSCAHVCTCGQGAACDPVSGTCICPPGKTGGHCERGCPQDRFGKGCEHKC-ACRNGGLCHATNGSCSCPLGWMGPHCEHACPAGRYGAACLLECSCQNNGSCEPTSGACLCGPGFYGQACEDTCPAGFHGSGCQRVCECQQGAPCDPVSGRCLCPAGFRGQFCE 1463          

HSP 3 Score: 452.21 bits (1162), Expect = 1.972e-133
Identity = 322/917 (35.11%), Postives = 420/917 (45.80%), Query Frame = 3
Query: 1278 TQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCV--PPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGC---GYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFG-KCE-ACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCH-NGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNC--DSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCE 3995
            T+ CNS   K   CSC  GF+ E     C         +++C   P   C    G     CP GY+       C      ++ +G C   G  C    G   C+CP G+T              G     D   CP+G +G  C   C  C H   C+ +   CLC P + G+ C+  C        CQ ++C C N G C   T +C+C PG +G  C+  C  G +G +C   C  +     C  ++G CLC  G+ G  C   C  G +G GC + C C       CD  +G C C  G+ G  C + C  G+FGLDC  +C       C+  TG C      G     C + CP    G +C + C C  N  SC+   G CHCAPG+ G  C   C  GLYG+ CQ SC CR    CD + G C C +   G  CE  C  G  G  C  NC C     CD++ G C C AG+ G KC   C  G++G  C + C C  G  C  ++G C C PGW G  CE  C  G++G+ C ++C C  G +C     +C C PG+ G  CE++C  G +G++CE  CQC      C   SG C C  G+ G +C +RCPS  YGP C Q+C+CLNGG C P  G C CPAG  G  C L CP  ++GP+C H C C     CD  +G C CP    G  CE + C  D     C   C C     C+   G C C  G  GP C   C  G +G  C  +C C N   C P  G CLC  GF G  C+  C  G++G  C+  C  C +   C P +G+C C AG     C+  C  G++G  C Q C    G  C+P +G C C  G  G  C   C    +G  C  RC C   + C+P++G C C    +G  C 
Sbjct:  663 TRSCNS---KDGSCSCKAGFQGERCEAECEPGSFGPGCRNRCTCRPGVACDPVSGECRTQCPPGYQGEDCGQECPVGTFGVNCSGSCSCVGAPCHRVTG--ECLCPPGKT--------------GEDCGAD---CPEGRWGLGCQEICPACEHGASCDPETGTCLCLPGFVGSRCQDACPAGWFGTGCQ-MRCACANDGHCHPATGRCSCAPGWTGLSCQRACDSGHWGPDCIHPCNCSAGHGNCDAVSGLCLCEAGYEGPQCEQWCRQGYFGPGCEQKCRCEHGAT--CDHVSGACTCPAGWRGSFCEHACPAGFFGLDCGSACNCSAGAPCDAVTGSCICPA--GRWGPHCAQTCPPLTFGLNCSQICTCF-NGASCDPVLGQCHCAPGWMGPTCLQACPAGLYGKNCQHSCLCRNGGSCDPILGQCTCPEGWTGLACENECLPGHHGAGCRLNCSCLNGGTCDRLTGHCRCPAGWTGDKCQSPCVSGMFGVHCEEHCACRKGATCHHVTGACLCPPGWRGSHCEQACPRGWFGEACAQRCHCPPGASCHHVSGECHCPPGFTGPGCEQACQPGTFGKDCEHPCQCPGETWACHPASGACVCAAGYHGTDCQQRCPSGRYGPGCEQICKCLNGGTCDPATGACYCPAGFLGADCSLACPQGRFGPSCAHVCTCGQGAACDPVSGTCICPPGKTGGHCE-RGCPQDRFGKGCEHKCACRNGGLCHATNGSCSCPLGWMGPHCEHACPAGRYGAACLLECSCQNNGSCEPTSGACLCGPGFYGQACEDTCPAGFHGSGCQRVC-ECQQGAPCDPVSGRCLCPAGFRGQFCERGCKPGFFGDGCLQQCNSPTGVPCDPISGLCLCPPGRAGTTCDLDCRRGRFGPGCALRCDCGGGADCDPISGQCHCVDSYTGPTCR 1549          

HSP 4 Score: 324.324 bits (830), Expect = 1.304e-89
Identity = 268/806 (33.25%), Postives = 346/806 (42.93%), Query Frame = 3
Query: 1134 GCQHICLNVEGSFICD-------CHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPN-----KRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCIN-----DLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQ-NQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRL-CDHVTGICYCADVAFGK--CEACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN-CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKES-DCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQM 3482
            GCQ IC   E    CD       C PG+       +C         P  +   GC   C  + +         CSC PG+     GL+C    +       C+ P  C       D  S LC C  GY   + +  C             GY         +C C +G T    +  C      RGS  +     CP G FG +C   C NC     C+     C+C     G  C   C      + C  + C C NG +C+    +C+C PG  G  C   C  G +G+NC+ +C    +   C  I G+C C  GW G +C   C  G  G GC   CSC   N   CD   G C+C  G+ G  C   C  G FG+ C   C       C+H TG C      G     C++ CP G  G  C + C C   + SC   +G CHC PGFTG  CE  C  G +G+ C+  CQC  +   C   +G C CA    G    + CPSG++GP C Q C C     CD   G C C AG+ G  CS  CP+G +G  C+  C C  G  CDP+SG C C PG  G  CE  C +  +G  C+ KC C NGG C      C C  GW G  CE +C  G YG  C   C C N G C+  SG C C PG+ G  C++ CP+  +G  C +VC+C  G  C P +G C CPAG  G  CE  C P  +G  CL  C       CD  +G C CP    G +C++     +    C   C C     C+ ++G+C C     GP C ++
Sbjct:  783 GCQEICPACEHGASCDPETGTCLCLPGFVGSRCQDAC---------PAGWFGTGCQMRCACANDGHCHPATGRCSCAPGWT----GLSCQRACDSGHWGPDCIHPCNCSAGHGNCDAVSGLCLCEAGYEGPQCEQWCRQ-----------GY--FGPGCEQKCRCEHGATCDHVSGACTCPAGWRGSFCE---HACPAGFFGLDCGSAC-NCSAGAPCDAVTGSCICPAGRWGPHCAQTCPPLTFGLNCSQI-CTCFNGASCDPVLGQCHCAPGWMGPTCLQACPAGLYGKNCQHSCLCR-NGGSCDPILGQCTCPEGWTGLACENECLPGHHGAGCRLNCSCL--NGGTCDRLTGHCRCPAGWTGDKCQSPCVSGMFGVHCEEHCACRKGATCHHVTGACLCPP--GWRGSHCEQACPRGWFGEACAQRCHCPPGA-SCHHVSGECHCPPGFTGPGCEQACQPGTFGKDCEHPCQCPGETWACHPASGACVCAAGYHGTDCQQRCPSGRYGPGCEQICKCLNGGTCDPATGACYCPAGFLGADCSLACPQGRFGPSCAHVCTCGQGAACDPVSGTCICPPGKTGGHCERGCPQDRFGKGCEHKCACRNGGLCHATNGSCSCPLGWMGPHCEHACPAGRYGAACLLECSCQNNGSCEPTSGACLCGPGFYGQACEDTCPAGFHGSGCQRVCECQQGAPCDPVSGRCLCPAGFRGQFCERGCKPGFFGDGCLQQCNSPTGVPCDPISGLCLCPPGRAGTTCDLDCRRGRFGPGCALRCDCGGGADCDPISGQCHCVDSYTGPTCREV 1551          
BLAST of Multiple epidermal growth factor domains protein 6 vs. UniProt/SwissProt
Match: sp|O75095|MEGF6_HUMAN (Multiple epidermal growth factor-like domains protein 6 OS=Homo sapiens OX=9606 GN=MEGF6 PE=1 SV=4)

HSP 1 Score: 731.865 bits (1888), Expect = 0.000e+0
Identity = 466/1309 (35.60%), Postives = 631/1309 (48.20%), Query Frame = 3
Query:  222 GMPNVCEVEQRQMIRVRRTVEVPRSKEVKVWKANCRFKGDWCLVHENKSFVEKTETSQIQMVPSIKYECCEGYAELSGYRGCIPKPNCEERIGKYCQNGAFCYQSGYNAKCICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGFYCKCPPGYEMSENGKNC-IDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTC-------------------------------------------QNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSC-QCRKDRLCDHVTGICYCADVAFG-KCE-ACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCI--YGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKE--SDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCE 3995
            GMP+VC  ++  ++  R+      S  V VWKA C ++  WC+ HE ++                   CC G+ +     GC+      E     C +G  C                                              C CPPG++    G  C  D++EC  +   C H CVN PG + C+C P   L  D   C+  I+ C   N GGC HHCV+L+  R  C C  G  L +D R C     C + NG C H CQ      +  C+C  GY +   D K C+D++EC      C H CLN +GSF C CH G+++G D + CY+++ME+ + C+  NGGC+  C+ + +   +C+C  G++L+ D  TC D D+C            C N+ G Y C C  GYRL  +   CED+DEC    GGC + C N  GS++C C  G  L +D + C                                           +    RG     +   C   +FG +C   C +C + G C     GC C   ++G IC   C  +     C    C C+NGGTC+S T  C CPPG+SG  CE GC +G++G++C K C  A +  RCH++ G CLC PG YG  CHL CP   +G GCS+ C C Q + + CD ++G C CK G+ G  C  +C+ GYFG  C  +C       C+  +G+C  +   G     C ++CP G  G +C  +C C      C    G C C PG TG+ CE  C +G +G  CQ  C  C+    CD  TG C C     G +C+  CP+G +GP+C   C C     C    G C C  G+ G  C + C  G +G  CS  C C   +G+CD ISG+C C  G+ G  CE  C +G++G  C+++C+C +G  CD     C C  GW G FCE +C  G++G +C   C C  G  CD ++G C C  G RG  C E CP+ TYG NC+Q C C NG  C P +G C C  G  G  C   CP   YG NC H+C+C+    CD  +G C CP+   GL+CE K C  ++  + CR    C     C+  TG+C C  G  G +C   C  G FG  C Q+C C  G  C+ V G C C  GFTG  C+Q C  G +G +C   C     N  CHP TG CSC AG     C+ +CP G YGP C+Q C C++G SC+ +TGAC+C +GF G  C   CP   +G NC H C C   + C+PVTG C+CP   +G  CE
Sbjct:   43 GMPHVCAEQELTLVGRRQPCVQALSHTVPVWKAGCGWQA-WCVGHERRTVYYMGYRQVYTTEARTVLRCCRGWMQQPDEEGCLSA----ECSASLCFHGGRCVPGSAQP---------------------------------------CHCPPGFQ----GPRCQYDVDECRTHNGGCQHRCVNTPGSYLCECKPGFRLHTDSRTCL-AINSCALGN-GGCQHHCVQLTITRHRCQCRPGFQLQEDGRHCVRRSPCANRNGSCMHRCQV--VRGLARCECHVGYQL-AADGKACEDVDECAAGLAQCAHGCLNTQGSFKCVCHAGYELGADGRQCYRIEMEIVNSCEANNGGCSHGCSHT-SAGPLCTCPRGYELDTDQRTCIDVDDCADSP---CCQQVCTNNPGGYECGCYAGYRLSADGCGCEDVDECASSRGGCEHHCTNLAGSFQCSCEAGYRLHEDRRGCSPLEEPMVDLDGELPFVRPLPHIAVLQDELPQLFQDDDVGADEEEAELRGEHTLTEKFVCLDDSFGHDCSLTCDDCRNGGTCLLGLDGCDCPEGWTGLICNETCPPDTFGKNCS-FSCSCQNGGTCDSVTGACRCPPGVSGTNCEDGCPKGYYGKHCRKKCNCA-NRGRCHRLYGACLCDPGLYGRFCHLTCPPWAFGPGCSEECQCVQPHTQSCDKRDGSCSCKAGFRGERCQAECELGYFGPGCWQACTCPVGVACDSVSGECGKRCPAGFQGEDCGQECPVGTFGVNCSSSCSC--GGAPCHGVTGQCRCPPGRTGEDCEADCPEGRWGLGCQEICPACQHAARCDPETGACLCLPGFVGSRCQDVCPAGWYGPSCQTRCSCANDGHCHPATGHCSCAPGWTGFSCQRACDTGHWGPDCSHPCNCSAGHGSCDAISGLCLCEAGYVGPRCEQQCPQGHFGPGCEQRCQCQHGAACDHVSGACTCPAGWRGTFCEHACPAGFFGLDCRSACNCTAGAACDAVNGSCLCPAGRRGPRCAETCPAHTYGHNCSQACACFNGASCDPVHGQCHCAPGWMGPSCLQACPAGLYGDNCRHSCLCQNGGTCDPVSGHCACPEGWAGLACE-KECLPRDVRAGCRHSGGCLNGGLCDPHTGRCLCPAGWTGDKCQSPCLRGWFGEACAQRCSCPPGAACHHVTGACRCPPGFTGSGCEQACPPGSFGEDCAQMCQCPGENPACHPATGTCSCAAGYHGPSCQQRCPPGRYGPGCEQLCGCLNGGSCDAATGACRCPTGFLGTDCNLTCPQGRFGPNCTHVCGCGQGAACDPVTGTCLCPPGRAGVRCE 1289          

HSP 2 Score: 553.132 bits (1424), Expect = 1.842e-170
Identity = 418/1274 (32.81%), Postives = 560/1274 (43.96%), Query Frame = 3
Query:  648 IDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINC----IPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCE-DIDECLDYTGGCGYKCVNT--------DGSYRCVCPNGETLGKDNKTCQ-NQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDC----LQNPSQVECQPLQ----------------------------------------CHCKNGGTCESETLKC--NCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK-CE-ACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAV-------------------------------------------GYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCL-NGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSK-ESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNP-------------------------------------------STGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVSVINRL 4016
            + G   C+C  GY+++ +GK C D++EC      C+H C+N  G F+C C     LG D   C    +  ++ C+ AN GGC+H C   S    +C+CP G+ LD D+R+C  VD C D+   C  +C ++P      C C  GY +  +    C+D++EC    GGC+H C N+ GSF C C  G+++  D + C  ++  + D       G   F    P+   +   LP    + D +   +E+  + G+H       C++D  S+   C +     +N  TC   +D C    G  G  C  T        + S+ C C NG T       C+      G++ +     CPKG +G+ C   C NC ++G C+     CLC P   G  C + C           ECQ +Q                                        C C  G  C+S + +C   CP G  GE C   C  G FG NC  +C  +C    CH +TG+C C PG  G  C   CP G WG+GC + C   Q+    CDP+ G C C  G+ G  C   C  G++G  C   C       C+  TG C      G     CQR C TG  G DC   C+CS    SC+  +G+C C  G+ G RCE +C +G +G  C+  CQC+    CDHV+G C C     G  CE ACP+G +G  C   C+CT    CD +NG C+C AG  GP+C++ CP   YG  CS+ C C  G +CDP+ G C C PGW G  C   C  G YGD C+  C C NGGTCD     C C  GW G  CEK C                                             G++G  C  RC C  G  C  ++G C C PG+ G  C++ CP  ++G +C Q+CQC      CHP  G C C AG HG  C+  CPP +YGP C   C C     CD  TG C CP    G  C +     +   +C   C C    +C+ VTG C C PG  G +C + C    FG+ C+  C C NG  C+  +G+C C  G+TG  C+  C  G YG  C L+C  C+ N TC P TG C C  G     C+  CP G++G  CQ  C C HGA C+P                                            TG C C  G  GA C   C    +G +C   C C   + C+PV+G C C     G  C      RL
Sbjct:  262 VRGLARCECHVGYQLAADGKACEDVDECAAGLAQCAHGCLNTQGSFKCVCHAGYELGADGRQCYRIEMEIVNSCE-ANNGGCSHGCSHTS-AGPLCTCPRGYELDTDQRTCIDVDDCADSPC-CQQVCTNNPGG--YECGCYAGYRLSADGCG-CEDVDECASSRGGCEHHCTNLAGSFQCSCEAGYRLHEDRRGCSPLEEPMVD-----LDGELPFVRPLPHIAVLQDELPQL-FQDDDVGADEEEAELRGEHTLTEKFVCLDD--SFGHDCSLTCDDCRNGGTCLLGLDGCDCPEGWTGLICNETCPPDTFGKNCSFSCSCQNGGTCDSVTGACRCPPGVSGTNCEDG---CPKGYYGKHCRKKC-NCANRGRCHRLYGACLCDPGLYGRFCHLTCPPWAFGPGCSEECQCVQPHTQSCDKRDGSCSCKAGFRGERCQAECELGYFGPGCWQACTCPVGVACDSVSGECGKRCPAGFQGEDCGQECPVGTFGVNCSSSC--SCGGAPCHGVTGQCRCPPGRTGEDCEADCPEGRWGLGCQEICPACQHAAR-CDPETGACLCLPGFVGSRCQDVCPAGWYGPSCQTRCSCANDGHCHPATGHC--SCAPGWTGFSCQRACDTGHWGPDCSHPCNCSAGHGSCDAISGLCLCEAGYVGPRCEQQCPQGHFGPGCEQRCQCQHGAACDHVSGACTCPAGWRGTFCEHACPAGFFGLDCRSACNCTAGAACDAVNGSCLCPAGRRGPRCAETCPAHTYGHNCSQACACFNGASCDPVHGQCHCAPGWMGPSCLQACPAGLYGDNCRHSCLCQNGGTCDPVSGHCACPEGWAGLACEKECLPRDVRAGCRHSGGCLNGGLCDPHTGRCLCPAGWTGDKCQSPCLRGWFGEACAQRCSCPPGAACHHVTGACRCPPGFTGSGCEQACPPGSFGEDCAQMCQCPGENPACHPATGTCSCAAGYHGPSCQQRCPPGRYGPGCEQLCGCLNGGSCDAATGACRCPTGFLGTDCNLTCPQGRFGPNCTHVCGCGQGAACDPVTGTCLCPPGRAGVRCERGCPQNRFGVGCEHTCSCRNGGLCHASNGSCSCGLGWTGRHCELACPPGRYGAACHLEC-SCHNNSTCEPATGTCRCGPGFYGQACEHPCPPGFHGAGCQGLCWCQHGAPCDPISGRCLCPAGFHGHFCERGCEPGSFGEGCHQRCDCDGGAPCDPVTGLCLCPPGRSGATCNLDCRRGQFGPSCTLHCDCGGGADCDPVSGQCHCVDGYMGPTCREGGPLRL 1511          

HSP 3 Score: 449.129 bits (1154), Expect = 1.572e-132
Identity = 372/1168 (31.85%), Postives = 494/1168 (42.29%), Query Frame = 3
Query:  654 GGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSH---------------LCQSDPSSS--VITCK-CRPGYAIDVN-DVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCY------KVDMELTDPCKYGNGGCTQFCNSSPNKR-----AICSCLPGFKLEADGLTCSD-------EDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTG-GCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTC-QGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK--CEACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN-CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQC-HNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEI--------------------------------------KNCDSK------ESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQ----FRCPNN 3884
            GG+ C C  GY +S +G  C D++EC  +R  C H C NL G F+C C     L  DR  C P   P    +            ++ F+   P   +L  +     +  L +D++ G                  +C  D       +TC  CR G    +  D   C +     I N  C         SF C C  G        +C         + E   P  Y    C + CN +   R       C C PG       LTC          +EC     +CV P T   D     C+C  G+R  + +  CE     L Y G GC   C          CP G      +  C  +   G   +   + CP GTFG  C  +CS       C+     C C P  +G  CE DC +    + CQ +   C++   C+ ET  C C PG  G  C+  C  G++G +C+  C  A +   CH  TG C C PGW G SC   C TG WG  CS  C+C+   +  CD  +G C C+ GY G  C  +C  G+FG  C   C       C+H +G C   TC  G     C+  CP G  G DCR  C+C+  + +C+  NG C C  G  G RC   C    YG  C  +C C     CD V G C+CA    G    +ACP+G +G  C  +C C     CD ++G C C  G+ G  C K C       GC     C+ G  CDP +G C C  GW G+ C++PC  G++G+ C ++C C  G  C      C+C PG+ G  CE++C  G +G +C   CQC      C   +G C C  G+ G +C +RCP   YGP C Q+C CLNGG C    G C+CP G  G  C LTCP  ++GPNC H C C     CD  TG C CP    G+ CE                                       ++C+         + C  +C C    +C   TG C+C PG  G  C   C  G  G  C+  C C +G PC+P+ G CLC +GF G  C++ C  G +G  C  +C  C+    C P TG C C  G     C   C  G +GP C   C C  GA C+P +G C C+ G+ G  C+     R P N
Sbjct:  391 GGYECGCYAGYRLSADGCGCEDVDECASSRGGCEHHCTNLAGSFQCSCEAGYRLHEDRRGCSPLEEPMVDLD-----------GELPFVRPLPHIAVLQDE-----LPQLFQDDDVGADEEEAELRGEHTLTEKFVCLDDSFGHDCSLTCDDCRNGGTCLLGLDGCDCPEGWTGLICNETCPPDTFGKNCSFSCSCQNGGTCDSVTGACRCPPGVSGTNCEDGCPKGYYGKHCRKKCNCANRGRCHRLYGACLCDPGLYGRFCHLTCPPWAFGPGCSEEC-----QCVQPHTQSCDKRDGSCSCKAGFRGERCQAECE-----LGYFGPGCWQACT---------CPVGVACDSVSGECGKRCPAGFQGEDCGQECPVGTFGVNCSSSCS--CGGAPCHGVTGQCRCPPGRTGEDCEADCPEGRWGLGCQEICPACQHAARCDPETGACLCLPGFVGSRCQDVCPAGWYGPSCQTRCSCA-NDGHCHPATGHCSCAPGWTGFSCQRACDTGHWGPDCSHPCNCSAG-HGSCDAISGLCLCEAGYVGPRCEQQCPQGHFGPGCEQRCQCQHGAACDHVSGAC---TCPAGWRGTFCEHACPAGFFGLDCRSACNCTAGA-ACDAVNGSCLCPAGRRGPRCAETCPAHTYGHNCSQACACFNGASCDPVHGQCHCAPGWMGPSCLQACPAGLYGDNCRHSCLCQNGGTCDPVSGHCACPEGWAGLACEKECLPRDVRAGCRHSGGCLNGGLCDPHTGRCLCPAGWTGDKCQSPCLRGWFGEACAQRCSCPPGAACHHVTGACRCPPGFTGSGCEQACPPGSFGEDCAQMCQCPGENPACHPATGTCSCAAGYHGPSCQQRCPPGRYGPGCEQLCGCLNGGSCDAATGACRCPTGFLGTDCNLTCPQGRFGPNCTHVCGCGQGAACDPVTGTCLCPPGRAGVRCERGCPQNRFGVGCEHTCSCRNGGLCHASNGSCSCGLGWTGRHCELACPPGRYGAACHLECSCHNNSTCEPATGTCRCGPGFYGQACEHPCPPGFHGAGCQGLCWCQHGAPCDPISGRCLCPAGFHGHFCERGCEPGSFGEGCHQRC-DCDGGAPCDPVTGLCLCPPGRSGATCNLDCRRGQFGPSCTLHCDCGGGADCDPVSGQCHCVDGYMGPTCREGGPLRLPEN 1514          
BLAST of Multiple epidermal growth factor domains protein 6 vs. UniProt/SwissProt
Match: sp|A6BM72|MEG11_HUMAN (Multiple epidermal growth factor-like domains protein 11 OS=Homo sapiens OX=9606 GN=MEGF11 PE=1 SV=3)

HSP 1 Score: 442.195 bits (1136), Expect = 6.337e-134
Identity = 280/700 (40.00%), Postives = 352/700 (50.29%), Query Frame = 3
Query: 1929 CTEGFF--GENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFG-KC-EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKR-CPEGLYGEGCSKECQCIYGN---CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKES-DCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCR--CANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCE 3995
            C  G++  G+ C   C   C   RC      C C PGW G  C   C +  WG  CS  C C   N   C+P  G C C  G+ G  C   C PG  G  C   C       C+   G+C      G   + C+  CP G  G+ C   C C +N  +C    G C C PG+TG  C   C  G +G+ C   C C     CDHVTG C+C     G +C E CP G +G  C+Q+CDC     C    G C C  GY GP+C +R CPEGL+G GC+  C C   N   C P++G C C PGW G  C   C  GYYGD C+  C C NG  C      C C PG+ GE C  SCA G YG NC   C C+NGG C  + G C C  GW+G++C   CPS T+G NCN+ C C NG  C P +G C C  G  GD CEL CP   +G NC  +C C   + CD  TG C C     G+ C+      +   +C   C C    SC+   G C+C PG RGP C ++C  G +G  C Q C     +  PC+ + G C CL GF+G LC+QVCA G++G +C   C  C  N TC P  G C C  G I  DC   CP G++GP C  AC C +GASC+   GAC C  G+ G  C  RCP  F+G +C   C+C + + C+ ++G C C    +G+ CE
Sbjct:   88 CCPGYYESGDFCIPLCTEECVHGRCVS-PDTCHCEPGWGGPDCSSGCDSDHWGPHCSNRCQCQ--NGALCNPITGACVCAAGFRGWRCEELCAPGTHGKGCQLPCQCRHGASCDPRAGEC--LCAPGYTGVYCEELCPPGSHGAHCELRCPC-QNGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPCHHGGQCDHVTGQCHCTAGYMGDRCQEECPFGSFGFQCSQHCDCHNGGQCSPTTGACECEPGYKGPRCQERLCPEGLHGPGCTLPCPCDADNTISCHPVTGACTCQPGWSGHHCNESCPVGYYGDGCQLPCTCQNGADCHSITGGCTCAPGFMGEVCAVSCAAGTYGPNCSSICSCNNGGTCSPVDGSCTCKEGWQGLDCTLPCPSGTWGLNCNESCTCANGAACSPIDGSCSCTPGWLGDTCELPCPDGTFGLNCSEHCDCSHADGCDPVTGHCCCLAGWTGIRCDSTCPPGRWGPNCSVSCSCENGGSCSPEDGSCECAPGFRGPLCQRICPPGFYGHGCAQPCPLCVHSSRPCHHISGICECLPGFSGALCNQVCAGGYFGQDCAQLC-SCANNGTCSPIDGSCQCFPGWIGKDCSQACPPGFWGPACFHACSCHNGASCSAEDGACHCTPGWTGLFCTQRCPAAFFGKDCGRVCQCQNGASCDHISGKCTCRTGFTGQHCE 780          

HSP 2 Score: 393.66 bits (1010), Expect = 3.084e-116
Identity = 266/696 (38.22%), Postives = 340/696 (48.85%), Query Frame = 3
Query: 1560 SYRCVCPNGETLGKDNKTCQ-NQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYK-CDPGYFGLDCSFSCP--EDCKTICNHETGQCPDKTCQ-GNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK--CEACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN-CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQ--CHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSK--ESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQV 3611
            S RC C NG         C      RG   ++    C  GT G+ C   C  C H   C+     CLC P Y+G  CE  C        C+ L+C C+NGGTC   T +C CPPG +G +C   C  G FG+NC ++CP      +C  +TG+C C  G+ G  C   CP G++G  CS+ C C+  N   C P  G C+C+ GY G  C  + C  G  G  C+  CP   D    C+  TG C   TCQ G +   C   CP G  G  C+  C C +N   C    G C CAPGF G+ C + C  G YG  C S C C     C  V G C C +   G      CPSG WG  CN++C C     C  I+G C C  G+ G  C   CP+G +G  CS+ C C + + CDP++G C C  GW G  C++ C  G +G  C   C C NGG+C      C+C PG+ G  C++ C  G+YG  C   C    H+   C  ISG C+C+PG+ G  C++ C    +G +C Q+C C N G C P +G CQC  G  G  C   CPP  +GP C H C C     C  + G C C     GL C  + C +     DC + CQC    SC+ ++GKC C+ G  G  C Q C  G FG  C+Q C C N   C+ V GTC C  GF GI CDQ 
Sbjct:  143 SNRCQCQNGALCNPITGACVCAAGFRGWRCEE---LCAPGTHGKGCQLPC-QCRHGASCDPRAGECLCAPGYTGVYCEELCPPGSHGAHCE-LRCPCQNGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPCH-HGGQCDHVTGQCHCTAGYMGDRCQEECPFGSFGFQCSQHCDCH--NGGQCSPTTGACECEPGYKGPRCQERLCPEGLHGPGCTLPCPCDADNTISCHPVTGAC---TCQPGWSGHHCNESCPVGYYGDGCQLPCTC-QNGADCHSITGGCTCAPGFMGEVCAVSCAAGTYGPNCSSICSCNNGGTCSPVDGSCTCKEGWQGLDCTLPCPSGTWGLNCNESCTCANGAACSPIDGSCSCTPGWLGDTCELPCPDGTFGLNCSEHCDCSHADGCDPVTGHCCCLAGWTGIRCDSTCPPGRWGPNCSVSCSCENGGSCSPEDGSCECAPGFRGPLCQRICPPGFYGHGCAQPCPLCVHSSRPCHHISGICECLPGFSGALCNQVCAGGYFGQDCAQLCSCANNGTCSPIDGSCQCFPGWIGKDCSQACPPGFWGPACFHACSCHNGASCSAEDGACHCTPGWTGLFC-TQRCPAAFFGKDCGRVCQCQNGASCDHISGKCTCRTGFTGQHCEQRCAPGTFGYGCQQLCECMNNSTCDHVTGTCYCSPGFKGIRCDQA 825          

HSP 3 Score: 388.652 bits (997), Expect = 1.718e-114
Identity = 273/736 (37.09%), Postives = 342/736 (46.47%), Query Frame = 3
Query: 1683 GEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRC-ELKCTKGLYGERCQSSCQCRKDRL--CDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCI--CKATEKCDLKTGECTCPKSAFGLSC-EIKNCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALC 3863
            G+ C+  C+     G C    T C C P + G  C   C  +     C   +C C+NG  C   T  C C  G  G  CE  C  G  G+ C+  C     ++ C    G+CLC PG+ G  C  LCP G+ G  C   C C   N   C    G+C C  G+ G  C   C PG FG +CS  CP      C+H TGQC      G     CQ +CP G  G  C + CDC  N   C    G C C PG+ G RC E  C +GL+G  C   C C  D    C  VTG C C     G    E+CP G +G  C   C C     C  I G C C  G+ G  C+  C  G YG  CS  C C  G  C P+ G C C  GW G  C  PC  G +G  C E C C NG  C      C C PGW G+ CE  C  G +G NC   C C +   CD ++G C C+ GW GI CD  CP   +GPNC+  C C NGG C PE+G C+C  G  G +C+  CPP  YG  C   C     ++  C   +G C C     G  C ++        DC Q C C+   +C+ + G CQC PG  G  C Q C  G +G  C   C C NG  C+  DG C C  G+TG+ C Q C   ++G +C   C  C    +C   +G+C+C  G     C+ +C  G +G  CQQ C+CM+ ++C+  TG C C  GF G  C
Sbjct:   96 GDFCIPLCTEECVHGRCVSPDT-CHCEPGWGGPDCSSGCDSDHWGPHCS-NRCQCQNGALCNPITGACVCAAGFRGWRCEELCAPGTHGKGCQLPCQCRHGAS-CDPRAGECLCAPGYTGVYCEELCPPGSHGAHCELRCPCQ--NGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPCHHGGQCDHVTGQC--HCTAGYMGDRCQEECPFGSFGFQCSQHCDC-HNGGQCSPTTGACECEPGYKGPRCQERLCPEGLHGPGCTLPCPCDADNTISCHPVTGACTCQPGWSGHHCNESCPVGYYGDGCQLPCTCQNGADCHSITGGCTCAPGFMGEVCAVSCAAGTYGPNCSSICSCNNGGTCSPVDGSCTCKEGWQGLDCTLPCPSGTWGLNCNESCTCANGAACSPIDGSCSCTPGWLGDTCELPCPDGTFGLNCSEHCDCSHADGCDPVTGHCCCLAGWTGIRCDSTCPPGRWGPNCSVSCSCENGGSCSPEDGSCECAPGFRGPLCQRICPPGFYGHGCAQPCPLCVHSSRPCHHISGICECLPGFSGALCNQVCAGGYFGQDCAQLCSCANNGTCSPIDGSCQCFPGWIGKDCSQACPPGFWGPACFHACSCHNGASCSAEDGACHCTPGWTGLFCTQRCPAAFFGKDCGRVCQ-CQNGASCDHISGKCTCRTGFTGQHCEQRCAPGTFGYGCQQLCECMNNSTCDHVTGTCYCSPGFKGIRC 822          

HSP 4 Score: 357.836 bits (917), Expect = 2.046e-103
Identity = 259/704 (36.79%), Postives = 327/704 (46.45%), Query Frame = 3
Query: 1665 CPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQ-----GNNSIGCQ-RDCPTGGSGSDCRKTCDC-SENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK--CEACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN-CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQ-CLNGGK-CHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSK--ESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDC 3734
            C    +G  C   C  C +   CN     C+C   + G  CE  C        CQ L C C++G +C+    +C C PG +G  CE  C  G  G +CE  CP   +   CH ITG+C C PGW G+ C   CP GT+G  CS+ C C+      CD   G+C C  GY G  C  +C  G FG  CS  C  DC     H  GQC   T       G     CQ R CP G  G  C   C C ++N++SC    G C C PG++G  C   C  G YG+ CQ  C C+    C  +TG C CA    G+    +C +G +GP C+  C C     C  ++G C C  G+ G  C+  CP G +G  C++ C C  G  C PI G C C PGW G+ CE PC +G +G  C E C C +   CD     C C  GW G  C+ +C  G +G NC   C C NGG C    G C+C PG+RG  C   CP   YG  C Q C  C++  + CH  +G+C+C  G  G +C   C    +G +C   C C     C    G C C     G  C  + C        C   C C    SC+   G C C PG  G  C Q C    FG DC + C+C NG  C+ + G C C +GFTG  C+Q CA G +G  C+  C  C  N TC   TG C C  G     C
Sbjct:  133 CDSDHWGPHCSNRC-QCQNGALCNPITGACVCAAGFRGWRCEELCAPGTHGKGCQ-LPCQCRHGASCDPRAGECLCAPGYTGVYCEELCPPGSHGAHCELRCPCQ-NGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPCHHGGQ--CDHVTGQCHCTAGYMGDRCQEECPFGSFGFQCSQHC--DC-----HNGGQCSPTTGACECEPGYKGPRCQERLCPEGLHGPGCTLPCPCDADNTISCHPVTGACTCQPGWSGHHCNESCPVGYYGDGCQLPCTCQNGADCHSITGGCTCAPGFMGEVCAVSCAAGTYGPNCSSICSCNNGGTCSPVDGSCTCKEGWQGLDCTLPCPSGTWGLNCNESCTCANGAACSPIDGSCSCTPGWLGDTCELPCPDGTFGLNCSEHCDCSHADGCDPVTGHCCCLAGWTGIRCDSTCPPGRWGPNCSVSCSCENGGSCSPEDGSCECAPGFRGPLCQRICPPGFYGHGCAQPCPLCVHSSRPCHHISGICECLPGFSGALCNQVCAGGYFGQDCAQLCSCANNGTCSPIDGSCQCFPGWIGKDCS-QACPPGFWGPACFHACSCHNGASCSAEDGACHCTPGWTGLFCTQRCPAAFFGKDCGRVCQCQNGASCDHISGKCTCRTGFTGQHCEQRCAPGTFGYGCQQLC-ECMNNSTCDHVTGTCYCSPGFKGIRC 822          

HSP 5 Score: 278.1 bits (710), Expect = 6.112e-76
Identity = 193/531 (36.35%), Postives = 250/531 (47.08%), Query Frame = 3
Query: 1524 GGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQ-NQNTRGSSLQKDPRRCPKGTFGEECLFNCS-NCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQ--CRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDE 3095
            G  G++C     S  C C NG         C+     +G   Q+  R CP+G  G  C   C  +  +   C+     C C P +SG  C   C        CQ L C C+NG  C S T  C C PG  GE+C + C  G +G NC   C +  +   C  + G C C  GW G  C L CP+GTWG+ C+++C+C   N   C P +G C C  G+ G  C   C  G FGL+CS  C       C+  TG C      G   I C   CP G  G +C  +C C EN  SC  ++G C CAPGF G  C+  C  G YG  C   C       R C H++GIC C     G    + C  G +G  C Q C C  +  C  I+G C C  G+ G  CS+ CP G +G  C   C C  G +C    G C C PGW G  C   C   ++G  C   C+C NG +CD    KC C  G+ G+ CE+ CA G +G  C+  C+C N   CD ++G C C PG++GI CD+
Sbjct:  308 GSFGFQC-----SQHCDCHNGGQCSPTTGACECEPGYKGPRCQE--RLCPEGLHGPGCTLPCPCDADNTISCHPVTGACTCQPGWSGHHCNESCPVGYYGDGCQ-LPCTCQNGADCHSITGGCTCAPGFMGEVCAVSCAAGTYGPNCSSIC-SCNNGGTCSPVDGSCTCKEGWQGLDCTLPCPSGTWGLNCNESCTCA--NGAACSPIDGSCSCTPGWLGDTCELPCPDGTFGLNCSEHCDCSHADGCDPVTGHC--CCLAGWTGIRCDSTCPPGRWGPNCSVSCSC-ENGGSCSPEDGSCECAPGFRGPLCQRICPPGFYGHGCAQPCPLCVHSSRPCHHISGICECLPGFSGALCNQVCAGGYFGQDCAQLCSCANNGTCSPIDGSCQCFPGWIGKDCSQACPPGFWGPACFHACSCHNGASCSAEDGACHCTPGWTGLFCTQRCPAAFFGKDCGRVCQCQNGASCDHISGKCTCRTGFTGQHCEQRCAPGTFGYGCQQLCECMNNSTCDHVTGTCYCSPGFKGIRCDQ 824          

HSP 6 Score: 263.848 bits (673), Expect = 3.188e-71
Identity = 158/418 (37.80%), Postives = 216/418 (51.67%), Query Frame = 3
Query: 2757 QCIYGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIK-NCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQ-MCEFGNFGLDCKQKCRCA--NGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEV 3998
            +C++G C      C C PGW G  C + CD  ++G  C  +C+C NG  C+     C C  G+ G  CE+ CA G +G+ C+  CQC +G  CD  +G+C C PG+ G+ C+E CP  ++G +C   C C NGG CH   G C CP G  G VC   CPP  +G NC  +C C    +CD  TG+C C     G  C+ +    S    C Q C C     C+  TG C+C+PG +GP+C + +C  G  G  C   C C   N   C+PV G C C  G++G  C++ C  G+YG  C+L C  C     CH  TG C+C  G +   C   C +G YGP C   C C +G +C+P  G+C C  G+ G  C   CP+  +G NC   C C + + C+P+ G C C     G  CE+
Sbjct:  106 ECVHGRCVSPD-TCHCEPGWGGPDCSSGCDSDHWGPHCSNRCQCQNGALCNPITGACVCAAGFRGWRCEELCAPGTHGKGCQLPCQCRHGASCDPRAGECLCAPGYTGVYCEELCPPGSHGAHCELRCPCQNGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPCHHGGQCDHVTGQCHCTAGYMGDRCQEECPFGSFGFQCSQHCDCHNGGQCSPTTGACECEPGYKGPRCQERLCPEGLHGPGCTLPCPCDADNTISCHPVTGACTCQPGWSGHHCNESCPVGYYGDGCQLPC-TCQNGADCHSITGGCTCAPGFMGEVCAVSCAAGTYGPNCSSICSCNNGGTCSPVDGSCTCKEGWQGLDCTLPCPSGTWGLNCNESCTCANGAACSPIDGSCSCTPGWLGDTCEL 521          

HSP 7 Score: 192.586 bits (488), Expect = 2.087e-48
Identity = 136/370 (36.76%), Postives = 177/370 (47.84%), Query Frame = 3
Query: 2910 IFGRKCQCEPGWH--GEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCE-IKNCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQ-CPSGYYGPLCQQACQCM--HGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVS 4001
            ++ R+ QC PG++  G+FC   C          GRC   +          C C PGW G +C   C S  +GP+C+  CQC NG  C+P  G C C AG  G  CE  C P  +G  C   C C+    CD + GEC C     G+ CE +    S  + C   C C    +C+ +TG+C C PG  G  C Q C  G FG +C Q C C +G  C+ V G C C +G+ G  C + C  G +G  C   C  C+    C P TG C CE G     C+ + CP G +GP C   C C   +  SC+P TGAC C  G+ G  C   CP  +YG  CQ  C C + + C+ +TG C C     G  C VS
Sbjct:   81 MYRRRSQCCPGYYESGDFCIPLCTE----ECVHGRCVSPD---------TCHCEPGWGGPDCSSGCDSDHWGPHCSNRCQCQNGALCNPITGACVCAAGFRGWRCEELCAPGTHGKGCQLPCQCRHGASCDPRAGECLCAPGYTGVYCEELCPPGSHGAHCELRCPCQNGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPCHHGGQCDHVTGQCHCTAGYMGDRCQEECPFGSFGFQCSQHC-DCHNGGQCSPTTGACECEPGYKGPRCQERLCPEGLHGPGCTLPCPCDADNTISCHPVTGACTCQPGWSGHHCNESCPVGYYGDGCQLPCTCQNGADCHSITGGCTCAPGFMGEVCAVS 436          

HSP 8 Score: 176.407 bits (446), Expect = 2.090e-43
Identity = 204/711 (28.69%), Postives = 289/711 (40.65%), Query Frame = 3
Query:  507 CQNGAFCYQSGYNAKCICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDL-------CKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFI--------CDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQ--FCNSSPNKRAI---CSCLPGFKLEADGLTCS--DEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGC----GYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNR-CHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCA 2558
            C++GA C       +C+C  G+ G +C++                          CPPG     +G +C     C    T     C ++ G   C CPP          C P     + +    C HH  +   +   C C  G++ D+ +  C            C  +NGG     Q  P++    C+C PGY       + C +     +   GC   C     + I        C C PGW   H ++SC         P  Y   GC     C +  +  +I   C+C PGF  E   ++C+        +    C    TC    GS  CTC  G++     + C      L+    C    G  C   DGS  C      T G    TC+               CP GTFG  C  +C +C H   C+     C C   ++G  C+  C        C  + C C+NGG+C  E   C C PG  G +C+  C  GF+G  C + CP    S+R CH I+G C C PG+ G+ C+ +C  G +G  C++ CSC  N    C P +G C+C  G+ G +C   C PG++G  C  +C       C+ E G C      G   + C + CP    G DC + C C +N  SC+  +G C C  GFTG+ CE +C  G +G  CQ  C+C  +  CDHVTG CYC+
Sbjct:  191 CRHGASCDPRA--GECLCAPGYTGVYCEE-------------------------LCPPG----SHGAHCELRCPCQNGGT-----CHHITG--ECACPPGWTGAVCAQPCPPGTFGQNCSQDCPC-HHGGQCDHVTGQCHCTAGYMGDRCQEECPFGSFGFQCSQHCDCHNGG-----QCSPTTGA--CECEPGYKGPRCQERLCPE----GLHGPGCTLPCPCDADNTISCHPVTGACTCQPGWSGHHCNESC---------PVGYYGDGCQLPCTCQNGADCHSITGGCTCAPGFMGEVCAVSCAAGTYGPNCSSICSCNNGGTCSPVDGS--CTCKEGWQGLDCTLPCPSGTWGLNCNESCTCANGAACSPIDGSCSC------TPGWLGDTCE-------------LPCPDGTFGLNCSEHC-DCSHADGCDPVTGHCCCLAGWTGIRCDSTCPPGRWGPNCS-VSCSCENGGSCSPEDGSCECAPGFRGPLCQRICPPGFYGHGCAQPCPLCVHSSRPCHHISGICECLPGFSGALCNQVCAGGYFGQDCAQLCSCANNGT--CSPIDGSCQCFPGWIGKDCSQACPPGFWGPACFHACSCHNGASCSAEDGAC--HCTPGWTGLFCTQRCPAAFFGKDCGRVCQC-QNGASCDHISGKCTCRTGFTGQHCEQRCAPGTFGYGCQQLCECMNNSTCDHVTGTCYCS 814          
BLAST of Multiple epidermal growth factor domains protein 6 vs. UniProt/SwissProt
Match: sp|Q80T91|MEG11_MOUSE (Multiple epidermal growth factor-like domains protein 11 OS=Mus musculus OX=10090 GN=Megf11 PE=1 SV=3)

HSP 1 Score: 441.039 bits (1133), Expect = 3.932e-133
Identity = 283/700 (40.43%), Postives = 350/700 (50.00%), Query Frame = 3
Query: 1929 CTEGFF--GENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFG-KC-EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKR-CPEGLYGEGCSKECQCIYGN---CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKES-DCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKC-RCANGE-PCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCE 3995
            C  G++  G+ C   C   C   RC      C C PGW G  C   C +  WG  CS  C C   N   C+P  G C C  G+ G  C   C PG  G  C   C       C+  TG+C      G   + C+  CP G  G+ C   C C +N  +C    G C C PG+TG  C   C  G +G+ C   C C     CDHVTG C+C     G +C E CP G +G  C+Q CDC     C    G C C  GY GP C +R CPEGL+G GC+  C C   N   C P++G C C PGW G  C   C  GYYG+ C+  C C NG  C      C C PG+ GE C   CA G YG NC   C C NGG C  + G C C  GW+G++C   CPS T+G NCN+ C C NG  C P +G C C  G  GD CEL CP   +G NC  +C C   + CD  TG C C     G+ C+      +   +C   C C    SC+   G C+C PG RGP C ++C  G +G  C Q C  C +   PC+ + G C CL GF+G LC+QVCA G +G +C   C  C  N TC P  G C C  G I  DC   CPSG++G  C   C C +GASC+   GAC C  G+ G  C  RCP+ F+G +C H C+C + + C+ +TG C C    SGR CE
Sbjct:   87 CCPGYYENGDFCIPLCTEECMHGRCVS-PDTCHCEPGWGGPDCSSGCDSEHWGPHCSNRCQCQ--NGALCNPITGACVCAPGFRGWRCEELCAPGTHGKGCQLLCQCHHGASCDPRTGEC--LCAPGYTGVYCEELCPPGSHGAHCELRCPC-QNGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPCHHGGQCDHVTGQCHCTAGYMGDRCQEECPFGTFGFLCSQRCDCHNGGQCSPATGACECEPGYKGPSCQERLCPEGLHGPGCTLPCPCDTENTISCHPVTGACTCQPGWSGHYCNESCPAGYYGNGCQLPCTCQNGADCHSITGSCTCAPGFMGEVCAVPCAAGTYGPNCSSVCSCSNGGTCSPVDGSCTCREGWQGLDCSLPCPSGTWGLNCNETCICANGAACSPFDGSCACTPGWLGDSCELPCPDGTFGLNCSEHCDCSHADGCDPVTGHCCCLAGWTGIRCDSTCPPGRWGPNCSVSCSCENGGSCSPEDGSCECAPGFRGPLCQRICPPGFYGHGCAQPCPLCVHSRGPCHHISGICECLPGFSGALCNQVCAGGHFGQDCAQLC-SCANNGTCSPIDGSCQCFPGWIGKDCSQACPSGFWGSACFHTCSCHNGASCSAEDGACHCTPGWTGLFCTQRCPSAFFGKDCGHICQCQNGASCDHITGKCTCRTGFSGRHCE 779          

HSP 2 Score: 393.275 bits (1009), Expect = 8.904e-116
Identity = 280/737 (37.99%), Postives = 348/737 (47.22%), Query Frame = 3
Query: 1683 GEECLFNCSN-CMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRC-ELKCTKGLYGERCQSSCQCRKDRL--CDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNC-ICKATE-KCDLKTGECTCPKSAFGLSC-EIKNCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALC 3863
            G+ C+  C+  CMH G C    T C C P + G  C   C        C   +C C+NG  C   T  C C PG  G  CE  C  G  G+ C+  C     ++ C   TG+CLC PG+ G  C  LCP G+ G  C   C C   N   C    G+C C  G+ G  C   C PG FG +CS  CP      C+H TGQC      G     CQ +CP G  G  C + CDC  N   C    G C C PG+ G  C E  C +GL+G  C   C C  +    C  VTG C C     G    E+CP+G +G  C   C C     C  I G C C  G+ G  C+  C  G YG  CS  C C  G  C P+ G C C  GW G  C  PC  G +G  C E C C NG  C  F   C C PGW G+ CE  C  G +G NC   C C +   CD ++G C C+ GW GI CD  CP   +GPNC+  C C NGG C PE+G C+C  G  G +C+  CPP  YG  C   C +C  +   C   +G C C     G  C ++        DC Q C C+   +C+ + G CQC PG  G  C Q C  G +G  C   C C NG  C+  DG C C  G+TG+ C Q C   ++G +C   C  C    +C   TG+C+C  G     C+ +C  G +G  CQQ C+CM+ A+C+  TG C C  GF G  C
Sbjct:   95 GDFCIPLCTEECMH-GRCVSPDT-CHCEPGWGGPDCSSGCDSEHWGPHCS-NRCQCQNGALCNPITGACVCAPGFRGWRCEELCAPGTHGKGCQLLCQCHHGAS-CDPRTGECLCAPGYTGVYCEELCPPGSHGAHCELRCPCQ--NGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPCHHGGQCDHVTGQC--HCTAGYMGDRCQEECPFGTFGFLCSQRCDC-HNGGQCSPATGACECEPGYKGPSCQERLCPEGLHGPGCTLPCPCDTENTISCHPVTGACTCQPGWSGHYCNESCPAGYYGNGCQLPCTCQNGADCHSITGSCTCAPGFMGEVCAVPCAAGTYGPNCSSVCSCSNGGTCSPVDGSCTCREGWQGLDCSLPCPSGTWGLNCNETCICANGAACSPFDGSCACTPGWLGDSCELPCPDGTFGLNCSEHCDCSHADGCDPVTGHCCCLAGWTGIRCDSTCPPGRWGPNCSVSCSCENGGSCSPEDGSCECAPGFRGPLCQRICPPGFYGHGCAQPCPLCVHSRGPCHHISGICECLPGFSGALCNQVCAGGHFGQDCAQLCSCANNGTCSPIDGSCQCFPGWIGKDCSQACPSGFWGSACFHTCSCHNGASCSAEDGACHCTPGWTGLFCTQRCPSAFFGKDCGHICQ-CQNGASCDHITGKCTCRTGFSGRHCEQRCAPGTFGYGCQQLCECMNNATCDHVTGTCYCSPGFKGIRC 821          

HSP 3 Score: 391.349 bits (1004), Expect = 4.570e-115
Identity = 267/696 (38.36%), Postives = 339/696 (48.71%), Query Frame = 3
Query: 1560 SYRCVCPNGETLGKDNKTCQ-NQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYK-CDPGYFGLDCSFSCPEDCKTI--CNHETGQCPDKTCQ-GNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK--CEACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN-CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQ--CHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSK--ESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQV 3611
            S RC C NG         C      RG   ++    C  GT G+ C   C  C H   C+     CLC P Y+G  CE  C        C+ L+C C+NGGTC   T +C CPPG +G +C   C  G FG+NC ++CP      +C  +TG+C C  G+ G  C   CP GT+G  CS+ C C+  N   C P  G C+C+ GY G +C  + C  G  G  C+  CP D +    C+  TG C   TCQ G +   C   CP G  G+ C+  C C +N   C    G C CAPGF G+ C + C  G YG  C S C C     C  V G C C +   G      CPSG WG  CN+ C C     C   +G C C  G+ G  C   CP+G +G  CS+ C C + + CDP++G C C  GW G  C++ C  G +G  C   C C NGG+C      C+C PG+ G  C++ C  G+YG  C   C    H+ G C  ISG C+C+PG+ G  C++ C    +G +C Q+C C N G C P +G CQC  G  G  C   CP   +G  C H C C     C  + G C C     GL C  + C S     DC   CQC    SC+ +TGKC C+ G  G  C Q C  G FG  C+Q C C N   C+ V GTC C  GF GI CDQ 
Sbjct:  142 SNRCQCQNGALCNPITGACVCAPGFRGWRCEE---LCAPGTHGKGCQLLC-QCHHGASCDPRTGECLCAPGYTGVYCEELCPPGSHGAHCE-LRCPCQNGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPCH-HGGQCDHVTGQCHCTAGYMGDRCQEECPFGTFGFLCSQRCDCH--NGGQCSPATGACECEPGYKGPSCQERLCPEGLHGPGCTLPCPCDTENTISCHPVTGAC---TCQPGWSGHYCNESCPAGYYGNGCQLPCTC-QNGADCHSITGSCTCAPGFMGEVCAVPCAAGTYGPNCSSVCSCSNGGTCSPVDGSCTCREGWQGLDCSLPCPSGTWGLNCNETCICANGAACSPFDGSCACTPGWLGDSCELPCPDGTFGLNCSEHCDCSHADGCDPVTGHCCCLAGWTGIRCDSTCPPGRWGPNCSVSCSCENGGSCSPEDGSCECAPGFRGPLCQRICPPGFYGHGCAQPCPLCVHSRGPCHHISGICECLPGFSGALCNQVCAGGHFGQDCAQLCSCANNGTCSPIDGSCQCFPGWIGKDCSQACPSGFWGSACFHTCSCHNGASCSAEDGACHCTPGWTGLFC-TQRCPSAFFGKDCGHICQCQNGASCDHITGKCTCRTGFSGRHCEQRCAPGTFGYGCQQLCECMNNATCDHVTGTCYCSPGFKGIRCDQA 824          

HSP 4 Score: 363.999 bits (933), Expect = 2.507e-105
Identity = 264/699 (37.77%), Postives = 327/699 (46.78%), Query Frame = 3
Query: 1680 FGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQ-----GNNSIGCQ-RDCPTGGSGSDCRKTCDC-SENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKCEACP--SGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN-CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQ-CLNG-GKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSK--ESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDC 3734
            +G  C   C  C +   CN     C+C P + G  CE  C        CQ L C C +G +C+  T +C C PG +G  CE  C  G  G +CE  CP   +   CH ITG+C C PGW G+ C   CP GT+G  CS+ C C+      CD   G+C C  GY G  C  +C  G FG  CS  C  DC     H  GQC   T       G     CQ R CP G  G  C   C C +EN++SC    G C C PG++G  C   C  G YG  CQ  C C+    C  +TG C CA    G+  A P  +G +GP C+  C C+    C  ++G C C  G+ G  CS  CP G +G  C++ C C  G  C P  G C C PGW G+ CE PC +G +G  C E C C +   CD     C C  GW G  C+ +C  G +G NC   C C NGG C    G C+C PG+RG  C   CP   YG  C Q C  C++  G CH  +G+C+C  G  G +C   C    +G +C   C C     C    G C C     G  C  + C S    S C   C C    SC+   G C C PG  G  C Q C    FG DC   C+C NG  C+ + G C C +GF+G  C+Q CA G +G  C+  C  C  N TC   TG C C  G     C
Sbjct:  137 WGPHCSNRC-QCQNGALCNPITGACVCAPGFRGWRCEELCAPGTHGKGCQ-LLCQCHHGASCDPRTGECLCAPGYTGVYCEELCPPGSHGAHCELRCPCQ-NGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPCHHGGQ--CDHVTGQCHCTAGYMGDRCQEECPFGTFGFLCSQRC--DC-----HNGGQCSPATGACECEPGYKGPSCQERLCPEGLHGPGCTLPCPCDTENTISCHPVTGACTCQPGWSGHYCNESCPAGYYGNGCQLPCTCQNGADCHSITGSCTCAPGFMGEVCAVPCAAGTYGPNCSSVCSCSNGGTCSPVDGSCTCREGWQGLDCSLPCPSGTWGLNCNETCICANGAACSPFDGSCACTPGWLGDSCELPCPDGTFGLNCSEHCDCSHADGCDPVTGHCCCLAGWTGIRCDSTCPPGRWGPNCSVSCSCENGGSCSPEDGSCECAPGFRGPLCQRICPPGFYGHGCAQPCPLCVHSRGPCHHISGICECLPGFSGALCNQVCAGGHFGQDCAQLCSCANNGTCSPIDGSCQCFPGWIGKDCS-QACPSGFWGSACFHTCSCHNGASCSAEDGACHCTPGWTGLFCTQRCPSAFFGKDCGHICQCQNGASCDHITGKCTCRTGFSGRHCEQRCAPGTFGYGCQQLC-ECMNNATCDHVTGTCYCSPGFKGIRC 821          

HSP 5 Score: 268.085 bits (684), Expect = 1.779e-72
Identity = 159/418 (38.04%), Postives = 216/418 (51.67%), Query Frame = 3
Query: 2757 QCIYGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIK-NCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQ-MCEFGNFGLDCKQKCRC--ANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEV 3998
            +C++G C      C C PGW G  C + CD  ++G  C  +C+C NG  C+     C C PG+ G  CE+ CA G +G+ C+  CQCH+G  CD  +G+C C PG+ G+ C+E CP  ++G +C   C C NGG CH   G C CP G  G VC   CPP  +G NC  +C C    +CD  TG+C C     G  C+ +    +    C Q C C     C+  TG C+C+PG +GP C + +C  G  G  C   C C   N   C+PV G C C  G++G  C++ C  G+YG  C+L C  C     CH  TG C+C  G +   C   C +G YGP C   C C +G +C+P  G+C C  G+ G  C   CP+  +G NC   C C + + C+P  G C C     G  CE+
Sbjct:  105 ECMHGRCVSPD-TCHCEPGWGGPDCSSGCDSEHWGPHCSNRCQCQNGALCNPITGACVCAPGFRGWRCEELCAPGTHGKGCQLLCQCHHGASCDPRTGECLCAPGYTGVYCEELCPPGSHGAHCELRCPCQNGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPCHHGGQCDHVTGQCHCTAGYMGDRCQEECPFGTFGFLCSQRCDCHNGGQCSPATGACECEPGYKGPSCQERLCPEGLHGPGCTLPCPCDTENTISCHPVTGACTCQPGWSGHYCNESCPAGYYGNGCQLPC-TCQNGADCHSITGSCTCAPGFMGEVCAVPCAAGTYGPNCSSVCSCSNGGTCSPVDGSCTCREGWQGLDCSLPCPSGTWGLNCNETCICANGAACSPFDGSCACTPGWLGDSCEL 520          

HSP 6 Score: 254.603 bits (649), Expect = 4.891e-68
Identity = 157/390 (40.26%), Postives = 201/390 (51.54%), Query Frame = 3
Query: 2850 GYY--GDQCKEKC--KCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIK-NCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILC-DQVCAKGWYGPNCKLKCLVCNRNK-TCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEV 3998
            GYY  GD C   C  +C++G    +    C CEPGW G  C   C   ++G +C  RCQC NG LC+ I+G C C PG+RG  C+E C   T+G  C  +CQC +G  C P  G C C  G  G  CE  CPP  +G +C   C C+    C   TGEC CP    G  C       +   +C QDC C     C+ VTG+C C  G  G +C + C FG FG  C Q+C C NG  C+P  G C C  G+ G  C +++C +G +GP C L C     N  +CHP TG C+C+ G   + C   CP+GYYG  CQ  C C +GA C+  TG+C C  GF G +C   C    YG NC   C C +   C+PV G C C +   G  C +
Sbjct:   90 GYYENGDFCIPLCTEECMHGRC--VSPDTCHCEPGWGGPDCSSGCDSEHWGPHCSNRCQCQNGALCNPITGACVCAPGFRGWRCEELCAPGTHGKGCQLLCQCHHGASCDPRTGECLCAPGYTGVYCEELCPPGSHGAHCELRCPCQNGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPCHHGGQCDHVTGQCHCTAGYMGDRCQEECPFGTFGFLCSQRCDCHNGGQCSPATGACECEPGYKGPSCQERLCPEGLHGPGCTLPCPCDTENTISCHPVTGACTCQPGWSGHYCNESCPAGYYGNGCQLPCTCQNGADCHSITGSCTCAPGFMGEVCAVPCAAGTYGPNCSSVCSCSNGGTCSPVDGSCTCREGWQGLDCSL 477          

HSP 7 Score: 241.506 bits (615), Expect = 8.004e-64
Identity = 161/444 (36.26%), Postives = 213/444 (47.97%), Query Frame = 3
Query: 1659 RRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCD-CSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK--CEACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAV 2978
              CP G +G  C   C+ C +   C+     C C P + G +C + C        C  + C C NGGTC      C C  G  G  C + C  G +G NC + C  A +   C    G C C PGW G SC L CP GT+G+ CS+ C C+    +GCDP  G C C  G+ G+ C   C PG +G +CS SC  +    C+ E G C  +   G     CQR CP G  G  C + C  C  +   C   +GIC C PGF+G  C   C  G +G+ C   C C  +  C  + G C C     GK   +ACPSG WG  C   C C     C   +G C C  G+ G  C++RCP   +G+ C   CQC  G +CD I+G C C  G+ G  CE  C  G +G  C++ C+C+N  TCD     C C PG+ G  C+++  +
Sbjct:  391 ESCPAGYYGNGCQLPCT-CQNGADCHSITGSCTCAPGFMGEVCAVPCAAGTYGPNCSSV-CSCSNGGTCSPVDGSCTCREGWQGLDCSLPCPSGTWGLNCNETCICA-NGAACSPFDGSCACTPGWLGDSCELPCPDGTFGLNCSEHCDCSHA--DGCDPVTGHCCCLAGWTGIRCDSTCPPGRWGPNCSVSCSCENGGSCSPEDGSC--ECAPGFRGPLCQRICPPGFYGHGCAQPCPLCVHSRGPCHHISGICECLPGFSGALCNQVCAGGHFGQDCAQLCSCANNGTCSPIDGSCQCFPGWIGKDCSQACPSGFWGSACFHTCSCHNGASCSAEDGACHCTPGWTGLFCTQRCPSAFFGKDCGHICQCQNGASCDHITGKCTCRTGFSGRHCEQRCAPGTFGYGCQQLCECMNNATCDHVTGTCYCSPGFKGIRCDQAALM 827          

HSP 8 Score: 169.088 bits (427), Expect = 5.371e-41
Identity = 199/708 (28.11%), Postives = 286/708 (40.40%), Query Frame = 3
Query:  507 CQNGAFCYQSGYNAKCICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDL-------CKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICL-NVEGSF-------ICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQ--FCNSSPNKRAI---CSCLPGFKLEADGLTCS--DEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQ-NQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPT-ACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCA 2558
            C +GA C       +C+C  G+ G +C++                          CPPG     +G +C     C    T     C ++ G   C CPP          C P     + +    C HH  +   +   C C  G++ D+ +  C            C  +NGG     Q  P++    C+C PGY       + C +     +   GC   C  + E +         C C PGW   + ++SC         P  Y   GC     C +  +  +I   C+C PGF  E   + C+        +    C    TC    GS  CTC  G++     + C         +G  G  C  T     C+C NG      + +C       G S +     CP GTFG  C  +C +C H   C+     C C   ++G  C+  C        C  + C C+NGG+C  E   C C PG  G +C+  C  GF+G  C + CP    S   CH I+G C C PG+ G+ C+ +C  G +G  C++ CSC  N    C P +G C+C  G+ G +C   C  G++G  C  +C       C+ E G C      G   + C + CP+   G DC   C C +N  SC+   G C C  GF+G+ CE +C  G +G  CQ  C+C  +  CDHVTG CYC+
Sbjct:  190 CHHGASC--DPRTGECLCAPGYTGVYCEE-------------------------LCPPG----SHGAHCELRCPCQNGGT-----CHHITG--ECACPPGWTGAVCAQPCPPGTFGQNCSQDCPC-HHGGQCDHVTGQCHCTAGYMGDRCQEECPFGTFGFLCSQRCDCHNGG-----QCSPATGA--CECEPGYKGPSCQERLCPE----GLHGPGCTLPCPCDTENTISCHPVTGACTCQPGWSGHYCNESC---------PAGYYGNGCQLPCTCQNGADCHSITGSCTCAPGFMGEVCAVPCAAGTYGPNCSSVCSCSNGGTCSPVDGS--CTCREGWQGLDCSLPCP--------SGTWGLNCNET-----CICANGAACSPFDGSCACTPGWLGDSCELP---CPDGTFGLNCSEHC-DCSHADGCDPVTGHCCCLAGWTGIRCDSTCPPGRWGPNCS-VSCSCENGGSCSPEDGSCECAPGFRGPLCQRICPPGFYGHGCAQPCPLCVHSRGPCHHISGICECLPGFSGALCNQVCAGGHFGQDCAQLCSCANNGT--CSPIDGSCQCFPGWIGKDCSQACPSGFWGSACFHTCSCHNGASCSAEDGAC--HCTPGWTGLFCTQRCPSAFFGKDCGHICQC-QNGASCDHITGKCTCRTGFSGRHCEQRCAPGTFGYGCQQLCECMNNATCDHVTGTCYCS 813          

HSP 9 Score: 159.458 bits (402), Expect = 4.529e-38
Identity = 108/291 (37.11%), Postives = 147/291 (50.52%), Query Frame = 3
Query: 3141 QCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCE-IKNCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFR-CPNNFYGANCQHRCKC--FHNSPCNPVTGHCVCPKKLSGRFCEVS 4001
            +C++G    P+   C C  G  G  C   C  + +GP+C + C C+    C+  TG C C     G  CE +    +    C+  CQC    SC+  TG+C C PG  G  C ++C  G+ G  C+ +C C NG  C+ + G C C  G+TG +C Q C  G +G NC   C  C+    C   TGQC C AG +   C+ +CP G +G LC Q C C +G  C+P+TGAC+C  G+ G  CQ R CP   +G  C   C C   +   C+PVTG C C    SG +C  S
Sbjct:  105 ECMHGRCVSPDT--CHCEPGWGGPDCSSGCDSEHWGPHCSNRCQCQNGALCNPITGACVCAPGFRGWRCEELCAPGTHGKGCQLLCQCHHGASCDPRTGECLCAPGYTGVYCEELCPPGSHGAHCELRCPCQNGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDC-PCHHGGQCDHVTGQCHCTAGYMGDRCQEECPFGTFGFLCSQRCDCHNGGQCSPATGACECEPGYKGPSCQERLCPEGLHGPGCTLPCPCDTENTISCHPVTGACTCQPGWSGHYCNES 392          
BLAST of Multiple epidermal growth factor domains protein 6 vs. TrEMBL
Match: A0A4E0RMW6 (Multiple epidermal growth factor domains protein 6 OS=Fasciola hepatica OX=6192 GN=D915_000170 PE=4 SV=1)

HSP 1 Score: 920.228 bits (2377), Expect = 0.000e+0
Identity = 544/1407 (38.66%), Postives = 740/1407 (52.59%), Query Frame = 3
Query:   18 AYKHIQILIHFFDKNCKAS*YQRHQIIFIYQLS*QIL*KYEMRFAIIFFLTIQIIPKLSGAGSQKLELGMPNVCEVEQRQMIRVRRTVEVPRSKEVKVWKANCRFKGDWCLVHENKSFVEKTETSQIQMVPSIKYECCEGYAELSGYRGCIPKPNCEERI--GKYCQNGAFCYQSGYNAKCICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPST-CINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQN-------------------QNTRGSSLQKDP---------------------RRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEI-GCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWG----IGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENS----VSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRL-CDHVTGICYCADVAFG-------------KCEACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHN---GGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATE------KCDLKTGECTCPKSAFGLSCEIKNCDSKES-DCRQDCQCSIKKS-CNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNR--NKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVS 4001
             +   ++ +   D+    + +  H        S  +    +     +    I  +P+       +L  GMPNVC+    Q + VRR    P  K  K+W+ NC F+G+WCL ++ ++       S +++    +Y+CC G+ +L G+ GC+PK NC   +   K C+NG  CYQ     +C CP GF G  C   +++C    G C+K+C        C+CP GY ++ + + C+DI+EC   R  C + C NLPGG+RC CP DM+L  D+I+CIPF  PC     G C H C  L   R++CSC  G+ L  D++ C   DLCK+NNGGC H C++   +  + C C  GY     D K+C DINEC   NGGCQH C NV+GSF C+C+PGWQ+G+D K+CY+V +E++DPC++GNGGCT  C  +    A C+C PG+ L+ADG TC D DEC+TG+  C  P+  C N++G+Y C C  G+RL  +  +C+DIDECL Y GGC YKCVNT GS++C+C  G+ L  D  TC                     QN R  +L                         RRCP G FGE C   CS+C + G CN D T C C P + G +C   C +    V CQ   C C     C+  T  C CP G  G+ C++ GC  G++G++C++ CP  C ++RC + TG+C C PG YGS CHL CP GTWG    + C   C        GC P+ GKC C+ GY    C++ C  G FG DC  +C  DC   C+  TG+C      G     C  DCP G  G+ C K C C  +S    +SC    G C C  G+ G  C+++C  G YG  C   C C    + CD VTG+C+CAD   G             +  ACP G+WGP C + CDC     C++  G C+C AG+ G +C ++CPEG YG  C + C C++G CD  SG C C PGW   +C+  C  G+YG  C+ +C C NG  C+    +C+C+ GW+G  C+ SC  G +G+NC   C C     G  CD ++G+C C PG  G  C E C    +G +C++ C CL G  C P  G C C  G +G+ CEL+CP  ++  NC   C C          KCD  TG+C CP+   G  C+ +    K   DC   C+C    S C+ VTG+C C  G  GP C Q C  G FG +CK +C CA+  PC+   G C C  G  G  C + C +G +G NC+ +C+   R  N  C P  G C C +G     C  +CP+GY+G  CQ  C+C +   C+P  G C C SGFYG  C   CPN FYG  C+ RC C H   C+ VTG C C     GR CE +
Sbjct:   24 TFAEPRVHVRVNDRRSGVAYFVPHDSPAANSGSAVVPSSEKDEVRRLLMEEISSVPE-----EPELTYGMPNVCKDPNPQPVPVRRKYRTPYKKLTKIWEPNCGFEGNWCLRYKQQTQYLIHYKSVLKVSDKDRYQCCSGFIQLPGHEGCVPKSNCSAYVQATKPCKNGGLCYQQNGIVRCNCPAGFTGVNCQIQIDDCASGTGDCQKDCAKNPKSKVCRCPAGYFLAPDRRRCLDIDECKYKRGGCMYFCENLPGGYRCACPSDMMLAADKISCIPFFDPCKHPPNGDCEHICTTLPGYRYVCSCQPGYRLADDKKRCIAQDLCKENNGGCQHDCRT--VNGEVRCSCHDGYQPAPYDAKKCVDINECAQDNGGCQHQCRNVDGSFSCECNPGWQLGNDGKTCYRVLLEMSDPCQFGNGGCTHICLRTEQGTAECACNPGYDLQADGRTCRDRDECLTGEAACHGPAVICTNEIGTYRCECQPGFRLAADGHSCQDIDECLSYNGGCQYKCVNTPGSFQCLCNLGDELNPDGLTCSRSTKYVRDDASQAIFVDSPGQNRRQINLNGPHSSTIHAVQTFSKKHFLLDAMGRRCPTGRFGENCQLTCSHCENGGRCNRDLTACDCAPGFYGPVCHEKCPKGRWGVGCQEY-CDCIEDIPCDPHTGHCQCPIGRHGDRCDLSGCQPGYWGQSCDRPCPDNCGTSRCERETGQCACAPGTYGSRCHLSCPEGTWGHLCRLRCPAECKGPGKKSRGCHPETGKCVCEPGYRAPECIFPCQRGTFGTDCRQTC-YDCTDGCDPVTGRCNVLCPAGKRGPKCDEDCPDGYWGAQCLKQCQCGIDSTGRPLSCNPLTGHCVCKAGYRGTHCDIRCELGTYGPGCTKKCDCGPGEVGCDPVTGLCHCADGTVGIRCGMQNDRYISDEEPACPPGRWGPKCTKTCDCVNGVECNKRTGVCVCFAGFNGTRCDQKCPEGKYGPNCVETCACVHGACDHRSGACECEPGWRNMLCDRECAPGFYGLDCQHRCNCTNGAECNPATGECRCQAGWYGVTCDHSCPEGKFGKNCAETCDCARDVPGIQCDKVNGRCICPPGRTGPRCAESCSEGFWGESCSRTCACLRGASCDPATGKCHCGPGWYGEACELSCPEGRWDRNCQRECECSGNSRNPVGGKCDRFTGKCQCPEGLSGPRCQERCPPGKYGPDCHLACRCHQPGSRCDPVTGECHCPAGWTGPVCEQPCPSGFFGPECKHRCTCASSRPCHHETGMCRCPPGTRGAQCQETCPEGRWGENCQNECVCHERNPNMICDPVDGSCHCRSGWQGPSCVSRCPAGYFGTDCQHQCKCENYGLCHPDNGTCICASGFYGERCALPCPNGFYGRQCKQRCGCIHGEACHGVTGACYCASGYRGRHCEQT 1421          

HSP 2 Score: 436.032 bits (1120), Expect = 1.204e-124
Identity = 382/1246 (30.66%), Postives = 534/1246 (42.86%), Query Frame = 3
Query:  654 GGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINC---IPFIHPCDSANKG------GCTHHCVKL-----SDMRFICSCPDGH-ILDKDRRSCSVVDLCKDNNGGCSH-----LCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGW---QIGHDHKSCYKVDMELTDPCKYGNG---GCTQFCNSSPNKRAI--CSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCIN--------DLGSYLCTCPVGYRLRKNKMTCED-------IDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCS----NCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQN-------------PSQVECQPLQ--CHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQ-GNNSIGCQRDCPTGGSGSDCRKTCDCSEN--SVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK-CE-ACPSGKWGPTCNQNCDCTYST------GCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIY--GNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGG---LCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCP-------------------------------------------PDKYGPNCLH---NCICKATEK-----------------------------------------------CDLKTGECTCPKSAFGLSC-EIKNCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEP--CNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQF 3869
            G + C+C PG+ ++ +G +C DI+EC+     C ++CVN PG F+C C     L PD + C     ++   D A++       G     + L     S +  + +    H +LD   R C      ++    CSH      C  D    +  C C PG+   V     C +         GCQ  C  +E    CD H G     IG     C   D+    P  +G      C   C +S  +R    C+C PG       L+C +       + +C  P+ C             +  C C  GYR  +    C+           C D T GC        G    +CP G+              RG    +D   CP G +G +CL  C     +      CN     C+C   Y GT C+I C                P +V C P+   CHC +G    +  ++C           E  C  G +G  C K C    +   C++ TG C+CF G+ G+ C   CP G +G  C +TC+C       CD ++G C+C+ G+  + C  +C PG++GLDC   C       CN  TG+C    CQ G   + C   CP G  G +C +TCDC+ +   + C++ NG C C PG TG RC   C++G +GE C  +C C +   CD  TG C+C    +G+ CE +CP G+W   C + C+C+ ++       CD+  G+C C  G  GP+C +RCP G YG  C   C+C      CDP++G C C  GW G +CE PC  G++G +CK +C C +   C      C+C PG  G  C+++C  G +G NC+  C CH      +CD + G C C  GW+G +C  RCP+  +G +C   C+C N G CHP+NG C C +G +G+ C L CP                                              YGP C H    CI K   +                                               C  +TG+C CP    G  C EI   D     C Q C C     C+ VTG+C C+PG  GP C   C +G +G+ C + C C N +P  C+PV G C C  G+TG  C++VC +G+YG  C   C  C     CH +TGQC C+ G     C   CP G +G  C Q C C +GA+C PSTG CQC +GF G  C  
Sbjct:  492 GTYRCECQPGFRLAADGHSCQDIDECLSYNGGCQYKCVNTPGSFQCLCNLGDELNPDGLTCSRSTKYVR--DDASQAIFVDSPGQNRRQINLNGPHSSTIHAVQTFSKKHFLLDAMGRRCPTGRFGENCQLTCSHCENGGRCNRD----LTACDCAPGFYGPV-----CHEKCPKGRWGVGCQEYCDCIE-DIPCDPHTGHCQCPIGRHGDRC---DLSGCQPGYWGQSCDRPCPDNCGTSRCERETGQCACAPGTYGSRCHLSCPEGTWGHLCRLRC--PAECKGPGKKSRGCHPETGKCVCEPGYRAPECIFPCQRGTFGTDCRQTCYDCTDGCD----PVTGRCNVLCPAGK--------------RGPKCDED---CPDGYWGAQCLKQCQCGIDSTGRPLSCNPLTGHCVCKAGYRGTHCDIRCELGTYGPGCTKKCDCGPGEVGCDPVTGLCHCADG----TVGIRCGMQNDRYISDEEPACPPGRWGPKCTKTCDCV-NGVECNKRTGVCVCFAGFNGTRCDQKCPEGKYGPNCVETCACVHG---ACDHRSGACECEPGWRNMLCDRECAPGFYGLDCQHRCNCTNGAECNPATGEC---RCQAGWYGVTCDHSCPEGKFGKNCAETCDCARDVPGIQCDKVNGRCICPPGRTGPRCAESCSEGFWGESCSRTCACLRGASCDPATGKCHCGPGWYGEACELSCPEGRWDRNCQRECECSGNSRNPVGGKCDRFTGKCQCPEGLSGPRCQERCPPGKYGPDCHLACRCHQPGSRCDPVTGECHCPAGWTGPVCEQPCPSGFFGPECKHRCTCASSRPCHHETGMCRCPPGTRGAQCQETCPEGRWGENCQNECVCHERNPNMICDPVDGSCHCRSGWQGPSCVSRCPAGYFGTDCQHQCKCENYGLCHPDNGTCICASGFYGERCALPCPNGFYGRQCKQRCGCIHGEACHGVTGACYCASGYRGRHCEQTCARGTYGPQCSHECPTCIIKTPAEIESRDTALRPTFSTGTSNGNRISRFAVDSGNLVATMWRASSMQTEVTCHPQTGQCPCPPGTRGQDCSEICPPDRFGPMCSQVCTCQNGGKCSPVTGECHCRPGFYGPLCQHTCPYGRYGVGCAEVCDCYNTQPSECDPVTGRCRCKPGYTGDRCEEVCPRGYYGEMCARACFQCEH---CHFETGQCLCDLGRFGETCGSICPDGRFGDGCSQTCDCKNGATCTPSTGTCQCYAGFIGPDCSL 1685          
BLAST of Multiple epidermal growth factor domains protein 6 vs. TrEMBL
Match: A0A4Z2DCC1 (Multiple epidermal growth factor-like domains protein isoform 4 OS=Schistosoma japonicum OX=6182 GN=EWB00_002369 PE=4 SV=1)

HSP 1 Score: 906.746 bits (2342), Expect = 0.000e+0
Identity = 524/1339 (39.13%), Postives = 744/1339 (55.56%), Query Frame = 3
Query:  225 MPNVCEVEQRQMIRVRRTVEVPRSKEVKVWKANCRFKGDWCLVHENKSFVEKTETSQIQMVPSIKYECCEGYAELSGYRGCIPKPNCEERIGK--YCQNGAFCYQSGYNAKCICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPST-CINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQ-----------------NQNTRGSSLQK-------------------DPR---RCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEI-GCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSC----NQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSE----NSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRL-CDHVTGICYCADVAFG-KCE------------ACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHN---GGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEK------CDLKTGECTCPKSAFGLSCEIKNCDSKE-SDCRQDCQCSIKKS-CNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKL--KCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVSVI 4007
            MPNVC     +  + R+ +++P +K  +VW+ NC  +G+WC+ ++ ++       +  +  P  ++ CC G+    GY GC+P  NC   + +   CQNG  CY++     C CPKGF G+ C     +C E+N  C+ +C    G   CKCPPGY ++ + + C+DI+EC  +R  C + C NLPGG+RC CP DM+L PD+I+CIPF +PC+    G C H C  L   R++CSC  G+ L ++++ C   + C+ NNGGC H C +   + V+ C C  GY I   D K+C DINEC+  NGGCQ +C NV+GS+ CDC+PGWQ+G+D KSCY++ +E++DPC++ NGGCT  C  + +  A CSC PG+ L+ DG TCSD DEC+ G+  C   +  CIN+ G+Y C C  G+R+  +  +C+DIDECLD  GGC ++CVNT G +RC+C  G+ L  D +TC                  NQN +  +++                    DP+    C  G FG +C   CS+C + G CN D TGC C   + G  CE  C +      C+   C C N   C+S +  C CP G+ G  CE+ GC  GF+G +C++ CP  C++N+C +  G C C PG YGS CHL CP  TWG  CS  C      +Q + +GCDP+ G+C CK GY    C+  C P YFG +C  +C  DC   C+  TG+C  +   G +   C+ DCP G  G  C K C C      N  +C+  NG+C C  G+ G++C+  C  G YG  C+  CQC   ++ CD VTG+C C +   G KC             +CP G+WG +C + C+C  S  C +  G C+C  G+ G KC ++C +G +G  C++ C C++G+CD  SG C C PGW   +C  PC  G+YG  C+++C C NG  CD     C+C  GW+G  C++ C+ G YG+NC  +C C +   G  CD ++G+C C PG  G  C E CPS  +G +C++ C CL G  C P NG C+C  G +G+ CEL C    +G  C   C C A  +      CD  TGEC CP+   G  C+ K    +  +DCR  C C    S C+ VTG C+C PG  G  C + C  G +G++CKQ+C CA+G+PC+   G C C +G  G  C+  C +G +G +C+    C + N N  C P  G C C  G +  +C  +CP+GY+G  CQ  C+C +   C+P  G C C +G+YG  CQ  CP  FYG  C+ +C+C H   CN +TG C C     G+ CE + +
Sbjct:    1 MPNVCSETNPKPRQFRQRIQIPYTKLTRVWEPNCEAEGNWCIKYKEQTHYAVHYKTVFKTTPEKQFRCCPGFTRQPGYEGCVPISNCSTFLKESVTCQNGGLCYENASTVYCNCPKGFTGSRCQLMTGDCNESNNYCQNDCGRTPGSNTCKCPPGYFLAADKRRCLDIDECKYDRGGCMYFCENLPGGYRCACPSDMVLAPDKISCIPFFNPCEHPPNGDCEHICTSLPGYRYMCSCKPGYHLAENKKRCLPDNPCQVNNGGCQHECHN--VNGVVHCSCHEGYQIVSYDSKKCTDINECSTNNGGCQQLCRNVDGSYSCDCNPGWQLGNDGKSCYRIVLEVSDPCQFDNGGCTHICARTDSGTAECSCRPGYDLQVDGRTCSDRDECLIGEANCYGQAVICINEPGTYRCECQRGFRISPDGHSCQDIDECLDDNGGCEFQCVNTIGDHRCLCDFGDELNPDGRTCSRSSNYVRDDSSALFTPTNQNRKQLNMRPIQRIVVGDVHQFSKIRTTFDPKGSSLCLPGRFGPDCSLTCSHCENGGRCNRDLTGCDCPSGFKGITCEEKCPKGFWGANCRQY-CDCANNVACDSISGICQCPLGLHGARCELSGCQVGFWGPHCDRLCPNHCATNQCDREKGHCTCAPGMYGSHCHLSCPENTWGEMCSLKCPAECLESQRHTKGCDPQTGECICKPGYQSPECILPCPPSYFGFNCKMTC-FDCPNGCDTVTGRCIVECPPGKHGSTCEEDCPAGYWGPQCSKRCRCGYDEKGNLRTCDTTNGVCTCKAGYRGEKCDEPCETGTYGPNCRFKCQCGISKIGCDPVTGLCQCPNGIIGHKCNMQNDIYSSDEEPSCPPGRWGKSCTEICNCKNSVECHKDTGVCVCFPGFVGDKCDQKCEKGKFGLNCTETCACVHGSCDHRSGACECEPGWRNMLCNKPCAPGFYGSDCQQRCLCTNGAECDPVTGDCECNEGWYGPACDQPCSEGTYGKNCVKKCDCADDIPGVSCDKVTGRCICPPGRTGQRCSELCPSGFWGESCSRTCACLRGATCDPVNGKCRCSLGWYGEACELPCQTGYWGEGCSIRCQCSANPRSPEGGECDRFTGECHCPQGFTGPRCQDKCPPGRYGTDCRLSCPCQKPGSRCDPVTGACECPPGWFGATCERPCLLGFYGINCKQRCSCASGQPCHHETGLCSCPAGKYGPQCEDTCPEGRWGEDCQRLCDCHLKNNNMLCDPVHGICYCRPGWLGPNCISRCPAGYFGINCQHECKCENNGVCHPDNGTCICQAGYYGERCQLSCPPGFYGLQCKQKCECIHGEACNEITGECYCSAGYHGKKCEQTCL 1335          

HSP 2 Score: 369.007 bits (946), Expect = 6.384e-102
Identity = 284/829 (34.26%), Postives = 384/829 (46.32%), Query Frame = 3
Query: 1632 RGSSLQKDPRRCPKGTFGEECLFNCS-NCMHKG---YCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGT-CESETLKCNCPPGISGEIC-----------EIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSEN--SVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK-CEA-CPSGKWGPTCNQNCDCTYSTG------CDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIY--GNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCH---NGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPD-------------------------------------------KYGPNCLHNCICKATEKCDLKTGECTCPKSAFGL-SCEIKNCDSKESDCRQDCQCSIKK---------SCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKT-CHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALC 3863
             GS+ ++D   CP G +G +C   C      KG    C+     C C   Y G  C+  C        C+  +C C      C+  T  C CP GI G  C           E  C  G +G++C + C    +S  CH+ TG C+CFPG+ G  C   C  G +G+ C++TC+C   +   CD ++G C+C+ G+  + C   C PG++G DC   C       C+  TG C  +  +G     C + C  G  G +C K CDC+++   VSC++  G C C PG TG+RC   C  G +GE C  +C C +   CD V G C C+   +G+ CE  C +G WG  C+  C C+ +        CD+  G+C C  G+ GP+C  +CP G YG  C   C C      CDP++G C C PGW G  CE PC  G+YG  CK++C C +G  C      C C  G +G  CE +C  G +G +C+  C CH   N  LCD + G C C PGW G NC  RCP+  +G NC   C+C N G CHP+NG C C AG +G+ C+L+CPP                                             YGP C   C    T   D  T +      A  +      +   +  +  ++   +I K         +C+  TG+C C PG  G  C   C    FG DC Q C C NG  C+ + GTC C SGF G LC   C  G +G  C   C   N   + C P+TG+C C+ G     C+  CP GY+G +C QACQ  H   C+  TG C C  G YG  C
Sbjct:  738 HGSTCEED---CPAGYWGPQCSKRCRCGYDEKGNLRTCDTTNGVCTCKAGYRGEKCDEPCETGTYGPNCR-FKCQCGISKIGCDPVTGLCQCPNGIIGHKCNMQNDIYSSDEEPSCPPGRWGKSCTEICNCK-NSVECHKDTGVCVCFPGFVGDKCDQKCEKGKFGLNCTETCACVHGS---CDHRSGACECEPGWRNMLCNKPCAPGFYGSDCQQRCLCTNGAECDPVTGDC--ECNEGWYGPACDQPCSEGTYGKNCVKKCDCADDIPGVSCDKVTGRCICPPGRTGQRCSELCPSGFWGESCSRTCACLRGATCDPVNGKCRCSLGWYGEACELPCQTGYWGEGCSIRCQCSANPRSPEGGECDRFTGECHCPQGFTGPRCQDKCPPGRYGTDCRLSCPCQKPGSRCDPVTGACECPPGWFGATCERPCLLGFYGINCKQRCSCASGQPCHHETGLCSCPAGKYGPQCEDTCPEGRWGEDCQRLCDCHLKNNNMLCDPVHGICYCRPGWLGPNCISRCPAGYFGINCQHECKCENNGVCHPDNGTCICQAGYYGERCQLSCPPGFYGLQCKQKCECIHGEACNEITGECYCSAGYHGKKCEQTCLPGTYGPQCSLICPVCHTRVTDSNTLDSLLLSEASSIPDNTFLSSQYQSKETIKNTNIAILKRLNENQNNPACHPQTGQCPCPPGSEGKDCSTPCPKDRFGPDCAQVCTCQNGATCSSITGTCNCRSGFYGPLCQYTCPPGRWGVGCASVCDCYNSQPSGCDPKTGRCRCKPGYTGERCEEVCPRGYFGEMCAQACQ--HCEDCHFETGQCLCQLGHYGETC 1554          

HSP 3 Score: 326.25 bits (835), Expect = 1.252e-87
Identity = 272/800 (34.00%), Postives = 362/800 (45.25%), Query Frame = 3
Query: 1428 DLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKC---VNTDG----SYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQN-NYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVS-----CEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKD-RLCDHVTGICYCADVAFGK-CE-ACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN----CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQC------------------------------------------------LNGGKCHP----ENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKES-DCRQDCQC--SIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILC 3602
            D  + +CTC  GYR  K    C++  E   Y   C +KC   ++  G    +  C CPNG    K    C  QN   SS ++    CP G +G+ C   C NC +   C+ D   C+C P + G  C+  C +    + C    C C +G +C+  +  C C PG    +C   C  GF+G +C++ C    +   C  +TG C C  GWYG +C   C  GT+G  C K C C  +     CD   G+C C  G  G  C   C  G++G  CS +C       C+   G+C  +   G     C+  C TG  G  C   C CS N  S     C+   G CHC  GFTG RC+ KC  G YG  C+ SC C+K    CD VTG C C    FG  CE  C  G +G  C Q C C     C    G C C AG YGP+C   CPEG +GE C + C C   N    CDP+ GIC C PGW G  C + C  GY+G  C+ +CKC N G C      C C+ G++GE C+ SC  G+YG  C+ +C+C +G  C+ I+G+C C  G+ G  C++ C   TYGP C+ +C                                                  LN  + +P    + G C CP G  G  C   CP D++GP+C   C C+    C   TG C C    +G  C+      +    C   C C  S    C+  TG+C+CKPG  G +C ++C  G FG  C Q C+  + E C+   G CLC  G  G  C
Sbjct:  773 DTTNGVCTCKAGYRGEK----CDEPCETGTYGPNCRFKCQCGISKIGCDPVTGLCQCPNGIIGHK----CNMQNDIYSSDEEP--SCPPGRWGKSCTEIC-NCKNSVECHKDTGVCVCFPGFVGDKCDQKCEKGKFGLNCTET-CACVHG-SCDHRSGACECEPGWRNMLCNKPCAPGFYGSDCQQRC-LCTNGAECDPVTGDCECNEGWYGPACDQPCSEGTYGKNCVKKCDCADDIPGVSCDKVTGRCICPPGRTGQRCSELCPSGFWGESCSRTCACLRGATCDPVNGKC--RCSLGWYGEACELPCQTGYWGEGCSIRCQCSANPRSPEGGECDRFTGECHCPQGFTGPRCQDKCPPGRYGTDCRLSCPCQKPGSRCDPVTGACECPPGWFGATCERPCLLGFYGINCKQRCSCASGQPCHHETGLCSCPAGKYGPQCEDTCPEGRWGEDCQRLCDCHLKNNNMLCDPVHGICYCRPGWLGPNCISRCPAGYFGINCQHECKCENNGVCHPDNGTCICQAGYYGERCQLSCPPGFYGLQCKQKCECIHGEACNEITGECYCSAGYHGKKCEQTCLPGTYGPQCSLICPVCHTRVTDSNTLDSLLLSEASSIPDNTFLSSQYQSKETIKNTNIAILKRLNENQNNPACHPQTGQCPCPPGSEGKDCSTPCPKDRFGPDCAQVCTCQNGATCSSITGTCNCRSGFYGPLCQYTCPPGRWGVGCASVCDCYNSQPSGCDPKTGRCRCKPGYTGERCEEVCPRGYFGEMCAQACQ--HCEDCHFETGQCLCQLGHYGETC 1554          

HSP 4 Score: 208.379 bits (529), Expect = 2.253e-50
Identity = 245/810 (30.25%), Postives = 322/810 (39.75%), Query Frame = 3
Query:  783 FRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFI---CSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKD------INECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGG--CTQFCNSSPNKR-----AICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCS-----NCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHC-KNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCN-QNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQ-GNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRL----------------------------------------------------CDHVTGICYCADVAFGK--CEACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN---CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKS 2969
            F+CQC      G  +I C P    C   N G   H C   +D+       SCP G    +  +SC+ +  CK+     S  C  D       C C PG+  D  D K  K          C   +G C H       S  C+C PGW+           +M    PC  G  G  C Q C  +           C C  G+   A    CS+     T    CV    C +D+    C    G  +     T +   E L  +G  G  C  T     C C  G T    N  C+   + G   +     C  G +GE C   C           G C+     C C   ++G  C+  C       +C+ L C C K G  C+  T  C CPPG  G  CE  C  GF+G NC++ C  A S   CH  TG C C  G YG  C   CP G WG  C + C C+ +NN   CDP +G C C+ G+ G NC+ +C  GYFG++C   C  +   +C+ + G C    CQ G     CQ  CP G  G  C++ C+C     +C E  G C+C+ G+ GK+CE  C  G YG +C   C     R+                                                    C   TG C C   + GK     CP  ++GP C Q C C     C  I G C C +G+YGP C   CP G +G GC+  C C       CDP +G CRC PG+ GE CE  C  GY+G+ C + C+  +   C     +C C+ G +GE C  S
Sbjct:  805 FKCQC------GISKIGCDPVTGLCQCPN-GIIGHKCNMQNDIYSSDEEPSCPPG----RWGKSCTEICNCKN-----SVECHKDTG----VCVCFPGFVGDKCDQKCEKGKFGLNCTETCACVHGSCDHR------SGACECEPGWR-----------NMLCNKPCAPGFYGSDCQQRCLCTNGAECDPVTGDCECNEGWYGPACDQPCSEG----TYGKNCVKKCDCADDIPGVSCDKVTGRCICPPGRTGQRCSE-LCPSGFWGESCSRT-----CACLRGATCDPVNGKCRC--SLGWYGEACELPCQTGYWGEGCSIRCQCSANPRSPEGGECDRFTGECHCPQGFTGPRCQDKCPPGRYGTDCR-LSCPCQKPGSRCDPVTGACECPPGWFGATCERPCLLGFYGINCKQRCSCA-SGQPCHHETGLCSCPAGKYGPQCEDTCPEGRWGEDCQRLCDCHLKNNNMLCDPVHGICYCRPGWLGPNCISRCPAGYFGINCQHECKCENNGVCHPDNGTC---ICQAGYYGERCQLSCPPGFYGLQCKQKCECIHGE-ACNEITGECYCSAGYHGKKCEQTCLPGTYGPQCSLICPVCHTRVTDSNTLDSLLLSEASSIPDNTFLSSQYQSKETIKNTNIAILKRLNENQNNPACHPQTGQCPCPPGSEGKDCSTPCPKDRFGPDCAQVCTCQNGATCSSITGTCNCRSGFYGPLCQYTCPPGRWGVGCASVCDCYNSQPSGCDPKTGRCRCKPGYTGERCEEVCPRGYFGEMCAQACQ--HCEDCHFETGQCLCQLGHYGETCGSS 1557          

HSP 5 Score: 104.375 bits (259), Expect = 1.763e-18
Identity = 107/376 (28.46%), Postives = 142/376 (37.77%), Query Frame = 3
Query: 1665 CPKGTFGEEC--LFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSC---------------------------------------------------NQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVS-CEEKNGICHCAPGFTGKRCELKCTKGL----------------------------YGERCQSSCQCRKDRLCDHVTGI 2546
            CP+G +GE+C  L +C    +   C+     C C P + G  C   C      + CQ  +C C+N G C  +   C C  G  GE C++ C  GF+G  C++ C        C++ITG+C C  G++G  C   C  GT+G  CS  C                                                     NQNN   C P+ G+C C  G  G +C   C    FG DC+  C       C+  TG C  ++  G     CQ  CP G  G  C   CDC  +  S C+ K G C C PG+TG+RCE  C +G                             YGE C SS Q        HV  +
Sbjct: 1202 CPEGRWGEDCQRLCDCHLKNNNMLCDPVHGICYCRPGWLGPNCISRCPAGYFGINCQ-HECKCENNGVCHPDNGTCICQAGYYGERCQLSCPPGFYGLQCKQKCECI-HGEACNEITGECYCSAGYHGKKCEQTCLPGTYGPQCSLICPVCHTRVTDSNTLDSLLLSEASSIPDNTFLSSQYQSKETIKNTNIAILKRLNENQNN-PACHPQTGQCPCPPGSEGKDCSTPCPKDRFGPDCAQVCTCQNGATCSSITGTCNCRS--GFYGPLCQYTCPPGRWGVGCASVCDCYNSQPSGCDPKTGRCRCKPGYTGERCEEVCPRGYFGEMCAQACQHCEDCHFETGQCLCQLGHYGETCGSSKQSPHTSKYVHVVNM 1572          
BLAST of Multiple epidermal growth factor domains protein 6 vs. TrEMBL
Match: A0A4S2LUT3 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004930 PE=4 SV=1)

HSP 1 Score: 895.96 bits (2314), Expect = 0.000e+0
Identity = 534/1407 (37.95%), Postives = 746/1407 (53.02%), Query Frame = 3
Query:   15 GAYKHIQILIHFFDKNCKAS*YQRHQIIFIYQLS*QIL*KYEMRFAIIFFLTIQIIPKLSGAGSQKLELGMPNVCEVEQRQMIRVRRTVEVPRSKEVKVWKANCRFKGDWCLVHENKSFVEKTETSQIQMVPSIKYECCEGYAELSGYRGCIPKPNCEERIGKY--CQNGAFCYQSGYNAKCICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPST-CINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQ-----------------------------NQNTR--GSSLQKDPRR----------CPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEI-GCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCS--CNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENS----VSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQC-RKDRLCDHVTGICYCADVAFG-KC------------EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHN---GGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKAT------EKCDLKTGECTCPKSAFGLSCEIKNCDSKES-DCRQDCQC-SIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCK--LKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVS 4001
            GAY  + +LI  F  +  A+            ++            ++  L   +  + S A    L+  MPNVC     +   + +  + P  K  K+W+ NC + G+WC+ ++ ++       + +++    +Y CC G+ +  G  GC+PK NC + +     C+NG  CY++    +C CP GF G  C   +++C    G C+K+C       YC+CP GY ++ + + C+DI+EC  NR  C + C NLPGG+RC CP DM+L  D+I+CIPF  PC     G C H C  L   R++CSC  G+ L  D++ C   D C++NNGGC H C++   +    C C  GY +   D ++C DINEC+  NGGCQH C NV+GS+ C+C+PGWQ+G+D K+CY+V +E+TDPC++GNGGCT  C  + +  A C+C PG+ L+ADG TC D DEC+TG+  C  P+  C+N++GSY C C  G+RL  +  +C+DIDECL+Y GGC +KCVNT GS++C+C  G+ L  D  TC                              N NTR   S +Q   R+          CP G FG++C   CS+C + G CN D TGC C   Y G  C   C  N     C+ L C C  G  C+  +  C CP G  G+ CEI GC  G++G +C++ CP  C++N+C + TG+C C PG YG+ CHL CP GTWG  C K+CS  C      GC P+ G+C C+ GY    C+  C  GYFG+DC  +C E C   C+  +G+C  +   G     C++DC  G  G+ C K C C  +S    V+C  + G C C  G+ G RCE++C  G YG  C+  C+C      CD VTG+C+C D   G KC             ACP G+WGP C + CDC +   C++  G C+C AGY G +C ++CP G YG  C + C C +G CD ISG C C PGW    C+  C  G+YG  C+ +C+C NG  CD     C+C  GWHG  C++ C  G YG+ C   C C +   G  CD ++G C C PG  G  C + CP   +G  C + C CL    C P  G C+C +G +G+ CEL CP  ++G  C+  C C          +CD  TG C CP+  +G  C+ +    K   +C+  C C  +   C+ VTG C+C PG  G  C Q C  G +G++CKQ+C C +  PC+   G C C     G  C   C +  +G +C     C   N N  C P  G C C  G    +C  +CP+G++G  CQ  C+C +   C+P  G C C  GFYG  C   CPN F+G  C+ RC+C H   C+ VTG C C     GR CE +
Sbjct:    5 GAYCFLFVLIISFSLHESANAQNSPSPKLPQSVN------RASEAEVVRLLNENVESEDSEA--PDLQPQMPNVCRDPNPRPRTIHQKYKTPYIKLTKMWEPNCGYPGNWCIRYKQQTHYVTHYKTIVKIPDKDQYRCCPGFTQQPGMEGCVPKSNCSQFVQSAFSCKNGGLCYENNGVVRCSCPAGFTGVHCQIQIDDCASGTGDCQKDCALNPKSSYCRCPAGYFLAPDRRRCLDIDECKYNRGGCMYFCENLPGGYRCACPSDMMLAADKISCIPFFDPCKHPPNGDCEHICTTLPGYRYVCSCRPGYRLADDKKRCLPHDPCQENNGGCQHDCRA--VNGEPHCSCHEGYQVSPQDPRKCTDINECSQDNGGCQHQCRNVDGSYSCECNPGWQLGNDGKTCYRVLLEVTDPCQFGNGGCTHICLRTDSNSAECACRPGYDLQADGRTCRDRDECLTGEAACYGPAVVCVNEIGSYRCECQAGFRLSADGHSCQDIDECLNYNGGCQHKCVNTPGSFQCLCNLGDELNPDGLTCSRSTKYVRDEGFDTSQAIVIGSPGQGRRQINTNTRVQESGVQVFTRKRIPVDSNGLPCPAGRFGDDCQLTCSHCENGGRCNRDLTGCDCPSGYHGLTCHDMCAPNRWGFGCREL-CDCMEGIPCDPNSGICKCPVGRHGDKCEIAGCQPGYWGRDCDRMCPDHCATNQCERDTGQCTCAPGTYGAQCHLSCPEGTWGEMCQKSCSKECTGGKTRGCHPQTGQCICQPGYRPPECILPCPRGYFGMDCRQTCFE-CTGGCDPVSGKCTIQCPPGKQGPRCEQDCDEGYWGTHCTKRCQCGIDSNGRPVACNPQTGECICKAGYRGARCEIRCEPGTYGPGCEKKCECGLGATACDPVTGLCHCEDGTVGTKCGMQNDRFASNDEPACPPGRWGPKCTKICDCVHGVECNKQTGLCVCFAGYNGTRCDEKCPPGKYGPNCIETCACQHGTCDHISGACECEPGWRNMHCDRLCAPGFYGLDCQHRCQCTNGAECDPQTGVCRCAAGWHGTACDRPCPEGRYGKGCSETCDCASDIPGISCDRVTGHCLCPPGRTGPRCADTCPEGLWGDGCVRTCACLRAATCDPFTGRCKCGSGWYGEACELPCPDGRWGEECVRECECSVDGHGGRGGRCDRFTGTCQCPEGYYGPKCQDRCPPGKYGPNCQLSCNCRQVGAVCDAVTGTCRCPPGWTGASCEQPCPDGYYGVECKQRCACPSDRPCHHETGACRCPPATYGPRCQYNCPEDRWGEDCANHCDCHQKNPNMVCDPVDGSCHCRPGWQGSNCVSRCPAGFFGSKCQYECKCENQGVCHPDNGTCICAPGFYGERCSLPCPNGFFGRQCKQRCECIHREACHGVTGQCYCAAGYRGRHCEET 1399          

HSP 2 Score: 540.036 bits (1390), Expect = 3.451e-162
Identity = 420/1262 (33.28%), Postives = 582/1262 (46.12%), Query Frame = 3
Query:  648 IDGGFYCKCPPGYEMS-ENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINC----IPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGC---SHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSP---------NKRAICSCLPGFK-----LEADGLTCSDE---DECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDG------SYRCVCPNGE-------------TLGKD-NKTC-----QNQNTR---------GSSLQKDPRRCPKGTFGEECLFNCSNCMHKGY---CNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSN----RCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYK-----------CDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYST---GCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCI-YGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCL------NGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHN-GGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEK---CDLKTGECTCPKSAFGLSCEIKNCDSK--ESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNR-------------------------------------------------NKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSP--CNPVTGHCVCPKKLSGRFCE 3995
            ++G  +C C  GY++S ++ + C DINEC ++   C H+C N+ G + C+C P   LG D   C    +    PC   N GGCTH C++       C+C  G+ L  D R+C   D C      C   + +C ++  S    C+C+ G+ +   D   C+DI+EC   NGGCQH C+N  GSF C C+ G ++  D  +C +    + D    G          SP         N R   S +  F      ++++GL C      D+C      C     C  DL    C CP GY    + +TC D+     +  GC   C   +G      S  C CP G                G+D ++ C      NQ  R         G+   +    CP+GT+GE C  +CS     G    C+     C+C P Y    C + C +    ++C+     C  G    S      CPPG  G  CE  C EG++G +C K C     SN     C+  TG+C+C  G+ G+ C + C  GT+G GC K C C       CDP  G C C+ G  G  C  +           C PG +G  C+  C       CN +TG C      G N   C   CP G  G +C +TC C   +  C+  +G C C PG+    C+  C  G YG  CQ  CQC     CD  TG+C CA    G      CP G++G  C++ CDC        CD++ G C+C  G  GP+C+  CPEGL+G+GC + C C+    CDP +G C+C  GW+GE CE PC +G +G++C  +C+C        GG CD F   CQC  G++G  C+  C  G YG NC+  C C   G +CD ++G C C PGW G +C++ CP   YG  C Q C C +   CH E G C+CP   +G  C+  CP D++G +C ++C C        CD   G C C     G +C +  C +    S C+ +C+C  +  C+   G C C PG  G +C   C  G FG  CKQ+C C + E C+ V G C C +G+ G  C++ C +G +GP CK +C VCN                                                  + TCHPQTG+C C  G     C+ +CPSG +GP C Q C C  GA+C+P TG+C+C +G+YG LCQ+ CP  +YG  C   C C++  P  C+ VTG C C     G  CE
Sbjct:  336 VNGEPHCSCHEGYQVSPQDPRKCTDINECSQDNGGCQHQCRNVDGSYSCECNPGWQLGNDGKTCYRVLLEVTDPCQFGN-GGCTHICLRTDSNSAECACRPGYDLQADGRTCRDRDECLTGEAACYGPAVVCVNEIGS--YRCECQAGFRLSA-DGHSCQDIDECLNYNGGCQHKCVNTPGSFQCLCNLGDELNPDGLTCSRSTKYVRD---EGFDTSQAIVIGSPGQGRRQINTNTRVQESGVQVFTRKRIPVDSNGLPCPAGRFGDDCQLTCSHCENGGRCNRDLTG--CDCPSGY----HGLTCHDMCAPNRWGFGCRELCDCMEGIPCDPNSGICKCPVGRHGDKCEIAGCQPGYWGRDCDRMCPDHCATNQCERDTGQCTCAPGTYGAQCHLSCPEGTWGEMCQKSCSKECTGGKTRGCHPQTGQCICQPGYRPPECILPCPRGYFGMDCRQTCFECTGGCDPVSGKCTIQCPPGKQGPRCEQDCDEGYWGTHCTKRCQCGIDSNGRPVACNPQTGECICKAGYRGARCEIRCEPGTYGPGCEKKCECGLGA-TACDPVTGLCHCEDGTVGTKCGMQNDRFASNDEPACPPGRWGPKCTKICDCVHGVECNKQTGLC--VCFAGYNGTRCDEKCPPGKYGPNCIETCACQHGT--CDHISGACECEPGWRNMHCDRLCAPGFYGLDCQHRCQCTNGAECDPQTGVCRCAAGWHGTACDRPCPEGRYGKGCSETCDCASDIPGISCDRVTGHCLCPPGRTGPRCADTCPEGLWGDGCVRTCACLRAATCDPFTGRCKCGSGWYGEACELPCPDGRWGEECVRECECSVDGHGGRGGRCDRFTGTCQCPEGYYGPKCQDRCPPGKYGPNCQLSCNCRQVGAVCDAVTGTCRCPPGWTGASCEQPCPDGYYGVECKQRCACPSDRPCHHETGACRCPPATYGPRCQYNCPEDRWGEDCANHCDCHQKNPNMVCDPVDGSCHCRPGWQGSNC-VSRCPAGFFGSKCQYECKCENQGVCHPDNGTCICAPGFYGERCSLPCPNGFFGRQCKQRCECIHREACHGVTGQCYCAAGYRGRHCEETCPRGSFGPECKFECPVCNMKSPGEIETTDTTLRPKVDWSQPGGRQELRIGVRTSSVVASMWRRPSDIGDVTCHPQTGECPCPPGTHGPGCEAKCPSGRFGPRCSQVCTCPQGATCSPITGSCECPAGYYGPLCQYTCPPGYYGKGCAQVCDCYNTQPSVCDTVTGVCHCKPGYMGDRCE 1578          

HSP 3 Score: 273.478 bits (698), Expect = 9.696e-71
Identity = 231/758 (30.47%), Postives = 329/758 (43.40%), Query Frame = 3
Query: 1302 NKRAICSCLPGFKLEADGLTCSDEDECVTGKH--KCVPPSTCIN---DLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQ-NQNTRGSSLQKDPRRCPKGTFGEEC--LFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSN-----RCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETG--QCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENS--VSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK--CEACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGY-------------YGPKCSKRCP------------------------------EGLYGEGCSKECQCIYG--------NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNG--GLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVC-QCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIK 3356
             +  +C C  G+    +G  C  +++C  GK+   C+    C +   D  S  C C  G+R     M C+ +         C       D  +RC C NG         C+      G++     R CP+G +G+ C    +C++ +    C+     CLC P  +G  C   C +      C    C C    TC+  T +C C  G  GE CE+ C +G +GE C + C  +   +     RC + TG C C  G+YG  C   CP G +G  C  +C+C Q     CD   G C+C  G+ G +C   C  GY+G++C   C       C+HETG  +CP  T        CQ +CP    G DC   CDC + +  + C+  +G CHC PG+ G  C  +C  G +G +CQ  C+C    +C    G C CA   +G+     CP+G +G  C Q C+C +   C  + GQC C AGY             +GP+C   CP                              E   G   S     ++          C P +G C C PG HG  CE  C  G +G +C + C C  G TC      C+C  G++G  C+ +C  GYYG+ C   C C+N    +CD ++G C C PG+ G  C++ CP   +G  C + C QC +   CH E G C C  G+ G+ C  TCP  ++G  C   C C+    C   TG C CP    G  C ++
Sbjct:  938 KQTGLCVCFAGY----NGTRC--DEKCPPGKYGPNCIETCACQHGTCDHISGACECEPGWR----NMHCDRL---------CAPGFYGLDCQHRCQCTNGAECDPQTGVCRCAAGWHGTACD---RPCPEGRYGKGCSETCDCASDIPGISCDRVTGHCLCPPGRTGPRCADTCPEGLWGDGCV-RTCACLRAATCDPFTGRCKCGSGWYGEACELPCPDGRWGEECVRECECSVDGHGGRGGRCDRFTGTCQCPEGYYGPKCQDRCPPGKYGPNCQLSCNCRQVGAV-CDAVTGTCRCPPGWTGASCEQPCPDGYYGVECKQRCACPSDRPCHHETGACRCPPAT----YGPRCQYNCPEDRWGEDCANHCDCHQKNPNMVCDPVDGSCHCRPGWQGSNCVSRCPAGFFGSKCQYECKCENQGVCHPDNGTCICAPGFYGERCSLPCPNGFFGRQCKQRCECIHREACHGVTGQCYCAAGYRGRHCEETCPRGSFGPECKFECPVCNMKSPGEIETTDTTLRPKVDWSQPGGRQELRIGVRTSSVVASMWRRPSDIGDVTCHPQTGECPCPPGTHGPGCEAKCPSGRFGPRCSQVCTCPQGATCSPITGSCECPAGYYGPLCQYTCPPGYYGKGCAQVCDCYNTQPSVCDTVTGVCHCKPGYMGDRCEQICPQGYHGEMCAKACHQCEH---CHFETGQCLCELGKEGETCGGTCPNGQFGAQCSETCNCRNGATCLPSTGMCQCPSWLIGPDCGLQ 1664          

HSP 4 Score: 141.739 bits (356), Expect = 5.863e-30
Identity = 217/798 (27.19%), Postives = 303/798 (37.97%), Query Frame = 3
Query:  552 CICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGFYCKCPPGYEMSENGKNCIDINECIRNRTD-CSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAI--DVNDVKQCKDINECNIKNGGCQHICLNVEGSF------ICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGG--CTQFCNSSPNKR-----------AICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTC-------INDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQ-NQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKG---YCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCS-CNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSC---PEDCKTI-CNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQC--RKDRLCDHVTGICYCADVAFG-KCE-ACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGW 2816
            C+C  G+ GT CD+                         KCPPG    + G NCI+   C     D  S  C   PG     C        DR+ C P  +  D  ++  CT+   +      +C C  G       R C      K    GCS  C        I+C    G+ +        +C D     +   GC   C  +  +        C C  GW         Y    EL  PC  G  G  C + C  S +               C C  G+     G  C  +D C  GK+      +C       + D  +  C CP G+     +  C D        G  G +C       RC CP+      +   C+    T G   Q +   CP+  +GE+C  +C +C  K     C+     C C P + G+ C   C       +CQ  +C C+N G C  +   C C PG  GE C + C  GFFG  C++ C        CH +TG+C C  G+ G  C   CP G++G  C   C  CN  +    +  +   + K  +       +   G        S    P D   + C+ +TG+CP     G +  GC+  CP+G  G  C + C C + + +C    G C C  G+ G  C+  C  G YG+ C   C C   +  +CD VTG+C+C     G +CE  CP G  G  C + C       C    GQC+C  G  G  C   CP G +G  CS+ C C  G  C P +G+C+C P W
Sbjct:  943 CVCFAGYNGTRCDE-------------------------KCPPG----KYGPNCIETCACQHGTCDHISGACECEPGWRNMHC--------DRL-CAPGFYGLDCQHRCQCTNG-AECDPQTGVCRCAAGWHGTACDRPCPEGRYGK----GCSETCDCASDIPGISCDRVTGHCLCPPGRTGPRCADTCPEGLWGDGCVRTCACLRAATCDPFTGRCKCGSGW---------YGEACEL--PCPDGRWGEECVRECECSVDGHGGRGGRCDRFTGTCQCPEGYY----GPKC--QDRCPPGKYGPNCQLSCNCRQVGAVCDAVTGTCRCPPGWTGASCEQPCPD--------GYYGVEC-----KQRCACPSDRPCHHETGACRCPPATYGPRCQYN---CPEDRWGEDCANHC-DCHQKNPNMVCDPVDGSCHCRPGWQGSNCVSRCPAGFFGSKCQ-YECKCENQGVCHPDNGTCICAPGFYGERCSLPCPNGFFGRQCKQRC-ECIHREACHGVTGQCYCAAGYRGRHCEETCPRGSFGPECKFECPVCNMKSPGEIETTDTTLRPKVDWSQPGGRQELRIGVRTSSVVASMWRRPSDIGDVTCHPQTGECPCPP--GTHGPGCEAKCPSGRFGPRCSQVCTCPQGA-TCSPITGSCECPAGYYGPLCQYTCPPGYYGKGCAQVCDCYNTQPSVCDTVTGVCHCKPGYMGDRCEQICPQGYHGEMCAKACH--QCEHCHFETGQCLCELGKEGETCGGTCPNGQFGAQCSETCNCRNGATCLPSTGMCQC-PSW 1655          
BLAST of Multiple epidermal growth factor domains protein 6 vs. TrEMBL
Match: A0A4S2LTQ9 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004930 PE=4 SV=1)

HSP 1 Score: 895.19 bits (2312), Expect = 0.000e+0
Identity = 534/1407 (37.95%), Postives = 746/1407 (53.02%), Query Frame = 3
Query:   15 GAYKHIQILIHFFDKNCKAS*YQRHQIIFIYQLS*QIL*KYEMRFAIIFFLTIQIIPKLSGAGSQKLELGMPNVCEVEQRQMIRVRRTVEVPRSKEVKVWKANCRFKGDWCLVHENKSFVEKTETSQIQMVPSIKYECCEGYAELSGYRGCIPKPNCEERIGKY--CQNGAFCYQSGYNAKCICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPST-CINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQ-----------------------------NQNTR--GSSLQKDPRR----------CPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEI-GCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCS--CNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENS----VSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQC-RKDRLCDHVTGICYCADVAFG-KC------------EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHN---GGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKAT------EKCDLKTGECTCPKSAFGLSCEIKNCDSKES-DCRQDCQC-SIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCK--LKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVS 4001
            GAY  + +LI  F  +  A+            ++            ++  L   +  + S A    L+  MPNVC     +   + +  + P  K  K+W+ NC + G+WC+ ++ ++       + +++    +Y CC G+ +  G  GC+PK NC + +     C+NG  CY++    +C CP GF G  C   +++C    G C+K+C       YC+CP GY ++ + + C+DI+EC  NR  C + C NLPGG+RC CP DM+L  D+I+CIPF  PC     G C H C  L   R++CSC  G+ L  D++ C   D C++NNGGC H C++   +    C C  GY +   D ++C DINEC+  NGGCQH C NV+GS+ C+C+PGWQ+G+D K+CY+V +E+TDPC++GNGGCT  C  + +  A C+C PG+ L+ADG TC D DEC+TG+  C  P+  C+N++GSY C C  G+RL  +  +C+DIDECL+Y GGC +KCVNT GS++C+C  G+ L  D  TC                              N NTR   S +Q   R+          CP G FG++C   CS+C + G CN D TGC C   Y G  C   C  N     C+ L C C  G  C+  +  C CP G  G+ CEI GC  G++G +C++ CP  C++N+C + TG+C C PG YG+ CHL CP GTWG  C K+CS  C      GC P+ G+C C+ GY    C+  C  GYFG+DC  +C E C   C+  +G+C  +   G     C++DC  G  G+ C K C C  +S    V+C  + G C C  G+ G RCE++C  G YG  C+  C+C      CD VTG+C+C D   G KC             ACP G+WGP C + CDC +   C++  G C+C AGY G +C ++CP G YG  C + C C +G CD ISG C C PGW    C+  C  G+YG  C+ +C+C NG  CD     C+C  GWHG  C++ C  G YG+ C   C C +   G  CD ++G C C PG  G  C + CP   +G  C + C CL    C P  G C+C +G +G+ CEL CP  ++G  C+  C C          +CD  TG C CP+  +G  C+ +    K   +C+  C C  +   C+ VTG C+C PG  G  C Q C  G +G++CKQ+C C +  PC+   G C C     G  C   C +  +G +C     C   N N  C P  G C C  G    +C  +CP+G++G  CQ  C+C +   C+P  G C C  GFYG  C   CPN F+G  C+ RC+C H   C+ VTG C C     GR CE +
Sbjct:    5 GAYCFLFVLIISFSLHESANAQNSPSPKLPQSVN------RASEAEVVRLLNENVESEDSEA--PDLQPQMPNVCRDPNPRPRTIHQKYKTPYIKLTKMWEPNCGYPGNWCIRYKQQTHYVTHYKTIVKIPDKDQYRCCPGFTQQPGMEGCVPKSNCSQFVQSAFSCKNGGLCYENNGVVRCSCPAGFTGVHCQIQIDDCASGTGDCQKDCALNPKSSYCRCPAGYFLAPDRRRCLDIDECKYNRGGCMYFCENLPGGYRCACPSDMMLAADKISCIPFFDPCKHPPNGDCEHICTTLPGYRYVCSCRPGYRLADDKKRCLPHDPCQENNGGCQHDCRA--VNGEPHCSCHEGYQVSPQDPRKCTDINECSQDNGGCQHQCRNVDGSYSCECNPGWQLGNDGKTCYRVLLEVTDPCQFGNGGCTHICLRTDSNSAECACRPGYDLQADGRTCRDRDECLTGEAACYGPAVVCVNEIGSYRCECQAGFRLSADGHSCQDIDECLNYNGGCQHKCVNTPGSFQCLCNLGDELNPDGLTCSRSTKYVRDEGFDTSQAIVIGSPGQGRRQINTNTRVQESGVQVFTRKRIPVDSNGLPCPAGRFGDDCQLTCSHCENGGRCNRDLTGCDCPSGYHGLTCHDMCAPNRWGFGCREL-CDCMEGIPCDPNSGICKCPVGRHGDKCEIAGCQPGYWGRDCDRMCPDHCATNQCERDTGQCTCAPGTYGAQCHLSCPEGTWGEMCQKSCSKECTGGKTRGCHPQTGQCICQPGYRPPECILPCPRGYFGMDCRQTCFE-CTGGCDPVSGKCTIQCPPGKQGPRCEQDCDEGYWGTHCTKRCQCGIDSNGRPVACNPQTGECICKAGYRGARCEIRCEPGTYGPGCEKKCECGLGATACDPVTGLCHCEDGTVGTKCGMQNDRFASNDEPACPPGRWGPKCTKICDCVHGVECNKQTGLCVCFAGYNGTRCDEKCPPGKYGPNCIETCACQHGTCDHISGACECEPGWRNMHCDRLCAPGFYGLDCQHRCQCTNGAECDPQTGVCRCAAGWHGTACDRPCPEGRYGKGCSETCDCASDIPGISCDRVTGHCLCPPGRTGPRCADTCPEGLWGDGCVRTCACLRAATCDPFTGRCKCGSGWYGEACELPCPDGRWGEECVRECECSVDGHGGRGGRCDRFTGTCQCPEGYYGPKCQDRCPPGKYGPNCQLSCNCRQVGAVCDAVTGTCRCPPGWTGASCEQPCPDGYYGVECKQRCACPSDRPCHHETGACRCPPATYGPRCQYNCPEDRWGEDCANHCDCHQKNPNMVCDPVDGSCHCRPGWQGSNCVSRCPAGFFGSKCQYECKCENQGVCHPDNGTCICAPGFYGERCSLPCPNGFFGRQCKQRCECIHREACHGVTGQCYCAAGYRGRHCEET 1399          

HSP 2 Score: 539.65 bits (1389), Expect = 2.769e-162
Identity = 420/1262 (33.28%), Postives = 582/1262 (46.12%), Query Frame = 3
Query:  648 IDGGFYCKCPPGYEMS-ENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINC----IPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGC---SHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSP---------NKRAICSCLPGFK-----LEADGLTCSDE---DECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDG------SYRCVCPNGE-------------TLGKD-NKTC-----QNQNTR---------GSSLQKDPRRCPKGTFGEECLFNCSNCMHKGY---CNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSN----RCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYK-----------CDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYST---GCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCL------NGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHN-GGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEK---CDLKTGECTCPKSAFGLSCEIKNCDSK--ESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNR-------------------------------------------------NKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSP--CNPVTGHCVCPKKLSGRFCE 3995
            ++G  +C C  GY++S ++ + C DINEC ++   C H+C N+ G + C+C P   LG D   C    +    PC   N GGCTH C++       C+C  G+ L  D R+C   D C      C   + +C ++  S    C+C+ G+ +   D   C+DI+EC   NGGCQH C+N  GSF C C+ G ++  D  +C +    + D    G          SP         N R   S +  F      ++++GL C      D+C      C     C  DL    C CP GY    + +TC D+     +  GC   C   +G      S  C CP G                G+D ++ C      NQ  R         G+   +    CP+GT+GE C  +CS     G    C+     C+C P Y    C + C +    ++C+     C  G    S      CPPG  G  CE  C EG++G +C K C     SN     C+  TG+C+C  G+ G+ C + C  GT+G GC K C C       CDP  G C C+ G  G  C  +           C PG +G  C+  C       CN +TG C      G N   C   CP G  G +C +TC C   +  C+  +G C C PG+    C+  C  G YG  CQ  CQC     CD  TG+C CA    G      CP G++G  C++ CDC        CD++ G C+C  G  GP+C+  CPEGL+G+GC + C C+    CDP +G C+C  GW+GE CE PC +G +G++C  +C+C        GG CD F   CQC  G++G  C+  C  G YG NC+  C C   G +CD ++G C C PGW G +C++ CP   YG  C Q C C +   CH E G C+CP   +G  C+  CP D++G +C ++C C        CD   G C C     G +C +  C +    S C+ +C+C  +  C+   G C C PG  G +C   C  G FG  CKQ+C C + E C+ V G C C +G+ G  C++ C +G +GP CK +C VCN                                                  + TCHPQTG+C C  G     C+ +CPSG +GP C Q C C  GA+C+P TG+C+C +G+YG LCQ+ CP  +YG  C   C C++  P  C+ VTG C C     G  CE
Sbjct:  336 VNGEPHCSCHEGYQVSPQDPRKCTDINECSQDNGGCQHQCRNVDGSYSCECNPGWQLGNDGKTCYRVLLEVTDPCQFGN-GGCTHICLRTDSNSAECACRPGYDLQADGRTCRDRDECLTGEAACYGPAVVCVNEIGS--YRCECQAGFRLSA-DGHSCQDIDECLNYNGGCQHKCVNTPGSFQCLCNLGDELNPDGLTCSRSTKYVRD---EGFDTSQAIVIGSPGQGRRQINTNTRVQESGVQVFTRKRIPVDSNGLPCPAGRFGDDCQLTCSHCENGGRCNRDLTG--CDCPSGY----HGLTCHDMCAPNRWGFGCRELCDCMEGIPCDPNSGICKCPVGRHGDKCEIAGCQPGYWGRDCDRMCPDHCATNQCERDTGQCTCAPGTYGAQCHLSCPEGTWGEMCQKSCSKECTGGKTRGCHPQTGQCICQPGYRPPECILPCPRGYFGMDCRQTCFECTGGCDPVSGKCTIQCPPGKQGPRCEQDCDEGYWGTHCTKRCQCGIDSNGRPVACNPQTGECICKAGYRGARCEIRCEPGTYGPGCEKKCECGLGA-TACDPVTGLCHCEDGTVGTKCGMQNDRFASNDEPACPPGRWGPKCTKICDCVHGVECNKQTGLC--VCFAGYNGTRCDEKCPPGKYGPNCIETCACQHGT--CDHISGACECEPGWRNMHCDRLCAPGFYGLDCQHRCQCTNGAECDPQTGVCRCAAGWHGTACDRPCPEGRYGKGCSETCDCASDIPGISCDRVTGHCLCPPGRTGPRCADTCPEGLWGDGCVRTCACLRAATCDPFTGRCKCGSGWYGEACELPCPDGRWGEECVRECECSVDGHGGRGGRCDRFTGTCQCPEGYYGPKCQDRCPPGKYGPNCQLSCNCRQVGAVCDAVTGTCRCPPGWTGASCEQPCPDGYYGVECKQRCACPSDRPCHHETGACRCPPATYGPRCQYNCPEDRWGEDCANHCDCHQKNPNMVCDPVDGSCHCRPGWQGSNC-VSRCPAGFFGSKCQYECKCENQGVCHPDNGTCICAPGFYGERCSLPCPNGFFGRQCKQRCECIHREACHGVTGQCYCAAGYRGRHCEETCPRGSFGPECKFECPVCNMKSPGEIETTDTTLRPKVDWSQPGGRQELRIGVRTSSVVASMWRRPSDIGDVTCHPQTGECPCPPGTHGPGCEAKCPSGRFGPRCSQVCTCPQGATCSPITGSCECPAGYYGPLCQYTCPPGYYGKGCAQVCDCYNTQPSVCDTVTGVCHCKPGYMGDRCE 1578          

HSP 3 Score: 220.32 bits (560), Expect = 4.181e-54
Identity = 175/547 (31.99%), Postives = 235/547 (42.96%), Query Frame = 3
Query: 1665 CPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQ-----PLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSC---PEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNC--------------DCTY------------------------------------STGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNG--GTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTY 3116
            CP+G +G+ C+  C+ C+    C+     C C   + G  CE+ C       EC       +  H   GG C+  T  C CP G  G  C+  C  G +G NC+ +C        C  +TG C C PGW G+SC   CP G +G+ C + C+C  +    C  + G C+C    +G  C Y C    +G DC+  C    ++   +C+   G C  +   G     C   CP G  GS C+  C C EN   C   NG C CAPGF G+RC L C  G +G +C+  C+C     C  VTG CYCA    G+   E CP G +GP C   C              D T                                        C    G+C C  G +GP C  +CP G +G  CS+ C C  G  C PI+G C C  G++G +C+  C  GYYG  C + C C N     CD     C C+PG+ G+ CE+ C  GY+G  C     CH    C   +G+C C  G  G  C     ++ Y
Sbjct: 1089 CPEGLWGDGCVRTCA-CLRAATCDPFTGRCKCGSGWYGEACELPCPDGRWGEECVRECECSVDGHGGRGGRCDRFTGTCQCPEGYYGPKCQDRCPPGKYGPNCQLSCNCRQVGAVCDAVTGTCRCPPGWTGASCEQPCPDGYYGVECKQRCACPSD--RPCHHETGACRCPPATYGPRCQYNCPEDRWGEDCANHCDCHQKNPNMVCDPVDGSCHCRP--GWQGSNCVSRCPAGFFGSKCQYECKC-ENQGVCHPDNGTCICAPGFYGERCSLPCPNGFFGRQCKQRCECIHREACHGVTGQCYCAAGYRGRHCEETCPRGSFGPECKFECPVCNMKSPGEIETTDTTLRPKVDWSQPGGRQELRIGVRTSSVVASMWRRPSDIGDVTCHPQTGECPCPPGTHGPGCEAKCPSGRFGPRCSQVCTCPQGATCSPITGSCECPAGYYGPLCQYTCPPGYYGKGCAQVCDCYNTQPSVCDTVTGVCHCKPGYMGDRCEQICPQGYHGEMCAK--ACHQCEHCHFETGQCLCELGKEGETCGGNAVTRRY 1627          

HSP 4 Score: 207.223 bits (526), Expect = 4.473e-50
Identity = 211/703 (30.01%), Postives = 289/703 (41.11%), Query Frame = 3
Query: 1107 INECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYK--VDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEA---------DGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCM-----HKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKN-GGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNR-CHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEG-CDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFT-------------GKRCELKCTK---------------------------------GLYGERCQSSCQCRK----DRLCDHVTGICYCADVAFGK-CEA-CPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN---CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGR 2993
            I  C  ++G C HI      S  C+C PGW+  H  + C      ++    C+  NG           +  +C C  G+   A          G  CS+  +C +     +P  +C    G   C CP G    +   TC +        G  G  CV T     C C    T       C+  +       + P  CP G +GEEC+  C   +       G C+     C C   Y G  C+  C        CQ L C+C+  G  C++ T  C CPPG +G  CE  C +G++G  C++ C  AC S+R CH  TG C C P  YG  C   CP   WG  C+  C C+Q N    CDP +G C C+ G+ G NC+ +C  G+FG  C + C  + + +C+ + G C      G     C   CP G  G  C++ C+C     +C    G C+CA G+              G  C+ +C                                   G+      +S   R     D  C   TG C C     G  CEA CPSG++GP C+Q C C     C  I G C C AGYYGP C   CP G YG+GC++ C C       CD ++G+C C PG+ G+ CE  C +GY+G+ C + C       C     +C CE G  GE C  +     Y R
Sbjct:  968 IETCACQHGTCDHI------SGACECEPGWRNMHCDRLCAPGFYGLDCQHRCQCTNGA------ECDPQTGVCRCAAGWHGTACDRPCPEGRYGKGCSETCDCASD----IPGISCDRVTGH--CLCPPGRTGPRCADTCPE--------GLWGDGCVRT-----CACLRAATCDPFTGRCKCGSGWYGEACELP--CPDGRWGEECVRECECSVDGHGGRGGRCDRFTGTCQCPEGYYGPKCQDRCPPGKYGPNCQ-LSCNCRQVGAVCDAVTGTCRCPPGWTGASCEQPCPDGYYGVECKQRC--ACPSDRPCHHETGACRCPPATYGPRCQYNCPEDRWGEDCANHCDCHQKNPNMVCDPVDGSCHCRPGWQGSNCVSRCPAGFFGSKCQYECKCENQGVCHPDNGTC--ICAPGFYGERCSLPCPNGFFGRQCKQRCECIHRE-ACHGVTGQCYCAAGYRGRHCEETCPRGSFGPECKFECPVCNMKSPGEIETTDTTLRPKVDWSQPGGRQELRIGVRTSSVVASMWRRPSDIGDVTCHPQTGECPCPPGTHGPGCEAKCPSGRFGPRCSQVCTCPQGATCSPITGSCECPAGYYGPLCQYTCPPGYYGKGCAQVCDCYNTQPSVCDTVTGVCHCKPGYMGDRCEQICPQGYHGEMCAKACHQCE--HCHFETGQCLCELGKEGETCGGNAVTRRYRR 1629          

HSP 5 Score: 119.398 bits (298), Expect = 3.907e-23
Identity = 201/760 (26.45%), Postives = 282/760 (37.11%), Query Frame = 3
Query:  552 CICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGFYCKCPPGYEMSENGKNCIDINECIRNRTD-CSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAI--DVNDVKQCKDINECNIKNGGCQHICLNVEGSF------ICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGG--CTQFCNSSPNKR-----------AICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTC-------INDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQ-NQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKG---YCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCS-CNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSC---PEDCKTI-CNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQC--RKDRLCDHVTGICYCADVAFG-KCE-ACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKC 2705
            C+C  G+ GT CD+                         KCPPG    + G NCI+   C     D  S  C   PG     C        DR+ C P  +  D  ++  CT+   +      +C C  G       R C      K    GCS  C        I+C    G+ +        +C D     +   GC   C  +  +        C C  GW         Y    EL  PC  G  G  C + C  S +               C C  G+     G  C  +D C  GK+      +C       + D  +  C CP G+     +  C D        G  G +C       RC CP+      +   C+    T G   Q +   CP+  +GE+C  +C +C  K     C+     C C P + G+ C   C       +CQ  +C C+N G C  +   C C PG  GE C + C  GFFG  C++ C        CH +TG+C C  G+ G  C   CP G++G  C   C  CN  +    +  +   + K  +       +   G        S    P D   + C+ +TG+CP     G +  GC+  CP+G  G  C + C C + + +C    G C C  G+ G  C+  C  G YG+ C   C C   +  +CD VTG+C+C     G +CE  CP G  G  C + C       C    GQC+C  G  G  C
Sbjct:  943 CVCFAGYNGTRCDE-------------------------KCPPG----KYGPNCIETCACQHGTCDHISGACECEPGWRNMHC--------DRL-CAPGFYGLDCQHRCQCTNG-AECDPQTGVCRCAAGWHGTACDRPCPEGRYGK----GCSETCDCASDIPGISCDRVTGHCLCPPGRTGPRCADTCPEGLWGDGCVRTCACLRAATCDPFTGRCKCGSGW---------YGEACEL--PCPDGRWGEECVRECECSVDGHGGRGGRCDRFTGTCQCPEGYY----GPKC--QDRCPPGKYGPNCQLSCNCRQVGAVCDAVTGTCRCPPGWTGASCEQPCPD--------GYYGVEC-----KQRCACPSDRPCHHETGACRCPPATYGPRCQYN---CPEDRWGEDCANHC-DCHQKNPNMVCDPVDGSCHCRPGWQGSNCVSRCPAGFFGSKCQ-YECKCENQGVCHPDNGTCICAPGFYGERCSLPCPNGFFGRQCKQRC-ECIHREACHGVTGQCYCAAGYRGRHCEETCPRGSFGPECKFECPVCNMKSPGEIETTDTTLRPKVDWSQPGGRQELRIGVRTSSVVASMWRRPSDIGDVTCHPQTGECPCPP--GTHGPGCEAKCPSGRFGPRCSQVCTCPQGA-TCSPITGSCECPAGYYGPLCQYTCPPGYYGKGCAQVCDCYNTQPSVCDTVTGVCHCKPGYMGDRCEQICPQGYHGEMCAKACH--QCEHCHFETGQCLCELGKEGETC 1618          
BLAST of Multiple epidermal growth factor domains protein 6 vs. TrEMBL
Match: A0A4S2LTR0 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004930 PE=4 SV=1)

HSP 1 Score: 889.797 bits (2298), Expect = 0.000e+0
Identity = 533/1422 (37.48%), Postives = 745/1422 (52.39%), Query Frame = 3
Query:   15 GAYKHIQILIHFFDKNCKAS*YQRHQIIFIYQLS*QIL*KYEMRFAIIFFLTIQIIPKLSGAGSQKLELGMPNVCEVEQRQMIRVRRTVEVPRSKEVKVWKANCRFKGDWCLVHENKSFVEKTETSQIQMVPSIKYECCEGYAELSGYRGCIPKPNCEERIGKY--CQNGAFCYQSGYNAKCICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPST-CINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQ-----------------------------NQNTR---------------------------GSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEI-GCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCS--CNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENS----VSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQC-RKDRLCDHVTGICYCADVAFG-KC------------EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHN---GGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKAT------EKCDLKTGECTCPKSAFGLSCEIKNCDSKES-DCRQDCQC-SIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCK--LKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVS 4001
            GAY  + +LI  F  +  A+            ++            ++  L   +  + S A    L+  MPNVC     +   + +  + P  K  K+W+ NC + G+WC+ ++ ++       + +++    +Y CC G+ +  G  GC+PK NC + +     C+NG  CY++    +C CP GF G  C   +++C    G C+K+C       YC+CP GY ++ + + C+DI+EC  NR  C + C NLPGG+RC CP DM+L  D+I+CIPF  PC     G C H C  L   R++CSC  G+ L  D++ C   D C++NNGGC H C++   +    C C  GY +   D ++C DINEC+  NGGCQH C NV+GS+ C+C+PGWQ+G+D K+CY+V +E+TDPC++GNGGCT  C  + +  A C+C PG+ L+ADG TC D DEC+TG+  C  P+  C+N++GSY C C  G+RL  +  +C+DIDECL+Y GGC +KCVNT GS++C+C  G+ L  D  TC                              N NTR                            +S+ K    CP G FG++C   CS+C + G CN D TGC C   Y G  C   C  N     C+ L C C  G  C+  +  C CP G  G+ CEI GC  G++G +C++ CP  C++N+C + TG+C C PG YG+ CHL CP GTWG  C K+CS  C      GC P+ G+C C+ GY    C+  C  GYFG+DC  +C E C   C+  +G+C  +   G     C++DC  G  G+ C K C C  +S    V+C  + G C C  G+ G RCE++C  G YG  C+  C+C      CD VTG+C+C D   G KC             ACP G+WGP C + CDC +   C++  G C+C AGY G +C ++CP G YG  C + C C +G CD ISG C C PGW    C+  C  G+YG  C+ +C+C NG  CD     C+C  GWHG  C++ C  G YG+ C   C C +   G  CD ++G C C PG  G  C + CP   +G  C + C CL    C P  G C+C +G +G+ CEL CP  ++G  C+  C C          +CD  TG C CP+  +G  C+ +    K   +C+  C C  +   C+ VTG C+C PG  G  C Q C  G +G++CKQ+C C +  PC+   G C C     G  C   C +  +G +C     C   N N  C P  G C C  G    +C  +CP+G++G  CQ  C+C +   C+P  G C C  GFYG  C   CPN F+G  C+ RC+C H   C+ VTG C C     GR CE +
Sbjct:    5 GAYCFLFVLIISFSLHESANAQNSPSPKLPQSVN------RASEAEVVRLLNENVESEDSEA--PDLQPQMPNVCRDPNPRPRTIHQKYKTPYIKLTKMWEPNCGYPGNWCIRYKQQTHYVTHYKTIVKIPDKDQYRCCPGFTQQPGMEGCVPKSNCSQFVQSAFSCKNGGLCYENNGVVRCSCPAGFTGVHCQIQIDDCASGTGDCQKDCALNPKSSYCRCPAGYFLAPDRRRCLDIDECKYNRGGCMYFCENLPGGYRCACPSDMMLAADKISCIPFFDPCKHPPNGDCEHICTTLPGYRYVCSCRPGYRLADDKKRCLPHDPCQENNGGCQHDCRA--VNGEPHCSCHEGYQVSPQDPRKCTDINECSQDNGGCQHQCRNVDGSYSCECNPGWQLGNDGKTCYRVLLEVTDPCQFGNGGCTHICLRTDSNSAECACRPGYDLQADGRTCRDRDECLTGEAACYGPAVVCVNEIGSYRCECQAGFRLSADGHSCQDIDECLNYNGGCQHKCVNTPGSFQCLCNLGDELNPDGLTCSRSTKYVRDEGFDTSQAIVIGSPGQGRRQINTNTRVQESGVQVFTRKRIPVDSMMMNDEPQSTASVLKHGLPCPAGRFGDDCQLTCSHCENGGRCNRDLTGCDCPSGYHGLTCHDMCAPNRWGFGCREL-CDCMEGIPCDPNSGICKCPVGRHGDKCEIAGCQPGYWGRDCDRMCPDHCATNQCERDTGQCTCAPGTYGAQCHLSCPEGTWGEMCQKSCSKECTGGKTRGCHPQTGQCICQPGYRPPECILPCPRGYFGMDCRQTCFE-CTGGCDPVSGKCTIQCPPGKQGPRCEQDCDEGYWGTHCTKRCQCGIDSNGRPVACNPQTGECICKAGYRGARCEIRCEPGTYGPGCEKKCECGLGATACDPVTGLCHCEDGTVGTKCGMQNDRFASNDEPACPPGRWGPKCTKICDCVHGVECNKQTGLCVCFAGYNGTRCDEKCPPGKYGPNCIETCACQHGTCDHISGACECEPGWRNMHCDRLCAPGFYGLDCQHRCQCTNGAECDPQTGVCRCAAGWHGTACDRPCPEGRYGKGCSETCDCASDIPGISCDRVTGHCLCPPGRTGPRCADTCPEGLWGDGCVRTCACLRAATCDPFTGRCKCGSGWYGEACELPCPDGRWGEECVRECECSVDGHGGRGGRCDRFTGTCQCPEGYYGPKCQDRCPPGKYGPNCQLSCNCRQVGAVCDAVTGTCRCPPGWTGASCEQPCPDGYYGVECKQRCACPSDRPCHHETGACRCPPATYGPRCQYNCPEDRWGEDCANHCDCHQKNPNMVCDPVDGSCHCRPGWQGSNCVSRCPAGFFGSKCQYECKCENQGVCHPDNGTCICAPGFYGERCSLPCPNGFFGRQCKQRCECIHREACHGVTGQCYCAAGYRGRHCEET 1414          

HSP 2 Score: 535.413 bits (1378), Expect = 2.472e-160
Identity = 420/1277 (32.89%), Postives = 582/1277 (45.58%), Query Frame = 3
Query:  648 IDGGFYCKCPPGYEMS-ENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINC----IPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGC---SHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSP---------NKRAICSCLPGF---KLEADGLTCSDE--------------------DECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDG------SYRCVCPNGE-------------TLGKD-NKTC-----QNQNTR---------GSSLQKDPRRCPKGTFGEECLFNCSNCMHKGY---CNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSN----RCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYK-----------CDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYST---GCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCI-YGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCL------NGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHN-GGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEK---CDLKTGECTCPKSAFGLSCEIKNCDSK--ESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNR-------------------------------------------------NKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSP--CNPVTGHCVCPKKLSGRFCE 3995
            ++G  +C C  GY++S ++ + C DINEC ++   C H+C N+ G + C+C P   LG D   C    +    PC   N GGCTH C++       C+C  G+ L  D R+C   D C      C   + +C ++  S    C+C+ G+ +   D   C+DI+EC   NGGCQH C+N  GSF C C+ G ++  D  +C +    + D    G          SP         N R   S +  F   ++  D +  +DE                    D+C      C     C  DL    C CP GY    + +TC D+     +  GC   C   +G      S  C CP G                G+D ++ C      NQ  R         G+   +    CP+GT+GE C  +CS     G    C+     C+C P Y    C + C +    ++C+     C  G    S      CPPG  G  CE  C EG++G +C K C     SN     C+  TG+C+C  G+ G+ C + C  GT+G GC K C C       CDP  G C C+ G  G  C  +           C PG +G  C+  C       CN +TG C      G N   C   CP G  G +C +TC C   +  C+  +G C C PG+    C+  C  G YG  CQ  CQC     CD  TG+C CA    G      CP G++G  C++ CDC        CD++ G C+C  G  GP+C+  CPEGL+G+GC + C C+    CDP +G C+C  GW+GE CE PC +G +G++C  +C+C        GG CD F   CQC  G++G  C+  C  G YG NC+  C C   G +CD ++G C C PGW G +C++ CP   YG  C Q C C +   CH E G C+CP   +G  C+  CP D++G +C ++C C        CD   G C C     G +C +  C +    S C+ +C+C  +  C+   G C C PG  G +C   C  G FG  CKQ+C C + E C+ V G C C +G+ G  C++ C +G +GP CK +C VCN                                                  + TCHPQTG+C C  G     C+ +CPSG +GP C Q C C  GA+C+P TG+C+C +G+YG LCQ+ CP  +YG  C   C C++  P  C+ VTG C C     G  CE
Sbjct:  336 VNGEPHCSCHEGYQVSPQDPRKCTDINECSQDNGGCQHQCRNVDGSYSCECNPGWQLGNDGKTCYRVLLEVTDPCQFGN-GGCTHICLRTDSNSAECACRPGYDLQADGRTCRDRDECLTGEAACYGPAVVCVNEIGS--YRCECQAGFRLSA-DGHSCQDIDECLNYNGGCQHKCVNTPGSFQCLCNLGDELNPDGLTCSRSTKYVRD---EGFDTSQAIVIGSPGQGRRQINTNTRVQESGVQVFTRKRIPVDSMMMNDEPQSTASVLKHGLPCPAGRFGDDCQLTCSHCENGGRCNRDLTG--CDCPSGY----HGLTCHDMCAPNRWGFGCRELCDCMEGIPCDPNSGICKCPVGRHGDKCEIAGCQPGYWGRDCDRMCPDHCATNQCERDTGQCTCAPGTYGAQCHLSCPEGTWGEMCQKSCSKECTGGKTRGCHPQTGQCICQPGYRPPECILPCPRGYFGMDCRQTCFECTGGCDPVSGKCTIQCPPGKQGPRCEQDCDEGYWGTHCTKRCQCGIDSNGRPVACNPQTGECICKAGYRGARCEIRCEPGTYGPGCEKKCECGLGA-TACDPVTGLCHCEDGTVGTKCGMQNDRFASNDEPACPPGRWGPKCTKICDCVHGVECNKQTGLC--VCFAGYNGTRCDEKCPPGKYGPNCIETCACQHGT--CDHISGACECEPGWRNMHCDRLCAPGFYGLDCQHRCQCTNGAECDPQTGVCRCAAGWHGTACDRPCPEGRYGKGCSETCDCASDIPGISCDRVTGHCLCPPGRTGPRCADTCPEGLWGDGCVRTCACLRAATCDPFTGRCKCGSGWYGEACELPCPDGRWGEECVRECECSVDGHGGRGGRCDRFTGTCQCPEGYYGPKCQDRCPPGKYGPNCQLSCNCRQVGAVCDAVTGTCRCPPGWTGASCEQPCPDGYYGVECKQRCACPSDRPCHHETGACRCPPATYGPRCQYNCPEDRWGEDCANHCDCHQKNPNMVCDPVDGSCHCRPGWQGSNC-VSRCPAGFFGSKCQYECKCENQGVCHPDNGTCICAPGFYGERCSLPCPNGFFGRQCKQRCECIHREACHGVTGQCYCAAGYRGRHCEETCPRGSFGPECKFECPVCNMKSPGEIETTDTTLRPKVDWSQPGGRQELRIGVRTSSVVASMWRRPSDIGDVTCHPQTGECPCPPGTHGPGCEAKCPSGRFGPRCSQVCTCPQGATCSPITGSCECPAGYYGPLCQYTCPPGYYGKGCAQVCDCYNTQPSVCDTVTGVCHCKPGYMGDRCE 1593          

HSP 3 Score: 421.009 bits (1081), Expect = 1.746e-119
Identity = 394/1297 (30.38%), Postives = 534/1297 (41.17%), Query Frame = 3
Query:  666 CKCPPGYEMSENGKNCIDINECIRNRTDC---SHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGY-AIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCH------PGWQIGHD-HKSCY------KVDMELTD---PCKYGNGGCTQFCNSSPNK-----RAICSCLPGFKLEADGLTCSDEDECVTGKH--KCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCED---IDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRR-----------------CPKGTFGEECLFNCSNCMHKGYCNDDQTGCL--CHPNYSGTICEIDCLQNPSQVECQPL-QCHCKNGG---TCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNC-----PTAC-------------------------SSN------------------------RCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSEN--SVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK-CE-ACPSGKWGPTCNQNCDCTYSTG------CDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQC--IYGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLN----------------------------------------------GGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNC-ICKATEKCDLKTGECTC--------PKSAFGLSCEIKNCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCN-RNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQAC-QCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEV---SVINRLK 4019
            C C PGY++  +G+ C D +EC+     C   +  CVN  G +RC+C     L  D  +C   I  C + N GGC H CV  +   F C C  G  L+ D  +CS       + G        D S +++      G   I+ N   Q   +     K      + +N E              P  + G D   +C       + + +LT    P  Y    C   C  +PN+     R +C C+ G   + +   C    +C  G+H  KC             +  C  GY  R     C D    ++C   TG C              CP G       K+C  + T G +    P+                  CP+G FG +C   C  C   G C+     C   C P   G  CE DC +      C    QC   + G    C  +T +C C  G  G  CEI C  G +G  CEK C      TAC                         +SN                         C++ TG C+CF G+ G+ C   CP G +G  C +TC+C       CD  +G C+C+ G+  ++C   C PG++GLDC   C       C+ +TG C  +   G +   C R CP G  G  C +TCDC+ +   +SC+   G C C PG TG RC   C +GL+G+ C  +C C +   CD  TG C C    +G+ CE  CP G+WG  C + C+C+          CD+  G C C  GYYGPKC  RCP G YG  C   C C  +   CD ++G CRC PGW G  CE PC +GYYG +CK++C C +                                                 CD     C C PGW G  C   C  G++G  C+  C+C N G+C   +G C C PG+ G  C   CP+  +G  C Q C+C++   CH   G C C AG  G  CE TCP   +GP C   C +C      +++T + T         P     L   ++      S  R+        +C+  TG+C C PG  GP C   C  G FG  C Q C C  G  C+P+ G+C C +G+ G LC   C  G+YG  C   C   N +   C   TG C C+ G +   C+  CP GY+G +C +AC QC H   C+  TG C C  G  G  C   CPN  +GA C   C C + + C P TG C CP  L G  C +   +V  R +
Sbjct:  431 CACRPGYDLQADGRTCRDRDECLTGEAACYGPAVVCVNEIGSYRCECQAGFRLSADGHSCQD-IDECLNYN-GGCQHKCVN-TPGSFQCLCNLGDELNPDGLTCSRSTKYVRDEG-------FDTSQAIVIGSPGQGRRQINTNTRVQESGVQVFTRKRIPVDSMMMNDEPQSTASVLKHGLPCPAGRFGDDCQLTCSHCENGGRCNRDLTGCDCPSGYHGLTCHDMC--APNRWGFGCRELCDCMEGIPCDPNSGIC----KCPVGRHGDKCE------------IAGCQPGYWGRDCDRMCPDHCATNQCERDTGQCTCAPGTYGAQCHLSCPEGTWGEMCQKSCSKECTGGKTRGCHPQTGQCICQPGYRPPECILPCPRGYFGMDCRQTCFECT--GGCDPVSGKCTIQCPPGKQGPRCEQDCDEGYWGTHCTKRCQCGIDSNGRPVACNPQTGECICKAGYRGARCEIRCEPGTYGPGCEKKCECGLGATACDPVTGLCHCEDGTVGTKCGMQNDRFASNDEPACPPGRWGPKCTKICDCVHGVECNKQTGLCVCFAGYNGTRCDEKCPPGKYGPNCIETCACQHGT---CDHISGACECEPGWRNMHCDRLCAPGFYGLDCQHRCQCTNGAECDPQTGVC--RCAAGWHGTACDRPCPEGRYGKGCSETCDCASDIPGISCDRVTGHCLCPPGRTGPRCADTCPEGLWGDGCVRTCACLRAATCDPFTGRCKCGSGWYGEACELPCPDGRWGEECVRECECSVDGHGGRGGRCDRFTGTCQCPEGYYGPKCQDRCPPGKYGPNCQLSCNCRQVGAVCDAVTGTCRCPPGWTGASCEQPCPDGYYGVECKQRCACPSDRPCHHETGACRCPPATYGPRCQYNCPEDRWGEDCANHCDCHQKNPNMVCDPVDGSCHCRPGWQGSNCVSRCPAGFFGSKCQYECKCENQGVCHPDNGTCICAPGFYGERCSLPCPNGFFGRQCKQRCECIHREACHGVTGQCYCAAGYRGRHCEETCPRGSFGPECKFECPVCNMKSPGEIETTDTTLRPKVDWSQPGGRQELRIGVRTSSVVASMWRRPSDIG-DVTCHPQTGECPCPPGTHGPGCEAKCPSGRFGPRCSQVCTCPQGATCSPITGSCECPAGYYGPLCQYTCPPGYYGKGCAQVCDCYNTQPSVCDTVTGVCHCKPGYMGDRCEQICPQGYHGEMCAKACHQCEH---CHFETGQCLCELGKEGETCGGTCPNGQFGAQCSETCNCRNGATCLPSTGMCQCPSWLIGPDCGLQADAVTRRYR 1688          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Cavefish
Match: MEGF6 (multiple EGF like domains 6 [Source:NCBI gene;Acc:103032853])

HSP 1 Score: 764.222 bits (1972), Expect = 0.000e+0
Identity = 505/1353 (37.32%), Postives = 681/1353 (50.33%), Query Frame = 3
Query:  210 KLELGMPNVCEVEQRQMIRVRRTVEVPR-SKEVKVWKANCRFKGD-WCLVHENKSFVEKTETSQIQMVPSIKYECCEGYAELSGYRGCIPKPNCEERIGKYCQNGAFCYQSGYNAKCICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTC------------------------------------------QNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCS------------------------------------------ENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFG-KCE-ACPSGKWGPTCNQNCDCT-YSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN-CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKE--SDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFC 3992
             L+  MPNVC VE+ ++I+V++   V   ++ VKVWK  CR  GD WC+ +E ++    +     +      Y CC G+++LSG  GC+  P C   +   C NG  C + G +  C CP GF G  C  D+NECEE+   CE  CCN  G FYCKC  G+ + ++GK C D++EC  +   C H CVN  G + C+C P   L  D   CI  +  C  +N GGC   CV+LS   F C C   + L  D + C + + C + NGGC+H C+S    +V  C+C  GY +   D K C+DI+EC      C H C N  GSF C C+PG+++G + + CY+++ME+ + C  GNGGC+  C     +  +CSC  G++L+ D  TC D +EC  G   C     C N  G Y C C  GYRL  +   C+D+DECL   GGC   C NT GSY+C C  G+ L +D  +C                                               R  S   +   C   TFG +C  +C +C + G CN ++ GC C   ++G IC   C +      C    C CKNG  C+ ++  C CPPG+SG++C+ GC +GF+G++C K C  A ++ RCH+  G CLC PG YG  CHL CP  ++G GCS  C C Q N   C  ++G C CK GY G  C  +C  GY+G  C   C       C+H TGQC   +  G +   C ++CP G  GS C ++CDC+                                          EN   C+++NG C C PG+TG  C   C  G +G  CQ  C C+    C   +G+C C     G  CE AC  G+WG  C   C+CT  + GCD + GQC C AGY G  C  +C EG +G GC  +CQC  G  C+P+ G C C PGW G  CE PC +G++G +C+ KC+CLNGG C      C C  GW G  C   C  G YG  C   C CH+   CD  SG+C C PGW G  C++ C    YG +C Q C C NGG C   +G C C +G  G  CEL C P  +G +C H C C+    CD   G C+CP    G  CE K C++ +    C++ C+C    +C+ +TG C C PG RG +C + C  G +G  C Q+C+C +G  CN V G C C  GFTG  C++ C  G +G NC   C     N+ C P  G C C  G     C  +C  G+YGP C++ CQC++   C  +TG C C  G+ G  C   CP  +YG +C     C   +  +PVTG CVC     G  C
Sbjct:   23 ALQPFMPNVC-VERERVIQVQKQPCVQAFTRMVKVWKQGCR--GDVWCVGYERRTVYFTSYRQVYKQDYQTSYRCCPGWSQLSGEAGCL-YPVCSYGV---CFNGGSC-KGGSSRLCECPPGFRGPSCQYDVNECEESTADCEGLCCNTIGSFYCKCSSGFTLRDDGKTCEDVDECQVHNGGCQHRCVNTRGSYYCECNPGFRLHTDGRTCIAVL-SCAISN-GGCEQECVQLSPTHFQCRCRHSYQLTADGKHCKLRNPCTERNGGCTHTCRSVGGHAV--CECHRGYRL-AQDQKSCEDIDECETGQAACAHDCRNTPGSFSCICNPGYELGSEGRKCYRIEMEIVNSCGSGNGGCSHHCQHGL-QGPVCSCNTGYQLDEDLKTCLDLNECAEGSSCC--EQDCTNYPGGYECYCRAGYRLNSDGCGCDDVDECLSDNGGCENICQNTAGSYQCFCRLGQRLAEDRHSCIPLERAVEALSSRLAVERPFPQVTLLQDYPQALERYDDYEEDSFGELRAESTIIEKYVCLNETFGHDCSLSCDDCSNGGLCNLEKNGCDCPDGWTGIICNQTCPEGTFGRNCS-FTCKCKNGAICDPKSGVCKCPPGVSGDMCQDGCPKGFYGKHCNKKCNCA-NNGRCHRTYGACLCDPGLYGRFCHLSCPKWSYGPGCSSECQCVQQNTLECHRRHGNCVCKPGYQGKTCSEECGSGYYGPGCKKKCQCSSGMPCHHVTGQCQCPS--GWHGESCDQECPQGKFGSGCSQSCDCNGAVCDSVTGLCRCPAGTTGERCAEECKEGRWGLACAELCPACENGGVCDKQNGTCMCEPGYTGTHCRTVCPAGWFGLGCQFQCSCKNGGRCHPSSGLCACKAGWTGPSCEKACQPGQWGADCANACNCTSRAAGCDAVTGQCHCQAGYTGTYCELKCSEGFFGPGCHHQCQCENGAICEPVGGACTCLPGWTGTYCEKPCPQGFHGLECQHKCECLNGGQCHHVTGTCACPAGWIGPRCTSKCQAGLYGPGCNQSCNCHHNASCDPTSGQCQCGPGWTGPTCEQECSFGFYGLDCRQQCLCQNGGSCDRISGHCTCSSGWTGVACELECAPGHFGADCQHTCECENEGVCDRHDGTCSCPAGWVGHRCE-KACEAGKFGPGCQRQCRCEHGAACDHITGACACPPGWRGLRCEKTCLPGYYGKRCSQRCKCPHGTSCNHVTGECGCPPGFTGSGCERTCQPGTFGVNCNQVCQCSEVNQLCDPVAGTCYCAPGYRGEKCNVECEEGHYGPNCERKCQCLNNGVCQATTGTCVCPPGYIGPDCNITCPAGWYGQDCARVALCGDGARSDPVTGRCVCKAGQRGEDC 1354          

HSP 2 Score: 490.345 bits (1261), Expect = 5.612e-148
Identity = 407/1209 (33.66%), Postives = 539/1209 (44.58%), Query Frame = 3
Query:  657 GFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQ-HICLNVEGSFIC--------------------DCHPGWQIGHDHKSC----YKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDE-DECVTGKH-----KCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCV----NTDGSYR----CVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTI-CNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFG-KCEA-CPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDK--------------------------------------------YGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIK-NCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVS-VINRL 4016
            G  C C  GY++ E+ K C+D+NEC    + C  +C N PGG+ C C     L  D   C   +  C S N GGC + C   +   + C C  G  L +DR SC  + L +      S L    P   V   +  P  A++  D  +     E   ++   + ++CLN      C                    DC  GW     +++C    +  +   T  CK G       C+    K  +C C PG      G  C D   +   GKH      C     C    G+  C C  G   R   ++C        Y  GC  +C     NT   +R    CVC      G   KTC  +             C  G +G  C   C  C     C+     C C   + G  C+ +C Q      C    C C NG  C+S T  C CP G +GE C   C EG +G  C + CP   +   C +  G C+C PG+ G+ C  +CP G +G+GC   CSC   N   C P +G C CK G+ G +C   C PG +G DC+ +C    +   C+  TGQC  +   G     C+  C  G  G  C   C C EN   CE   G C C PG+TG  CE  C +G +G  CQ  C+C     C HVTG C C     G +C + C +G +GP CNQ+C+C ++  CD  +GQC C  G+ GP C + C  G YG  C ++C C  G +CD ISG C C+ GW G  CE  C  G++G  C+  C+C N G CD     C C  GW G  CEK+C  G +G  C+ +C+C +G  CD I+G C C PGWRG+ C++ C    YG  C+Q C+C +G  C+   G C CP G  G  CE TC P                                              YGPNC   C C     C   TG C CP    G  C I         DC +   C      + VTG+C CK G RG  C Q C  G FG DC Q+C C+NG  C+PV+G C C  G+TG  CD  C  G YG NC  +C  C+ N TC   TG+C C+ G   + C+  CP G++G  CQ+ C C   A+C PSTG C C  G+ G  C+  C   ++G +C   C C   +PC+PV+G C+C     GR C++S  +NR 
Sbjct:  377 GPVCSCNTGYQLDEDLKTCLDLNECAEGSSCCEQDCTNYPGGYECYCRAGYRLNSDGCGCDD-VDECLSDN-GGCENICQNTAG-SYQCFCRLGQRLAEDRHSC--IPLERAVEALSSRLAVERPFPQVTLLQDYP-QALERYDDYEEDSFGELRAESTIIEKYVCLNETFGHDCSLSCDDCSNGGLCNLEKNGCDCPDGWTGIICNQTCPEGTFGRNCSFTCKCKNG-----AICDP---KSGVCKCPPGVS----GDMCQDGCPKGFYGKHCNKKCNCANNGRCHRTYGA--CLCDPGLYGRFCHLSCPK----WSYGPGCSSECQCVQQNTLECHRRHGNCVC----KPGYQGKTCSEE-------------CGSGYYGPGCKKKC-QCSSGMPCHHVTGQCQCPSGWHGESCDQECPQGKFGSGCS-QSCDC-NGAVCDSVTGLCRCPAGTTGERCAEECKEGRWGLACAELCPACENGGVCDKQNGTCMCEPGYTGTHCRTVCPAGWFGLGCQFQCSCK--NGGRCHPSSGLCACKAGWTGPSCEKACQPGQWGADCANACNCTSRAAGCDAVTGQCHCQA--GYTGTYCELKCSEGFFGPGCHHQCQC-ENGAICEPVGGACTCLPGWTGTYCEKPCPQGFHGLECQHKCECLNGGQCHHVTGTCACPAGWIGPRCTSKCQAGLYGPGCNQSCNCHHNASCDPTSGQCQCGPGWTGPTCEQECSFGFYGLDCRQQCLCQNGGSCDRISGHCTCSSGWTGVACELECAPGHFGADCQHTCECENEGVCDRHDGTCSCPAGWVGHRCEKACEAGKFGPGCQRQCRCEHGAACDHITGACACPPGWRGLRCEKTCLPGYYGKRCSQRCKCPHGTSCNHVTGECGCPPGFTGSGCERTCQPGTFGVNCNQVCQCSEVNQLCDPVAGTCYCAPGYRGEKCNVECEEGHYGPNCERKCQCLNNGVCQATTGTCVCPPGYIGPDCNITCPAGWYGQDCARVALCGDGARSDPVTGRCVCKAGQRGEDCGQGCAQGWFGEDCAQRCNCSNGAVCDPVNGNCTCGLGWTGDRCDTECPTGRYGANCLQQC-DCHNNSTCDRVTGECVCDLGYYGHFCQHVCPQGFHGHRCQRLCDCHGKATCEPSTGDCLCPPGYQGERCERECDQGWFGLDCAKTCDCDGGTPCDPVSGRCLCGPGKMGRRCDISCALNRY 1535          

HSP 3 Score: 438.343 bits (1126), Expect = 2.054e-129
Identity = 293/793 (36.95%), Postives = 390/793 (49.18%), Query Frame = 3
Query: 1635 GSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFG-KCEA-CPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN-CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHN-GGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKE--SDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCE 3995
            G++ ++    C +G +G  C   C  C + G C+     C+C P Y+GT C   C      + CQ  QC CKNGG C   +  C C  G +G  CE  C  G +G +C   C     +  C  +TG+C C  G+ G+ C L C  G +G GC   C C   N   C+P  G C C  G+ G  C   C  G+ GL+C   C       C+H TG C      G     C   C  G  G  C ++C+C  N+ SC+  +G C C PG+TG  CE +C+ G YG  C+  C C+    CD ++G C C+    G  CE  C  G +G  C   C+C     CD+ +G C C AG+ G +C K C  G +G GC ++C+C +G  CD I+G C C PGW G  CE  C  GYYG +C ++CKC +G +C+    +C C PG+ G  CE++C  G +G NC   CQC     LCD ++G C C PG+RG  C+  C    YGPNC + CQCLN G C    G C CP G  G  C +TCP   YG +C    +C    + D  TG C C     G  C  + C       DC Q C CS    C+ V G C C  G  G +C   C  G +G +C Q+C C N   C+ V G C+C  G+ G  C  VC +G++G  C+  C  C+   TC P TG C C  G     C+ +C  G++G  C + C C  G  C+P +G C C  G  G  C   C  N YG  C   C+C + + CNP  G C C     G  C+
Sbjct:  786 GTTGERCAEECKEGRWGLACAELCPACENGGVCDKQNGTCMCEPGYTGTHCRTVCPAGWFGLGCQ-FQCSCKNGGRCHPSSGLCACKAGWTGPSCEKACQPGQWGADCANACNCTSRAAGCDAVTGQCHCQAGYTGTYCELKCSEGFFGPGCHHQCQCE--NGAICEPVGGACTCLPGWTGTYCEKPCPQGFHGLECQHKCECLNGGQCHHVTGTCACPA--GWIGPRCTSKCQAGLYGPGCNQSCNCHHNA-SCDPTSGQCQCGPGWTGPTCEQECSFGFYGLDCRQQCLCQNGGSCDRISGHCTCSSGWTGVACELECAPGHFGADCQHTCECENEGVCDRHDGTCSCPAGWVGHRCEKACEAGKFGPGCQRQCRCEHGAACDHITGACACPPGWRGLRCEKTCLPGYYGKRCSQRCKCPHGTSCNHVTGECGCPPGFTGSGCERTCQPGTFGVNCNQVCQCSEVNQLCDPVAGTCYCAPGYRGEKCNVECEEGHYGPNCERKCQCLNNGVCQATTGTCVCPPGYIGPDCNITCPAGWYGQDCARVALCGDGARSDPVTGRCVCKAGQRGEDCG-QGCAQGWFGEDCAQRCNCSNGAVCDPVNGNCTCGLGWTGDRCDTECPTGRYGANCLQQCDCHNNSTCDRVTGECVCDLGYYGHFCQHVCPQGFHGHRCQRLC-DCHGKATCEPSTGDCLCPPGYQGERCERECDQGWFGLDCAKTCDCDGGTPCDPVSGRCLCGPGKMGRRCDISCALNRYGPECLESCECGNGAQCNPRNGRCTCLNGWIGPNCQ 1570          

HSP 4 Score: 418.313 bits (1074), Expect = 2.890e-122
Identity = 277/732 (37.84%), Postives = 375/732 (51.23%), Query Frame = 3
Query: 1563 YRCVCPNGETLGKDNKTCQ-NQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTG-CLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFG-KCE-ACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN--CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCE-IKNCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCK 3737
            ++C C NG      +  C       G S +K    C  G +G +C   C NC  +    D  TG C C   Y+GT CE+ C +      C   QC C+NG  CE     C C PG +G  CE  C +GF G  C+  C    +  +CH +TG C C  GW G  C   C  G +G GC+++C+C+ N    CDP +G+C+C  G+ G  C  +C  G++GLDC   C       C+  +G C   +  G   + C+ +C  G  G+DC+ TC+C EN   C+  +G C C  G+ G RCE  C  G +G  CQ  C+C     CDH+TG C C     G +CE  C  G +G  C+Q C C + T C+ + G+C C  G+ G  C + C  G +G  C++ CQC   N  CDP++G C C PG+ GE C   C+EG+YG  C+ KC+CLN G C      C C PG+ G  C  +C  G+YG++C     C +G   D ++G+C C  G RG +C + C    +G +C Q C C NG  C P NG C C  G  GD C+  CP  +YG NCL  C C     CD  TGEC C    +G  C+ +         C++ C C  K +C   TG C C PG +G +C + C+ G FGLDC + C C  G PC+PV G CLC  G  G  CD  CA   YGP C L+   C     C+P+ G+C+C  G I  +C+
Sbjct:  851 FQCSCKNGGRCHPSSGLCACKAGWTGPSCEK---ACQPGQWGADCANAC-NCTSRAAGCDAVTGQCHCQAGYTGTYCELKCSEGFFGPGCH-HQCQCENGAICEPVGGACTCLPGWTGTYCEKPCPQGFHGLECQHKCECL-NGGQCHHVTGTCACPAGWIGPRCTSKCQAGLYGPGCNQSCNCHHN--ASCDPTSGQCQCGPGWTGPTCEQECSFGFYGLDCRQQCLCQNGGSCDRISGHCTCSS--GWTGVACELECAPGHFGADCQHTCEC-ENEGVCDRHDGTCSCPAGWVGHRCEKACEAGKFGPGCQRQCRCEHGAACDHITGACACPPGWRGLRCEKTCLPGYYGKRCSQRCKCPHGTSCNHVTGECGCPPGFTGSGCERTCQPGTFGVNCNQVCQCSEVNQLCDPVAGTCYCAPGYRGEKCNVECEEGHYGPNCERKCQCLNNGVCQATTGTCVCPPGYIGPDCNITCPAGWYGQDCARVALCGDGARSDPVTGRCVCKAGQRGEDCGQGCAQGWFGEDCAQRCNCSNGAVCDPVNGNCTCGLGWTGDRCDTECPTGRYGANCLQQCDCHNNSTCDRVTGECVCDLGYYGHFCQHVCPQGFHGHRCQRLCDCHGKATCEPSTGDCLCPPGYQGERCERECDQGWFGLDCAKTCDCDGGTPCDPVSGRCLCGPGKMGRRCDISCALNRYGPEC-LESCECGNGAQCNPRNGRCTCLNGWIGPNCQ 1570          

HSP 5 Score: 401.364 bits (1030), Expect = 1.960e-116
Identity = 325/1023 (31.77%), Postives = 461/1023 (45.06%), Query Frame = 3
Query: 1038 SVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITG----KCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCD------PKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFS----------------CPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCD-CSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN---CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVC-QCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKE--SDCRQDCQCSIKKS-CNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEV 3998
            S   C+C PG+           D+NEC      C+ +C N  GSF C C  G+ +  D K+C  VD      C+  NGGC   C ++      C C PGF+L  DG TC     C      C      ++    + C C   Y+L  +   C+  + C +  GGC + C +  G   C C  G  L +D K+C++                     +EC    + C H          C+C+P Y        C +   ++      C   NGG         +C  G+ G +C   C  G+     +++  T    N C + +      C  +PG Y   C       + G GC     C  +N  GC+        + +C C+ G       + C P    ++   S                 P+  +   ++E     +   +  ++I  +  C     G DC  +CD CS   +   EKNG C C  G+TG  C   C +G +G  C  +C+C+   +CD  +G+C C     G    + CP G +G  CN+ C+C  +  C +  G C+C  G YG  C   CP+  YG GCS ECQC+  N   C    G C C PG+ G+ C   C  GYYG  CK+KC+C +G  C     +CQC  GWHGE C++ C  G +G  C   C C NG +CD ++G C C  G  G  C E C    +G  C ++C  C NGG C  +NG C C  G  G  C   CP   +G  C   C CK   +C   +G C C     G SCE K C   +  +DC   C C+ + + C+ VTG+C C+ G  G  C   C  G FG  C  +C+C NG  C PV G C CL G+TG  C++ C +G++G  C+ KC   N  + CH  TG C+C AG I   C  +C +G YGP C Q+C C H ASC+P++G CQC  G+ G  C+  C   FYG +C+ +C C +   C+ ++GHC C    +G  CE+
Sbjct:  127 SSRLCECPPGFRGPSCQY----DVNECEESTADCEGLCCNTIGSFYCKCSSGFTLRDDGKTCEDVDE-----CQVHNGGCQHRCVNT-RGSYYCECNPGFRLHTDGRTCIAVLSCAISNGGCEQECVQLSPT-HFQCRCRHSYQLTADGKHCKLRNPCTERNGGCTHTCRSVGGHAVCECHRGYRLAQDQKSCEDI--------------------DECETGQAACAHDCRNTPGSFSCICNPGYELGSEGRKCYRIEMEI---VNSCGSGNGGCSH------HCQHGLQGPVCS--CNTGY---QLDEDLKTCLDLNECAEGSSCCEQDCTNYPGGYECYCRAGYRLNSDGCGCDDVDECLSDN-GGCENICQNTAGSYQCFCRLGQRLAEDRHSCIPLERAVEALSSRLAVERPFPQVTLLQDYPQALERYDDYEEDSFGEL--RAESTIIEKYVCLNETFGHDCSLSCDDCSNGGLCNLEKNG-CDCPDGWTGIICNQTCPEGTFGRNCSFTCKCKNGAICDPKSGVCKCPPGVSGDMCQDGCPKGFYGKHCNKKCNCANNGRCHRTYGACLCDPGLYGRFCHLSCPKWSYGPGCSSECQCVQQNTLECHRRHGNCVCKPGYQGKTCSEECGSGYYGPGCKKKCQCSSGMPCHHVTGQCQCPSGWHGESCDQECPQGKFGSGCSQSCDC-NGAVCDSVTGLCRCPAGTTGERCAEECKEGRWGLACAELCPACENGGVCDKQNGTCMCEPGYTGTHCRTVCPAGWFGLGCQFQCSCKNGGRCHPSSGLCACKAGWTGPSCE-KACQPGQWGADCANACNCTSRAAGCDAVTGQCHCQAGYTGTYCELKCSEGFFGPGCHHQCQCENGAICEPVGGACTCLPGWTGTYCEKPCPQGFHGLECQHKCECLNGGQ-CHHVTGTCACPAGWIGPRCTSKCQAGLYGPGCNQSCNCHHNASCDPTSGQCQCGPGWTGPTCEQECSFGFYGLDCRQQCLCQNGGSCDRISGHCTCSSGWTGVACEL 1097          

HSP 6 Score: 265.774 bits (678), Expect = 9.169e-72
Identity = 185/525 (35.24%), Postives = 259/525 (49.33%), Query Frame = 3
Query: 1530 CGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFG-KCEA-CPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCI-YGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDE 3095
            C +     D   +C+C NG +  + +  C    + G +       C  G FG +C   C  C ++G C+     C C   + G  CE  C        CQ  QC C++G  C+  T  C CPPG  G  CE  C  G++G+ C + C        C+ +TG+C C PG+ GS C   C  GT+G+ C++ C C++ N + CDP  G C C  GY G  C  +C+ G++G +C   C      +C   TG C      G     C   CP G  G DC +   C + + S +   G C C  G  G+ C   C +G +GE C   C C    +CD V G C C     G +C+  CP+G++G  C Q CDC  ++ CD++ G+C+C  GYYG  C   CP+G +G  C + C C     C+P +G C C PG+ GE CE  CD+G++G  C + C C  G  CD    +C C PG  G  C+ SCA+  YG  C   C+C NG  C+  +G+C C+ GW G NC E
Sbjct: 1056 CSFGFYGLDCRQQCLCQNGGSCDRISGHCTC--SSGWTGVACELECAPGHFGADCQHTCE-CENEGVCDRHDGTCSCPAGWVGHRCEKACEAGKFGPGCQ-RQCRCEHGAACDHITGACACPPGWRGLRCEKTCLPGYYGKRCSQRCKCP-HGTSCNHVTGECGCPPGFTGSGCERTCQPGTFGVNCNQVCQCSEVN-QLCDPVAGTCYCAPGYRGEKCNVECEEGHYGPNCERKCQCLNNGVCQATTGTCVCPP--GYIGPDCNITCPAGWYGQDCARVALCGDGARS-DPVTGRCVCKAGQRGEDCGQGCAQGWFGEDCAQRCNCSNGAVCDPVNGNCTCGLGWTGDRCDTECPTGRYGANCLQQCDCHNNSTCDRVTGECVCDLGYYGHFCQHVCPQGFHGHRCQRLCDCHGKATCEPSTGDCLCPPGYQGERCERECDQGWFGLDCAKTCDCDGGTPCDPVSGRCLCGPGKMGRRCDISCALNRYGPECLESCECGNGAQCNPRNGRCTCLNGWIGPNCQE 1571          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Cavefish
Match: MEGF6 (multiple EGF like domains 6 [Source:NCBI gene;Acc:103032853])

HSP 1 Score: 689.108 bits (1777), Expect = 0.000e+0
Identity = 442/1197 (36.93%), Postives = 590/1197 (49.29%), Query Frame = 3
Query:  672 CPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTC------------------------------------------QNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCS------------------------------------------ENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFG-KCE-ACPSGKWGPTCNQNCDCT-YSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN-CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKE--SDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFC 3992
            C  GY     G    D++EC  +   C H CVN  G + C+C P   L  D   CI  +  C  +N GGC   CV+LS   F C C   + L  D + C + + C + NGGC+H C+S    +V  C+C  GY +   D K C+DI+EC      C H C N  GSF C C+PG+++G + + CY+++ME+ + C  GNGGC+  C     +  +CSC  G++L+ D  TC D +EC  G   C     C N  G Y C C  GYRL  +   C+D+DECL   GGC   C NT GSY+C C  G+ L +D  +C                                               R  S   +   C   TFG +C  +C +C + G CN ++ GC C   ++G IC   C +      C    C CKNG  C+ ++  C CPPG+SG++C+ GC +GF+G++C K C  A ++ RCH+  G CLC PG YG  CHL CP  ++G GCS  C C Q N   C  ++G C CK GY G  C  +C  GY+G  C   C       C+H TGQC   +  G +   C ++CP G  GS C ++CDC+                                          EN   C+++NG C C PG+TG  C   C  G +G  CQ  C C+    C   +G+C C     G  CE AC  G+WG  C   C+CT  + GCD + GQC C AGY G  C  +C EG +G GC  +CQC  G  C+P+ G C C PGW G  CE PC +G++G +C+ KC+CLNGG C      C C  GW G  C   C  G YG  C   C CH+   CD  SG+C C PGW G  C++ C    YG +C Q C C NGG C   +G C C +G  G  CEL C P  +G +C H C C+    CD   G C+CP    G  CE K C++ +    C++ C+C    +C+ +TG C C PG RG +C + C  G +G  C Q+C+C +G  CN V G C C  GFTG  C++ C  G +G NC   C     N+ C P  G C C  G     C  +C  G+YGP C++ CQC++   C  +TG C C  G+ G  C   CP  +YG +C     C   +  +PVTG CVC     G  C
Sbjct:   37 CYNGYHGYHGGYVRPDVDECQVHNGGCQHRCVNTRGSYYCECNPGFRLHTDGRTCIAVL-SCAISN-GGCEQECVQLSPTHFQCRCRHSYQLTADGKHCKLRNPCTERNGGCTHTCRSVGGHAV--CECHRGYRL-AQDQKSCEDIDECETGQAACAHDCRNTPGSFSCICNPGYELGSEGRKCYRIEMEIVNSCGSGNGGCSHHCQHGL-QGPVCSCNTGYQLDEDLKTCLDLNECAEGSSCC--EQDCTNYPGGYECYCRAGYRLNSDGCGCDDVDECLSDNGGCENICQNTAGSYQCFCRLGQRLAEDRHSCIPLERAVEALSSRLAVERPFPQVTLLQDYPQALERYDDYEEDSFGELRAESTIIEKYVCLNETFGHDCSLSCDDCSNGGLCNLEKNGCDCPDGWTGIICNQTCPEGTFGRNCS-FTCKCKNGAICDPKSGVCKCPPGVSGDMCQDGCPKGFYGKHCNKKCNCA-NNGRCHRTYGACLCDPGLYGRFCHLSCPKWSYGPGCSSECQCVQQNTLECHRRHGNCVCKPGYQGKTCSEECGSGYYGPGCKKKCQCSSGMPCHHVTGQCQCPS--GWHGESCDQECPQGKFGSGCSQSCDCNGAVCDSVTGLCRCPAGTTGERCAEECKEGRWGLACAELCPACENGGVCDKQNGTCMCEPGYTGTHCRTVCPAGWFGLGCQFQCSCKNGGRCHPSSGLCACKAGWTGPSCEKACQPGQWGADCANACNCTSRAAGCDAVTGQCHCQAGYTGTYCELKCSEGFFGPGCHHQCQCENGAICEPVGGACTCLPGWTGTYCEKPCPQGFHGLECQHKCECLNGGQCHHVTGTCACPAGWIGPRCTSKCQAGLYGPGCNQSCNCHHNASCDPTSGQCQCGPGWTGPTCEQECSFGFYGLDCRQQCLCQNGGSCDRISGHCTCSSGWTGVACELECAPGHFGADCQHTCECENEGVCDRHDGTCSCPAGWVGHRCE-KACEAGKFGPGCQRQCRCEHGAACDHITGACACPPGWRGLRCEKTCLPGYYGKRCSQRCKCPHGTSCNHVTGECGCPPGFTGSGCERTCQPGTFGVNCNQVCQCSEVNQLCDPVAGTCYCAPGYRGEKCNVECEEGHYGPNCERKCQCLNNGVCQATTGTCVCPPGYIGPDCNITCPAGWYGQDCARVALCGDGARSDPVTGRCVCKAGQRGEDC 1220          

HSP 2 Score: 579.711 bits (1493), Expect = 0.000e+0
Identity = 408/1183 (34.49%), Postives = 564/1183 (47.68%), Query Frame = 3
Query:  648 IDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINC----IPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEAD---GLTCSDEDE-----CVTGKHKCVPPSTCINDLGSYLCT-----CPVGY--RLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPL-QCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQ-----------------------------------------NNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK-CEA-CPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIY-GNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCD--SKESDCRQDCQCS-IKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCE 3995
            + G   C+C  GY ++++ K+C DI+EC   +  C+H+C N PG F C C P   LG +   C    +  ++ C S N GGC+HHC +      +CSC  G+ LD+D ++C  ++ C + +  C   C + P      C CR GY ++ +D   C D++EC   NGGC++IC N  GS+ C C  G ++  D  SC  ++  +                +  ++ A+    P   L  D    L   D+ E      +  +   +    C+N+   + C+     C  G    L KN   C D    +     C       + S+ C C NG      +  C+        + +D   CPKG +G+ C   C NC + G C+     CLC P   G  C + C +      C    QC  +N   C      C C PG  G+ C   C  G++G  C+K C  + S   CH +TG+C C  GW+G SC   CP G +G GCS++C CN                                           N   CD +NG C C+ GY G +C   C  G+FGL C F C       C+  +G C  K   G     C++ C  G  G+DC   C+C+  +  C+   G CHC  G+TG  CELKC++G +G  C   CQC    +C+ V G C C     G  CE  CP G  G  C   C+C     C  + G C C AG+ GP+C+ +C  GLYG GC++ C C +  +CDP SG C+C PGW G  CE  C  G+YG  C+++C C NGG+CD     C C  GW G  CE  CA G++G +C+  C+C N G+CD   G C C  GW G  C++ C +  +GP C + C+C +G  C    G C CP G  G  CE TC P  YG  C   C C     C+  TGEC CP    G  CE + C   +   +C Q CQCS + + C+ V G C C PG RG +C   CE G++G +C++KC+C N   C    GTC+C  G+ G  C+  C  GWYG +C  +  +C       P TG+C C+AG    DC   C  G++G  C Q C C +GA C+P  G C C  G+ G  C   CP   YGANC  +C C +NS C+ VTG CVC     G FC+
Sbjct:  153 VGGHAVCECHRGYRLAQDQKSCEDIDECETGQAACAHDCRNTPGSFSCICNPGYELGSEGRKCYRIEMEIVNSCGSGN-GGCSHHC-QHGLQGPVCSCNTGYQLDEDLKTCLDLNECAEGSSCCEQDCTNYPGG--YECYCRAGYRLN-SDGCGCDDVDECLSDNGGCENICQNTAGSYQCFCRLGQRLAEDRHSCIPLERAV---------------EALSSRLAVERPFPQVTLLQDYPQALERYDDYEEDSFGELRAESTIIEKYVCLNETFGHDCSLSCDDCSNGGLCNLEKNGCDCPDGWTGIICNQTCPEGTFGRNCSFTCKCKNGAICDPKSGVCKCPPGVSGDMCQD--GCPKGFYGKHCNKKC-NCANNGRCHRTYGACLCDPGLYGRFCHLSCPKWSYGPGCSSECQCVQQNTLECHRRHGNCVCKPGYQGKTCSEECGSGYYGPGCKKKCQCS-SGMPCHHVTGQCQCPSGWHGESCDQECPQGKFGSGCSQSCDCNGAVCDSVTGLCRCPAGTTGERCAEECKEGRWGLACAELCPACENGGVCDKQNGTCMCEPGYTGTHCRTVCPAGWFGLGCQFQCSCKNGGRCHPSSGLCACKA--GWTGPSCEKACQPGQWGADCANACNCTSRAAGCDAVTGQCHCQAGYTGTYCELKCSEGFFGPGCHHQCQCENGAICEPVGGACTCLPGWTGTYCEKPCPQGFHGLECQHKCECLNGGQCHHVTGTCACPAGWIGPRCTSKCQAGLYGPGCNQSCNCHHNASCDPTSGQCQCGPGWTGPTCEQECSFGFYGLDCRQQCLCQNGGSCDRISGHCTCSSGWTGVACELECAPGHFGADCQHTCECENEGVCDRHDGTCSCPAGWVGHRCEKACEAGKFGPGCQRQCRCEHGAACDHITGACACPPGWRGLRCEKTCLPGYYGKRCSQRCKCPHGTSCNHVTGECGCPPGFTGSGCE-RTCQPGTFGVNCNQVCQCSEVNQLCDPVAGTCYCAPGYRGEKCNVECEEGHYGPNCERKCQCLNNGVCQATTGTCVCPPGYIGPDCNITCPAGWYGQDC-ARVALCGDGARSDPVTGRCVCKAGQRGEDCGQGCAQGWFGEDCAQRCNCSNGAVCDPVNGNCTCGLGWTGDRCDTECPTGRYGANCLQQCDCHNNSTCDRVTGECVCDLGYYGHFCQ 1307          

HSP 3 Score: 488.419 bits (1256), Expect = 2.863e-148
Identity = 407/1209 (33.66%), Postives = 539/1209 (44.58%), Query Frame = 3
Query:  657 GFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQ-HICLNVEGSFIC--------------------DCHPGWQIGHDHKSC----YKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDE-DECVTGKH-----KCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCV----NTDGSYR----CVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTI-CNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFG-KCEA-CPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPD--------------------------------------------KYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIK-NCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVS-VINRL 4016
            G  C C  GY++ E+ K C+D+NEC    + C  +C N PGG+ C C     L  D   C   +  C S N GGC + C   +   + C C  G  L +DR SC  + L +      S L    P   V   +  P  A++  D  +     E   ++   + ++CLN      C                    DC  GW     +++C    +  +   T  CK G       C+    K  +C C PG      G  C D   +   GKH      C     C    G+  C C  G   R   ++C        Y  GC  +C     NT   +R    CVC      G   KTC  +             C  G +G  C   C  C     C+     C C   + G  C+ +C Q      C    C C NG  C+S T  C CP G +GE C   C EG +G  C + CP   +   C +  G C+C PG+ G+ C  +CP G +G+GC   CSC   N   C P +G C CK G+ G +C   C PG +G DC+ +C    +   C+  TGQC  +   G     C+  C  G  G  C   C C EN   CE   G C C PG+TG  CE  C +G +G  CQ  C+C     C HVTG C C     G +C + C +G +GP CNQ+C+C ++  CD  +GQC C  G+ GP C + C  G YG  C ++C C  G +CD ISG C C+ GW G  CE  C  G++G  C+  C+C N G CD     C C  GW G  CEK+C  G +G  C+ +C+C +G  CD I+G C C PGWRG+ C++ C    YG  C+Q C+C +G  C+   G C CP G  G  CE TC P                                              YGPNC   C C     C   TG C CP    G  C I         DC +   C      + VTG+C CK G RG  C Q C  G FG DC Q+C C+NG  C+PV+G C C  G+TG  CD  C  G YG NC  +C  C+ N TC   TG+C C+ G   + C+  CP G++G  CQ+ C C   A+C PSTG C C  G+ G  C+  C   ++G +C   C C   +PC+PV+G C+C     GR C++S  +NR 
Sbjct:  243 GPVCSCNTGYQLDEDLKTCLDLNECAEGSSCCEQDCTNYPGGYECYCRAGYRLNSDGCGCDD-VDECLSDN-GGCENICQNTAGS-YQCFCRLGQRLAEDRHSC--IPLERAVEALSSRLAVERPFPQVTLLQDYP-QALERYDDYEEDSFGELRAESTIIEKYVCLNETFGHDCSLSCDDCSNGGLCNLEKNGCDCPDGWTGIICNQTCPEGTFGRNCSFTCKCKNG-----AICDP---KSGVCKCPPGVS----GDMCQDGCPKGFYGKHCNKKCNCANNGRCHRTYGA--CLCDPGLYGRFCHLSCPK----WSYGPGCSSECQCVQQNTLECHRRHGNCVC----KPGYQGKTCSEE-------------CGSGYYGPGCKKKC-QCSSGMPCHHVTGQCQCPSGWHGESCDQECPQGKFGSGCS-QSCDC-NGAVCDSVTGLCRCPAGTTGERCAEECKEGRWGLACAELCPACENGGVCDKQNGTCMCEPGYTGTHCRTVCPAGWFGLGCQFQCSCK--NGGRCHPSSGLCACKAGWTGPSCEKACQPGQWGADCANACNCTSRAAGCDAVTGQCHCQA--GYTGTYCELKCSEGFFGPGCHHQCQC-ENGAICEPVGGACTCLPGWTGTYCEKPCPQGFHGLECQHKCECLNGGQCHHVTGTCACPAGWIGPRCTSKCQAGLYGPGCNQSCNCHHNASCDPTSGQCQCGPGWTGPTCEQECSFGFYGLDCRQQCLCQNGGSCDRISGHCTCSSGWTGVACELECAPGHFGADCQHTCECENEGVCDRHDGTCSCPAGWVGHRCEKACEAGKFGPGCQRQCRCEHGAACDHITGACACPPGWRGLRCEKTCLPGYYGKRCSQRCKCPHGTSCNHVTGECGCPPGFTGSGCERTCQPGTFGVNCNQVCQCSEVNQLCDPVAGTCYCAPGYRGEKCNVECEEGHYGPNCERKCQCLNNGVCQATTGTCVCPPGYIGPDCNITCPAGWYGQDCARVALCGDGARSDPVTGRCVCKAGQRGEDCGQGCAQGWFGEDCAQRCNCSNGAVCDPVNGNCTCGLGWTGDRCDTECPTGRYGANCLQQC-DCHNNSTCDRVTGECVCDLGYYGHFCQHVCPQGFHGHRCQRLCDCHGKATCEPSTGDCLCPPGYQGERCERECDQGWFGLDCAKTCDCDGGTPCDPVSGRCLCGPGKMGRRCDISCALNRY 1401          

HSP 4 Score: 437.187 bits (1123), Expect = 1.034e-129
Identity = 293/793 (36.95%), Postives = 390/793 (49.18%), Query Frame = 3
Query: 1635 GSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFG-KCEA-CPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN-CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHN-GGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKE--SDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCE 3995
            G++ ++    C +G +G  C   C  C + G C+     C+C P Y+GT C   C      + CQ  QC CKNGG C   +  C C  G +G  CE  C  G +G +C   C     +  C  +TG+C C  G+ G+ C L C  G +G GC   C C   N   C+P  G C C  G+ G  C   C  G+ GL+C   C       C+H TG C      G     C   C  G  G  C ++C+C  N+ SC+  +G C C PG+TG  CE +C+ G YG  C+  C C+    CD ++G C C+    G  CE  C  G +G  C   C+C     CD+ +G C C AG+ G +C K C  G +G GC ++C+C +G  CD I+G C C PGW G  CE  C  GYYG +C ++CKC +G +C+    +C C PG+ G  CE++C  G +G NC   CQC     LCD ++G C C PG+RG  C+  C    YGPNC + CQCLN G C    G C CP G  G  C +TCP   YG +C    +C    + D  TG C C     G  C  + C       DC Q C CS    C+ V G C C  G  G +C   C  G +G +C Q+C C N   C+ V G C+C  G+ G  C  VC +G++G  C+  C  C+   TC P TG C C  G     C+ +C  G++G  C + C C  G  C+P +G C C  G  G  C   C  N YG  C   C+C + + CNP  G C C     G  C+
Sbjct:  652 GTTGERCAEECKEGRWGLACAELCPACENGGVCDKQNGTCMCEPGYTGTHCRTVCPAGWFGLGCQ-FQCSCKNGGRCHPSSGLCACKAGWTGPSCEKACQPGQWGADCANACNCTSRAAGCDAVTGQCHCQAGYTGTYCELKCSEGFFGPGCHHQCQCE--NGAICEPVGGACTCLPGWTGTYCEKPCPQGFHGLECQHKCECLNGGQCHHVTGTCACPA--GWIGPRCTSKCQAGLYGPGCNQSCNCHHNA-SCDPTSGQCQCGPGWTGPTCEQECSFGFYGLDCRQQCLCQNGGSCDRISGHCTCSSGWTGVACELECAPGHFGADCQHTCECENEGVCDRHDGTCSCPAGWVGHRCEKACEAGKFGPGCQRQCRCEHGAACDHITGACACPPGWRGLRCEKTCLPGYYGKRCSQRCKCPHGTSCNHVTGECGCPPGFTGSGCERTCQPGTFGVNCNQVCQCSEVNQLCDPVAGTCYCAPGYRGEKCNVECEEGHYGPNCERKCQCLNNGVCQATTGTCVCPPGYIGPDCNITCPAGWYGQDCARVALCGDGARSDPVTGRCVCKAGQRGEDCG-QGCAQGWFGEDCAQRCNCSNGAVCDPVNGNCTCGLGWTGDRCDTECPTGRYGANCLQQCDCHNNSTCDRVTGECVCDLGYYGHFCQHVCPQGFHGHRCQRLC-DCHGKATCEPSTGDCLCPPGYQGERCERECDQGWFGLDCAKTCDCDGGTPCDPVSGRCLCGPGKMGRRCDISCALNRYGPECLESCECGNGAQCNPRNGRCTCLNGWIGPNCQ 1436          

HSP 5 Score: 416.772 bits (1070), Expect = 1.523e-122
Identity = 277/732 (37.84%), Postives = 375/732 (51.23%), Query Frame = 3
Query: 1563 YRCVCPNGETLGKDNKTCQ-NQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTG-CLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFG-KCE-ACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN--CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCE-IKNCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCK 3737
            ++C C NG      +  C       G S +K    C  G +G +C   C NC  +    D  TG C C   Y+GT CE+ C +      C   QC C+NG  CE     C C PG +G  CE  C +GF G  C+  C    +  +CH +TG C C  GW G  C   C  G +G GC+++C+C+ N    CDP +G+C+C  G+ G  C  +C  G++GLDC   C       C+  +G C   +  G   + C+ +C  G  G+DC+ TC+C EN   C+  +G C C  G+ G RCE  C  G +G  CQ  C+C     CDH+TG C C     G +CE  C  G +G  C+Q C C + T C+ + G+C C  G+ G  C + C  G +G  C++ CQC   N  CDP++G C C PG+ GE C   C+EG+YG  C+ KC+CLN G C      C C PG+ G  C  +C  G+YG++C     C +G   D ++G+C C  G RG +C + C    +G +C Q C C NG  C P NG C C  G  GD C+  CP  +YG NCL  C C     CD  TGEC C    +G  C+ +         C++ C C  K +C   TG C C PG +G +C + C+ G FGLDC + C C  G PC+PV G CLC  G  G  CD  CA   YGP C L+   C     C+P+ G+C+C  G I  +C+
Sbjct:  717 FQCSCKNGGRCHPSSGLCACKAGWTGPSCEK---ACQPGQWGADCANAC-NCTSRAAGCDAVTGQCHCQAGYTGTYCELKCSEGFFGPGCH-HQCQCENGAICEPVGGACTCLPGWTGTYCEKPCPQGFHGLECQHKCECL-NGGQCHHVTGTCACPAGWIGPRCTSKCQAGLYGPGCNQSCNCHHN--ASCDPTSGQCQCGPGWTGPTCEQECSFGFYGLDCRQQCLCQNGGSCDRISGHCTCSS--GWTGVACELECAPGHFGADCQHTCEC-ENEGVCDRHDGTCSCPAGWVGHRCEKACEAGKFGPGCQRQCRCEHGAACDHITGACACPPGWRGLRCEKTCLPGYYGKRCSQRCKCPHGTSCNHVTGECGCPPGFTGSGCERTCQPGTFGVNCNQVCQCSEVNQLCDPVAGTCYCAPGYRGEKCNVECEEGHYGPNCERKCQCLNNGVCQATTGTCVCPPGYIGPDCNITCPAGWYGQDCARVALCGDGARSDPVTGRCVCKAGQRGEDCGQGCAQGWFGEDCAQRCNCSNGAVCDPVNGNCTCGLGWTGDRCDTECPTGRYGANCLQQCDCHNNSTCDRVTGECVCDLGYYGHFCQHVCPQGFHGHRCQRLCDCHGKATCEPSTGDCLCPPGYQGERCERECDQGWFGLDCAKTCDCDGGTPCDPVSGRCLCGPGKMGRRCDISCALNRYGPEC-LESCECGNGAQCNPRNGRCTCLNGWIGPNCQ 1436          

HSP 6 Score: 367.851 bits (943), Expect = 2.229e-105
Identity = 304/954 (31.87%), Postives = 429/954 (44.97%), Query Frame = 3
Query: 1320 SCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGS-YRCVCPNGETLGKDNKTCQNQNT------------------------RGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITG----KCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCD------PKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFS----------------CPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCD-CSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN---CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVC-QCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKE--SDCRQDCQCSIKKS-CNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEV 3998
            +C  G+     G    D DEC      C     C+N  GSY C C  G+RL  +  TC  +  C    GGC  +CV    + ++C C +   L  D K C+ +N                         RG  L +D + C      +EC    + C H          C+C+P Y        C +   ++      C   NGG         +C  G+ G +C   C  G+     +++  T    N C + +      C  +PG Y   C       + G GC     C  +N  GC+        + +C C+ G       + C P    ++   S                 P+  +   ++E     +   +  ++I  +  C     G DC  +CD CS   +   EKNG C C  G+TG  C   C +G +G  C  +C+C+   +CD  +G+C C     G    + CP G +G  CN+ C+C  +  C +  G C+C  G YG  C   CP+  YG GCS ECQC+  N   C    G C C PG+ G+ C   C  GYYG  CK+KC+C +G  C     +CQC  GWHGE C++ C  G +G  C   C C NG +CD ++G C C  G  G  C E C    +G  C ++C  C NGG C  +NG C C  G  G  C   CP   +G  C   C CK   +C   +G C C     G SCE K C   +  +DC   C C+ + + C+ VTG+C C+ G  G  C   C  G FG  C  +C+C NG  C PV G C CL G+TG  C++ C +G++G  C+ KC   N  + CH  TG C+C AG I   C  +C +G YGP C Q+C C H ASC+P++G CQC  G+ G  C+  C   FYG +C+ +C C +   C+ ++GHC C    +G  CE+
Sbjct:   36 TCYNGYHGYHGGYVRPDVDECQVHNGGCQ--HRCVNTRGSYYCECNPGFRLHTDGRTCIAVLSCAISNGGCEQECVQLSPTHFQCRCRHSYQLTADGKHCKLRNPCTERNGGCTHTCRSVGGHAVCECHRGYRLAQDQKSCEDI---DECETGQAACAHDCRNTPGSFSCICNPGYELGSEGRKCYRIEMEI---VNSCGSGNGGCSH------HCQHGLQGPVCS--CNTGY---QLDEDLKTCLDLNECAEGSSCCEQDCTNYPGGYECYCRAGYRLNSDGCGCDDVDECLSDN-GGCENICQNTAGSYQCFCRLGQRLAEDRHSCIPLERAVEALSSRLAVERPFPQVTLLQDYPQALERYDDYEEDSFGEL--RAESTIIEKYVCLNETFGHDCSLSCDDCSNGGLCNLEKNG-CDCPDGWTGIICNQTCPEGTFGRNCSFTCKCKNGAICDPKSGVCKCPPGVSGDMCQDGCPKGFYGKHCNKKCNCANNGRCHRTYGACLCDPGLYGRFCHLSCPKWSYGPGCSSECQCVQQNTLECHRRHGNCVCKPGYQGKTCSEECGSGYYGPGCKKKCQCSSGMPCHHVTGQCQCPSGWHGESCDQECPQGKFGSGCSQSCDC-NGAVCDSVTGLCRCPAGTTGERCAEECKEGRWGLACAELCPACENGGVCDKQNGTCMCEPGYTGTHCRTVCPAGWFGLGCQFQCSCKNGGRCHPSSGLCACKAGWTGPSCE-KACQPGQWGADCANACNCTSRAAGCDAVTGQCHCQAGYTGTYCELKCSEGFFGPGCHHQCQCENGAICEPVGGACTCLPGWTGTYCEKPCPQGFHGLECQHKCECLNGGQ-CHHVTGTCACPAGWIGPRCTSKCQAGLYGPGCNQSCNCHHNASCDPTSGQCQCGPGWTGPTCEQECSFGFYGLDCRQQCLCQNGGSCDRISGHCTCSSGWTGVACEL 963          

HSP 7 Score: 265.003 bits (676), Expect = 1.428e-71
Identity = 185/525 (35.24%), Postives = 259/525 (49.33%), Query Frame = 3
Query: 1530 CGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFG-KCEA-CPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCI-YGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDE 3095
            C +     D   +C+C NG +  + +  C    + G +       C  G FG +C   C  C ++G C+     C C   + G  CE  C        CQ  QC C++G  C+  T  C CPPG  G  CE  C  G++G+ C + C        C+ +TG+C C PG+ GS C   C  GT+G+ C++ C C++ N + CDP  G C C  GY G  C  +C+ G++G +C   C      +C   TG C      G     C   CP G  G DC +   C + + S +   G C C  G  G+ C   C +G +GE C   C C    +CD V G C C     G +C+  CP+G++G  C Q CDC  ++ CD++ G+C+C  GYYG  C   CP+G +G  C + C C     C+P +G C C PG+ GE CE  CD+G++G  C + C C  G  CD    +C C PG  G  C+ SCA+  YG  C   C+C NG  C+  +G+C C+ GW G NC E
Sbjct:  922 CSFGFYGLDCRQQCLCQNGGSCDRISGHCTC--SSGWTGVACELECAPGHFGADCQHTCE-CENEGVCDRHDGTCSCPAGWVGHRCEKACEAGKFGPGCQ-RQCRCEHGAACDHITGACACPPGWRGLRCEKTCLPGYYGKRCSQRCKCP-HGTSCNHVTGECGCPPGFTGSGCERTCQPGTFGVNCNQVCQCSEVN-QLCDPVAGTCYCAPGYRGEKCNVECEEGHYGPNCERKCQCLNNGVCQATTGTCVCPP--GYIGPDCNITCPAGWYGQDCARVALCGDGARS-DPVTGRCVCKAGQRGEDCGQGCAQGWFGEDCAQRCNCSNGAVCDPVNGNCTCGLGWTGDRCDTECPTGRYGANCLQQCDCHNNSTCDRVTGECVCDLGYYGHFCQHVCPQGFHGHRCQRLCDCHGKATCEPSTGDCLCPPGYQGERCERECDQGWFGLDCAKTCDCDGGTPCDPVSGRCLCGPGKMGRRCDISCALNRYGPECLESCECGNGAQCNPRNGRCTCLNGWIGPNCQE 1437          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Cavefish
Match: megf6b (multiple EGF-like-domains 6b [Source:ZFIN;Acc:ZDB-GENE-101112-3])

HSP 1 Score: 680.633 bits (1755), Expect = 0.000e+0
Identity = 429/1143 (37.53%), Postives = 582/1143 (50.92%), Query Frame = 3
Query:  714 IDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTC----------------------------------------QNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSC-QCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIY--GNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFG-------LSCEIKNC-------DSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVC 3965
             DI+EC  +   C H+CVN  G + CQC     L  D   CI  +H C   N GGC H+CV+ +   F C C   + L +D + C++ D C   NGGCS  C++D   +   C C PGY +   D K C+DINEC      C H C N  GSF+C C+  +++G D K CY+++ME+ + C+  NGGC+  C  S +   +CSC  G++L+ D  TC D DECV G   C     C N  G Y C C  GYRL  +  +C+DIDECL   GGC + C N+ GS++C C  G  L +D ++C                                             R  S   +   C   TFG +C  +C +C++ G CN  ++GC C   ++G IC   C +      C    C CKNGG C+  T  C CPPG+SG++C+ GC +G +G++C K C  A ++ RCH+  G CLC PG YG  CHL CP   +G GCS+ C C Q N   C  ++G C C+ G+ G  C  +CD G+FG  C   C     + CN  TG C  +   G     C +DC  G  G  C ++CDCS     C++  G C C  G  G RCE    KG +GE C+ +C  C     CD  +G C C     G+     CP+G++G  C   C C  S  C  + G+C C  G+ G  C K C  G +G  C + C C    G+CDP +G C C PG+ G  CE+ C  G++G  C++ C+C N  +CD     C C  GW G FCEK C  G+YG +C+ +C C NGG C+ I+G+C C  GW G  C+++CP  ++G +C Q C C NGG C   +G C C +G  G  CEL C   ++G +C   C  +   +CD +TG+C C     G       L C + N              C + C+C    SC+ +TG C C PG RG  C + C  G +G DC + C C  G  C+ V G C C  G+TG  C+Q C  G YG NC   C    RN+ CHP +G+C C  G     C  +C SG YGP C++ CQC++G +C  +TGAC+C  GF GA C   C    YG +C     C   +  +PVTG CVC
Sbjct:   33 ADIDECQVHNGGCQHKCVNTRGSYHCQCNAGSRLHVDGRTCIA-VHSCGIGN-GGCEHYCVQQTAAHFQCRCRPNYTLAEDGKHCTLSDPCAVRNGGCSQECRTDGGRA--HCDCSPGYTL-AEDGKTCEDINECQTGQANCAHGCRNTRGSFVCVCNAAYELGEDGKQCYRIEMEIVNSCEVNNGGCSHHCQHSTSG-PVCSCNQGYRLDDDLRTCIDLDECVDGSSCC--EQDCTNYPGGYECYCAAGYRLNSDGCSCDDIDECLAENGGCDHTCQNSAGSFQCYCKRGHRLDEDRRSCILLEGAVEALSNGQAVERPKPQLAVLHDYEALERYDDYEEDTSELRAESSLTEKFVCLNDTFGFDCSLSCEDCVNGGVCNAYRSGCECPDGWTGIICNQTCPEGWFGRNCS-FSCKCKNGGVCDPVTGSCRCPPGVSGDLCQDGCPKGLYGKHCNKKCNCA-NNGRCHRTYGACLCDPGLYGRFCHLPCPKWVFGPGCSEECKCVQQNTLECHRRHGSCICRPGFWGNKCEKECDEGFFGSGCEKKCSCPSGSTCNPVTGACQQQCPAGKTGENCDQDCEIGTFGLSCSQSCDCS--GAPCDQVTGQCRCPAGVMGSRCE----KGQWGEGCKETCPVCENGGECDKQSGTCICTPGYMGRLCQNLCPAGRFGQGCQLKCVCENSGRCHPVTGRCTCALGWTGHNCKKACDAGHWGPDCVRVCDCKNSDGSCDPATGQCTCEPGFTGVHCEHKCPAGFFGSGCRQHCQCENEASCDHVSGACTCSMGWTGTFCEKPCPQGFYGLDCQQKCVCVNGGQCNHITGECVCSAGWLGTTCNQKCPEGSFGLSCTQPCLCQNGGSCDHVSGHCSCASGWTGAACELECATGRFGTDCHREC--ENGGQCDRQTGKCVCGAGWVGEISKLSILKCIVCNLCLISVWSGRFGVSCEEQCRCEHAASCHHITGSCLCPPGWRGVHCEKACLPGRYGKDCAELCVCPQGTSCHHVTGECGCPPGYTGHGCEQTCLPGTYGLNCNQVCQCSERNQLCHPVSGECYCAPGYRGPKCDLECESGRYGPDCERQCQCLNGGTCQATTGACECPPGFIGAQCNITCSAGRYGQDCARVALCGDGARPDPVTGRCVC 1157          

HSP 2 Score: 558.14 bits (1437), Expect = 1.568e-174
Identity = 426/1204 (35.38%), Postives = 561/1204 (46.59%), Query Frame = 3
Query:  648 IDGG-FYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINC----IPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDE---CLDYTGGC-------GYKCVNT--------DGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVEC-QPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEK--NCPTA-----------------------------------------CSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQ-GNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK-CEA-CPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGE-------------FCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCIC-KATEKCDLKTGECTCPKSAFGLSCEIKNCDSKE--SDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEV 3998
             DGG  +C C PGY ++E+GK C DINEC   + +C+H C N  G F C C     LG D   C    +  ++ C+  N GGC+HHC + S    +CSC  G+ LD D R+C  +D C D +  C   C + P      C C  GY ++ +D   C DI+EC  +NGGC H C N  GSF C C  G ++  D +SC  ++  +       NG   Q       + A+       +   D    + E   +  +        C+ND   + C+           ++CED      C  Y  GC       G  C  T        + S+ C C NG        +C+        L +D   CPKG +G+ C   C NC + G C+     CLC P   G  C + C +      C +  +C  +N   C      C C PG  G  CE  C EGFFG  CEK  +CP+                                          CS   C Q+TG+C C  G  GS C      G WG GC +TC   +N  E CD ++G C C  GY G  C   C  G FG  C   C  +    C+  TG+C   TC  G     C++ C  G  G DC + CDC  +  SC+   G C C PGFTG  CE KC  G +G  C+  CQC  +  CDHV+G C C+    G  CE  CP G +G  C Q C C     C+ I G+C+C AG+ G  C+++CPEG +G  C++ C C  G +CD +SG C C  GW G  CE  C  G +G  C  +C+  NGG CD    KC C  GW GE              C  S   G +G +CE +C+C +   C  I+G C C PGWRG++C++ C    YG +C ++C C  G  CH   G C CP G  G  CE TC P  YG NC   C C +  + C   +GEC C     G  C+++ C+S     DC + CQC    +C   TG C+C PG  G QC   C  G +G DC +   C +G   +PV G C+C  G     C Q CA GWYG +C  +C   NR   C   +G CSC  G     C+ +CP G YGP C   C+C H +SC+  TG C+C  G+YG LC+  CP   YG+ CQ  C C + +PC+P TGHCVCP    G  CE 
Sbjct:  134 TDGGRAHCDCSPGYTLAEDGKTCEDINECQTGQANCAHGCRNTRGSFVCVCNAAYELGEDGKQCYRIEMEIVNSCE-VNNGGCSHHC-QHSTSGPVCSCNQGYRLDDDLRTCIDLDECVDGSSCCEQDCTNYPGG--YECYCAAGYRLN-SDGCSCDDIDECLAENGGCDHTCQNSAGSFQCYCKRGHRLDEDRRSCILLEGAVE---ALSNG---QAVERPKPQLAVLHDYEALERYDDYEEDTSE---LRAESSLTEKFVCLNDTFGFDCS-----------LSCEDCVNGGVCNAYRSGCECPDGWTGIICNQTCPEGWFGRNCSFSCKCKNGGVCDPVTGSCRCPPGVSGDLCQDG--CPKGLYGKHCNKKC-NCANNGRCHRTYGACLCDPGLYGRFCHLPCPKWVFGPGCSEECKCVQQNTLECHRRHGSCICRPGFWGNKCEKECDEGFFGSGCEKKCSCPSGSTCNPVTGACQQQCPAGKTGENCDQDCEIGTFGLSCSQSCDCSGAPCDQVTGQCRCPAGVMGSRCE----KGQWGEGCKETCPVCENGGE-CDKQSGTCICTPGYMGRLCQNLCPAGRFGQGCQLKCVCENSGRCHPVTGRC---TCALGWTGHNCKKACDAGHWGPDCVRVCDCKNSDGSCDPATGQCTCEPGFTGVHCEHKCPAGFFGSGCRQHCQCENEASCDHVSGACTCSMGWTGTFCEKPCPQGFYGLDCQQKCVCVNGGQCNHITGECVCSAGWLGTTCNQKCPEGSFGLSCTQPCLCQNGGSCDHVSGHCSCASGWTGAACELECATGRFGTDCHRECE--NGGQCDRQTGKCVCGAGWVGEISKLSILKCIVCNLCLISVWSGRFGVSCEEQCRCEHAASCHHITGSCLCPPGWRGVHCEKACLPGRYGKDCAELCVCPQGTSCHHVTGECGCPPGYTGHGCEQTCLPGTYGLNCNQVCQCSERNQLCHPVSGECYCAPGYRGPKCDLE-CESGRYGPDCERQCQCLNGGTCQATTGACECPPGFIGAQCNITCSAGRYGQDCARVALCGDGARPDPVTGRCVCNPGHQAEDCGQGCAPGWYGVDCSQRCNCSNRG-LCDSASGNCSCGLGFTGLHCEEECPVGRYGPNCVLECECQHNSSCDGVTGTCRCGPGYYGHLCEHVCPAGLYGSRCQQHCDCMNGAPCHPSTGHCVCPAGYRGPRCET 1297          

HSP 3 Score: 376.326 bits (965), Expect = 1.435e-108
Identity = 272/740 (36.76%), Postives = 361/740 (48.78%), Query Frame = 3
Query: 1572 VCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNG-GTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTK-------------GLYGERCQSSCQCRKDRLCDHVTGICYCADVAFG-KCE-ACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN--CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCE-IKNCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDC 3734
            VC NG    K + TC    T G   +     CP G FG+ C   C  C + G C+     C C   ++G  C+  C       +C  + C CKN  G+C+  T +C C PG +G  CE  C  GFFG  C ++C    +   C  ++G C C  GW G+ C   CP G +G+ C + C C   N   C+   G+C C  G+ G  C  KC  G FGL C+  C       C+H +G C   +  G     C+ +C TG  G+DC + C   EN   C+ + G C C  G+ G+  +L   K             G +G  C+  C+C     C H+TG C C     G  CE AC  G++G  C + C C   T C  + G+C C  GY G  C + C  G YG  C++ CQC   N  C P+SG C C PG+ G  C+  C+ G YG  C+ +C+CLNGGTC      C+C PG+ G  C  +C+ G YG++C     C +G   D ++G+C C PG +  +C + C    YG +C+Q C C N G C   +G C C  G  G  CE  CP  +YGPNC+  C C+    CD  TG C C    +G  CE +       S C+Q C C     C+  TG C C  G RGP+C   CE G FG +C Q C CA G PC+PV G CLC SG TGI CD  C    +GP+C L C  C     C  + G+C+C  G I   C
Sbjct:  655 VCENGGECDKQSGTCIC--TPGYMGRLCQNLCPAGRFGQGCQLKCV-CENSGRCHPVTGRCTCALGWTGHNCKKACDAGHWGPDCVRV-CDCKNSDGSCDPATGQCTCEPGFTGVHCEHKCPAGFFGSGCRQHCQCE-NEASCDHVSGACTCSMGWTGTFCEKPCPQGFYGLDCQQKCVCV--NGGQCNHITGECVCSAGWLGTTCNQKCPEGSFGLSCTQPCLCQNGGSCDHVSGHCSCAS--GWTGAACELECATGRFGTDCHREC---ENGGQCDRQTGKCVCGAGWVGEISKLSILKCIVCNLCLISVWSGRFGVSCEEQCRCEHAASCHHITGSCLCPPGWRGVHCEKACLPGRYGKDCAELCVCPQGTSCHHVTGECGCPPGYTGHGCEQTCLPGTYGLNCNQVCQCSERNQLCHPVSGECYCAPGYRGPKCDLECESGRYGPDCERQCQCLNGGTCQATTGACECPPGFIGAQCNITCSAGRYGQDCARVALCGDGARPDPVTGRCVCNPGHQAEDCGQGCAPGWYGVDCSQRCNCSNRGLCDSASGNCSCGLGFTGLHCEEECPVGRYGPNCVLECECQHNSSCDGVTGTCRCGPGYYGHLCEHVCPAGLYGSRCQQHCDCMNGAPCHPSTGHCVCPAGYRGPRCETDCEQGTFGHNCSQSCDCAEGTPCDPVSGRCLCSSGKTGIKCDSDCTVQQFGPDCALHC-ECENGADCDSRNGRCTCLNGWIGLTC 1381          

HSP 4 Score: 343.969 bits (881), Expect = 1.899e-97
Identity = 256/751 (34.09%), Postives = 348/751 (46.34%), Query Frame = 3
Query: 1428 DLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGE---TLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIG---------------CQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYC--ADVAFGKCEACPSGKWGPTCNQNCDCTYSTG-CDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKE--SDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQ 3608
            D  S  C C  GY  R     C+++     +  GC  KCV  + S RC    G     LG     C+             + C  G +G +C+  C      G C+     C C P ++G  CE  C        C+   C C+N  +C+  +  C C  G +G  CE  C +GF+G +C++ C    +  +C+ ITG+C+C  GW G++C+  CP G++G+ C++ C C   N   CD  +G C C  G+ G  C  +C  G FG DC   C    +  C+ +TG+C      G   +G               C     +G  G  C + C C E++ SC    G C C PG+ G  CE  C  G YG+ C   C C +   C HVTG C C       G  + C  G +G  CNQ C C+     C  ++G+C C  GY GPKC   C  G YG  C ++CQC+ G  C   +G C C PG+ G  C   C  G YG  C     C +G   D    +C C PG   E C + CA G+YG +C  RC C N GLCD  SG C C  G+ G++C+E CP   YGPNC   C+C +   C    G C+C  G +G +CE  CP   YG  C  +C C     C   TG C CP    G  CE  +C+      +C Q C C+    C+ V+G+C C  G  G +C   C    FG DC   C C NG  C+  +G C CL+G+ G+ C +
Sbjct:  663 DKQSGTCICTPGYMGR----LCQNLCPAGRFGQGCQLKCV-CENSGRCHPVTGRCTCALGWTGHNCK-------------KACDAGHWGPDCVRVCDCKNSDGSCDPATGQCTCEPGFTGVHCEHKCPAGFFGSGCRQ-HCQCENEASCDHVSGACTCSMGWTGTFCEKPCPQGFYGLDCQQKCVCV-NGGQCNHITGECVCSAGWLGTTCNQKCPEGSFGLSCTQPCLCQ--NGGSCDHVSGHCSCASGWTGAACELECATGRFGTDCHRECENGGQ--CDRQTGKCV----CGAGWVGEISKLSILKCIVCNLCLISVWSGRFGVSCEEQCRC-EHAASCHHITGSCLCPPGWRGVHCEKACLPGRYGKDCAELCVCPQGTSCHHVTGECGCPPGYTGHGCEQTCLPGTYGLNCNQVCQCSERNQLCHPVSGECYCAPGYRGPKCDLECESGRYGPDCERQCQCLNGGTCQATTGACECPPGFIGAQCNITCSAGRYGQDCARVALCGDGARPDPVTGRCVCNPGHQAEDCGQGCAPGWYGVDCSQRCNCSNRGLCDSASGNCSCGLGFTGLHCEEECPVGRYGPNCVLECECQHNSSCDGVTGTCRCGPGYYGHLCEHVCPAGLYGSRCQQHCDCMNGAPCHPSTGHCVCPAGYRGPRCET-DCEQGTFGHNCSQSCDCAEGTPCDPVSGRCLCSSGKTGIKCDSDCTVQQFGPDCALHCECENGADCDSRNGRCTCLNGWIGLTCTE 1383          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Cavefish
Match: megf11 (multiple EGF like domains 11 [Source:NCBI gene;Acc:103029924])

HSP 1 Score: 435.261 bits (1118), Expect = 3.538e-132
Identity = 288/749 (38.45%), Postives = 363/749 (48.46%), Query Frame = 3
Query: 1929 CTEGFF--GENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK--CEACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKR-CPEGLYGEGCSKECQCIYGN---CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCE-IKNCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKC-RCANGE-PCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVSVINRLKL------------------SFI*IFSLEQ*IITSKQIFIIY 4088
            C  G+F  GE C   C   C+  RC      C C PGW G  C   C +G WG  CS  C C   N   C+P  G C C  GY G  C   C+PGY+G  C   C       C+HETG+C      G     C   CP+G  G  C + C C +N  +C    G C C  G+TG  C   C  G YG  C   C CR   LCDH+TG C C     G+   E CP G +GP C  +CDC     C  ING C+C  G+ GP C  R CP GLYG  C K C C   N   C P+SG C C  GW G  C   C  GYYG+ C  +C C NG  C      C C PG+ G+ C  +C+ G+YG NC   C CHN   C    G C C  GW+G++C   C S T+G +CNQ C C NG  C P +G C C  G     C+L+CP   YG +C  +C C   + CD  +G C C     G+ C+ +        +C   C C    SC+   G C C PG RG  C ++C  G +G  C Q C +C +   PC+ + G C CLSGF G LC+QVC  G YG  C   C  C  N TC+P  G C C  G I  DC   CPSG+YG  C + C+C +GA C+  TG C C +GF GA C+ +CP   +G  CQ  C+C +N+ C+ VTG C C     G  C+ + +   +L                  + + I  L   I+    +F+ Y
Sbjct:   94 CCPGYFESGELCVPLCTEECAHGRCVS-PDTCQCEPGWGGLDCSSGCESGYWGPHCSNRCQCQ--NGALCNPITGACVCTDGYQGWRCEDHCEPGYYGKGCQLQCQCLNGATCHHETGEC--ICAPGYMGAVCGERCPSGSHGPQCEQRCPC-QNGGTCHHITGECSCPAGWTGSVCAQPCPLGKYGINCSRDCSCRNGGLCDHITGQCQCVAGYTGRRCQEECPVGTYGPQCALHCDCQNGAKCYHINGACLCDTGFKGPHCQDRFCPPGLYGLICDKYCPCNATNTLSCHPLSGECSCAAGWTGLYCNETCPPGYYGEGCSVQCHCANGADCHGTTGACVCAPGFTGDDCSHTCSPGFYGTNCSSTCHCHNQASCSPSDGSCICKEGWQGVDCSILCSSGTWGVSCNQTCLCANGAACDPMDGSCTCAPGWRDKHCQLSCPDGTYGLDCREHCDCNHADGCDPVSGYCRCLAGWTGIHCDNVCPQGFWGPNCSMTCSCQNGGSCSPEDGTCVCAPGYRGTSCKRICSPGFYGHRCSQTCPQCVHSTGPCHHITGHCECLSGFFGPLCNQVCPSGRYGKACAEVCF-CTNNGTCNPIDGSCQCFPGWIGDDCSRGCPSGFYGRDCAEVCRCQNGADCDHMTGQCACRTGFIGASCEQKCPPGTFGYGCQQLCECMNNATCDYVTGTCYCSPGYKGIRCDQAALMMEELNPYTKISPALTSERQSAGAVMGIIFLLLIIMAMLSLFVWY 835          

HSP 2 Score: 245.743 bits (626), Expect = 2.901e-66
Identity = 164/446 (36.77%), Postives = 224/446 (50.22%), Query Frame = 3
Query: 1659 RRCPKGTFGEECLFNCS-NCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSC-QCRKDR-LCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAV 2978
            R CP G +G  C   C  N  +   C+     C C   ++G  C   C        C  +QCHC NG  C   T  C C PG +G+ C   C+ GF+G NC   C    +   C    G C+C  GW G  C +LC +GTWG+ C++TC C   N   CDP +G C C  G+   +C   C  G +GLDC   C  +    C+  +G C  +   G   I C   CP G  G +C  TC C +N  SC  ++G C CAPG+ G  C+  C+ G YG RC  +C QC      C H+TG C C    FG    + CPSG++G  C + C CT +  C+ I+G C C  G+ G  CS+ CP G YG  C++ C+C  G +CD ++G C C  G+ G  CE  C  G +G  C++ C+C+N  TCD     C C PG+ G  C+++  +
Sbjct:  353 RFCPPGLYGLICDKYCPCNATNTLSCHPLSGECSCAAGWTGLYCNETCPPGYYGEGCS-VQCHCANGADCHGTTGACVCAPGFTGDDCSHTCSPGFYGTNCSSTCHCH-NQASCSPSDGSCICKEGWQGVDCSILCSSGTWGVSCNQTCLC--ANGAACDPMDGSCTCAPGWRDKHCQLSCPDGTYGLDCREHCDCNHADGCDPVSGYC--RCLAGWTGIHCDNVCPQGFWGPNCSMTCSC-QNGGSCSPEDGTCVCAPGYRGTSCKRICSPGFYGHRCSQTCPQCVHSTGPCHHITGHCECLSGFFGPLCNQVCPSGRYGKACAEVCFCTNNGTCNPIDGSCQCFPGWIGDDCSRGCPSGFYGRDCAEVCRCQNGADCDHMTGQCACRTGFIGASCEQKCPPGTFGYGCQQLCECMNNATCDYVTGTCYCSPGYKGIRCDQAALM 791          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Cavefish
Match: megf11 (multiple EGF like domains 11 [Source:NCBI gene;Acc:103029924])

HSP 1 Score: 423.705 bits (1088), Expect = 1.373e-129
Identity = 279/700 (39.86%), Postives = 345/700 (49.29%), Query Frame = 3
Query: 1929 CTEGFF--GENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK--CEACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKR-CPEGLYGEGCSKECQCIYGN---CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCE-IKNCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKC-RCANGE-PCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCE 3995
            C  G+F  GE C   C   C+  RC      C C PGW G  C   C +G WG  CS  C C   N   C+P  G C C  GY G  C   C+PGY+G  C   C       C+HETG+C      G     C   CP+G  G  C + C C +N  +C    G C C  G+TG  C   C  G YG  C   C CR   LCDH+TG C C     G+   E CP G +GP C  +CDC     C  ING C+C  G+ GP C  R CP GLYG  C K C C   N   C P+SG C C  GW G  C   C  GYYG+ C  +C C NG  C      C C PG+ G+ C  +C+ G+YG NC   C CHN   C    G C C  GW+G++C   C S T+G +CNQ C C NG  C P +G C C  G     C+L+CP   YG +C  +C C   + CD  +G C C     G+ C+ +        +C   C C    SC+   G C C PG RG  C ++C  G +G  C Q C +C +   PC+ + G C CLSGF G LC+QVC  G YG  C   C  C  N TC+P  G C C  G I  DC   CP G +GP C  +C C +GA C+   G C+C  G+ G  C  RCP+ FYG +C   C+C + + C+ +TG C C     G  CE
Sbjct:   88 CCPGYFESGELCVPLCTEECAHGRCVS-PDTCQCEPGWGGLDCSSGCESGYWGPHCSNRCQCQ--NGALCNPITGACVCTDGYQGWRCEDHCEPGYYGKGCQLQCQCLNGATCHHETGEC--ICAPGYMGAVCGERCPSGSHGPQCEQRCPC-QNGGTCHHITGECSCPAGWTGSVCAQPCPLGKYGINCSRDCSCRNGGLCDHITGQCQCVAGYTGRRCQEECPVGTYGPQCALHCDCQNGAKCYHINGACLCDTGFKGPHCQDRFCPPGLYGLICDKYCPCNATNTLSCHPLSGECSCAAGWTGLYCNETCPPGYYGEGCSVQCHCANGADCHGTTGACVCAPGFTGDDCSHTCSPGFYGTNCSSTCHCHNQASCSPSDGSCICKEGWQGVDCSILCSSGTWGVSCNQTCLCANGAACDPMDGSCTCAPGWRDKHCQLSCPDGTYGLDCREHCDCNHADGCDPVSGYCRCLAGWTGIHCDNVCPQGFWGPNCSMTCSCQNGGSCSPEDGTCVCAPGYRGTSCKRICSPGFYGHRCSQTCPQCVHSTGPCHHITGHCECLSGFFGPLCNQVCPSGRYGKACAEVCF-CTNNGTCNPIDGSCQCFPGWIGDDCSRACPIGQWGPDCLNSCNCHNGAQCSLYDGECRCSPGWTGLYCTQRCPSGFYGRDCAEVCRCQNGADCDHMTGQCACRTGFIGASCE 780          

HSP 2 Score: 330.102 bits (845), Expect = 9.024e-96
Identity = 256/753 (34.00%), Postives = 352/753 (46.75%), Query Frame = 3
Query: 1308 RAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCIND--LGSYLCT--CPVGYRLR--KNKMTCEDIDECLDYTGGC-------GYKCVN--TDGSY------RCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCH-LLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK-CE-ACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKC-KCLNG-GTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIK-NCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQM 3482
            R    C PG+    +       +EC  G+  CV P TC  +   G   C+  C  GY      N+  C++   C   TG C       G++C +    G Y      +C C NG T   +   C        ++  +  RCP G+ G +C   C  C + G C+     C C   ++G++C   C      + C    C C+NGG C+  T +C C  G +G  C+  C  G +G  C  +C    +  +C+ I G CLC  G+ G  C    CP G +G+ C K C CN  N   C P +G+C C  G+ G+ C   C PGY+G  CS  C       C+  TG C      G     C   C  G  G++C  TC C  N  SC   +G C C  G+ G  C + C+ G +G  C  +C C     CD + G C CA     K C+ +CP G +G  C ++CDC ++ GCD ++G C CLAG+ G  C   CP+G +G  CS  C C  G +C P  G C C PG+ G  C+  C  G+YG +C + C +C++  G C      C+C  G+ G  C + C  G YG+ C   C C N G C+ I G C C PGW G +C   CP   +GP+C   C C NG +C   +G C+C  G  G  C   CP   YG +C   C C+    CD  TG+C C     G SCE K    +    C+Q C+C    +C+ VTG C C PG +G +C Q 
Sbjct:   83 RRRSQCCPGYFESGELCVPLCTEECAHGR--CVSPDTCQCEPGWGGLDCSSGCESGYWGPHCSNRCQCQNGALCNPITGACVCTDGYQGWRCEDHCEPGYYGKGCQLQCQCLNGATCHHETGECICAPGYMGAVCGE--RCPSGSHGPQCEQRCP-CQNGGTCHHITGECSCPAGWTGSVCAQPCPLGKYGINCS-RDCSCRNGGLCDHITGQCQCVAGYTGRRCQEECPVGTYGPQCALHCDCQ-NGAKCYHINGACLCDTGFKGPHCQDRFCPPGLYGLICDKYCPCNATNTLSCHPLSGECSCAAGWTGLYCNETCPPGYYGEGCSVQCHCANGADCHGTTGAC--VCAPGFTGDDCSHTCSPGFYGTNCSSTCHC-HNQASCSPSDGSCICKEGWQGVDCSILCSSGTWGVSCNQTCLCANGAACDPMDGSCTCAPGWRDKHCQLSCPDGTYGLDCREHCDCNHADGCDPVSGYCRCLAGWTGIHCDNVCPQGFWGPNCSMTCSCQNGGSCSPEDGTCVCAPGYRGTSCKRICSPGFYGHRCSQTCPQCVHSTGPCHHITGHCECLSGFFGPLCNQVCPSGRYGKACAEVCFCTNNGTCNPIDGSCQCFPGWIGDDCSRACPIGQWGPDCLNSCNCHNGAQCSLYDGECRCSPGWTGLYCTQRCPSGFYGRDCAEVCRCQNGADCDHMTGQCACRTGFIGASCEQKCPPGTFGYGCQQLCECMNNATCDYVTGTCYCSPGYKGIRCDQA 825          

HSP 3 Score: 280.026 bits (715), Expect = 1.929e-78
Identity = 248/768 (32.29%), Postives = 335/768 (43.62%), Query Frame = 3
Query: 1005 CSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKD-------INECNIKNGGCQHICLNVEGSFIC-DCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCN-----SSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKH--------KCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCH--------------PNYSGTICEIDCLQNPSQ-VECQPL------------------------------QCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSC-QCRKDR-LCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDE 3095
            C+  C      S  TC+C PG+   ++    C+         N C  +NG    +C  + G+ +C D + GW+   DH           +P  YG  GC   C      +  ++   C C PG+     G  C   + C +G H         C    TC +  G   C+CP G+        C          G  G  C     S  C C NG     D+ T Q Q   G + ++    CP GT+G +C  +C +C +   C      CLC               P   G IC+  C  N +  + C PL                              QCHC NG  C   T  C C PG +G+ C   C+ GF+G NC   C    +   C    G C+C  GW G  C +LC +GTWG+ C++TC C   N   CDP +G C C  G+   +C   C  G +GLDC   C  +    C+  +G C  +   G   I C   CP G  G +C  TC C +N  SC  ++G C CAPG+ G  C+  C+ G YG RC  +C QC      C H+TG C C    FG    + CPSG++G  C + C CT +  C+ I+G C C  G+ G  CS+ CP G +G  C   C C  G  C    G CRC+PGW G  C   C  G+YG  C E C+C NG  CD    +C C  G+ G  CE+ C  G +G  C+  C+C N   CD ++G C C PG++GI CD+
Sbjct:  103 CTEECAHGRCVSPDTCQCEPGWG-GLDCSSGCESGYWGPHCSNRCQCQNGA---LCNPITGACVCTDGYQGWRC-EDH----------CEPGYYGK-GCQLQCQCLNGATCHHETGECICAPGYM----GAVCG--ERCPSGSHGPQCEQRCPCQNGGTCHHITGE--CSCPAGWTGSVCAQPCP--------LGKYGINC-----SRDCSCRNGGLC--DHITGQCQCVAGYTGRRCQEECPVGTYGPQCALHC-DCQNGAKCYHINGACLCDTGFKGPHCQDRFCPPGLYGLICDKYCPCNATNTLSCHPLSGECSCAAGWTGLYCNETCPPGYYGEGCSVQCHCANGADCHGTTGACVCAPGFTGDDCSHTCSPGFYGTNCSSTCHCH-NQASCSPSDGSCICKEGWQGVDCSILCSSGTWGVSCNQTCLC--ANGAACDPMDGSCTCAPGWRDKHCQLSCPDGTYGLDCREHCDCNHADGCDPVSGYC--RCLAGWTGIHCDNVCPQGFWGPNCSMTCSC-QNGGSCSPEDGTCVCAPGYRGTSCKRICSPGFYGHRCSQTCPQCVHSTGPCHHITGHCECLSGFFGPLCNQVCPSGRYGKACAEVCFCTNNGTCNPIDGSCQCFPGWIGDDCSRACPIGQWGPDCLNSCNCHNGAQCSLYDGECRCSPGWTGLYCTQRCPSGFYGRDCAEVCRCQNGADCDHMTGQCACRTGFIGASCEQKCPPGTFGYGCQQLCECMNNATCDYVTGTCYCSPGYKGIRCDQ 824          

HSP 4 Score: 272.707 bits (696), Expect = 6.751e-76
Identity = 165/429 (38.46%), Postives = 219/429 (51.05%), Query Frame = 3
Query: 2733 GEGCSKEC--QCIYGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIK-NCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCL-QMCEFGNFGLDCKQKCRC--ANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVS 4001
            GE C   C  +C +G C      C+C PGW G  C + C+ GY+G  C  +C+C NG  C+     C C  G+ G  CE  C  GYYG+ C+ +CQC NG  C   +G+C C PG+ G  C ERCPS ++GP C Q C C NGG CH   G C CPAG  G VC   CP  KYG NC  +C C+    CD  TG+C C     G  C+ +    +    C   C C     C  + G C C  G +GP C  + C  G +GL C + C C   N   C+P+ G C C +G+TG+ C++ C  G+YG  C ++C  C     CH  TG C C  G    DC   C  G+YG  C   C C + ASC+PS G+C C  G+ G  C   C +  +G +C   C C + + C+P+ G C C      + C++S
Sbjct:   96 GELCVPLCTEECAHGRCVSPD-TCQCEPGWGGLDCSSGCESGYWGPHCSNRCQCQNGALCNPITGACVCTDGYQGWRCEDHCEPGYYGKGCQLQCQCLNGATCHHETGECICAPGYMGAVCGERCPSGSHGPQCEQRCPCQNGGTCHHITGECSCPAGWTGSVCAQPCPLGKYGINCSRDCSCRNGGLCDHITGQCQCVAGYTGRRCQEECPVGTYGPQCALHCDCQNGAKCYHINGACLCDTGFKGPHCQDRFCPPGLYGLICDKYCPCNATNTLSCHPLSGECSCAAGWTGLYCNETCPPGYYGEGCSVQCH-CANGADCHGTTGACVCAPGFTGDDCSHTCSPGFYGTNCSSTCHCHNQASCSPSDGSCICKEGWQGVDCSILCSSGTWGVSCNQTCLCANGAACDPMDGSCTCAPGWRDKHCQLS 522          

HSP 5 Score: 157.918 bits (398), Expect = 1.081e-38
Identity = 218/743 (29.34%), Postives = 302/743 (40.65%), Query Frame = 3
Query:  450 SGYRGCIPKPNCEERIGKYCQNGAFCYQSGYNAKCICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGF------YCKCPPGYEMSENGKNCIDINECI--------RNRTDCSH---ECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDL-------CKDNNGG-CSHL---CQSDPSSSVITCK---CRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSS-----PNKRAICSCLPGFKLEADGLTCSD---EDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPT-ACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCA 2558
            SGY G    P+C  R    CQNGA C  +     C+C  G+ G  C+ D  E      GC+ +C  ++G         C C PGY  +  G+ C   +           +N   C H   EC    G     C     LG   INC      C   N G C H       +   C C  G+   + +  C V          C   NG  C H+   C  D       C+   C PG    +     C     CN  N      C  + G   C C  GW   + +++C         P  Y   GC+  C+ +           C C PGF  +    TCS       C +  H C   ++C    GS  C C  G++     + C         +G  G  C  T     C+C NG      + +C      G   +     CP GT+G +C  +C +C H   C+     C C   ++G  C+  C Q      C  + C C+NGG+C  E   C C PG  G  C+  C+ GF+G  C + CP    S+  CH ITG C C  G++G  C+ +CP+G +G  C++ C C  N    C+P +G C+C  G+ G +C   C  G +G DC  SC       C+   G+C  +   G   + C + CP+G  G DC + C C +N   C+   G C C  GF G  CE KC  G +G  CQ  C+C  +  CD+VTG CYC+
Sbjct:  135 SGYWG----PHCSNRC--QCQNGALC--NPITGACVCTDGYQGWRCE-DHCEPGYYGKGCQLQCQCLNGATCHHETGECICAPGYMGAVCGERCPSGSHGPQCEQRCPCQNGGTCHHITGECSCPAGWTGSVCAQPCPLGKYGINC---SRDCSCRNGGLCDH-------ITGQCQCVAGYTGRRCQEECPVGTYGPQCALHCDCQNGAKCYHINGACLCDTGFKGPHCQDRFCPPGLYGLI-----CDKYCPCNATN---TLSCHPLSGE--CSCAAGWTGLYCNETC---------PPGYYGEGCSVQCHCANGADCHGTTGACVCAPGFTGDDCSHTCSPGFYGTNCSSTCH-CHNQASCSPSDGS--CICKEGWQGVDCSILCS--------SGTWGVSCNQT-----CLCANGAACDPMDGSC--TCAPGWRDKHCQLSCPDGTYGLDCREHC-DCNHADGCDPVSGYCRCLAGWTGIHCDNVCPQGFWGPNCS-MTCSCQNGGSCSPEDGTCVCAPGYRGTSCKRICSPGFYGHRCSQTCPQCVHSTGPCHHITGHCECLSGFFGPLCNQVCPSGRYGKACAEVCFCTNNGT--CNPIDGSCQCFPGWIGDDCSRACPIGQWGPDCLNSCNCHNGAQCSLYDGEC--RCSPGWTGLYCTQRCPSGFYGRDCAEVCRC-QNGADCDHMTGQCACRTGFIGASCEQKCPPGTFGYGCQQLCECMNNATCDYVTGTCYCS 814          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009938.1 (pep scaffold:Pmarinus_7.0:GL476399:1110574:1308132:1 gene:ENSPMAG00000008980.1 transcript:ENSPMAT00000009938.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 603.594 bits (1555), Expect = 0.000e+0
Identity = 391/1097 (35.64%), Postives = 526/1097 (47.95%), Query Frame = 3
Query: 1104 DINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQ-----------------------------KDPRR----------CPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCS------------------------------------------ENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTG-CDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSK--ESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGL--------------------------------INYDCKG--------------QCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCE 3995
            DI+EC+++   C H C N  GSF+C C+PG+++G D K CY+++ME+ + C+  NGGCT  C  +  +   C C  GF L+ DG TC D DEC      C     C N+ G Y C C  GYR+  +   C+D+DECL   GGC   C N +GSY C C  G  L ++ + C  +    +  +                             ++ RR          C   TFG +C  +CS+C + G C++ Q GC C   ++G +C   C +      CQ  +C C+NGG+C+  + KC CPPG+SGE+CE GC +GFFG+ C K C  A ++ RCH+I G CLC PG YG  CHL CP   +G  CS  C C + + + C+PK+G C+C  GY G  C   C  G++G  C   C       C+H +G+C  +   G +   CQ  CP G  G  C+ +C C                                           E+  +C    G C C  GF GK C+  C  G +G+ C   C C  D  CD  TG C C    FG    + C +G+WG  C + C+C    G C+ + G+C+C AG+ GP+C ++C  G +G  C   CQC +G  CD +SG C C  GW G  CE PC +G++G +CKE C C NG  C+     C C PGW G  C + C    +G NC   C CHNG  C+ ++G C C PGW G +C  +C +  YG  C Q C C NG  C    G C CP G  G  CE  C   K+G  C  +C C+    C+ +TG CTC     G +CE   C +      C + C+C+   SC+ VTG C C  G RG  C + C  G++G  C ++C CA+G PC+ V G C C  GFTG  CDQ C  G +G NC   C     N+ CHP TG+C+C AG                                  + DC G               CP+G+YG  C   C C    SC+P +G CQC  G  GA CQ  CP   +GA CQ  C C +   C+   G C C    +G  CE
Sbjct:    1 DIDECDLETSMCVHSCRNTRGSFVCQCNPGYELGSDGKQCYRIEMEIVNSCEKDNGGCTHTCQHA-TQGPRCLCDSGFHLDVDGKTCRDTDECSEEGSCCA--QFCSNNAGGYECGCRAGYRIGLDGCNCDDVDECLAENGGCEQLCRNNEGSYECSCRRGFRLDEERRGCIRKGPSHAQARPPQSLTPPPPRLPLPGQPTPTCAVANYGPQEHRRQEHTLVQKFICLGETFGHDCSLSCSDCRNGGGCSEGQDGCDCLAGWTGLVCNETCPEGKFGSNCQS-ECRCQNGGSCDPVSGKCRCPPGVSGELCEDGCPKGFFGKACNKKCNCA-NNGRCHRIYGACLCDPGLYGRFCHLPCPKWAYGPSCSSECQCAKASTQECNPKDGTCRCHAGYQGSQCQEVCADGFYGTGCRLPCTCADGVACDHVSGECKLQCQPGFHGTDCQLKCPAGRFGGGCQASCSCGGAPCDHATGRCFCPPGKTGDYCEKECPEGRWGLGCQGNCSSCESGGACNRSTGECDCKAGFMGKACQSSCPAGRFGQGCALRCACENDAQCDPATGQCSCGPGWFGHNCKKPCHAGRWGRNCERLCECNSVVGSCEPVTGKCVCEAGFTGPRCEQKCTAGTFGPSCRSRCQCEHGAACDHVSGACTCAAGWTGTYCERPCPDGFFGMECKEPCGCRNGAHCNHITGLCSCAPGWVGPKCSQPCQGQTHGENCSQACDCHNGATCEHVTGLCLCTPGWTGASCQRKCDAGFYGAGCAQHCICRNGATCSHVTGDCSCPDGWTGVACETECTGGKFGAGCQQSCSCQNGGTCEARTGRCTCKAGWTGDACE-STCPAGFFGGRCGERCECAHGDSCHHVTGACHCHAGWRGRHCDKPCLPGHYGEGCTRRCSCASGVPCDHVTGNCGCPPGFTGNGCDQTCPAGTFGQNCNSVCQCSADNQQCHPVTGRCNCLAGFHGPHCDSIAPPGNPSKGSLSRCRCRNNNTAVPHSLDCYGAGGSMSLFCASGQAACPAGHYGKECASLCSCGERGSCDPVSGRCQCQPGRTGAKCQQVCPRGRFGAGCQQSCACRNGGLCDTANGTCTCGLGWTGLHCE 1091          

HSP 2 Score: 500.745 bits (1288), Expect = 5.851e-155
Identity = 394/1203 (32.75%), Postives = 522/1203 (43.39%), Query Frame = 3
Query:  717 DINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINC----IPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNT--DGSY------RCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQ--------------NPSQVECQP------------------------------LQCHCKNGGTCESETLKC--NCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK-CE-ACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKE--SDCRQDCQCSI-KKSCNQVTGKCQCKPGLRGPQCLQM----------------------------------------------CEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCE 3995
            DI+EC    + C H C N  G F CQC P   LG D   C    +  ++ C+  N GGCTH C + +     C C  G  LD D ++C   D C +    C+  C ++  +    C CR GY I + D   C D++EC  +NGGC+ +C N EGS+ C C  G          +++D E     + G          S         LPG       +      E    +H  V    C+ +   + C+       R      E  D C    G  G  C  T  +G +       C C NG +    +  C+        L +D   CPKG FG+ C   C NC + G C+     CLC P   G  C + C +                S  EC P                              L C C +G  C+  + +C   C PG  G  C++ C  G FG  C+ +C  +C    C   TG+C C PG  G  C   CP G WG+GC   CS  ++    C+   G+C CK G+ G  C   C  G FG  C+  C  +    C+  TGQC      G     C++ C  G  G +C + C+C+    SCE   G C C  GFTG RCE KCT G +G  C+S CQC     CDHV+G C CA    G  CE  CP G +G  C + C C     C+ I G C C  G+ GPKCS+ C    +GE CS+ C C  G  C+ ++G+C C PGW G  C+  CD G+YG  C + C C NG TC      C C  GW G  CE  C  G +G  C+  C C NGG C+  +G+C C  GW G  C+  CP+  +G  C + C+C +G  CH   G C C AG  G  C+  C P  YG  C   C C +   CD  TG C CP    G  C+ + C +     +C   CQCS   + C+ VTG+C C  G  GP C  +                                              C  G++G +C   C C     C+PV G C C  G TG  C QVC +G +G  C+  C  C     C    G C+C  G     C+ +CP G YG  CQ +C C +  +C+  TG C+C  G YG  C++ CP  F+G NC   C C + + C+PVTG CVCP    G  C+
Sbjct:    1 DIDECDLETSMCVHSCRNTRGSFVCQCNPGYELGSDGKQCYRIEMEIVNSCEKDN-GGCTHTC-QHATQGPRCLCDSGFHLDVDGKTCRDTDECSEEGSCCAQFCSNN--AGGYECGCRAGYRIGL-DGCNCDDVDECLAENGGCEQLCRNNEGSYECSCRRG----------FRLDEERRGCIRKGPSHAQARPPQSLTPPPPRLPLPGQPTPTCAVANYGPQEHRRQEHTLVQKFICLGETFGHDCSLSC-SDCRNGGGCSEGQDGCDCLAGWTGLVCNETCPEGKFGSNCQSECRCQNGGSCDPVSGKCRCPPGVSGELCED--GCPKGFFGKACNKKC-NCANNGRCHRIYGACLCDPGLYGRFCHLPCPKWAYGPSCSSECQCAKASTQECNPKDGTCRCHAGYQGSQCQEVCADGFYGTGCRLPCTCADGVACDHVSGECKLQCQPGFHGTDCQLKCPAGRFGGGCQASC--SCGGAPCDHATGRCFCPPGKTGDYCEKECPEGRWGLGCQGNCSSCESG-GACNRSTGECDCKAGFMGKACQSSCPAGRFGQGCALRCACENDAQCDPATGQCSCGP--GWFGHNCKKPCHAGRWGRNCERLCECNSVVGSCEPVTGKCVCEAGFTGPRCEQKCTAGTFGPSCRSRCQCEHGAACDHVSGACTCAAGWTGTYCERPCPDGFFGMECKEPCGCRNGAHCNHITGLCSCAPGWVGPKCSQPCQGQTHGENCSQACDCHNGATCEHVTGLCLCTPGWTGASCQRKCDAGFYGAGCAQHCICRNGATCSHVTGDCSCPDGWTGVACETECTGGKFGAGCQQSCSCQNGGTCEARTGRCTCKAGWTGDACESTCPAGFFGGRCGERCECAHGDSCHHVTGACHCHAGWRGRHCDKPCLPGHYGEGCTRRCSCASGVPCDHVTGNCGCPPGFTGNGCD-QTCPAGTFGQNCNSVCQCSADNQQCHPVTGRCNCLAGFHGPHCDSIAPPGNPSKGSLSRCRCRNNNTAVPHSLDCYGAGGSMSLFCASGQAACPAGHYGKECASLCSCGERGSCDPVSGRCQCQPGRTGAKCQQVCPRGRFGAGCQQSC-ACRNGGLCDTANGTCTCGLGWTGLHCEKECPEGKYGAGCQVSCPCRNNGTCDRFTGCCKCPEGVYGHACEYECPPGFFGLNCMRPCDCRNGALCHPVTGQCVCPAGYHGSKCD 1177          

HSP 3 Score: 474.167 bits (1219), Expect = 3.973e-145
Identity = 384/1183 (32.46%), Postives = 526/1183 (44.46%), Query Frame = 3
Query:  654 GGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCI--------------------------PFIHPCDSANKGGCTHHCVKLSDM-RFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKD-------INECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTD---PCKYGNGGCTQFCNSSPNKR-----AICSCLPGFKLE---------ADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSN-RCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQ-GNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQC-LNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKES----DCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVS-VINRL 4016
            GG+ C C  GY +  +G NC D++EC+     C   C N  G + C C     L  +R  CI                               C  AN G   H   + + + +FIC    G     D   CS+      N GGCS             C C  G+   V + + C +        +EC  +NGG    C  V G   C C PG            V  EL +   P  +    C + CN + N R       C C PG             A G +CS E +C     +   P           C C  GY+  + +  C D      Y  GC            C C +G      +  C+ Q   G        +CP G FG  C  +CS       C+     C C P  +G  CE +C +    + CQ     C++GG C   T +C+C  G  G+ C+  C  G FG+ C   C  AC ++ +C   TG+C C PGW+G +C   C  G WG  C + C CN +    C+P  GKC C+ G+ G  C  KC  G FG  C   C  +    C+H +G C   TC  G     C+R CP G  G +C++ C C  N   C    G+C CAPG+ G +C   C    +GE C  +C C     C+HVTG+C C     G      C +G +G  C Q+C C     C  + G C C  G+ G  C   C  G +G GC + C C  G  C+  +G C C  GW G+ CE+ C  G++G +C E+C+C +G +C      C C  GW G  C+K C  G+YG  C  RC C +G  CD ++G C C PG+ G  CD+ CP+ T+G NCN VCQC  +  +CHP  G C C AG HG  C+   PP       L  C C+        + +C     +  L C              +C   C C  + SC+ V+G+CQC+PG  G +C Q+C  G FG  C+Q C C NG  C+  +GTC C  G+TG+ C++ C +G YG  C++ C  C  N TC   TG C C  G+  + C+ +CP G++G  C + C C +GA C+P TG C C +G++G+ C   C    +G  C  RC C   S C+ VTG C+CP   +G  C+V   +NR 
Sbjct:  108 GGYECGCRAGYRIGLDGCNCDDVDECLAENGGCEQLCRNNEGSYECSCRRGFRLDEERRGCIRKGPSHAQARPPQSLTPPPPRLPLPGQPTPTCAVANYGPQEHRRQEHTLVQKFICL---GETFGHD---CSLSCSDCRNGGGCSE--------GQDGCDCLAGWTGLVCN-ETCPEGKFGSNCQSECRCQNGG---SCDPVSGK--CRCPPG------------VSGELCEDGCPKGFFGKACNKKCNCANNGRCHRIYGACLCDPGLYGRFCHLPCPKWAYGPSCSSECQCAKASTQECNPK-------DGTCRCHAGYQGSQCQEVCADGF----YGTGC---------RLPCTCADGVACDHVSGECKLQCQPGFHGTDCQLKCPAGRFGGGCQASCS--CGGAPCDHATGRCFCPPGKTGDYCEKECPEGRWGLGCQGNCSSCESGGACNRSTGECDCKAGFMGKACQSSCPAGRFGQGCALRC--ACENDAQCDPATGQCSCGPGWFGHNCKKPCHAGRWGRNCERLCECN-SVVGSCEPVTGKCVCEAGFTGPRCEQKCTAGTFGPSCRSRCQCEHGAACDHVSGAC---TCAAGWTGTYCERPCPDGFFGMECKEPCGC-RNGAHCNHITGLCSCAPGWVGPKCSQPCQGQTHGENCSQACDCHNGATCEHVTGLCLCTPGWTGASCQRKCDAGFYGAGCAQHCICRNGATCSHVTGDCSCPDGWTGVACETECTGGKFGAGCQQSCSCQNGGTCEARTGRCTCKAGWTGDACESTCPAGFFGGRCGERCECAHGDSCHHVTGACHCHAGWRGRHCDKPCLPGHYGEGCTRRCSCASGVPCDHVTGNCGCPPGFTGNGCDQTCPAGTFGQNCNSVCQCSADNQQCHPVTGRCNCLAGFHGPHCDSIAPPGNPSKGSLSRCRCRNNNTAVPHSLDCYGAGGSMSLFCASGQAACPAGHYGKECASLCSCGERGSCDPVSGRCQCQPGRTGAKCQQVCPRGRFGAGCQQSCACRNGGLCDTANGTCTCGLGWTGLHCEKECPEGKYGAGCQVSC-PCRNNGTCDRFTGCCKCPEGVYGHACEYECPPGFFGLNCMRPCDCRNGALCHPVTGQCVCPAGYHGSKCDHECTVGTFGDKCLSRCDCVDGSQCDHVTGKCLCPPGKAGDKCDVDCRVNRY 1228          

HSP 4 Score: 355.525 bits (911), Expect = 1.135e-102
Identity = 250/714 (35.01%), Postives = 336/714 (47.06%), Query Frame = 3
Query: 1659 RRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETG--QCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN--CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFC---EKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKES-DCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPL 3770
            + C  G +G  C   C      G C      C+C   ++G  CE  C        C+  +C C++G  C+  +  C C  G +G  CE  C +GFFG  C++ C    +   C+ ITG C C PGW G  C   C   T G  CS+ C C+  N   C+   G C C  G+ G +C  KCD G++G  C+  C       C+H TG   CPD    G   + C+ +C  G  G+ C+++C C +N  +CE + G C C  G+TG  CE  C  G +G RC   C+C     C HVTG C+C     G+   + C  G +G  C + C C     CD + G C C  G+ G  C + CP G +G+ C+  CQC   N  C P++G C C  G+HG  C++    G        +C+C N  T       C    G    FC   + +C  G+YG+ C   C C   G CD +SG+C C PG  G  C + CP   +G  C Q C C NGG C   NG C C  G  G  CE  CP  KYG  C  +C C+    CD  TG C CP+  +G +CE +        +C + C C     C+ VTG+C C  G  G +C   C  G FG  C  +C C +G  C+ V G CLC  G  G  CD  C    YGP+C L C   N+   C+P++G CSC  G +   C+   P     PL
Sbjct:  571 KPCHAGRWGRNCERLCECNSVVGSCEPVTGKCVCEAGFTGPRCEQKCTAGTFGPSCRS-RCQCEHGAACDHVSGACTCAAGWTGTYCERPCPDGFFGMECKEPCGCR-NGAHCNHITGLCSCAPGWVGPKCSQPCQGQTHGENCSQACDCH--NGATCEHVTGLCLCTPGWTGASCQRKCDAGFYGAGCAQHCICRNGATCSHVTGDCSCPD----GWTGVACETECTGGKFGAGCQQSCSC-QNGGTCEARTGRCTCKAGWTGDACESTCPAGFFGGRCGERCECAHGDSCHHVTGACHCHAGWRGRHCDKPCLPGHYGEGCTRRCSCASGVPCDHVTGNCGCPPGFTGNGCDQTCPAGTFGQNCNSVCQCSADNQQCHPVTGRCNCLAGFHGPHCDSIAPPGNPSKGSLSRCRCRNNNTAVPHSLDCYGAGGSMSLFCASGQAACPAGHYGKECASLCSCGERGSCDPVSGRCQCQPGRTGAKCQQVCPRGRFGAGCQQSCACRNGGLCDTANGTCTCGLGWTGLHCEKECPEGKYGAGCQVSCPCRNNGTCDRFTGCCKCPEGVYGHACEYECPPGFFGLNCMRPCDCRNGALCHPVTGQCVCPAGYHGSKCDHECTVGTFGDKCLSRCDCVDGSQCDHVTGKCLCPPGKAGDKCDVDCRVNRYGPHCSLTCECANK-ALCNPRSGSCSCLYGWVGPTCQEDTPFRLSRPL 1274          

HSP 5 Score: 254.218 bits (648), Expect = 4.300e-69
Identity = 224/689 (32.51%), Postives = 301/689 (43.69%), Query Frame = 3
Query: 1137 CQHICLNVEGSFICDCHPGWQIGHDHKSCYK--VDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGF---------KLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSY------RCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKT----CQGNNSIGC---QRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFG-KCEA-CPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN-CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGP 3122
            C+H       S  C C  GW   +  + C      ME  +PC   NG     CN   +   +CSC PG+         + +  G  CS   +C  G       +TC +  G  LC C  G+       +C+   +   Y  GC   C+  +G+        C CP+G T       C+ +             C  G FG  C  +CS C + G C      C C   ++G  CE  C        C   +C C +G +C   T  C+C  G  G  C+  C  G +GE C + C  A S   C  +TG C C PG+ G+ C   CP GT+G  C+  C C+ +N + C P  G+C C  G+HG +C     PG         C       C +     P         G+ S+ C   Q  CP G  G +C   C C E   SC+  +G C C PG TG +C+  C +G +G  CQ SC CR   LCD   G C C     G  CE  CP GK+G  C  +C C  +  CD+  G C C  G YG  C   CP G +G  C + C C  G  C P++G C C  G+HG  C++ C  G +GD+C  +C C++G  CD    KC C PG  G+ C+  C V  YG +C   C+C N  LC+  SG C C+ GW G  C E  P +   P
Sbjct:  632 CEHGAACDHVSGACTCAAGWTGTYCERPCPDGFFGMECKEPCGCRNGA---HCN---HITGLCSCAPGWVGPKCSQPCQGQTHGENCSQACDCHNG-------ATCEHVTG--LCLCTPGW----TGASCQRKCDAGFYGAGCAQHCICRNGATCSHVTGDCSCPDGWT----GVACETE-------------CTGGKFGAGCQQSCS-CQNGGTCEARTGRCTCKAGWTGDACESTCPAGFFGGRCGE-RCECAHGDSCHHVTGACHCHAGWRGRHCDKPCLPGHYGEGCTRRCSCA-SGVPCDHVTGNCGCPPGFTGNGCDQTCPAGTFGQNCNSVCQCSADNQQ-CHPVTGRCNCLAGFHGPHCDSIAPPGNPSKGSLSRC------RCRNNNTAVPHSLDCYGAGGSMSLFCASGQAACPAGHYGKECASLCSCGERG-SCDPVSGRCQCQPGRTGAKCQQVCPRGRFGAGCQQSCACRNGGLCDTANGTCTCGLGWTGLHCEKECPEGKYGAGCQVSCPCRNNGTCDRFTGCCKCPEGVYGHACEYECPPGFFGLNCMRPCDCRNGALCHPVTGQCVCPAGYHGSKCDHECTVGTFGDKCLSRCDCVDGSQCDHVTGKCLCPPGKAGDKCDVDCRVNRYGPHCSLTCECANKALCNPRSGSCSCLYGWVGPTCQEDTPFRLSRP 1273          

HSP 6 Score: 62.7734 bits (151), Expect = 5.061e-10
Identity = 46/147 (31.29%), Postives = 66/147 (44.90%), Query Frame = 3
Query:  654 GGFYCKCPPGYEMSENGKNCIDI-----NECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAID 1079
            G F C+C PGYE+  +GK C  I     N C ++   C+H C +   G RC C     L  D   C       + + +G C       +   + C C  G+ +  D  +C  VD C   NGGC  LC+++  S    C CR G+ +D
Sbjct:   21 GSFVCQCNPGYELGSDGKQCYRIEMEIVNSCEKDNGGCTHTCQHATQGPRCLCDSGFHLDVDGKTCRDTD---ECSEEGSCCAQFCSNNAGGYECGCRAGYRIGLDGCNCDDVDECLAENGGCEQLCRNNEGS--YECSCRRGFRLD 162          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007575.1 (pep scaffold:Pmarinus_7.0:GL479777:18063:31178:-1 gene:ENSPMAG00000006841.1 transcript:ENSPMAT00000007575.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 299.671 bits (766), Expect = 6.254e-90
Identity = 177/432 (40.97%), Postives = 231/432 (53.47%), Query Frame = 3
Query: 2715 CPEGLYGEGCSKECQCI-YGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQC-LNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIK-NCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVS 4001
            C EG +GEGC + C+C   G+CD +SG C C  GW G  CE  C  G +G +C  +C C NG +C      C+C PGW G+ C+K C  G +G  C  RC C  G  C+ ++G+C C PG+ G  C+  C   T+GP+C  VCQC     +CHP  G C C  G HG  C L CP  +YG  C   C C     CD  +G C C     G +C +         DC   C C     C++VTG C C PGL GP C + C  G FG  C  +C+C N   C+  +GTC C  G+TG+ C++ C  G YG  C+  CL C  N TC   +G C C  G     C+  CP G+YG  CQ+AC C +GA+C+P++G C C  GF+G  CQ  C    +GA C+ RC C    PC+P TG C+CP   +G  C+ S
Sbjct:    2 CEEGRFGEGCRRPCKCANRGSCDRLSGQCVCPAGWTGPTCEETCPAGQHGLRCGSRCDCENGASCHAETGACRCHPGWRGKRCDKPCLPGQFGAECAQRCTCRQGAPCNHLTGECGCPPGFTGNGCELTCLPGTFGPDCKWVCQCQAPTQQCHPVTGQCHCLPGHHGQRCHLACPAGRYGSGCRQTCKCANGGSCDTTSGFCDCQPGFTGANCSLPCPAGRYGKDCALACACGGGGQCDRVTGSCSCPPGLAGPNCGEDCPGGRFGARCGGRCQCKNSGFCDARNGTCACGLGWTGVHCERECPAGKYGVGCRQDCL-CEHNGTCDSVSGACRCTDGYYGPRCEHACPPGFYGLNCQRACHCRNGANCDPASGHCLCPPGFHGERCQKGCDAGRFGAGCRARCNCQGGVPCHPTTGECLCPPGKTGAQCDAS 432          

HSP 2 Score: 293.893 bits (751), Expect = 7.016e-88
Identity = 192/478 (40.17%), Postives = 239/478 (50.00%), Query Frame = 3
Query: 2193 KCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK-CE-ACPSGKWGPTCNQNCDCTYST-GCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIY-GNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKE--SDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQ 3608
            +C+ G FG  C   C    +  C+  +GQC      G     C+  CP G  G  C   CDC EN  SC  + G C C PG+ GKRC+  C  G +G  C   C CR+   C+H+TG C C     G  CE  C  G +GP C   C C   T  C  + GQC CL G++G +C   CP G YG GC + C+C   G+CD  SG C C PG+ G  C  PC  G YG  C   C C  GG CD     C C PG  G  C + C  G +G  C GRCQC N G CD  +G C C  GW G++C+  CP+  YG  C Q C C + G C   +G C+C  G +G  CE  CPP  YG NC   C C+    CD  +G C CP    G  C+ K CD+    + CR  C C     C+  TG+C C PG  G QC   C  G++G+ C   C C N   C+PV+G C CL G+ G  C +
Sbjct:    1 ECEEGRFGEGCRRPCKCANRGSCDRLSGQCVCPA--GWTGPTCEETCPAGQHGLRCGSRCDC-ENGASCHAETGACRCHPGWRGKRCDKPCLPGQFGAECAQRCTCRQGAPCNHLTGECGCPPGFTGNGCELTCLPGTFGPDCKWVCQCQAPTQQCHPVTGQCHCLPGHHGQRCHLACPAGRYGSGCRQTCKCANGGSCDTTSGFCDCQPGFTGANCSLPCPAGRYGKDCALACACGGGGQCDRVTGSCSCPPGLAGPNCGEDCPGGRFGARCGGRCQCKNSGFCDARNGTCACGLGWTGVHCERECPAGKYGVGCRQDCLCEHNGTCDSVSGACRCTDGYYGPRCEHACPPGFYGLNCQRACHCRNGANCDPASGHCLCPPGFHGERCQ-KGCDAGRFGAGCRARCNCQGGVPCHPTTGECLCPPGKTGAQCDASCPAGSYGVGCSLDCACGNRGRCSPVNGKCTCLFGWVGPTCRE 474          

HSP 3 Score: 287.345 bits (734), Expect = 1.872e-85
Identity = 184/475 (38.74%), Postives = 234/475 (49.26%), Query Frame = 3
Query: 2328 DCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN--CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKES-DCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCK 3737
            +C  G  G  CR+ C C+ N  SC+  +G C C  G+TG  CE  C  G +G RC S C C     C   TG C C     GK   + C  G++G  C Q C C     C+ + G+C C  G+ G  C   C  G +G  C   CQC      C P++G C C PG HG+ C   C  G YG  C++ CKC NGG+CD     C C+PG+ G  C   C  G YG++C   C C  GG CD ++G C C PG  G NC E CP   +G  C   CQC N G C   NG C C  G  G  CE  CP  KYG  C  +C+C+    CD  +G C C    +G  CE          +C++ C C    +C+  +G C C PG  G +C + C+ G FG  C+ +C C  G PC+P  G CLC  G TG  CD  C  G YG  C L C   NR + C P  G+C+C  G +   C+
Sbjct:    1 ECEEGRFGEGCRRPCKCA-NRGSCDRLSGQCVCPAGWTGPTCEETCPAGQHGLRCGSRCDCENGASCHAETGACRCHPGWRGKRCDKPCLPGQFGAECAQRCTCRQGAPCNHLTGECGCPPGFTGNGCELTCLPGTFGPDCKWVCQCQAPTQQCHPVTGQCHCLPGHHGQRCHLACPAGRYGSGCRQTCKCANGGSCDTTSGFCDCQPGFTGANCSLPCPAGRYGKDCALACACGGGGQCDRVTGSCSCPPGLAGPNCGEDCPGGRFGARCGGRCQCKNSGFCDARNGTCACGLGWTGVHCERECPAGKYGVGCRQDCLCEHNGTCDSVSGACRCTDGYYGPRCEHACPPGFYGLNCQRACHCRNGANCDPASGHCLCPPGFHGERCQKGCDAGRFGAGCRARCNCQGGVPCHPTTGECLCPPGKTGAQCDASCPAGSYGVGCSLDCACGNRGR-CSPVNGKCTCLFGWVGPTCR 473          

HSP 4 Score: 286.574 bits (732), Expect = 2.690e-85
Identity = 176/480 (36.67%), Postives = 237/480 (49.38%), Query Frame = 3
Query: 2586 CPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHN-GGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKE--SDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVSVINR 4013
            C  G++G  C + C C     CD+++GQC+C AG+ GP C + CP G +G  C   C C  G +C   +G CRC+PGW G+ C+ PC  G +G +C ++C C  G  C+    +C C PG+ G  CE +C  G +G +C+  CQC      C  ++G+C C+PG  G  C   CP+  YG  C Q C+C NGG C   +G C C  G  G  C L CP  +YG +C   C C    +CD  TG C+CP    G +C  ++C      + C   CQC     C+   G C C  G  G  C + C  G +G+ C+Q C C +   C+ V G C C  G+ G  C+  C  G+YG NC+  C  C     C P +G C C  G     C+  C +G +G  C+  C C  G  C+P+TG C C  G  GA C   CP   YG  C   C C +   C+PV G C C     G  C      R
Sbjct:    2 CEEGRFGEGCRRPCKCANRGSCDRLSGQCVCPAGWTGPTCEETCPAGQHGLRCGSRCDCENGASCHAETGACRCHPGWRGKRCDKPCLPGQFGAECAQRCTCRQGAPCNHLTGECGCPPGFTGNGCELTCLPGTFGPDCKWVCQCQAPTQQCHPVTGQCHCLPGHHGQRCHLACPAGRYGSGCRQTCKCANGGSCDTTSGFCDCQPGFTGANCSLPCPAGRYGKDCALACACGGGGQCDRVTGSCSCPPGLAGPNCG-EDCPGGRFGARCGGRCQCKNSGFCDARNGTCACGLGWTGVHCERECPAGKYGVGCRQDCLCEHNGTCDSVSGACRCTDGYYGPRCEHACPPGFYGLNCQRACH-CRNGANCDPASGHCLCPPGFHGERCQKGCDAGRFGAGCRARCNCQGGVPCHPTTGECLCPPGKTGAQCDASCPAGSYGVGCSLDCACGNRGRCSPVNGKCTCLFGWVGPTCREGASER 479          

HSP 5 Score: 283.108 bits (723), Expect = 5.866e-84
Identity = 182/474 (38.40%), Postives = 236/474 (49.79%), Query Frame = 3
Query: 2460 KCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN-CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKC-LNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKES-DCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQ 3866
            +C +G +GE C+  C+C     CD ++G C C     G    E CP+G+ G  C   CDC     C    G C C  G+ G +C K C  G +G  C++ C C  G  C+ ++G C C PG+ G  CE  C  G +G  CK  C+C      C     +C C PG HG+ C  +C  G YG  C   C+C NGG CD  SG CDC PG+ G NC   CP+  YG +C   C C  GG+C    G C CP G  G  C   CP  ++G  C   C CK +  CD + G C C     G+ CE +    K    CRQDC C    +C+ V+G C+C  G  GP+C   C  G +GL+C++ C C NG  C+P  G CLC  GF G  C + C  G +G  C+ +C  C     CHP TG+C C  G     C   CP+G YG  C   C C +   C+P  G C CL G+ G  C+
Sbjct:    1 ECEEGRFGEGCRRPCKCANRGSCDRLSGQCVCPAGWTGPTCEETCPAGQHGLRCGSRCDCENGASCHAETGACRCHPGWRGKRCDKPCLPGQFGAECAQRCTCRQGAPCNHLTGECGCPPGFTGNGCELTCLPGTFGPDCKWVCQCQAPTQQCHPVTGQCHCLPGHHGQRCHLACPAGRYGSGCRQTCKCANGGSCDTTSGFCDCQPGFTGANCSLPCPAGRYGKDCALACACGGGGQCDRVTGSCSCPPGLAGPNCGEDCPGGRFGARCGGRCQCKNSGFCDARNGTCACGLGWTGVHCERECPAGKYGVGCRQDCLCEHNGTCDSVSGACRCTDGYYGPRCEHACPPGFYGLNCQRACHCRNGANCDPASGHCLCPPGFHGERCQKGCDAGRFGAGCRARC-NCQGGVPCHPTTGECLCPPGKTGAQCDASCPAGSYGVGCSLDCACGNRGRCSPVNGKCTCLFGWVGPTCR 473          

HSP 6 Score: 269.626 bits (688), Expect = 2.628e-79
Identity = 186/481 (38.67%), Postives = 236/481 (49.06%), Query Frame = 3
Query: 1665 CPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQ-GNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFG-KCE-ACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDE 3095
            C +G FGE C   C  C ++G C+     C+C   ++G  CE  C      + C   +C C+NG +C +ET  C C PG  G+ C+  C  G FG  C + C T      C+ +TG+C C PG+ G+ C L C  GT+G  C   C C Q   + C P  G+C C  G+HG  C   C  G +G  C  +C       C+  +G C    CQ G     C   CP G  G DC   C C      C+   G C C PG  G  C   C  G +G RC   CQC+    CD   G C C     G  CE  CP+GK+G  C Q+C C ++  CD ++G C C  GYYGP+C   CP G YG  C + C C  G NCDP SG C C PG+HGE C+  CD G +G  C+ +C C  G  C     +C C PG  G  C+ SC  G YG  C   C C N G C  ++GKC C+ GW G  C E
Sbjct:    2 CEEGRFGEGCRRPC-KCANRGSCDRLSGQCVCPAGWTGPTCEETCPAGQHGLRCG-SRCDCENGASCHAETGACRCHPGWRGKRCDKPCLPGQFGAECAQRC-TCRQGAPCNHLTGECGCPPGFTGNGCELTCLPGTFGPDCKWVCQC-QAPTQQCHPVTGQCHCLPGHHGQRCHLACPAGRYGSGCRQTCKCANGGSCDTTSGFC---DCQPGFTGANCSLPCPAGRYGKDCALACACGGGG-QCDRVTGSCSCPPGLAGPNCGEDCPGGRFGARCGGRCQCKNSGFCDARNGTCACGLGWTGVHCERECPAGKYGVGCRQDCLCEHNGTCDSVSGACRCTDGYYGPRCEHACPPGFYGLNCQRACHCRNGANCDPASGHCLCPPGFHGERCQKGCDAGRFGAGCRARCNCQGGVPCHPTTGECLCPPGKTGAQCDASCPAGSYGVGCSLDCACGNRGRCSPVNGKCTCLFGWVGPTCRE 474          

HSP 7 Score: 254.218 bits (648), Expect = 7.523e-74
Identity = 177/472 (37.50%), Postives = 228/472 (48.31%), Query Frame = 3
Query: 1560 SYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFG-KCE-ACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEK 2966
            S +CVCP G T      TC+               CP G  G  C   C +C +   C+ +   C CHP + G  C+  CL      EC   +C C+ G  C   T +C CPPG +G  CE+ C  G FG +C+  C     + +CH +TG+C C PG +G  CHL CP G +G GC +TC C   N   CD  +G C C+ G+ G NC   C  G +G DC+ +C       C+  TG C      G     C  DCP G  G+ C   C C +NS  C+ +NG C C  G+TG  CE +C  G YG  C+  C C  +  CD V+G C C D  +G +CE ACP G +G  C + C C     CD  +G C+C  G++G +C K C  G +G GC   C C  G  C P +G C C PG  G  C+  C  G YG  C   C C N G C     KC C  GW G  C +
Sbjct:   27 SGQCVCPAGWT----GPTCEET-------------CPAGQHGLRCGSRC-DCENGASCHAETGACRCHPGWRGKRCDKPCLPGQFGAECA-QRCTCRQGAPCNHLTGECGCPPGFTGNGCELTCLPGTFGPDCKWVCQCQAPTQQCHPVTGQCHCLPGHHGQRCHLACPAGRYGSGCRQTCKCA--NGGSCDTTSGFCDCQPGFTGANCSLPCPAGRYGKDCALACACGGGGQCDRVTGSCSCPP--GLAGPNCGEDCPGGRFGARCGGRCQC-KNSGFCDARNGTCACGLGWTGVHCERECPAGKYGVGCRQDCLCEHNGTCDSVSGACRCTDGYYGPRCEHACPPGFYGLNCQRACHCRNGANCDPASGHCLCPPGFHGERCQKGCDAGRFGAGCRARCNCQGGVPCHPTTGECLCPPGKTGAQCDASCPAGSYGVGCSLDCACGNRGRCSPVNGKCTCLFGWVGPTCRE 474          

HSP 8 Score: 169.859 bits (429), Expect = 3.951e-45
Identity = 154/498 (30.92%), Postives = 221/498 (44.38%), Query Frame = 3
Query: 1377 ECVTGK--HKCVPPSTCIN----DLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQ-NQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCL--------------QNPSQVECQPL--QCHC----------------------------KNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFG-KCEA-CPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSK 2711
            EC  G+    C  P  C N    D  S  C CP G+       TCE+      +    G +C +     RC C NG +   +   C+ +   RG    K    C  G FG EC   C+ C     CN     C C P ++G  CE+ CL              Q P+Q +C P+  QCHC                             NGG+C++ +  C+C PG +G  C + C  G +G++C   C       +C ++TG C C PG  G +C   CP G +G  C   C C  + +  CD +NG C C  G+ GV+C  +C  G +G+ C   C  +    C+  +G C  +   G     C+  CP G  G +C++ C C  N  +C+  +G C C PGF G+RC+  C  G +G  C++ C C+    C   TG C C     G +C+A CP+G +G  C+ +C C     C  +NG+C CL G+ GP C +
Sbjct:    1 ECEEGRFGEGCRRPCKCANRGSCDRLSGQCVCPAGW----TGPTCEETCPAGQH----GLRCGS-----RCDCENGASCHAETGACRCHPGWRGKRCDKP---CLPGQFGAECAQRCT-CRQGAPCNHLTGECGCPPGFTGNGCELTCLPGTFGPDCKWVCQCQAPTQ-QCHPVTGQCHCLPGHHGQRCHLACPAGRYGSGCRQTCKCANGGSCDTTSGFCDCQPGFTGANCSLPCPAGRYGKDCALACACG-GGGQCDRVTGSCSCPPGLAGPNCGEDCPGGRFGARCGGRCQCKNSGF--CDARNGTCACGLGWTGVHCERECPAGKYGVGCRQDCLCEHNGTCDSVSGAC--RCTDGYYGPRCEHACPPGFYGLNCQRACHC-RNGANCDPASGHCLCPPGFHGERCQKGCDAGRFGAGCRARCNCQGGVPCHPTTGECLCPPGKTGAQCDASCPAGSYGVGCSLDCACGNRGRCSPVNGKCTCLFGWVGPTCRE 474          

HSP 9 Score: 117.087 bits (292), Expect = 1.762e-27
Identity = 134/437 (30.66%), Postives = 168/437 (38.44%), Query Frame = 3
Query: 1173 ICDCHPGWQIGHDHKSCY--KVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKC---VPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSN-RCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQC---PDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCE 2456
             C CHPGW+     K C   +   E    C    G     CN   +    C C PGF      LTC         K  C    P   C    G   C C  G+  ++  + C          G  G  C  T     C C NG +    +  C  Q     +    P  CP G +G++C   C+ C   G C+     C C P  +G  C  DC        C   +C CKN G C++    C C  G +G  CE  C  G +G  C ++C   C  N  C  ++G C C  G+YG  C   CP G +G+ C + C C   N   CDP +G C C  G+HG  C   CD G FG  C   C       C+  TG+C   P KT        C   CP G  G  C   C C  N   C   NG C C  G+ G  C 
Sbjct:   72 ACRCHPGWRGKRCDKPCLPGQFGAECAQRCTCRQG---APCN---HLTGECGCPPGFTGNGCELTCLPGTFGPDCKWVCQCQAPTQQCHPVTGQ--CHCLPGHHGQRCHLACP--------AGRYGSGCRQT-----CKCANGGSCDTTSGFCDCQPGFTGANCSLP--CPAGRYGKDCALACA-CGGGGQCDRVTGSCSCPPGLAGPNCGEDCPGGRFGARCG-GRCQCKNSGFCDARNGTCACGLGWTGVHCERECPAGKYGVGCRQDC--LCEHNGTCDSVSGACRCTDGYYGPRCEHACPPGFYGLNCQRACHC--RNGANCDPASGHCLCPPGFHGERCQKGCDAGRFGAGCRARCNCQGGVPCHPTTGECLCPPGKT-----GAQCDASCPAGSYGVGCSLDCACG-NRGRCSPVNGKCTCLFGWVGPTCR 473          

HSP 10 Score: 62.3882 bits (150), Expect = 4.520e-10
Identity = 126/542 (23.25%), Postives = 181/542 (33.39%), Query Frame = 3
Query:  486 EERIGKYCQNGAFCYQSG----YNAKCICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSS-----VITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEG------SFICDCHPGWQIGHDHKSC----YKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCH 2054
            E R G+ C+    C   G     + +C+CP G+ G  C++                          CP G      G  C        N   C  E         C+C P          C+P     + A +  C       + +   C CP G   +    +C       D    C  +CQ    +         C C PG+       ++C           GC+  C    G      S  CDC PG+   +    C    Y  D  L   C  G G C +   S       CSC PG      G  C           +C   ++   D  +  C C +G+      + CE       Y  GC            C+C +  T    +  C  + T G    +    CP G +G  C   C +C +   C+     CLC P + G  C+  C        C+  +C+C+ G  C   T +C CPPG +G  C+  C  G +G  C  +C    +  RC  + GKC C  GW G +C 
Sbjct:    4 EGRFGEGCRRPCKCANRGSCDRLSGQCVCPAGWTGPTCEE-------------------------TCPAGQHGLRCGSRCD-----CENGASCHAE------TGACRCHPGWRGKRCDKPCLPGQFGAECAQRCTCRQG-APCNHLTGECGCPPGFTGNGCELTCLPGTFGPD----CKWVCQCQAPTQQCHPVTGQCHCLPGH-----HGQRCHLACPAGRYGSGCRQTCKCANGGSCDTTSGFCDCQPGFTGANCSLPCPAGRYGKDCALACACG-GGGQCDRVTGS-------CSCPPGLAGPNCGEDCPGGRFGARCGGRCQCKNSGFCDARNGTCACGLGW----TGVHCERECPAGKYGVGC---------RQDCLCEHNGTCDSVSGAC--RCTDGYYGPRCEHACPPGFYGLNCQRAC-HCRNGANCDPASGHCLCPPGFHGERCQKGCDAGRFGAGCR-ARCNCQGGVPCHPTTGECLCPPGKTGAQCDASCPAGSYGVGCSLDCACG-NRGRCSPVNGKCTCLFGWVGPTCR 473          

HSP 11 Score: 50.447 bits (119), Expect = 2.415e-6
Identity = 28/89 (31.46%), Postives = 46/89 (51.69%), Query Frame = 3
Query: 3741 QCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVSVI 4007
            +C  G +G  C++ C+C +  SC+  +G C C +G+ G  C+  CP   +G  C  RC C + + C+  TG C C     G+ C+   +
Sbjct:    1 ECEEGRFGEGCRRPCKCANRGSCDRLSGQCVCPAGWTGPTCEETCPAGQHGLRCGSRCDCENGASCHAETGACRCHPGWRGKRCDKPCL 89          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Sea Lamprey
Match: megf10 (multiple EGF-like-domains 10 [Source:NCBI gene;Acc:564571])

HSP 1 Score: 188.734 bits (478), Expect = 5.039e-51
Identity = 110/269 (40.89%), Postives = 135/269 (50.19%), Query Frame = 3
Query: 2583 ACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKEC-QCIYGN--CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKESD 3380
             CP G+WGP C+ +C+C     C   +G C C  GY G  C + C  G YG  CS+ C QC++ N  C  ISG C C PG+HG +C   C    YG  C   C C N GTC+     CQC PGW G  C +SC  G++G NC   C CHNG +C    G+C C PGW G+ C +RCP   YG +C Q C C NG  C   +G C C  G  G  C+  C P  +G  C   C C     CD  TG C C     G+ C+       ES 
Sbjct:    8 VCPEGRWGPNCSLSCNCNNGASCSPDDGTCECAFGYRGTTCQRICSPGFYGARCSQACPQCVHSNGPCHHISGQCDCLPGFHGSLCNQVCPSKRYGKNCFGTCSCTNNGTCNPIDGSCQCYPGWIGSDCSQSCPPGHWGPNCIHTCNCHNGAVCSAYDGECRCSPGWTGLYCTQRCPLSFYGKDCTQPCLCQNGADCEHISGQCTCRTGFMGRHCQTKCLPGTFGYGCRQLCECLNNATCDHVTGACYCHPGWKGIRCDQAGLIIMESS 276          

HSP 2 Score: 181.8 bits (460), Expect = 1.071e-48
Identity = 109/267 (40.82%), Postives = 138/267 (51.69%), Query Frame = 3
Query: 2820 GEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRC-QC-HNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIK-NCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQV 3611
            G  C+N C EG +G  C   C C NG +C      C+C  G+ G  C++ C+ G+YG  C   C QC H+ G C  ISG+CDC+PG+ G  C++ CPS+ YG NC   C C N G C+P +G CQC  G  G  C  +CPP  +GPNC+H C C     C    GEC C     GL C  +        DC Q C C     C  ++G+C C+ G  G  C   C  G FG  C+Q C C N   C+ V G C C  G+ GI CDQ 
Sbjct:    2 GLHCDNVCPEGRWGPNCSLSCNCNNGASCSPDDGTCECAFGYRGTTCQRICSPGFYGARCSQACPQCVHSNGPCHHISGQCDCLPGFHGSLCNQVCPSKRYGKNCFGTCSCTNNGTCNPIDGSCQCYPGWIGSDCSQSCPPGHWGPNCIHTCNCHNGAVCSAYDGECRCSPGWTGLYCTQRCPLSFYGKDCTQPCLCQNGADCEHISGQCTCRTGFMGRHCQTKCLPGTFGYGCRQLCECLNNATCDHVTGACYCHPGWKGIRCDQA 268          

HSP 3 Score: 171.014 bits (432), Expect = 4.637e-45
Identity = 104/267 (38.95%), Postives = 137/267 (51.31%), Query Frame = 3
Query: 2694 GPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKC-KCLNG-GTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIK-NCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQM 3482
            G  C   CPEG +G  CS  C C  G +C P  G C C  G+ G  C+  C  G+YG +C + C +C++  G C     +C C PG+HG  C + C    YG+NC G C C N G C+ I G C C PGW G +C + CP   +GPNC   C C NG  C   +G C+C  G  G  C   CP   YG +C   C+C+    C+  +G+CTC     G  C+ K    +    CRQ C+C    +C+ VTG C C PG +G +C Q 
Sbjct:    2 GLHCDNVCPEGRWGPNCSLSCNCNNGASCSPDDGTCECAFGYRGTTCQRICSPGFYGARCSQACPQCVHSNGPCHHISGQCDCLPGFHGSLCNQVCPSKRYGKNCFGTCSCTNNGTCNPIDGSCQCYPGWIGSDCSQSCPPGHWGPNCIHTCNCHNGAVCSAYDGECRCSPGWTGLYCTQRCPLSFYGKDCTQPCLCQNGADCEHISGQCTCRTGFMGRHCQTKCLPGTFGYGCRQLCECLNNATCDHVTGACYCHPGWKGIRCDQA 268          

HSP 4 Score: 151.369 bits (381), Expect = 1.759e-38
Identity = 92/242 (38.02%), Postives = 131/242 (54.13%), Query Frame = 3
Query: 1833 LQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSN-RCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYC 2555
            L C+C NG +C  +   C C  G  G  C+  C+ GF+G  C + CP    SN  CH I+G+C C PG++GS C+ +CP+  +G  C  TCSC  N    C+P +G C+C  G+ G +C   C PG++G +C  +C      +C+   G+C  +   G   + C + CP    G DC + C C +N   CE  +G C C  GF G+ C+ KC  G +G  C+  C+C  +  CDHVTG CYC
Sbjct:   20 LSCNCNNGASCSPDDGTCECAFGYRGTTCQRICSPGFYGARCSQACPQCVHSNGPCHHISGQCDCLPGFHGSLCNQVCPSKRYGKNCFGTCSCTNNGT--CNPIDGSCQCYPGWIGSDCSQSCPPGHWGPNCIHTCNCHNGAVCSAYDGEC--RCSPGWTGLYCTQRCPLSFYGKDCTQPCLC-QNGADCEHISGQCTCRTGFMGRHCQTKCLPGTFGYGCRQLCECLNNATCDHVTGACYC 256          

HSP 5 Score: 142.895 bits (359), Expect = 8.868e-36
Identity = 96/280 (34.29%), Postives = 136/280 (48.57%), Query Frame = 3
Query: 3195 AGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCE-IKNCDSKESDCRQDCQCSIKKS--CNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVSVINRLKLS 4025
            AG H   C+  CP  ++GPNC  +C C     C    G C C     G +C+ I +     + C Q C   +  +  C+ ++G+C C PG  G  C Q+C    +G +C   C C N   CNP+DG+C C  G+ G  C Q C  G +GPNC   C  C+    C    G+C C  G     C  +CP  +YG  C Q C C +GA C   +G C C +GF G  CQ +C    +G  C+  C+C +N+ C+ VTG C C     G  C+ + +  ++ S
Sbjct:    1 AGLH---CDNVCPEGRWGPNCSLSCNCNNGASCSPDDGTCECAFGYRGTTCQRICSPGFYGARCSQACPQCVHSNGPCHHISGQCDCLPGFHGSLCNQVCPSKRYGKNCFGTCSCTNNGTCNPIDGSCQCYPGWIGSDCSQSCPPGHWGPNCIHTC-NCHNGAVCSAYDGECRCSPGWTGLYCTQRCPLSFYGKDCTQPCLCQNGADCEHISGQCTCRTGFMGRHCQTKCLPGTFGYGCRQLCECLNNATCDHVTGACYCHPGWKGIRCDQAGLIIMESS 276          

HSP 6 Score: 142.124 bits (357), Expect = 1.621e-35
Identity = 94/272 (34.56%), Postives = 135/272 (49.63%), Query Frame = 3
Query: 2175 GVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTC-DCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK--CEACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAV 2978
            G++C   C  G +G +CS SC  +    C+ + G C  +   G     CQR C  G  G+ C + C  C  ++  C   +G C C PGF G  C   C    YG+ C  +C C  +  C+ + G C C     G    ++CP G WGP C   C+C     C   +G+C C  G+ G  C++RCP   YG+ C++ C C  G +C+ ISG C C  G+ G  C+  C  G +G  C++ C+CLN  TCD     C C PGW G  C+++  +
Sbjct:    2 GLHCDNVCPEGRWGPNCSLSCNCNNGASCSPDDGTC--ECAFGYRGTTCQRICSPGFYGARCSQACPQCVHSNGPCHHISGQCDCLPGFHGSLCNQVCPSKRYGKNCFGTCSCTNNGTCNPIDGSCQCYPGWIGSDCSQSCPPGHWGPNCIHTCNCHNGAVCSAYDGECRCSPGWTGLYCTQRCPLSFYGKDCTQPCLCQNGADCEHISGQCTCRTGFMGRHCQTKCLPGTFGYGCRQLCECLNNATCDHVTGACYCHPGWKGIRCDQAGLI 271          

HSP 7 Score: 80.1073 bits (196), Expect = 1.697e-15
Identity = 58/174 (33.33%), Postives = 81/174 (46.55%), Query Frame = 3
Query: 1665 CPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNC 2186
            CP   +G+ C   CS C + G CN     C C+P + G+ C   C        C    C+C NG  C +   +C C PG +G  C   C   F+G++C + C     ++ C  I+G+C C  G+ G  C   C  GT+G GC + C C  N    CD   G C C  G+ G+ C
Sbjct:   97 CPSKRYGKNCFGTCS-CTNNGTCNPIDGSCQCYPGWIGSDCSQSCPPGHWGPNCI-HTCNCHNGAVCSAYDGECRCSPGWTGLYCTQRCPLSFYGKDCTQPCLCQNGAD-CEHISGQCTCRTGFMGRHCQTKCLPGTFGYGCRQLCECLNN--ATCDHVTGACYCHPGWKGIRC 265          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Sea Lamprey
Match: megf10 (multiple EGF-like-domains 10 [Source:NCBI gene;Acc:564571])

HSP 1 Score: 188.734 bits (478), Expect = 6.779e-51
Identity = 110/269 (40.89%), Postives = 135/269 (50.19%), Query Frame = 3
Query: 2583 ACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKEC-QCIYGN--CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKESD 3380
             CP G+WGP C+ +C+C     C   +G C C  GY G  C + C  G YG  CS+ C QC++ N  C  ISG C C PG+HG +C   C    YG  C   C C N GTC+     CQC PGW G  C +SC  G++G NC   C CHNG +C    G+C C PGW G+ C +RCP   YG +C Q C C NG  C   +G C C  G  G  C+  C P  +G  C   C C     CD  TG C C     G+ C+       ES 
Sbjct:    8 VCPEGRWGPNCSLSCNCNNGASCSPDDGTCECAFGYRGTTCQRICSPGFYGARCSQACPQCVHSNGPCHHISGQCDCLPGFHGSLCNQVCPSKRYGKNCFGTCSCTNNGTCNPIDGSCQCYPGWIGSDCSQSCPPGHWGPNCIHTCNCHNGAVCSAYDGECRCSPGWTGLYCTQRCPLSFYGKDCTQPCLCQNGADCEHISGQCTCRTGFMGRHCQTKCLPGTFGYGCRQLCECLNNATCDHVTGACYCHPGWKGIRCDQAGLIIMESS 276          

HSP 2 Score: 181.8 bits (460), Expect = 1.451e-48
Identity = 109/267 (40.82%), Postives = 138/267 (51.69%), Query Frame = 3
Query: 2820 GEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRC-QC-HNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIK-NCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQV 3611
            G  C+N C EG +G  C   C C NG +C      C+C  G+ G  C++ C+ G+YG  C   C QC H+ G C  ISG+CDC+PG+ G  C++ CPS+ YG NC   C C N G C+P +G CQC  G  G  C  +CPP  +GPNC+H C C     C    GEC C     GL C  +        DC Q C C     C  ++G+C C+ G  G  C   C  G FG  C+Q C C N   C+ V G C C  G+ GI CDQ 
Sbjct:    2 GLHCDNVCPEGRWGPNCSLSCNCNNGASCSPDDGTCECAFGYRGTTCQRICSPGFYGARCSQACPQCVHSNGPCHHISGQCDCLPGFHGSLCNQVCPSKRYGKNCFGTCSCTNNGTCNPIDGSCQCYPGWIGSDCSQSCPPGHWGPNCIHTCNCHNGAVCSAYDGECRCSPGWTGLYCTQRCPLSFYGKDCTQPCLCQNGADCEHISGQCTCRTGFMGRHCQTKCLPGTFGYGCRQLCECLNNATCDHVTGACYCHPGWKGIRCDQA 268          

HSP 3 Score: 170.629 bits (431), Expect = 7.422e-45
Identity = 104/267 (38.95%), Postives = 137/267 (51.31%), Query Frame = 3
Query: 2694 GPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKC-KCLNG-GTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIK-NCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQM 3482
            G  C   CPEG +G  CS  C C  G +C P  G C C  G+ G  C+  C  G+YG +C + C +C++  G C     +C C PG+HG  C + C    YG+NC G C C N G C+ I G C C PGW G +C + CP   +GPNC   C C NG  C   +G C+C  G  G  C   CP   YG +C   C+C+    C+  +G+CTC     G  C+ K    +    CRQ C+C    +C+ VTG C C PG +G +C Q 
Sbjct:    2 GLHCDNVCPEGRWGPNCSLSCNCNNGASCSPDDGTCECAFGYRGTTCQRICSPGFYGARCSQACPQCVHSNGPCHHISGQCDCLPGFHGSLCNQVCPSKRYGKNCFGTCSCTNNGTCNPIDGSCQCYPGWIGSDCSQSCPPGHWGPNCIHTCNCHNGAVCSAYDGECRCSPGWTGLYCTQRCPLSFYGKDCTQPCLCQNGADCEHISGQCTCRTGFMGRHCQTKCLPGTFGYGCRQLCECLNNATCDHVTGACYCHPGWKGIRCDQA 268          

HSP 4 Score: 150.984 bits (380), Expect = 2.559e-38
Identity = 92/242 (38.02%), Postives = 131/242 (54.13%), Query Frame = 3
Query: 1833 LQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSN-RCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYC 2555
            L C+C NG +C  +   C C  G  G  C+  C+ GF+G  C + CP    SN  CH I+G+C C PG++GS C+ +CP+  +G  C  TCSC  N    C+P +G C+C  G+ G +C   C PG++G +C  +C      +C+   G+C  +   G   + C + CP    G DC + C C +N   CE  +G C C  GF G+ C+ KC  G +G  C+  C+C  +  CDHVTG CYC
Sbjct:   20 LSCNCNNGASCSPDDGTCECAFGYRGTTCQRICSPGFYGARCSQACPQCVHSNGPCHHISGQCDCLPGFHGSLCNQVCPSKRYGKNCFGTCSCTNNGT--CNPIDGSCQCYPGWIGSDCSQSCPPGHWGPNCIHTCNCHNGAVCSAYDGEC--RCSPGWTGLYCTQRCPLSFYGKDCTQPCLC-QNGADCEHISGQCTCRTGFMGRHCQTKCLPGTFGYGCRQLCECLNNATCDHVTGACYC 256          

HSP 5 Score: 142.895 bits (359), Expect = 1.254e-35
Identity = 96/280 (34.29%), Postives = 136/280 (48.57%), Query Frame = 3
Query: 3195 AGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCE-IKNCDSKESDCRQDCQCSIKKS--CNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVSVINRLKLS 4025
            AG H   C+  CP  ++GPNC  +C C     C    G C C     G +C+ I +     + C Q C   +  +  C+ ++G+C C PG  G  C Q+C    +G +C   C C N   CNP+DG+C C  G+ G  C Q C  G +GPNC   C  C+    C    G+C C  G     C  +CP  +YG  C Q C C +GA C   +G C C +GF G  CQ +C    +G  C+  C+C +N+ C+ VTG C C     G  C+ + +  ++ S
Sbjct:    1 AGLH---CDNVCPEGRWGPNCSLSCNCNNGASCSPDDGTCECAFGYRGTTCQRICSPGFYGARCSQACPQCVHSNGPCHHISGQCDCLPGFHGSLCNQVCPSKRYGKNCFGTCSCTNNGTCNPIDGSCQCYPGWIGSDCSQSCPPGHWGPNCIHTC-NCHNGAVCSAYDGECRCSPGWTGLYCTQRCPLSFYGKDCTQPCLCQNGADCEHISGQCTCRTGFMGRHCQTKCLPGTFGYGCRQLCECLNNATCDHVTGACYCHPGWKGIRCDQAGLIIMESS 276          

HSP 6 Score: 141.739 bits (356), Expect = 2.553e-35
Identity = 94/272 (34.56%), Postives = 135/272 (49.63%), Query Frame = 3
Query: 2175 GVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTC-DCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK--CEACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAV 2978
            G++C   C  G +G +CS SC  +    C+ + G C  +   G     CQR C  G  G+ C + C  C  ++  C   +G C C PGF G  C   C    YG+ C  +C C  +  C+ + G C C     G    ++CP G WGP C   C+C     C   +G+C C  G+ G  C++RCP   YG+ C++ C C  G +C+ ISG C C  G+ G  C+  C  G +G  C++ C+CLN  TCD     C C PGW G  C+++  +
Sbjct:    2 GLHCDNVCPEGRWGPNCSLSCNCNNGASCSPDDGTC--ECAFGYRGTTCQRICSPGFYGARCSQACPQCVHSNGPCHHISGQCDCLPGFHGSLCNQVCPSKRYGKNCFGTCSCTNNGTCNPIDGSCQCYPGWIGSDCSQSCPPGHWGPNCIHTCNCHNGAVCSAYDGECRCSPGWTGLYCTQRCPLSFYGKDCTQPCLCQNGADCEHISGQCTCRTGFMGRHCQTKCLPGTFGYGCRQLCECLNNATCDHVTGACYCHPGWKGIRCDQAGLI 271          

HSP 7 Score: 79.7221 bits (195), Expect = 2.026e-15
Identity = 58/174 (33.33%), Postives = 81/174 (46.55%), Query Frame = 3
Query: 1665 CPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNC 2186
            CP   +G+ C   CS C + G CN     C C+P + G+ C   C        C    C+C NG  C +   +C C PG +G  C   C   F+G++C + C     ++ C  I+G+C C  G+ G  C   C  GT+G GC + C C  N    CD   G C C  G+ G+ C
Sbjct:   97 CPSKRYGKNCFGTCS-CTNNGTCNPIDGSCQCYPGWIGSDCSQSCPPGHWGPNCI-HTCNCHNGAVCSAYDGECRCSPGWTGLYCTQRCPLSFYGKDCTQPCLCQNGAD-CEHISGQCTCRTGFMGRHCQTKCLPGTFGYGCRQLCECLNN--ATCDHVTGACYCHPGWKGIRC 265          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007940.1 (pep scaffold:Pmarinus_7.0:GL476818:32523:83161:-1 gene:ENSPMAG00000007182.1 transcript:ENSPMAT00000007940.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 147.902 bits (372), Expect = 1.967e-39
Identity = 87/209 (41.63%), Postives = 111/209 (53.11%), Query Frame = 3
Query: 2724 GLY--GEGCSKEC--QCIYGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFG 3338
            G Y   + C  EC  QC++G C      C+C PGW G  C + CD  ++G  C  +C+C NG  C+     C C  G+ G  CE+ C    YG  C+ RCQCHNG  CD ++G+C C PG+ G  C+E CP  ++G  C   C C NGG CH   G C CPAG  G VC   CPP KYG +C   C C    +CD  +G+C C     G
Sbjct:   99 GFYENADACLPECTSQCVHGRCV-APDTCQCEPGWGGTDCSSGCDIEHWGPHCSNRCQCRNGARCNPITGACVCAAGFQGWRCEEPCPTATYGLGCQLRCQCHNGATCDHVTGECHCPPGFTGAFCEEVCPPGSHGAQCELRCPCQNGGVCHHVTGECSCPAGWMGFVCGQPCPPSKYGIHCSQECQCHNGGQCDHISGQCHCTAGFSG 306          

HSP 2 Score: 144.436 bits (363), Expect = 3.687e-38
Identity = 83/182 (45.60%), Postives = 104/182 (57.14%), Query Frame = 3
Query: 2670 CICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGD 3212
            C C  G+ G  CS  C    +G  CS  CQC  G  C+PI+G C C  G+ G  CE PC    YG  C+ +C+C NG TCD    +C C PG+ G FCE+ C  G +G  CE RC C NGG+C  ++G+C C  GW G  C + CP   YG +C+Q CQC NGG+C   +G C C AG  GD
Sbjct:  126 CQCEPGWGGTDCSSGCDIEHWGPHCSNRCQCRNGARCNPITGACVCAAGFQGWRCEEPCPTATYGLGCQLRCQCHNGATCDHVTGECHCPPGFTGAFCEEVCPPGSHGAQCELRCPCQNGGVCHHVTGECSCPAGWMGFVCGQPCPPSKYGIHCSQECQCHNGGQCDHISGQCHCTAGFSGD 307          

HSP 3 Score: 132.88 bits (333), Expect = 3.373e-34
Identity = 76/181 (41.99%), Postives = 94/181 (51.93%), Query Frame = 3
Query: 2925 CQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKES-DCRQDCQCSIKKSCNQVTGKCQCKPGLRG 3464
            CQCEPGW G  C   C + ++G +C  RCQC NG  C+ I+G C C  G++G  C+E CP+ TYG  C   CQC NG  C    G C CP G  G  CE  CPP  +G  C   C C+    C   TGEC+CP    G  C      SK    C Q+CQC     C+ ++G+C C  G  G
Sbjct:  126 CQCEPGWGGTDCSSGCDIEHWGPHCSNRCQCRNGARCNPITGACVCAAGFQGWRCEEPCPTATYGLGCQLRCQCHNGATCDHVTGECHCPPGFTGAFCEEVCPPGSHGAQCELRCPCQNGGVCHHVTGECSCPAGWMGFVCGQPCPPSKYGIHCSQECQCHNGGQCDHISGQCHCTAGFSG 306          

HSP 4 Score: 131.724 bits (330), Expect = 7.361e-34
Identity = 72/162 (44.44%), Postives = 89/162 (54.94%), Query Frame = 3
Query: 2598 KWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRG 3080
             WGP C+  C C     C+ I G C+C AG+ G +C + CP   YG GC   CQC  G  CD ++G C C PG+ G  CE  C  G +G QC+ +C C NGG C     +C C  GW G  C + C    YG +C   CQCHNGG CD ISG+C C  G+ G
Sbjct:  145 HWGPHCSNRCQCRNGARCNPITGACVCAAGFQGWRCEEPCPTATYGLGCQLRCQCHNGATCDHVTGECHCPPGFTGAFCEEVCPPGSHGAQCELRCPCQNGGVCHHVTGECSCPAGWMGFVCGQPCPPSKYGIHCSQECQCHNGGQCDHISGQCHCTAGFSG 306          

HSP 5 Score: 123.25 bits (308), Expect = 7.513e-31
Identity = 68/182 (37.36%), Postives = 98/182 (53.85%), Query Frame = 3
Query: 3438 CQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSG 3983
            CQC+PG  G  C   C+  ++G  C  +C+C NG  CNP+ G C+C +GF G  C++ C    YG  C+L+C  C+   TC   TG+C C  G     C+  CP G +G  C+  C C +G  C+  TG C C +G+ G +C   CP + YG +C   C+C +   C+ ++G C C    SG
Sbjct:  126 CQCEPGWGGTDCSSGCDIEHWGPHCSNRCQCRNGARCNPITGACVCAAGFQGWRCEEPCPTATYGLGCQLRCQ-CHNGATCDHVTGECHCPPGFTGAFCEEVCPPGSHGAQCELRCPCQNGGVCHHVTGECSCPAGWMGFVCGQPCPPSKYGIHCSQECQCHNGGQCDHISGQCHCTAGFSG 306          

HSP 6 Score: 101.679 bits (252), Expect = 1.463e-23
Identity = 70/186 (37.63%), Postives = 91/186 (48.92%), Query Frame = 3
Query: 2151 CKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPK 2702
            C+C+ G+ G +C   CD  ++G  CS  C       CN  TG C      G     C+  CPT   G  C+  C C  N  +C+   G CHC PGFTG  CE  C  G +G +C+  C C+   +C HVTG C C     G    + CP  K+G  C+Q C C     CD I+GQC C AG+ G +
Sbjct:  126 CQCEPGWGGTDCSSGCDIEHWGPHCSNRCQCRNGARCNPITGAC--VCAAGFQGWRCEEPCPTATYGLGCQLRCQC-HNGATCDHVTGECHCPPGFTGAFCEEVCPPGSHGAQCELRCPCQNGGVCHHVTGECSCPAGWMGFVCGQPCPPSKYGIHCSQECQCHNGGQCDHISGQCHCTAGFSGDR 308          

HSP 7 Score: 97.8265 bits (242), Expect = 2.873e-22
Identity = 69/189 (36.51%), Postives = 88/189 (46.56%), Query Frame = 3
Query: 1884 CNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKR 2450
            C C PG  G  C  GC    +G +C   C    +  RC+ ITG C+C  G+ G  C   CPT T+G+GC   C C+  N   CD   G+C C  G+ G  C   C PG  G  C   CP     +C+H TG+C      G     C + CP    G  C + C C  N   C+  +G CHC  GF+G R
Sbjct:  126 CQCEPGWGGTDCSSGCDIEHWGPHCSNRCQCR-NGARCNPITGACVCAAGFQGWRCEEPCPTATYGLGCQLRCQCH--NGATCDHVTGECHCPPGFTGAFCEEVCPPGSHGAQCELRCPCQNGGVCHHVTGECSCPA--GWMGFVCGQPCPPSKYGIHCSQECQC-HNGGQCDHISGQCHCTAGFSGDR 308          

HSP 8 Score: 97.4413 bits (241), Expect = 4.465e-22
Identity = 59/143 (41.26%), Postives = 75/143 (52.45%), Query Frame = 3
Query: 3564 TCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFC 3992
            TC C  G+ G  C   C    +GP+C  +C  C     C+P TG C C AG   + C+  CP+  YG  CQ  CQC +GA+C+  TG C C  GF GA C+  CP   +GA C+ RC C +   C+ VTG C CP    G  C
Sbjct:  125 TCQCEPGWGGTDCSSGCDIEHWGPHCSNRCQ-CRNGARCNPITGACVCAAGFQGWRCEEPCPTATYGLGCQLRCQCHNGATCDHVTGECHCPPGFTGAFCEEVCPPGSHGAQCELRCPCQNGGVCHHVTGECSCPAGWMGFVC 266          

HSP 9 Score: 94.3597 bits (233), Expect = 4.153e-21
Identity = 81/275 (29.45%), Postives = 111/275 (40.36%), Query Frame = 3
Query: 1437 SYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKT----------------CQNQNTRGSSLQKDPRRCPKGTFGEECLFNCS------------NCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHG 2177
            SY  T    Y    +++      + L++     +KC     SYR     G       K+                C +Q   G  +  D  +C  G  G +C   C              C +   CN     C+C   + G  CE  C      + CQ L+C C NG TC+  T +C+CPPG +G  CE  C  G  G  CE  CP   +   CH +TG+C C  GW G  C   CP   +GI CS+ C C  +N   CD  +G+C C  G+ G
Sbjct:   41 SYAVTVQESYAHPFDQVYYTSCSDILNW-----FKCTRHRISYRTAYRRGARTMYRRKSQCCPGFYENADACLPECTSQCVHGRCVAPDTCQCEPGWGGTDCSSGCDIEHWGPHCSNRCQCRNGARCNPITGACVCAAGFQGWRCEEPCPTATYGLGCQ-LRCQCHNGATCDHVTGECHCPPGFTGAFCEEVCPPGSHGAQCELRCPCQ-NGGVCHHVTGECSCPAGWMGFVCGQPCPPSKYGIHCSQECQC--HNGGQCDHISGQCHCTAGFSG 306          

HSP 10 Score: 87.0409 bits (214), Expect = 1.157e-18
Identity = 47/99 (47.47%), Postives = 57/99 (57.58%), Query Frame = 3
Query: 3699 CSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCE 3995
            C CE G    DC   C   ++GP C   CQC +GA CNP TGAC C +GF G  C+  CP   YG  CQ RC+C + + C+ VTG C CP   +G FCE
Sbjct:  126 CQCEPGWGGTDCSSGCDIEHWGPHCSNRCQCRNGARCNPITGACVCAAGFQGWRCEEPCPTATYGLGCQLRCQCHNGATCDHVTGECHCPPGFTGAFCE 224          

HSP 11 Score: 48.9062 bits (115), Expect = 5.030e-6
Identity = 63/223 (28.25%), Postives = 88/223 (39.46%), Query Frame = 3
Query: 1308 RAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLR------KNKMTCEDIDECLDYTGGC-------GYKC-----VNTDG---SYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGE 1913
            R    C PGF   AD        +CV G+  CV P TC  + G     C  G  +        N+  C +   C   TG C       G++C       T G     RC C NG T   D+ T +     G +       CP G+ G +C   C  C + G C+     C C   + G +C   C  +   + C   +C C NGG C+  + +C+C  G SG+
Sbjct:   91 RRKSQCCPGFYENADACLPECTSQCVHGR--CVAPDTCQCEPGWGGTDCSSGCDIEHWGPHCSNRCQCRNGARCNPITGACVCAAGFQGWRCEEPCPTATYGLGCQLRCQCHNGATC--DHVTGECHCPPGFTGAFCEEVCPPGSHGAQCELRCP-CQNGGVCHHVTGECSCPAGWMGFVCGQPCPPSKYGIHCS-QECQCHNGGQCDHISGQCHCTAGFSGD 307          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Nematostella
Match: EDO38318 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD81])

HSP 1 Score: 426.787 bits (1096), Expect = 2.099e-131
Identity = 276/719 (38.39%), Postives = 367/719 (51.04%), Query Frame = 3
Query: 1896 PGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNG--ICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCAD-------VAFGKC-EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN---CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKES-DCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKT-----CHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCE 3995
            PG SG  C   C  G++G  C + C    +   C + TG C C  GW G  C   CP  TWG GC++ CSC+ +    CD   G+C C  G++G  C  +C  G +G +CS++C       C+   G C D    G   + C++ C  G  G DC   C C  N   C+  +G  +C C+PG+TG  C   C   L+G  C   C C     C+ VTG C C D           +C + C    WGP C   C C+ +  CD  +G+C C  G+ G +C  RCP+G YG  CS  C C   N   CD  SG C CNPGW G  C  PC  G +G  C  KC C+NG +C+    KC C  G+HG+ C ++C+VGY+GR C+ +CQC +G  CD ++G C+C+PGW G  CD+ CPS TYG NC   C C+NG  C+  +G C C AG HG+ C+  CP  K+G NC   C+C     C+  TG C+C     G SC       +   +C   CQC   +SC++ +GKC C PG +G  C Q+C  G +G +C   C CAN   C+ V G+C C  G+TG  C   C  G YG  C   C  C+ +KT     C   TGQC+C  G +   C+ +CP G YGP C   C C++GA C+  TG C C  G+ G  C   C    +G  C  RC C + + C+  TG C C     G  C 
Sbjct:    2 PGYSGPTCIDECPTGYYGYECTQKCQCV-NGASCDRRTGSCNCTVGWIGKFCQQTCPHNTWGEGCARNCSCSASALM-CDRMTGECICPPGWYGRYCKEECPRGIYGRNCSYTCQCAYNQTCSKRDGLC-DCRVPGVTGVTCRQPCRAGFFGIDCNHKCPC-MNGAECDRVSGKCVCSCSPGWTGPFCSKPCPPSLWGHNCAHPCNCTNGARCNAVTGQCACTDGCSCNAGWTGPECRDPCGLDSWGPGCTNTCQCSRNGECDAASGRCACAPGFTGDRCESRCPKGYYGTNCSNACTCKATNTNVCDVTSGFCHCNPGWSGRSCYQPCPGGSWGVNCSSKCDCINGSSCNAATGKCVCLDGYHGDSCLEACSVGYFGRQCQSKCQCLHG-YCDHVTGSCECLPGWTGKRCDQACPSGTYGFNCTLPCACVNG-SCNATDGSCNCAAGYHGNACDRPCPAGKHGANCGLKCLCANNGTCNAITGRCSCGTGWTGPSCNASCSAGRYGINCVARCQC---ESCDRFSGKCHCPPGYQGHTCSQVCPKGFYGSECIHPCPCANNGTCDHVTGSCTCRPGWTGKSCKDPCPAGRYGMMCASSCR-CDPSKTDVKKPCDHVTGQCNCRPGYVGVLCENRCPQGTYGPGCHNNCTCLNGAQCDHVTGTCTCPVGYKGKYCDVICDKGTFGPGCTQRCLCENGAKCDRKTGACTCAPGFEGLRCS 710          

HSP 2 Score: 402.519 bits (1033), Expect = 1.587e-122
Identity = 299/886 (33.75%), Postives = 397/886 (44.81%), Query Frame = 3
Query: 1764 PNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCK-KGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCP------------------------------------TGGSGSDCR-------------KTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDR--LCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGNCDPISGICRCNPGW------------------------------------------HGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEK-----CDLKTGECTCPKSAFGLSCEIK-NCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRN-KTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQAC-QCMHG--ASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRC-KCFHNSPCNPVTGHCVCPKKLSGRFCEVSVINRLKLSFI*IFSLEQ*IITSKQI---FIIYS 4091
            P YSG  C  +C       EC   +C C NG +C+  T  CNC  G  G+ C+  C    +GE C +NC  + S+  C ++TG+C+C PGWYG  C   CP G +G  CS TC C  N  + C  ++G C C+  G  GV C   C  G+FG+DC+  CP      C+  +G+C      G     C + CP                                     G +G +CR              TC CS N   C+  +G C CAPGFTG RCE +C KG YG  C ++C C+     +CD  +G C+C     G+   + CP G WG  C+  CDC   + C+   G+C+CL GY+G  C + C  G +G  C  +CQC++G CD ++G C C PGW                                          HG  C+ PC  G +G  C  KC C N GTC+    +C C  GW G  C  SC+ G YG NC  RCQC +   CD  SGKC C PG++G  C + CP   YG  C   C C N G C    G C C  G  G  C+  CP  +YG  C  +C C  ++      CD  TG+C C     G+ CE +    +    C  +C C     C+ VTG C C  G +G  C  +C+ G FG  C Q+C C NG  C+   G C C  GF G+ C + C +G YG NC   C    RN + C    G C C  G     C   C  G+YG  C+  C  C     A+CN   G C C +GFYG  C   C + +YG  C   C  C   S C+ V G C+  +   G F  + V+   +L  I +   +  +   + +   F IYS
Sbjct:    2 PGYSGPTCIDECPTGYYGYECT-QKCQCVNGASCDRRTGSCNCTVGWIGKFCQQTCPHNTWGEGCARNCSCSASALMCDRMTGECICPPGWYGRYCKEECPRGIYGRNCSYTCQCAYN--QTCSKRDGLCDCRVPGVTGVTCRQPCRAGFFGIDCNHKCPCMNGAECDRVSGKCVCSCSPGWTGPFCSKPCPPSLWGHNCAHPCNCTNGARCNAVTGQCACTDGCSCNAGWTGPECRDPCGLDSWGPGCTNTCQCSRNG-ECDAASGRCACAPGFTGDRCESRCPKGYYGTNCSNACTCKATNTNVCDVTSGFCHCNPGWSGRSCYQPCPGGSWGVNCSSKCDCINGSSCNAATGKCVCLDGYHGDSCLEACSVGYFGRQCQSKCQCLHGYCDHVTGSCECLPGWTGKRCDQACPSGTYGFNCTLPCACVNGSCNATDGSCNCAAGYHGNACDRPCPAGKHGANCGLKCLCANNGTCNAITGRCSCGTGWTGPSCNASCSAGRYGINCVARCQCES---CDRFSGKCHCPPGYQGHTCSQVCPKGFYGSECIHPCPCANNGTCDHVTGSCTCRPGWTGKSCKDPCPAGRYGMMCASSCRCDPSKTDVKKPCDHVTGQCNCRPGYVGVLCENRCPQGTYGPGCHNNCTCLNGAQCDHVTGTCTCPVGYKGKYCDVICDKGTFGPGCTQRCLCENGAKCDRKTGACTCAPGFEGLRCSRPCLEGRYGGNCTKICDCNPRNTRRCDNVDGNCLCTLGYTPPRCDKLCQDGFYGQDCRMRCPDCSRHVIAACNKHHGNCTCAAGFYGYQCYDPCESGYYGVGCASMCTTCSVTSLCDHVHGTCI--RYTHGLF-HIVVMEDFELFSIRVRQRDLRLGLERLMETYFDIYS 877          

HSP 3 Score: 199.134 bits (505), Expect = 3.023e-52
Identity = 239/824 (29.00%), Postives = 332/824 (40.29%), Query Frame = 3
Query:  543 NAKCICPKGFLGTFCDKD-------LXXXXXXXXXXXXXXXXIDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSH--------ECVNLPGGFRCQCPPDMILGPDRINCIPFI------HPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNG--GCSHLCQ----SDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNG-GCQHICLNV--EGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSC-----PEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFG-KC-EACPSGKWGPTCNQNCDCT--YSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKEC----QCIYGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCK 2885
              +CICP G+ G +C ++        N          + C   DG   C+ P        G  C           DC+H        EC  + G   C C P          C P +      HPC+  N   C       + +   C+C DG   +         D C  ++   GC++ CQ     +  ++   C C PG+  D  + +  K     N  N   C+    NV    S  C C+PGW      +SCY+       PC  G+ G         N  + C C+ G    A    C     C+ G H             S L  C VGY  R+    C+   +CL      GY C +  GS  C+                    G + ++  + CP GT+G  C   C+ C++ G CN     C C   Y G  C+  C        C  L+C C N GTC + T +C+C  G +G  C   C+ G +G NC       C    C + +GKC C PG+ G +C  +CP G +G  C   C C  N    CD   G C C+ G+ G +C   C  G +G+ C+ SC       D K  C+H TGQC  +   G   + C+  CP G  G  C   C C  N   C+   G C C  G+ GK C++ C KG +G  C   C C     CD  TG C CA    G +C   C  G++G  C + CDC    +  CD ++G C+C  GY  P+C K C +G YG+ C   C    + +   C+   G C C  G++G  C +PC+ GYYG  C   C 
Sbjct:   82 TGECICPPGWYGRYCKEECPRGIYGRNCSYTCQCAYNQTCSKRDGLCDCRVP-----GVTGVTCRQPCRAGFFGIDCNHKCPCMNGAECDRVSGKCVCSCSPGWTGPFCSKPCPPSLWGHNCAHPCNCTNGARC-------NAVTGQCACTDGCSCNAGWTGPECRDPCGLDSWGPGCTNTCQCSRNGECDAASGRCACAPGFTGDRCESRCPKGYYGTNCSNACTCKATNTNVCDVTSGFCHCNPGWS----GRSCYQ-------PCPGGSWG--------VNCSSKCDCINGSSCNAATGKCV----CLDGYHG-----------DSCLEACSVGYFGRQ----CQSKCQCLH-----GY-CDHVTGSCECL-------------------PGWTGKRCDQACPSGTYGFNCTLPCA-CVN-GSCNATDGSCNCAAGYHGNACDRPCPAGKHGANCG-LKCLCANNGTCNAITGRCSCGTGWTGPSCNASCSAGRYGINCVAR----CQCESCDRFSGKCHCPPGYQGHTCSQVCPKGFYGSECIHPCPCANNGT--CDHVTGSCTCRPGWTGKSCKDPCPAGRYGMMCASSCRCDPSKTDVKKPCDHVTGQCNCR--PGYVGVLCENRCPQGTYGPGCHNNCTC-LNGAQCDHVTGTCTCPVGYKGKYCDVICDKGTFGPGCTQRCLCENGAKCDRKTGACTCAPGFEGLRCSRPCLEGRYGGNCTKICDCNPRNTRRCDNVDGNCLCTLGYTPPRCDKLCQDGFYGQDCRMRCPDCSRHVIAACNKHHGNCTCAAGFYGYQCYDPCESGYYGVGCASMCT 818          

HSP 4 Score: 188.348 bits (477), Expect = 7.412e-49
Identity = 124/324 (38.27%), Postives = 163/324 (50.31%), Query Frame = 3
Query: 3063 MPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATE-KCDLKTGECTCPKSAFGLSCEIKNCDS--KESDCRQDCQCSIKKSCNQVTGKCQCK-PGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCL--CLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQ------CSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKC--FHNSPCNPVTGHCVCPKKLSGRFC 3992
            MPG+ G  C + CP+  YG  C Q CQC+NG  C    G C C  G  G  C+ TCP + +G  C  NC C A+   CD  TGEC CP   +G  C+ + C       +C   CQC+  ++C++  G C C+ PG+ G  C Q C  G FG+DC  KC C NG  C+ V G C+  C  G+TG  C + C    +G NC   C  C     C+  TGQ      CSC AG    +C+  C    +GP C   CQC     C+ ++G C C  GF G  C+ RCP  +YG NC + C C   + + C+  +G C C    SGR C
Sbjct:    1 MPGYSGPTCIDECPTGYYGYECTQKCQCVNGASCDRRTGSCNCTVGWIGKFCQQTCPHNTWGEGCARNCSCSASALMCDRMTGECICPPGWYGRYCK-EECPRGIYGRNCSYTCQCAYNQTCSKRDGLCDCRVPGVTGVTCRQPCRAGFFGIDCNHKCPCMNGAECDRVSGKCVCSCSPGWTGPFCSKPCPPSLWGHNCAHPC-NCTNGARCNAVTGQCACTDGCSCNAGWTGPECRDPCGLDSWGPGCTNTCQCSRNGECDAASGRCACAPGFTGDRCESRCPKGYYGTNCSNACTCKATNTNVCDVTSGFCHCNPGWSGRSC 322          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Nematostella
Match: EDO45543 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSD3])

HSP 1 Score: 185.267 bits (469), Expect = 5.228e-50
Identity = 125/345 (36.23%), Postives = 172/345 (49.86%), Query Frame = 3
Query:  654 GGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPK--GTF 1682
            G F C C  GY +  + K+C+D++EC      C+  C N+PG F C C     LG DR +C+  I  C S     C   C   S   + CSC  G  L  D RSC  +D C  N   C+H C +   S   +C C  G+ +D+ D + C DI+EC+     C   C NV GS+ C C PG+ +  + +SC  +     D C  G   C Q C + P     C+C  G++L  D   C D DEC TGKH+C     C N +G+Y C+C  G+ L  ++  C D+DEC+  +  C  +CVNT GSY+C C  G  L  DN  C + N   SS++   + C    GTF
Sbjct:   42 GSFICSCWTGYILGSDYKSCVDVDECSSGIAQCNQTCANIPGSFTCSCGNGYFLGSDRTSCLD-IDEC-STRVSQCNQTCNN-SLGSYTCSCRSGFSLASDGRSCKDLDECSINTHRCNHTCINTIGS--YSCSCNTGFFLDL-DQRNCLDIDECSSNLHICNQTCNNVPGSYYCTCFPGFYLMMEDQSCVDI-----DECAAGFHQCNQNCQNIPGSYN-CTCGLGYQLAYDKKNCLDIDECATGKHQCAQ--NCTNIIGNYSCSCTTGFELAVDQTNCVDVDECVTRSHKCFQQCVNTRGSYKCSCNPGFVLASDNFGCLDINECKSSIKYCSQGCKNLYGTF 372          

HSP 2 Score: 165.236 bits (417), Expect = 3.075e-43
Identity = 113/323 (34.98%), Postives = 154/323 (47.68%), Query Frame = 3
Query:  648 IDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTC 1616
            I G F C C  GY +  +  +C+DI+EC    + C+  C N  G + C C     L  D  +C   +  C S N   C H C+  +   + CSC  G  LD D+R+C  +D C  N   C+  C + P S    C C PG+ + + D + C DI+EC      C   C N+ GS+ C C  G+Q+ +D K+C  +     D C  G   C Q C +     + CSC  GF+L  D   C D DECVT  HKC     C+N  GSY C+C  G+ L  +   C DI+EC      C   C N  G++ C C  G  L  D +TC
Sbjct:   81 IPGSFTCSCGNGYFLGSDRTSCLDIDECSTRVSQCNQTCNNSLGSYTCSCRSGFSLASDGRSCKD-LDEC-SINTHRCNHTCIN-TIGSYSCSCNTGFFLDLDQRNCLDIDECSSNLHICNQTCNNVPGS--YYCTCFPGFYLMMED-QSCVDIDECAAGFHQCNQNCQNIPGSYNCTCGLGYQLAYDKKNCLDI-----DECATGKHQCAQNCTNIIGNYS-CSCTTGFELAVDQTNCVDVDECVTRSHKCFQQ--CVNTRGSYKCSCNPGFVLASDNFGCLDINECKSSIKYCSQGCKNLYGTFSCFCYRGYALDSDKRTC 389          

HSP 3 Score: 144.821 bits (364), Expect = 2.160e-36
Identity = 104/308 (33.77%), Postives = 146/308 (47.40%), Query Frame = 3
Query:  648 IDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRC 1571
            + G +YC C PG+ +    ++C+DI+EC      C+  C N+PG + C C     L  D+ NC+  I  C +  K  C  +C  +    + CSC  G  L  D+ +C  VD C   +  C   C +   S    C C PG+ +  +D   C DINEC      C   C N+ G+F C C+ G+ +  D ++C  V+      C  G  GC+Q CN++      C C  G+ L  D ++C D DEC T     V    C N  GSY C+C  GY+      +C D+DEC   T  C   CVN  GSY C
Sbjct:  204 VPGSYYCTCFPGFYLMMEDQSCVDIDECAAGFHQCNQNCQNIPGSYNCTCGLGYQLAYDKKNCLD-IDEC-ATGKHQCAQNCTNIIG-NYSCSCTTGFELAVDQTNCVDVDECVTRSHKCFQQCVNTRGS--YKCSCNPGFVL-ASDNFGCLDINECKSSIKYCSQGCKNLYGTFSCFCYRGYALDSDKRTCIDVE-----ECSSGAHGCSQICNNTQGSFH-CGCHQGYNLLDDLISCGDIDECATK----VCSHNCTNTPGSYRCSCFPGYQQGPKNDSCLDVDECSTSTHNCTQICVNQPGSYTC 495          

HSP 4 Score: 134.035 bits (336), Expect = 6.878e-33
Identity = 131/460 (28.48%), Postives = 187/460 (40.65%), Query Frame = 3
Query:  915 FICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQN---------------QNTRGS---------SLQKDPRRCPK----GTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPT----GTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKC 2198
            ++CSC  G+ L  D  +C  +D C  N   C   C +   S +  C C  GY +  +D K C D++EC+     C   C N+ GSF C C  G+ +G D  SC  +     D C      C Q CN+S      CSC  GF L +DG +C D DEC    H+C    TCIN +GSY C+C  G+ L  ++  C DIDEC      C   C N  GSY C C  G  L  ++++C +               QN  GS          L  D + C       T   +C  NC+N +           C C   +   + + +C+      EC      C         + KC+C PG        GC +    ++  K C   C +      T  C C+ G+   S    C       +   GCS+ C+  Q ++         C C +GY+ ++ L  C
Sbjct:    3 YVCSCVTGYYLGVDNTTCLDLDECSTNANNCEQRCTNSLGSFI--CSCWTGYILG-SDYKSCVDVDECSSGIAQCNQTCANIPGSFTCSCGNGYFLGSDRTSCLDI-----DECSTRVSQCNQTCNNSLGSYT-CSCRSGFSLASDGRSCKDLDECSINTHRC--NHTCINTIGSYSCSCNTGFFLDLDQRNCLDIDECSSNLHICNQTCNNVPGSYYCTCFPGFYLMMEDQSCVDIDECAAGFHQCNQNCQNIPGSYNCTCGLGYQLAYDKKNCLDIDECATGKHQCAQNCTNIIGN-------YSCSCTTGFELAVDQTNCVDVD---ECVTRSHKCFQQCVNTRGSYKCSCNPGFVLASDNFGCLDINECKSSIKYCSQGCKN---LYGTFSCFCYRGYALDSDKRTCIDVEECSSGAHGCSQICNNTQGSFH--------CGCHQGYNLLDDLISC 430          

HSP 5 Score: 89.3521 bits (220), Expect = 2.861e-18
Identity = 56/153 (36.60%), Postives = 81/153 (52.94%), Query Frame = 3
Query: 1164 GSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQN 1622
            GS++C C  G+ +G D+ +C  +     D C      C Q C +S     ICSC  G+ L +D  +C D DEC +G  +C    TC N  GS+ C+C  GY L  ++ +C DIDEC      C   C N+ GSY C C +G +L  D ++C++
Sbjct:    1 GSYVCSCVTGYYLGVDNTTCLDL-----DECSTNANNCEQRCTNSLGS-FICSCWTGYILGSDYKSCVDVDECSSGIAQC--NQTCANIPGSFTCSCGNGYFLGSDRTSCLDIDECSTRVSQCNQTCNNSLGSYTCSCRSGFSLASDGRSCKD 145          

HSP 6 Score: 60.8474 bits (146), Expect = 2.667e-9
Identity = 69/224 (30.80%), Postives = 95/224 (42.41%), Query Frame = 3
Query: 1434 GSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTI--CEIDCLQNPSQVECQ-----PLQC---HCKNGGTCESETLKCN--CPPGISGEICEIGCTEGFFGENCEKNCPTA--CSSN------RCHQITGK--CLCFPGWY 2039
            GSY+C+C  GY L  +  TC D+DEC      C  +C N+ GS+ C C  G  LG D K+C + +   S + +  + C          F CS C +  +   D+T CL     S  +  C   C  +     C       L      CK+   C   T +CN  C   I    C   C  GFF +  ++NC     CSSN       C+ + G   C CFPG+Y
Sbjct:    1 GSYVCSCVTGYYLGVDNTTCLDLDECSTNANNCEQRCTNSLGSFICSCWTGYILGSDYKSCVDVDECSSGIAQCNQTCANIPGS----FTCS-CGNGYFLGSDRTSCLDIDECSTRVSQCNQTCNNSLGSYTCSCRSGFSLASDGRSCKDLDECSINTHRCNHTCINTIGSYSCS--CNTGFFLDLDQRNCLDIDECSSNLHICNQTCNNVPGSYYCTCFPGFY 217          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Nematostella
Match: EDO44398 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVK5])

HSP 1 Score: 181.415 bits (459), Expect = 2.604e-46
Identity = 124/328 (37.80%), Postives = 161/328 (49.09%), Query Frame = 3
Query:  654 GGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINEC--NIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKL---EADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQN 1622
            G +YC C  G+ +S NG+ C D+NEC+     C  +CVN PG +RC+C        D +     I  C         H C   +   + C+C  G+    +R  C  +D C DNNGGC  LC +   S    CKC PGY       + C DI+EC  +   G C H C N  GSF C CH G+ +  D  +C  +     D C   NGGC Q C +SP   + C+C  G+           C D DEC +G H+C   +TC+N  G+Y C CP GYR   NK  C DIDEC      C  +CVNT+GSY C CP G  L  D + CQ+
Sbjct:  381 GSYYCTCNEGFVLSANGRRCRDVNECMMGGVKCDQKCVNTPGSYRCECYRGFRQSDDVLKKCIDIDECLEGLPD--CHKCTNTAG-SYYCTCDTGYKQVNNRTRCQDIDECMDNNGGCGQLCVNTAGS--YHCKCEPGYNATDAGARTCVDIDECAGHFGKGDCDHKCNNTAGSFKCSCHHGYALTDDGLTCQDI-----DECAVDNGGCHQKCVNSPGNFS-CACHDGYITAGRNGSDFICDDIDECASGIHQCEEGATCVNTPGNYSCLCPQGYRSDWNK--CVDIDECKQRM--CEKECVNTEGSYFCFCPPGYQLTDDKRHCQD 693          

HSP 2 Score: 138.272 bits (347), Expect = 7.042e-33
Identity = 111/329 (33.74%), Postives = 148/329 (44.98%), Query Frame = 3
Query:  723 NECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGC--THHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKC------VPPS---------------------------------TCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNG 1586
            N CI N   C   C+N P G  C C     L  D  +C             GC      ++ +    I S  + +I DK  +    VD C++NNGGC  LC + P S    C+CR GY +  ND K C ++NEC  +   C+ +C + +G + C+CH G+Q+G D  SC  V+ E   P  + +  C   C ++P     C+C  GF L A+G  C D +EC+ G  KC       P S                                  C N  GSY CTC  GY+   N+  C+DIDEC+D  GGCG  CVNT GSY C C  G
Sbjct:  198 NPCITNNGGCGQVCLNTPNGRICSCHHGYTLEFDEESCRGNTK---GRTATGCFFVKFTIQPNKRIHISSTTNVNISDKKSQ---YVDECQNNNGGCRDLCINTPGS--FMCQCRQGYVL-ANDNKTCINLNECATRKHRCEQLCRDTDGGYYCECHKGYQVGPDGMSCIDVN-ECLLPKSFHH--CDHSCVNTPGS-YYCTCNEGFVLSANGRRCRDVNECMMGGVKCDQKCVNTPGSYRCECYRGFRQSDDVLKKCIDIDECLEGLPDCHKCTNTAGSYYCTCDTGYKQVNNRTRCQDIDECMDNNGGCGQLCVNTAGSYHCKCEPG 513          

HSP 3 Score: 119.783 bits (299), Expect = 2.831e-27
Identity = 103/335 (30.75%), Postives = 146/335 (43.58%), Query Frame = 3
Query:  720 INECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVD--LCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHD-HKSCYKVDM-----------------------------------ELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGF-KLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDN 1607
            ++EC  N   C   C+N PG F CQC    +L  D   CI  ++ C +  K  C   C + +D  + C C  G+ +  D  SC  V+  L   +   C H C + P S    C C  G+ +  N  ++C+D+NEC +    C   C+N  GS+ C+C+ G++   D  K C  +D                                    +  D C   NGGC Q C ++      C C PG+   +A   TC D DEC     K      C N  GS+ C+C  GY L  + +TC+DIDEC    GGC  KCVN+ G++ C C +G      N
Sbjct:  278 VDECQNNNGGCRDLCINTPGSFMCQCRQGYVLANDNKTCIN-LNEC-ATRKHRCEQLC-RDTDGGYYCECHKGYQVGPDGMSCIDVNECLLPKSFHHCDHSCVNTPGS--YYCTCNEGFVLSANG-RRCRDVNECMMGGVKCDQKCVNTPGSYRCECYRGFRQSDDVLKKCIDIDECLEGLPDCHKCTNTAGSYYCTCDTGYKQVNNRTRCQDIDECMDNNGGCGQLCVNTAGSYH-CKCEPGYNATDAGARTCVDIDECAGHFGKGDCDHKCNNTAGSFKCSCHHGYALTDDGLTCQDIDECAVDNGGCHQKCVNSPGNFSCACHDGYITAGRN 605          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Nematostella
Match: EDO34683 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNM8])

HSP 1 Score: 166.777 bits (421), Expect = 2.739e-45
Identity = 121/343 (35.28%), Postives = 159/343 (46.36%), Query Frame = 3
Query:  666 CKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSP------------------NKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGS 1640
            C C  GY+++E+ K C DINEC      C H C N  G + C C    +LG DR  C       D  + GGC   C   +   + C C  G  ++ D+ +C+ ++ C  NNGGCSH C +        C C  G+ +  +  K C D NEC + NGGC+H C N  GS+ C C PG   G++    YK      + C   NGGC+Q C                       K   C C  G+KL  D  TCSD +EC      C     C N +GSY C+C  G+ L  ++ TC D+DECLD  GGC   C N  GSY+C C  G T+  D   C  +   G 
Sbjct:    8 CDCNKGYKLNEDKKTCSDINECHVYNGGCDHNCTNSIGSYDCSCRKGFLLGADRHTCNDVDECLD--DNGGCEQICHNRAG-SYKCECRVGFTMNADKHNCTDINECLVNNGGCSHGCVN--LVGRYYCSCPKGFEVGASG-KTCVDKNECLLANGGCEHYCQNTNGSYHCFCRPG---GYELYDTYKCRAPSPELCSNQNGGCSQRCIQHSKYCIWGKCFLSCLNDWMCTKFVECDCNKGYKLNEDKKTCSDINECHVYNGGC--DHNCTNSIGSYDCSCRKGFLLGADRHTCNDVDECLDDNGGCEQICHNRAGSYKCECRVGFTMNADKHNCTGEYPHGD 339          

HSP 2 Score: 126.716 bits (317), Expect = 1.535e-31
Identity = 92/259 (35.52%), Postives = 123/259 (47.49%), Query Frame = 3
Query:  654 GGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSV--VDLCKDNNGGCSHLCQSDPS-----------------SSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDE 1373
            G + C+C  G+ M+ +  NC DINEC+ N   CSH CVNL G + C CP    +G     C+   + C  AN GGC H+C + ++  + C C  G     D   C     +LC + NGGCS  C                      +  + C C  GY ++  D K C DINEC++ NGGC H C N  GS+ C C  G+ +G D  +C  VD  L D     NGGC Q C++       C C  GF + AD   C+ E
Sbjct:   86 GSYKCECRVGFTMNADKHNCTDINECLVNNGGCSHGCVNLVGRYYCSCPKGFEVGASGKTCVD-KNECLLAN-GGCEHYC-QNTNGSYHCFCRPGGYELYDTYKCRAPSPELCSNQNGGCSQRCIQHSKYCIWGKCFLSCLNDWMCTKFVECDCNKGYKLN-EDKKTCSDINECHVYNGGCDHNCTNSIGSYDCSCRKGFLLGADRHTCNDVDECLDD-----NGGCEQICHNRAGSYK-CECRVGFTMNADKHNCTGE 334          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Nematostella
Match: EDO39882 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8T1])

HSP 1 Score: 148.673 bits (374), Expect = 4.180e-40
Identity = 98/261 (37.55%), Postives = 136/261 (52.11%), Query Frame = 3
Query:  723 NECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDID 1505
            NEC+ N   CSH C+NL GG+ C CPP   L  D+  C   I+ C   N+GGC   C   S   + CSC +G++L++D R+C   D C+ N GGC   C +  SS    C CR GYA+   D+  C+D++EC+     C   C+N  GSF C C  G      + +C  V     + C+     C+Q C ++      C+C  GF L  DG TC D +EC    H C     C+N +GSY C C +GY+L +N  +CE +D
Sbjct:    3 NECLVNNGGCSHTCLNLIGGYSCLCPPGFELSLDKRTCTD-INEC-GYNRGGCGQICTN-SLGSYNCSCLNGYVLNEDLRTCKDADECRVNRGGCEFQCINTDSS--YYCTCRSGYALTA-DLHGCRDVDECSSVTHACPETCINTIGSFTCTCASGLIYNPVNNTCDDV-----NECQSSLNPCSQRCVNTRGS-LYCACSSGFLLLGDGFTCRDVNECSQSGHGC--EQHCMNTVGSYTCICELGYKLGQNGRSCERVD 249          

HSP 2 Score: 133.65 bits (335), Expect = 7.482e-35
Identity = 84/252 (33.33%), Postives = 125/252 (49.60%), Query Frame = 3
Query:  864 ANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQ 1619
             N GGC+H C+ L    + C CP G  L  D+R+C+ ++ C  N GGC  +C +   S    C C  GY ++  D++ CKD +EC +  GGC+  C+N + S+ C C  G+ +  D   C  VD      C      C + C ++      C+C  G        TC D +EC +  + C     C+N  GS  C C  G+ L  +  TC D++EC     GC   C+NT GSY C+C  G  LG++ ++C+
Sbjct:    7 VNNGGCSHTCLNLIG-GYSCLCPPGFELSLDKRTCTDINECGYNRGGCGQICTNSLGS--YNCSCLNGYVLN-EDLRTCKDADECRVNRGGCEFQCINTDSSYYCTCRSGYALTADLHGCRDVD-----ECSSVTHACPETCINTIGS-FTCTCASGLIYNPVNNTCDDVNECQSSLNPC--SQRCVNTRGSLYCACSSGFLLLGDGFTCRDVNECSQSGHGCEQHCMNTVGSYTCICELGYKLGQNGRSCE 246          

HSP 3 Score: 120.553 bits (301), Expect = 2.738e-30
Identity = 75/186 (40.32%), Postives = 95/186 (51.08%), Query Frame = 3
Query: 1110 NECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRC 1667
            NEC + NGGC H CLN+ G + C C PG+++  D ++C  +     + C Y  GGC Q C +S      CSCL G+ L  D  TC D DEC   +  C     CIN   SY CTC  GY L  +   C D+DEC   T  C   C+NT GS+ C C +G      N TC + N   SSL    +RC
Sbjct:    3 NECLVNNGGCSHTCLNLIGGYSCLCPPGFELSLDKRTCTDI-----NECGYNRGGCGQICTNSLGSYN-CSCLNGYVLNEDLRTCKDADECRVNRGGC--EFQCINTDSSYYCTCRSGYALTADLHGCRDVDECSSVTHACPETCINTIGSFTCTCASGLIYNPVNNTCDDVNECQSSLNPCSQRC 180          

HSP 4 Score: 108.227 bits (269), Expect = 4.672e-26
Identity = 79/244 (32.38%), Postives = 107/244 (43.85%), Query Frame = 3
Query:  648 IDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAID-VNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDED 1376
            + GG+ C CPPG+E+S + + C DINEC  NR  C   C N  G + C C    +L  D   C          N+GGC   C+  +D  + C+C  G+ L  D   C  VD C      C   C +   S   TC C  G   + VN+   C D+NEC      C   C+N  GS  C C  G+ +  D  +C  V     + C     GC Q C ++      C C  G+KL  +G +C   D
Sbjct:   19 LIGGYSCLCPPGFELSLDKRTCTDINECGYNRGGCGQICTNSLGSYNCSCLNGYVLNEDLRTCKDADEC--RVNRGGCEFQCIN-TDSSYYCTCRSGYALTADLHGCRDVDECSSVTHACPETCINTIGS--FTCTCASGLIYNPVNNT--CDDVNECQSSLNPCSQRCVNTRGSLYCACSSGFLLLGDGFTCRDV-----NECSQSGHGCEQHCMNTVGSYT-CICELGYKLGQNGRSCERVD 249          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Medaka
Match: megf6b (multiple EGF like domains 6 [Source:NCBI gene;Acc:101160063])

HSP 1 Score: 773.081 bits (1995), Expect = 0.000e+0
Identity = 504/1375 (36.65%), Postives = 684/1375 (49.75%), Query Frame = 3
Query:  156 IFFLTIQIIPKLSGAGSQK----LELGMPNVCEVEQRQMIRVRRTVEVPRSKEVKVWKANCRFKGDWCLVHENKSFVEKTETSQIQMVPSIKYECCEGYAELSGYRGCIPKPNCEERIGKYCQNGAFCYQSGYNAKCICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQ-------------------------------------------NQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCS------------------------------------------ENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK--CEACPSGKWGPTCNQNCDCTY-STGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN-CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKE--SDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCE 3995
            I F ++ I    +   + K    L+  MPNVC   +  ++  R+      ++ VKVWK  C  +  WC  +E ++          +       +CC G+ + +   GC+  P C   +   C NG  C + G    C CP GF G  C  D+NECEE NGGCE  CCN  G FYC+CP G +++E+G+ C DINEC  +   C H+CVN  G + C+C P   L  D   C+P +  C   N GGC H CV+ S   F C C   + L +D + C + + C + NGGC H C+ D   +   C C+ GY +   D + C+DI+EC  K   C H C N  GS+ C C+  +++G + K CY+++ME+ + C+  NGGC+  C  S +   +C+C  G++L+ D  TC D DEC  G+        C N  G Y C C  GYRL  +  +C+D+DECL   GGC + C NT GS++C C  G  LGKD  +C                                                R  S   +   C   TFG +C   C +C + G CN  +TGC C   ++G +C   C        C    C CKNG +C+  +  C CPPG+SG++C+ GC +G +G+ C K C  A  + RCH+  G CLC PG YG  CHL CP  T+G GCS  C C+Q N + C  ++G C CK GY G  C   C  G +G  C   C       C+H TG+C      G +S  C +DCP G  G+ C + C+C+                                          EN   C++ NG C+C PG+ G+ C+  C  G +GERCQ  C C  +  CD V+G C C     G    + C  G WG  C + C+C+     CD + GQC C AG+ G  C ++CP G++G  C  ECQC  G  CD +SG C C  GW G  CE PC +G+YG  C+++C C NGG+CD     C C  GW G FC  +C  G+YG  C   C C NGG+C   SG C C PGW G NC E C +  YG +C Q C C NG  C+  +G C C +G  G  CEL C   ++G +C   C C+   +CD +TG C+C     G  CE K C +      C + C C    SC+ VTG+CQC PG RG  C + C  G +G  C + C CA G  C+ V G C C +GFTG  C++ C  G +GPNC   C    +N+ CHP +G C C  G     C+  C  G YGP C+Q C+C +G  C+P TGAC+C +GF G  C   CP   YG +C     C   +  +PVTG CVC    +G+ C 
Sbjct:    8 ILFSSLLIFIYEANVFTHKIASNLQPYMPNVCTAREVALVAQRQPSVQAFTRMVKVWKQGCGGQA-WCAGYERRTAYYTAYRQVYRQDYQTVKKCCPGWTQQNDEAGCL-HPVCSYGV---CFNGGKC-REGSTQLCDCPAGFRGPSCQYDVNECEETNGGCEAVCCNTIGSFYCRCPAGQKLNEDGRTCQDINECQVHNGGCQHKCVNTMGSYHCECNPGSRLHVDGRTCLP-VRSCAIRN-GGCEHSCVQQSAANFRCRCKPDYELAEDGKHCMLQNPCANQNGGCMHECRVDGGKA--HCDCKVGYML-AEDGQTCEDIDECETKEDDCAHGCRNSPGSYTCICNAAYELGSNGKQCYRIEMEIVNSCENNNGGCSHHCQHSTSG-PVCTCNHGYRLDDDLKTCLDVDEC--GEQVSCCEQECTNYPGGYECYCSAGYRLNADGCSCDDVDECLAANGGCDHTCQNTAGSFQCFCLWGYRLGKDRLSCMPIEDAVEALSSGGAIELPRIRPQLVLLQEYGQALERYDDYEDDEGELRAESNLAEKFLCLDDTFGSDCSLTCDDCTNGGECNAWKTGCECPDGWTGIVCNQSCPGGYFGKNCS-FPCKCKNGASCDPISGGCRCPPGVSGDLCQEGCPKGLYGKLCNKKCNCA-YNGRCHRTYGACLCDPGLYGRFCHLPCPKWTYGPGCSDECKCDQKNTQECHRRHGTCICKPGYQGNTCREACQSGTYGAGCEKQCACPSGVSCDHVTGRCQKTCHPGRHSENCDQDCPEGRFGAGCMQLCNCTGASCDKVTGQCLCPAGRMGQHCETSCTEGFWGPGCKEACPACENGGVCDKLNGSCNCPPGYMGRLCQSSCPTGRFGERCQLKCVCENNAHCDPVSGRCSCTPGWTGPHCSKVCDVGHWGADCAETCNCSNGDLSCDAVTGQCSCDAGFTGTHCQQKCPAGMFGPTCHHECQCKNGALCDHVSGACTCKAGWTGTFCEKPCPQGFYGLDCQQRCLCQNGGSCDHVSGVCSCPSGWIGRFCNLTCPAGFYGEACNQSCSCRNGGICHPASGGCLCSPGWTGPNCQEECSAGFYGADCQQRCLCQNGAACNKTDGACVCSSGWMGAACELECAAGRFGADCQQQCECENGGQCDRRTGRCSCSAGWLGERCE-KACGAGRFGVGCTERCHCGNGASCHHVTGECQCLPGWRGKHCHKACLPGTYGERCSRPCICARGASCHHVSGQCGCPAGFTGSGCEKTCLPGTFGPNCNQVCRCSEKNQLCHPVSGSCYCAPGFHGLKCEHVCAEGRYGPDCKQDCRCDNGGKCDPFTGACECPAGFIGPHCNTTCPAGRYGLHCAQVALCGVGTQSDPVTGRCVCLPGQTGKDCR 1365          

HSP 2 Score: 523.087 bits (1346), Expect = 6.051e-160
Identity = 394/1152 (34.20%), Postives = 530/1152 (46.01%), Query Frame = 3
Query:  654 GGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMR--FICSCPDGHILDK-DRRSCSVVDLCKDNNGGCSHLCQSDPSSS--VITCK-CRPGYAIDVNDVK-QCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYG------NGGCTQFCNSSPNKR-----AICSCLPGFKLEADGLTCSD-------EDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSN-RCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGK-CHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKES-DCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVSVINRL 4016
            GG+ C C  GY ++ +G +C D++EC+     C H C N  G F+C C     LG DR++C+P     ++ + GG     ++L  +R   +     G  L++ D       +L  ++N     LC  D   S   +TC  C  G   +      +C D     + N  C         SF C C  G         C        D C+ G         C + CN + N R       C C PG       L C          DEC     KC   +T         C C  GY+      TC +  +   Y  GC           +C CP+G +       CQ     G   +   + CP+G FG  C+  C NC     C+     CLC     G  CE  C +      C+     C+NGG C+     CNCPPG  G +C+  C  G FGE C+  C   C +N  C  ++G+C C PGW G  C  +C  G WG  C++TC+C+  +   CD   G+C C  G+ G +C  KC  G FG  C   C      +C+H +G C  K   G     C++ CP G  G DC++ C C +N  SC+  +G+C C  G+ G+ C L C  G YGE C  SC CR   +C   +G C C+    G    E C +G +G  C Q C C     C++ +G C+C +G+ G  C   C  G +G  C ++C+C  G  CD  +G C C+ GW GE CE  C  G +G  C E+C C NG +C     +CQC PGW G+ C K+C  G YG  C   C C  G  C  +SG+C C  G+ G  C++ C   T+GPNCNQVC+C    + CHP +G C C  G HG  CE  C   +YGP+C  +C C    KCD  TG C CP    G  C       +    C Q   C +    + VTG+C C PG  G  C Q C  G FG DC   C C+NG  C+   G C C  G+TG  CD  C  G +G +C LKC  C  N +C   TG C C  G     C+  CP G++G LCQ  C C +GASC+P +G C C  G++G  C   C    YG +C   C C   +PC+PVTG C+CP   +GR C++     L
Sbjct:  424 GGYECYCSAGYRLNADGCSCDDVDECLAANGGCDHTCQNTAGSFQCFCLWGYRLGKDRLSCMPIEDAVEALSSGGA----IELPRIRPQLVLLQEYGQALERYDDYEDDEGELRAESNLAEKFLCLDDTFGSDCSLTCDDCTNGGECNAWKTGCECPDGWTGIVCNQSCPGGYFGKNCSFPCKCKNGASCDPISGGCRCPPGVSGDLCQEGCPKGLYGKLCNKKCNCAYNGRCHRTYGACLCDPGLYGRFCHLPCPKWTYGPGCSDEC-----KCDQKNTQECHRRHGTCICKPGYQ----GNTCREACQSGTYGAGC---------EKQCACPSGVSCDHVTGRCQKTCHPGRHSENCDQDCPEGRFGAGCMQLC-NCT-GASCDKVTGQCLCPAGRMGQHCETSCTEGFWGPGCKEACPACENGGVCDKLNGSCNCPPGYMGRLCQSSCPTGRFGERCQLKC--VCENNAHCDPVSGRCSCTPGWTGPHCSKVCDVGHWGADCAETCNCSNGDLS-CDAVTGQCSCDAGFTGTHCQQKCPAGMFGPTCHHECQCKNGALCDHVSGACTCKA--GWTGTFCEKPCPQGFYGLDCQQRCLC-QNGGSCDHVSGVCSCPSGWIGRFCNLTCPAGFYGEACNQSCSCRNGGICHPASGGCLCSPGWTGPNCQEECSAGFYGADCQQRCLCQNGAACNKTDGACVCSSGWMGAACELECAAGRFGADCQQQCECENGGQCDRRTGRCSCSAGWLGERCEKACGAGRFGVGCTERCHCGNGASCHHVTGECQCLPGWRGKHCHKACLPGTYGERCSRPCICARGASCHHVSGQCGCPAGFTGSGCEKTCLPGTFGPNCNQVCRCSEKNQLCHPVSGSCYCAPGFHGLKCEHVCAEGRYGPDCKQDCRCDNGGKCDPFTGACECPAGFIGPHCNTTCPAGRYGLHCAQVALCGVGTQSDPVTGRCVCLPGQTGKDCRQGCPAGWFGADCASFCNCSNGGVCDSATGNCTCALGWTGEHCDTECPAGRFGADCALKC-NCQNNGSCDRVTGTCRCGPGYYGGLCEHACPPGFHGALCQLQCDCENGASCHPVSGRCICPPGYHGGHCHRVCEQGSYGQDCAKVCDCEDAAPCDPVTGRCICPSGKTGRRCDIDCRADL 1544          

HSP 3 Score: 391.734 bits (1005), Expect = 4.598e-113
Identity = 274/770 (35.58%), Postives = 376/770 (48.83%), Query Frame = 3
Query: 1446 CTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTG-CLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN--CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIK-NCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCK 3737
            C CP GY  R  + +C         TG  G +C       +CVC N       +  C    T G +     + C  G +G +C   C NC +     D  TG C C   ++GT C+  C        C   +C CKNG  C+  +  C C  G +G  CE  C +GF+G +C++ C    +   C  ++G C C  GW G  C+L CP G +G  C+++CSC       C P +G C C  G+ G NC  +C  G++G DC   C       CN   G C   +  G     C+ +C  G  G+DC++ C+C EN   C+ + G C C+ G+ G+RCE  C  G +G  C   C C     C HVTG C C     GK   +AC  G +G  C++ C C     C  ++GQC C AG+ G  C K C  G +G  C++ C+C   N  C P+SG C C PG+HG  CE+ C EG YG  CK+ C+C NGG CD F   C+C  G+ G  C  +C  G YG +C     C  G   D ++G+C C+PG  G +C + CP+  +G +C   C C NGG C    G C C  G  G+ C+  CP  ++G +C   C C+    CD  TG C C    +G  CE         + C+  C C    SC+ V+G+C C PG  G  C ++CE G++G DC + C C +  PC+PV G C+C SG TG  CD  C    YGP+C   C  C     C P++G+C C    I   C+
Sbjct:  835 CNCPPGYMGRLCQSSCP--------TGRFGERC-----QLKCVCENNAHCDPVSGRCSC--TPGWTGPHCSKVCDVGHWGADCAETC-NCSNGDLSCDAVTGQCSCDAGFTGTHCQQKCPAGMFGPTCH-HECQCKNGALCDHVSGACTCKAGWTGTFCEKPCPQGFYGLDCQQRCLCQ-NGGSCDHVSGVCSCPSGWIGRFCNLTCPAGFYGEACNQSCSCRNGGI--CHPASGGCLCSPGWTGPNCQEECSAGFYGADCQQRCLCQNGAACNKTDGACVCSS--GWMGAACELECAAGRFGADCQQQCEC-ENGGQCDRRTGRCSCSAGWLGERCEKACGAGRFGVGCTERCHCGNGASCHHVTGECQCLPGWRGKHCHKACLPGTYGERCSRPCICARGASCHHVSGQCGCPAGFTGSGCEKTCLPGTFGPNCNQVCRCSEKNQLCHPVSGSCYCAPGFHGLKCEHVCAEGRYGPDCKQDCRCDNGGKCDPFTGACECPAGFIGPHCNTTCPAGRYGLHCAQVALCGVGTQSDPVTGRCVCLPGQTGKDCRQGCPAGWFGADCASFCNCSNGGVCDSATGNCTCALGWTGEHCDTECPAGRFGADCALKCNCQNNGSCDRVTGTCRCGPGYYGGLCEHACPPGFHGALCQLQCDCENGASCHPVSGRCICPPGYHGGHCHRVCEQGSYGQDCAKVCDCEDAAPCDPVTGRCICPSGKTGRRCDIDCRADLYGPDCSETC-TCQNQAQCDPRSGRCRCSHSWIGPSCQ 1580          

HSP 4 Score: 342.813 bits (878), Expect = 1.428e-96
Identity = 242/691 (35.02%), Postives = 314/691 (45.44%), Query Frame = 3
Query: 1551 TDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQC--------------------------------------------RKDRLCDHVTGICYCADVAFG-KCE-ACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN-CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIK-NCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQ 3479
             D +  C C NG+ L  D  T Q     G +     ++CP G FG  C   C  C +   C+     C C   ++GT CE  C Q    ++CQ  +C C+NGG+C+  +  C+CP G  G  C + C  GF+GE C ++C    +   CH  +G CLC PGW G +C   C  G +G  C + C C   N   C+  +G C C  G+ G  C  +C  G FG DC   C  +    C+  TG+C      G     C++ C  G  G  C + C C  N  SC    G C C PG+ GK C   C  G YGERC   C C                                             K++LC  V+G CYCA    G KCE  C  G++GP C Q+C C     CD   G C C AG+ GP C+  CP G YG  C++   C  G   DP++G C C PG  G+ C   C  G++G  C   C C NGG CD     C C  GW GE C+  C  G +G +C  +C C N G CD ++G C C PG+ G  C+  CP   +G  C   C C NG  CHP +G C CP G HG  C   C    YG +C   C C+    CD  TG C CP    G  C+I    D    DC + C C  +  C+  +G+C+C     GP C +
Sbjct:  900 ADCAETCNCSNGD-LSCDAVTGQCSCDAGFTGTHCQQKCPAGMFGPTCHHEC-QCKNGALCDHVSGACTCKAGWTGTFCEKPCPQGFYGLDCQ-QRCLCQNGGSCDHVSGVCSCPSGWIGRFCNLTCPAGFYGEACNQSCSCR-NGGICHPASGGCLCSPGWTGPNCQEECSAGFYGADCQQRCLCQ--NGAACNKTDGACVCSSGWMGAACELECAAGRFGADCQQQCECENGGQCDRRTGRCSCSA--GWLGERCEKACGAGRFGVGCTERCHCG-NGASCHHVTGECQCLPGWRGKHCHKACLPGTYGERCSRPCICARGASCHHVSGQCGCPAGFTGSGCEKTCLPGTFGPNCNQVCRCSEKNQLCHPVSGSCYCAPGFHGLKCEHVCAEGRYGPDCKQDCRCDNGGKCDPFTGACECPAGFIGPHCNTTCPAGRYGLHCAQVALCGVGTQSDPVTGRCVCLPGQTGKDCRQGCPAGWFGADCASFCNCSNGGVCDSATGNCTCALGWTGEHCDTECPAGRFGADCALKCNCQNNGSCDRVTGTCRCGPGYYGGLCEHACPPGFHGALCQLQCDCENGASCHPVSGRCICPPGYHGGHCHRVCEQGSYGQDCAKVCDCEDAAPCDPVTGRCICPSGKTGRRCDIDCRADLYGPDCSETCTCQNQAQCDPRSGRCRCSHSWIGPSCQE 1581          

HSP 5 Score: 341.658 bits (875), Expect = 3.206e-96
Identity = 252/735 (34.29%), Postives = 343/735 (46.67%), Query Frame = 3
Query: 1167 SFICDCHPGWQIGHDHKSC----YKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN-CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCE 3350
            S  C C PGW   H  K C    +  D   T  C  G+  C             CSC  GF        C       T  H+C   +  + D  S  CTC  G+        CE           C       D   RC+C NG +    +  C   +  G   +     CP G +GE C  +CS C + G C+    GCLC P ++G  C+ +C       +CQ  +C C+NG  C      C C  G  G  CE+ C  G FG +C++ C    +  +C + TG+C C  GW G  C   C  G +G+GC++ C C   N   C    G+C+C  G+ G +C   C PG +G  CS  C       C+H +GQC      G    GC++ C  G  G +C + C CSE +  C   +G C+CAPGF G +CE  C +G YG  C+  C+C     CD  TG C C     G      CP+G++G  C Q   C   T  D + G+C+CL G  G  C + CP G +G  C+  C C  G  CD  +G C C  GW GE C+  C  G +G  C  KC C N G+CD     C+C PG++G  CE +C  G++G  C+ +C C NG  C  +SG+C C PG+ G +C   C   +YG +C +VC C +   C P  G C CP+G+ G  C++ C  D YGP+C   C C+   +CD ++G C C  S  G SC+
Sbjct:  875 SGRCSCTPGWTGPHCSKVCDVGHWGADCAETCNCSNGDLSCDAV-------TGQCSCDAGFTGTHCQQKCPAGMFGPTCHHECQCKNGALCDHVSGACTCKAGW----TGTFCEKP---------CPQGFYGLDCQQRCLCQNGGSCDHVSGVCSCPS--GWIGRFCNLTCPAGFYGEACNQSCS-CRNGGICHPASGGCLCSPGWTGPNCQEECSAGFYGADCQ-QRCLCQNGAACNKTDGACVCSSGWMGAACELECAAGRFGADCQQQCECE-NGGQCDRRTGRCSCSAGWLGERCEKACGAGRFGVGCTERCHCG--NGASCHHVTGECQCLPGWRGKHCHKACLPGTYGERCSRPCICARGASCHHVSGQCGCPA--GFTGSGCEKTCLPGTFGPNCNQVCRCSEKNQLCHPVSGSCYCAPGFHGLKCEHVCAEGRYGPDCKQDCRCDNGGKCDPFTGACECPAGFIGPHCNTTCPAGRYGLHCAQVALCGVGTQSDPVTGRCVCLPGQTGKDCRQGCPAGWFGADCASFCNCSNGGVCDSATGNCTCALGWTGEHCDTECPAGRFGADCALKCNCQNNGSCDRVTGTCRCGPGYYGGLCEHACPPGFHGALCQLQCDCENGASCHPVSGRCICPPGYHGGHCHRVCEQGSYGQDCAKVCDCEDAAPCDPVTGRCICPSGKTGRRCDIDCRADLYGPDCSETCTCQNQAQCDPRSGRCRCSHSWIGPSCQ 1580          

HSP 6 Score: 249.595 bits (636), Expect = 1.124e-66
Identity = 185/522 (35.44%), Postives = 246/522 (47.13%), Query Frame = 3
Query: 1551 TDGSYRCVCPNGETLGKDNKTCQ-NQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK-CEA-CPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCP 3104
             D   RC+C NG    K +  C  +    G++ + +   C  G FG +C   C  C + G C+     C C   + G  CE  C      V C   +CHC NG +C   T +C C PG  G+ C   C  G +GE C + C  A     CH ++G+C C  G+ GS C   C  GT+G  C++ C C++ N + C P +G C C  G+HG+ C + C  G +G DC   C  D    C+  TG C      G     C   CP G  G  C +   C   + S +   G C C PG TGK C   C  G +G  C S C C    +CD  TG C CA    G+ C+  CP+G++G  C   C+C  +  CD++ G C C  GYYG  C   CP G +G  C  +C C  G +C P+SG C C PG+HG  C   C++G YG  C + C C +   CD    +C C  G  G  C+  C    YG +C   C C N   CD  SG+C C   W G +C E  P
Sbjct: 1073 ADCQQRCLCQNGAACNKTDGACVCSSGWMGAACELE---CAAGRFGADCQQQCE-CENGGQCDRRTGRCSCSAGWLGERCEKACGAGRFGVGCTE-RCHCGNGASCHHVTGECQCLPGWRGKHCHKACLPGTYGERCSRPCICA-RGASCHHVSGQCGCPAGFTGSGCEKTCLPGTFGPNCNQVCRCSEKN-QLCHPVSGSCYCAPGFHGLKCEHVCAEGRYGPDCKQDCRCDNGGKCDPFTGACECPA--GFIGPHCNTTCPAGRYGLHCAQVALCGVGTQS-DPVTGRCVCLPGQTGKDCRQGCPAGWFGADCASFCNCSNGGVCDSATGNCTCALGWTGEHCDTECPAGRFGADCALKCNCQNNGSCDRVTGTCRCGPGYYGGLCEHACPPGFHGALCQLQCDCENGASCHPVSGRCICPPGYHGGHCHRVCEQGSYGQDCAKVCDCEDAAPCDPVTGRCICPSGKTGRRCDIDCRADLYGPDCSETCTCQNQAQCDPRSGRCRCSHSWIGPSCQEGGP 1584          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Medaka
Match: zgc:158328 (multiple epidermal growth factor-like domains protein 6 [Source:NCBI gene;Acc:101169224])

HSP 1 Score: 741.495 bits (1913), Expect = 0.000e+0
Identity = 488/1352 (36.09%), Postives = 671/1352 (49.63%), Query Frame = 3
Query:  147 FAIIFFLTIQIIPKLSGAGSQKLELGMPNVCEVEQRQMIRVRRTVEVPRSKEVKVWKANCRFKGDWCLVHENKSFVEKTETSQIQMVPSIKYECCEGYAELSGYRGCIPKPNCEERIGKYCQNGAFCYQSGYNAKCICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQN---------------------------------------------------TRGSSLQKDPRRCPKGT-------------FGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK--CEACPSGKWGPTCNQNCDCT-YSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN-CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHN-GGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKES-DCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFC 3992
            F  IF   + +   +  A S +L+  MPNVC  ++  ++  R+      +  VKVWK  C     WC  +E ++    T      MV    YECC G+ +     GC    +   R G  C NG    ++G +  C+CP GF GT+C  D+NECE N GGCE +CCN  G +YCKC  G  +  +G++C D+NEC      C   C+N  G + C+C     +  D   CI  ++ C   N GGC H CV +    + C C   + L +D R C + + C+DNNGGC+ LC  +   +  +C C+ G+ +   D + C DI+EC+  +  C H C+N  GSF C CHPG+++G   K CY+++ME+ + C+  NGGC+  C  +     +CSC  G++L  D  TC D DEC + +  C     C N  G Y C+C  G  L  +   C+D+DECL  T GC + CVNT GSY+C CP G  L  D  +C + N                                                    R S    + +R P+G              FG++C  +C +C++ G C + +  C C P ++G IC   C +      C  L C C+NGG+C+  T +C CPPG+ G  CE GC  G+FG++C+  C    ++  CH++ G CLC PG+YG  CHL+CP  T G GCSK C C++ +  GCDPK G C CK  + G  C   C  G +G +C  +C E     C+H TGQC      G     CQ DCP G  G  C  +C   ENS SC +K G+C C  GF GKRC+ +C  G YG  C + C C  D  CD   G C+C     G      C  G WG +C   C C   S GCD ++G+C+C AGY G  C K C  G YG GCS+ CQC  G  CD +SG C C+PG+ G  CE  C +G+YG  C + C+C NG  C      C C  GW G  C   C  G +G+NC   CQC      C  ++G C C PG+ G  C+ RCP+ ++GP C   C C+NGG C    G C C  G  G  C   CP   YG NC+  C C    +C+  TG C C     G++C+      +    CR  C C     C+ V G C+C  G  GP+C   C  G +GL+C + C+C N   C+   G+C C +G+ G  C   C  G++G NC   C  C   + C   TG+C C  G     C+ +C +G +G  C Q C C   A C+P TG C C  G  G  C+  C  + +G +C  +C C H++ C+ V+G C+CP    G  C
Sbjct:    2 FQNIFVFCVNVFCLIYTASSLQLQHSMPNVCTDQKMFVLGKRQPCVHAFTHMVKVWKQGCTSH-LWCSRYERRTAYYMTYQQVYGMVLHTVYECCPGWTQKDDEMGCF---HTGMRNGDSCHNGGRFAETG-DRICLCPSGFKGTYCQYDVNECEFNKGGCEGQCCNTIGSYYCKCSEGSRLGSDGRSCDDVNECEEFNGGCQQTCINTAGSYHCECSKGFRMHTDGRTCIA-LNSCSILN-GGCEHKCVDMGPNHYKCECQRNYKLKRDGRHCELRNPCQDNNGGCAQLCHFNVGHA--SCSCQSGFRL-ARDGRNCADIDECSSGSARCSHGCVNTVGSFRCVCHPGFELGAGGKQCYRIEMEIVNSCEKNNGGCSHHCEHTTGG-PLCSCNHGYQLSHDRKTCIDSDECASEESCCT--HVCRNYPGGYDCSCRAGLTLNPDGCGCDDVDECLAETSGCEHYCVNTLGSYKCFCPKGFRLNHDKHSCISLNGEEELEEEEEEDKDEKQLELSRFQDLLLHGNPQLMHYTSALRSHPSVYDAGVRDSKEDVEMQRGPRGELMLDSHIVCLGGFFGDDCTLSCKDCVN-GECTESKDRCHCSPGWTGIICNKTCPKGTYGQACISL-CLCQNGGSCDPVTGRCLCPPGVEGRFCEEGCPRGYFGQHCKAKCKCP-NNGPCHRLHGACLCSPGFYGRFCHLVCPRWTHGAGCSKECDCDREHSAGCDPKTGSCFCKAEFQGPQCDRACQMGNYGENCGLTC-ECSGAPCDHITGQCLCPA--GKTGSSCQEDCPDGFWGLKCHYSCPICENSSSCNKKTGLCDCKSGFMGKRCQKECPAGYYGPGCMNPCYCPPDSRCDAQNGHCHCPPGKRGHDCVTLCEPGFWGQSCVNRCQCQGPSVGCDPVDGRCVCEAGYSGDLCEKSCVNGSYGPGCSQRCQCQNGALCDHVSGACTCSPGFTGTFCERICPDGFYGLDCGQMCECRNGARCHHITGACLCTAGWAGPHCILVCLAGTFGQNCSRLCQCTELHDWCHPVTGTCSCSPGYYGKRCELRCPAGSFGPGCKSRCSCINGGSCDSRTGACYCSPGYIGAYCSRRCPQGYYGRNCVKQCFCGEGGQCNPATGRCICGPGRMGMTCQQACPRGRYGPQCRNACSCQNGALCDPVDGSCKCGLGWIGPRCDTACSQGKYGLNCAEDCQCLNNGTCDRFTGSCSCAAGYYGFTCQHTCPSGYHGVNCSHACY-CKTGQDCDHVTGKCICAPGYHGPQCQRRCEAGRFGAGCAQLCDCADEAPCDPQTGRCLCPPGRTGQRCEKHCNGDHFGPDCSLQCHCSHSARCDGVSGRCMCPLNWIGPVC 1333          

HSP 2 Score: 339.347 bits (869), Expect = 8.421e-96
Identity = 221/567 (38.98%), Postives = 286/567 (50.44%), Query Frame = 3
Query: 2331 CPTGGSGSDCRKTC-DCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIY---GNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQ-CHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKA-TEKCDLKTGECTCPKSAFGLSCEIKNC--DSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVS 4001
            C  G  G DC  +C DC      C E    CHC+PG+TG  C   C KG YG+ C S C C+    CD VTG C C     G+   E CP G +G  C   C C  +  C +++G C+C  G+YG  C   CP   +G GCSKEC C       CDP +G C C   + G  C+  C  G YG+ C   C+C +G  CD    +C C  G  G  C++ C  G++G  C   C  C N   C+  +G CDC  G+ G  C + CP+  YGP C   C C    +C  +NG C CP G+ G  C   C P  +G +C++ C C+  +  CD   G C C     G  CE K+C   S    C Q CQC     C+ V+G C C PG  G  C ++C  G +GLDC Q C C NG  C+ + G CLC +G+ G  C  VC  G +G NC   C     +  CHP TG CSC  G     C+ +CP+G +GP C+  C C++G SC+  TGAC C  G+ GA C  RCP  +YG NC  +C C     CNP TG C+C     G  C+ +
Sbjct:  559 CLGGFFGDDCTLSCKDCVNGE--CTESKDRCHCSPGWTGIICNKTCPKGTYGQACISLCLCQNGGSCDPVTGRCLCPPGVEGRFCEEGCPRGYFGQHCKAKCKCPNNGPCHRLHGACLCSPGFYGRFCHLVCPRWTHGAGCSKECDCDREHSAGCDPKTGSCFCKAEFQGPQCDRACQMGNYGENCGLTCEC-SGAPCDHITGQCLCPAGKTGSSCQEDCPDGFWGLKCHYSCPICENSSSCNKKTGLCDCKSGFMGKRCQKECPAGYYGPGCMNPCYCPPDSRCDAQNGHCHCPPGKRGHDCVTLCEPGFWGQSCVNRCQCQGPSVGCDPVDGRCVCEAGYSGDLCE-KSCVNGSYGPGCSQRCQCQNGALCDHVSGACTCSPGFTGTFCERICPDGFYGLDCGQMCECRNGARCHHITGACLCTAGWAGPHCILVCLAGTFGQNCSRLCQCTELHDWCHPVTGTCSCSPGYYGKRCELRCPAGSFGPGCKSRCSCINGGSCDSRTGACYCSPGYIGAYCSRRCPQGYYGRNCVKQCFCGEGGQCNPATGRCICGPGRMGMTCQQA 1121          

HSP 3 Score: 330.487 bits (846), Expect = 8.377e-93
Identity = 226/610 (37.05%), Postives = 299/610 (49.02%), Query Frame = 3
Query: 2196 CDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDC--TYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCK-CLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGK-CHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKES-DCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCAN-GEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVS 4001
            C  G+FG DC+ SC +     C     +C      G   I C + CP G  G  C   C C +N  SC+   G C C PG  G+ CE  C +G +G+ C++ C+C  +  C  + G C C+   +G+     CP    G  C++ CDC   +S GCD   G C C A + GP+C + C  G YGE C   C+C    CD I+G C C  G  G  C+  C +G++G +C   C  C N  +C+     C C+ G+ G+ C+K C  GYYG  C   C C     CD  +G C C PG RG +C   C    +G +C   CQC      C P +G C C AG  GD+CE +C    YGP C   C C+    CD  +G CTC     G  CE    D     DC Q C+C     C+ +TG C C  G  GP C+ +C  G FG +C + C+C    + C+PV GTC C  G+ G  C+  C  G +GP CK +C  C    +C  +TG C C  G I   C  +CP GYYG  C + C C  G  CNP+TG C C  G  G  CQ  CP   YG  C++ C C + + C+PV G C C     G  C+ +
Sbjct:  559 CLGGFFGDDCTLSCKDCVNGECTESKDRC--HCSPGWTGIICNKTCPKGTYGQACISLCLC-QNGGSCDPVTGRCLCPPGVEGRFCEEGCPRGYFGQHCKAKCKCPNNGPCHRLHGACLCSPGFYGRFCHLVCPRWTHGAGCSKECDCDREHSAGCDPKTGSCFCKAEFQGPQCDRACQMGNYGENCGLTCECSGAPCDHITGQCLCPAGKTGSSCQEDCPDGFWGLKCHYSCPICENSSSCNKKTGLCDCKSGFMGKRCQKECPAGYYGPGCMNPCYCPPDSRCDAQNGHCHCPPGKRGHDCVTLCEPGFWGQSCVNRCQCQGPSVGCDPVDGRCVCEAGYSGDLCEKSCVNGSYGPGCSQRCQCQNGALCDHVSGACTCSPGFTGTFCERICPDGFYGLDCGQMCECRNGARCHHITGACLCTAGWAGPHCILVCLAGTFGQNCSRLCQCTELHDWCHPVTGTCSCSPGYYGKRCELRCPAGSFGPGCKSRC-SCINGGSCDSRTGACYCSPGYIGAYCSRRCPQGYYGRNCVKQCFCGEGGQCNPATGRCICGPGRMGMTCQQACPRGRYGPQCRNACSCQNGALCDPVDGSCKCGLGWIGPRCDTA 1164          

HSP 4 Score: 209.534 bits (532), Expect = 3.229e-54
Identity = 131/351 (37.32%), Postives = 180/351 (51.28%), Query Frame = 3
Query: 2970 CAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIK-NCDSKESDCRQDCQCSIKKS--CNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSP-CNPVTGHCVCPKKLSGRFCEVSVIN 4010
            C  G++G +C   C+    G C     +C C PGW GI C++ CP  TYG  C  +C C NGG C P  G C CP G  G  CE  CP   +G +C   C C     C    G C C    +G  C +     +  + C ++C C  + S  C+  TG C CK   +GPQC + C+ GN+G +C   C C+ G PC+ + G CLC +G TG  C + C  G++G  C   C +C  + +C+ +TG C C++G +   C+ +CP+GYYGP C   C C   + C+   G C C  G  G  C   C   F+G +C +RC+C   S  C+PV G CVC    SG  CE S +N
Sbjct:  559 CLGGFFGDDCTLSCKDCVNGECTESKDRCHCSPGWTGIICNKTCPKGTYGQACISLCLCQNGGSCDPVTGRCLCPPGVEGRFCEEGCPRGYFGQHCKAKCKCPNNGPCHRLHGACLCSPGFYGRFCHLVCPRWTHGAGCSKECDCDREHSAGCDPKTGSCFCKAEFQGPQCDRACQMGNYGENCGLTCECS-GAPCDHITGQCLCPAGKTGSSCQEDCPDGFWGLKCHYSCPICENSSSCNKKTGLCDCKSGFMGKRCQKECPAGYYGPGCMNPCYCPPDSRCDAQNGHCHCPPGKRGHDCVTLCEPGFWGQSCVNRCQCQGPSVGCDPVDGRCVCEAGYSGDLCEKSCVN 908          

HSP 5 Score: 90.1225 bits (222), Expect = 1.234e-17
Identity = 50/130 (38.46%), Postives = 67/130 (51.54%), Query Frame = 3
Query: 3609 VCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEV 3998
            VC  G++G +C L C  C  N  C     +C C  G     C   CP G YG  C   C C +G SC+P TG C C  G  G  C+  CP  ++G +C+ +CKC +N PC+ + G C+C     GRFC +
Sbjct:  558 VCLGGFFGDDCTLSCKDC-VNGECTESKDRCHCSPGWTGIICNKTCPKGTYGQACISLCLCQNGGSCDPVTGRCLCPPGVEGRFCEEGCPRGYFGQHCKAKCKCPNNGPCHRLHGACLCSPGFYGRFCHL 686          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Medaka
Match: zgc:158328 (multiple epidermal growth factor-like domains protein 6 [Source:NCBI gene;Acc:101169224])

HSP 1 Score: 715.687 bits (1846), Expect = 0.000e+0
Identity = 483/1368 (35.31%), Postives = 661/1368 (48.32%), Query Frame = 3
Query:  225 MPNVCEVEQRQMIRVRRTVEVPRSKEVKVWKANCRFKGDWCLVHENKSFVEKTETSQIQMVPSIKYECCEGYAELSGYRGCIPKPNCEERIGKYCQNGAFCYQSGYNAKCICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQN---------------------------------------------------TRGSSLQKDPRRCPKGTF-------------GEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDK------------TCQ------------------------------GNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK--CEACPSGKWGPTCNQNCDCT-YSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN-CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHN-GGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKES-DCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFC 3992
            MPNVC  ++  ++  R+      +  VKVWK  C     WC  +E ++    T      MV    YECC G+ +     GC    +   R G  C NG    ++G +  C+CP GF GT+C  D+NECE N GGCE +CCN  G +YCKC  G  +  +G++C D+NEC      C   C+N  G + C+C     +  D   CI  ++ C   N GGC H CV +    + C C   + L +D R C + + C+DNNGGC+ LC  +   +  +C C+ G+ +   D + C DI+EC+  +  C H C+N  GSF C CHPG+++G   K CY+++ME+ + C+  NGGC+  C  +     +CSC  G++L  D  TC D DEC + +  C     C N  G Y C+C  G  L  +   C+D+DECL  T GC + CVNT GSY+C CP G  L  D  +C + N                                                    R S    + +R P+G               G++C  +C +C++ G C + +  C C P ++G IC   C +      C  L C C+NGG+C+  T +C CPPG+ G  CE GC  G+FG++C+  C    ++  CH++ G CLC PG+YG  CHL+CP  T G GCSK C C++ +  GCDPK G C CK  + G  C   C PG+FG  C  +C       C+  TG C  +            TCQ                              G     CQ DCP G  G  C  +C   ENS SC +K G+C C  GF GKRC+ +C  G YG  C + C C  D  CD   G C+C     G      C  G WG +C   C C   S GCD ++G+C+C AGY G  C K C  G YG GCS+ CQC  G  CD +SG C C+PG+ G  CE  C +G+YG  C + C+C NG  C      C C  GW G  C   C  G +G+NC   CQC      C  ++G C C PG+ G  C+ RCP+ ++GP C   C C+NGG C    G C C  G  G  C   CP   YG NC+  C C    +C+  TG C C     G++C+      +    CR  C C     C+ V G C+C  G  GP+C   C  G +GL+C + C+C N   C+   G+C C +G+ G  C   C  G++G NC   C  C   + C   TG+C C  G     C+ +C +G +G  C Q C C   A C+P TG C C  G  G  C+  C  + +G +C  +C C H++ C+ V+G C+CP    G  C
Sbjct:    1 MPNVCTDQKMFVLGKRQPCVHAFTHMVKVWKQGCTSH-LWCSRYERRTAYYMTYQQVYGMVLHTVYECCPGWTQKDDEMGCF---HTGMRNGDSCHNGGRFAETG-DRICLCPSGFKGTYCQYDVNECEFNKGGCEGQCCNTIGSYYCKCSEGSRLGSDGRSCDDVNECEEFNGGCQQTCINTAGSYHCECSKGFRMHTDGRTCIA-LNSCSILN-GGCEHKCVDMGPNHYKCECQRNYKLKRDGRHCELRNPCQDNNGGCAQLCHFNVGHA--SCSCQSGFRL-ARDGRNCADIDECSSGSARCSHGCVNTVGSFRCVCHPGFELGAGGKQCYRIEMEIVNSCEKNNGGCSHHCEHTTGG-PLCSCNHGYQLSHDRKTCIDSDECASEESCCT--HVCRNYPGGYDCSCRAGLTLNPDGCGCDDVDECLAETSGCEHYCVNTLGSYKCFCPKGFRLNHDKHSCISLNGEEELEEEEEEDKDEKQLELSRFQDLLLHGNPQLMHYTSALRSHPSVYDAGVRDSKEDVEMQRGPRGELMLDSHIVCLGGFFGDDCTLSCKDCVN-GECTESKDRCHCSPGWTGIICNKTCPKGTYGQACISL-CLCQNGGSCDPVTGRCLCPPGVEGRFCEEGCPRGYFGQHCKAKCKCP-NNGPCHRLHGACLCSPGFYGRFCHLVCPRWTHGAGCSKECDCDREHSAGCDPKTGSCFCKAEFQGPQCDRACGPGFFGAGCEQTCDCPGGGSCDPTTGACIQRCPAGFHGDRCKLTCQMGNYGENCGLTCECSGAPCDHITGQCLCPAGKTGSSCQEDCPDGFWGLKCHYSCPICENSSSCNKKTGLCDCKSGFMGKRCQKECPAGYYGPGCMNPCYCPPDSRCDAQNGHCHCPPGKRGHDCVTLCEPGFWGQSCVNRCQCQGPSVGCDPVDGRCVCEAGYSGDLCEKSCVNGSYGPGCSQRCQCQNGALCDHVSGACTCSPGFTGTFCERICPDGFYGLDCGQMCECRNGARCHHITGACLCTAGWAGPHCILVCLAGTFGQNCSRLCQCTELHDWCHPVTGTCSCSPGYYGKRCELRCPAGSFGPGCKSRCSCINGGSCDSRTGACYCSPGYIGAYCSRRCPQGYYGRNCVKQCFCGEGGQCNPATGRCICGPGRMGMTCQQACPRGRYGPQCRNACSCQNGALCDPVDGSCKCGLGWIGPRCDTACSQGKYGLNCAEDCQCLNNGTCDRFTGSCSCAAGYYGFTCQHTCPSGYHGVNCSHACY-CKTGQDCDHVTGKCICAPGYHGPQCQRRCEAGRFGAGCAQLCDCADEAPCDPQTGRCLCPPGRTGQRCEKHCNGDHFGPDCSLQCHCSHSARCDGVSGRCMCPLNWIGPVC 1351          

HSP 2 Score: 409.453 bits (1051), Expect = 7.457e-120
Identity = 272/715 (38.04%), Postives = 357/715 (49.93%), Query Frame = 3
Query: 1665 CPKGTFGEECLFNCS-NCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKC--NCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK-CE-ACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQC--IYGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDS--KESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQA 3782
            CP+ T G  C   C  +  H   C+     C C   + G  C+  C        C+   C C  GG+C+  T  C   CP G  G+ C++ C  G +GENC   C   CS   C  ITG+CLC  G  GSSC   CP G WG+ C  +C   +N+   C+ K G C CK G+ G  C  +C  GY+G  C   C     + C+ + G C      G     C   C  G  G  C   C C   SV C+  +G C C  G++G  CE  C  G YG  C   CQC+   LCDHV+G C C+    G  CE  CP G +G  C Q C+C     C  I G C+C AG+ GP C   C  G +G+ CS+ CQC  ++  C P++G C C+PG++G+ CE  C  G +G  CK +C C+NGG+CD     C C PG+ G +C + C  GYYGRNC  +C C  GG C+  +G+C C PG  G+ C + CP   YGP C   C C NG  C P +G C+C  G  G  C+  C   KYG NC  +C C     CD  TG C+C    +G +C+   C S     +C   C C   + C+ VTGKC C PG  GPQC + CE G FG  C Q C CA+  PC+P  G CLC  G TG  C++ C    +GP+C L+C  C+ +  C   +G+C              CP  + GP+C + 
Sbjct:  661 CPRWTHGAGCSKECDCDREHSAGCDPKTGSCFCKAEFQGPQCDRACGPGFFGAGCEQT-CDCPGGGSCDPTTGACIQRCPAGFHGDRCKLTCQMGNYGENCGLTC--ECSGAPCDHITGQCLCPAGKTGSSCQEDCPDGFWGLKCHYSCPICENS-SSCNKKTGLCDCKSGFMGKRCQKECPAGYYGPGCMNPCYCPPDSRCDAQNGHC--HCPPGKRGHDCVTLCEPGFWGQSCVNRCQCQGPSVGCDPVDGRCVCEAGYSGDLCEKSCVNGSYGPGCSQRCQCQNGALCDHVSGACTCSPGFTGTFCERICPDGFYGLDCGQMCECRNGARCHHITGACLCTAGWAGPHCILVCLAGTFGQNCSRLCQCTELHDWCHPVTGTCSCSPGYYGKRCELRCPAGSFGPGCKSRCSCINGGSCDSRTGACYCSPGYIGAYCSRRCPQGYYGRNCVKQCFCGEGGQCNPATGRCICGPGRMGMTCQQACPRGRYGPQCRNACSCQNGALCDPVDGSCKCGLGWIGPRCDTACSQGKYGLNCAEDCQCLNNGTCDRFTGSCSCAAGYYGFTCQ-HTCPSGYHGVNCSHACYCKTGQDCDHVTGKCICAPGYHGPQCQRRCEAGRFGAGCAQLCDCADEAPCDPQTGRCLCPPGRTGQRCEKHCNGDHFGPDCSLQCH-CSHSARCDGVSGRC-------------MCPLNWIGPVCTEG 1354          

HSP 3 Score: 354.369 bits (908), Expect = 8.918e-101
Identity = 231/613 (37.68%), Postives = 311/613 (50.73%), Query Frame = 3
Query: 2196 CDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDC--TYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGIC--RCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQ-CHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKA-TEKCDLKTGECTCPKSAFGLSCEIKNC--DSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVS 4001
            C  G+FG DC+ SC +     C     +C      G   I C + CP G  G  C   C C +N  SC+   G C C PG  G+ CE  C +G +G+ C++ C+C  +  C  + G C C+   +G+     CP    G  C++ CDC   +S GCD   G C C A + GP+C + C  G +G GC + C C  G +CDP +G C  RC  G+HG+ C+  C  G YG+ C   C+C +G  CD    +C C  G  G  C++ C  G++G  C   C  C N   C+  +G CDC  G+ G  C + CP+  YGP C   C C    +C  +NG C CP G+ G  C   C P  +G +C++ C C+  +  CD   G C C     G  CE K+C   S    C Q CQC     C+ V+G C C PG  G  C ++C  G +GLDC Q C C NG  C+ + G CLC +G+ G  C  VC  G +G NC   C     +  CHP TG CSC  G     C+ +CP+G +GP C+  C C++G SC+  TGAC C  G+ GA C  RCP  +YG NC  +C C     CNP TG C+C     G  C+ +
Sbjct:  532 CLGGFFGDDCTLSCKDCVNGECTESKDRC--HCSPGWTGIICNKTCPKGTYGQACISLCLC-QNGGSCDPVTGRCLCPPGVEGRFCEEGCPRGYFGQHCKAKCKCPNNGPCHRLHGACLCSPGFYGRFCHLVCPRWTHGAGCSKECDCDREHSAGCDPKTGSCFCKAEFQGPQCDRACGPGFFGAGCEQTCDCPGGGSCDPTTGACIQRCPAGFHGDRCKLTCQMGNYGENCGLTCEC-SGAPCDHITGQCLCPAGKTGSSCQEDCPDGFWGLKCHYSCPICENSSSCNKKTGLCDCKSGFMGKRCQKECPAGYYGPGCMNPCYCPPDSRCDAQNGHCHCPPGKRGHDCVTLCEPGFWGQSCVNRCQCQGPSVGCDPVDGRCVCEAGYSGDLCE-KSCVNGSYGPGCSQRCQCQNGALCDHVSGACTCSPGFTGTFCERICPDGFYGLDCGQMCECRNGARCHHITGACLCTAGWAGPHCILVCLAGTFGQNCSRLCQCTELHDWCHPVTGTCSCSPGYYGKRCELRCPAGSFGPGCKSRCSCINGGSCDSRTGACYCSPGYIGAYCSRRCPQGYYGRNCVKQCFCGEGGQCNPATGRCICGPGRMGMTCQQA 1139          

HSP 4 Score: 328.561 bits (841), Expect = 3.832e-92
Identity = 240/660 (36.36%), Postives = 316/660 (47.88%), Query Frame = 3
Query: 2052 HLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRL--CDHVTGICYC-ADVAFGKCE-ACPSGKWGPTCNQNCDCTYSTGCDQINGQCI--CLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCK-CLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGK-CHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKES-DCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCAN-GEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVS 4001
            H++C  G +G  C+ +C    N    C     +C C  G+ G+ C   C  G +G  C   C       C+  TG+C      G     C+  CP G  G  C+  C C  N   C   +G C C+PGF G+ C L C +  +G  C   C C ++    CD  TG C+C A+    +C+ AC  G +G  C Q CDC     CD   G CI  C AG++G +C   C  G YGE C   C+C    CD I+G C C  G  G  C+  C +G++G +C   C  C N  +C+     C C+ G+ G+ C+K C  GYYG  C   C C     CD  +G C C PG RG +C   C    +G +C   CQC      C P +G C C AG  GD+CE +C    YGP C   C C+    CD  +G CTC     G  CE    D     DC Q C+C     C+ +TG C C  G  GP C+ +C  G FG +C + C+C    + C+PV GTC C  G+ G  C+  C  G +GP CK +C  C    +C  +TG C C  G I   C  +CP GYYG  C + C C  G  CNP+TG C C  G  G  CQ  CP   YG  C++ C C + + C+PV G C C     G  C+ +
Sbjct:  529 HIVCLGGFFGDDCTLSCKDCVNGE--CTESKDRCHCSPGWTGIICNKTCPKGTYGQACISLCLCQNGGSCDPVTGRCLCPP--GVEGRFCEEGCPRGYFGQHCKAKCKCPNNG-PCHRLHGACLCSPGFYGRFCHLVCPRWTHGAGCSKECDCDREHSAGCDPKTGSCFCKAEFQGPQCDRACGPGFFGAGCEQTCDCPGGGSCDPTTGACIQRCPAGFHGDRCKLTCQMGNYGENCGLTCECSGAPCDHITGQCLCPAGKTGSSCQEDCPDGFWGLKCHYSCPICENSSSCNKKTGLCDCKSGFMGKRCQKECPAGYYGPGCMNPCYCPPDSRCDAQNGHCHCPPGKRGHDCVTLCEPGFWGQSCVNRCQCQGPSVGCDPVDGRCVCEAGYSGDLCEKSCVNGSYGPGCSQRCQCQNGALCDHVSGACTCSPGFTGTFCERICPDGFYGLDCGQMCECRNGARCHHITGACLCTAGWAGPHCILVCLAGTFGQNCSRLCQCTELHDWCHPVTGTCSCSPGYYGKRCELRCPAGSFGPGCKSRC-SCINGGSCDSRTGACYCSPGYIGAYCSRRCPQGYYGRNCVKQCFCGEGGQCNPATGRCICGPGRMGMTCQQACPRGRYGPQCRNACSCQNGALCDPVDGSCKCGLGWIGPRCDTA 1182          

HSP 5 Score: 238.039 bits (606), Expect = 4.349e-63
Identity = 152/397 (38.29%), Postives = 204/397 (51.39%), Query Frame = 3
Query: 2841 CDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCIC--KATEKCDLKTGECTCPKSAFGLSCEIKNCDSK--ESDCRQDCQCSIKKSCNQVTGKC--QCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSP-CNPVTGHCVCPKKLSGRFCEVSVIN 4010
            C  G++GD C   CK    G C     +C C PGW G  C K+C  G YG+ C   C C NGG CD ++G+C C PG  G  C+E CP   +G +C   C+C N G CH  +G C C  G +G  C L CP   +G  C   C C  + +  CD KTG C C     G  C+ + C      + C Q C C    SC+  TG C  +C  G  G +C   C+ GN+G +C   C C+ G PC+ + G CLC +G TG  C + C  G++G  C   C +C  + +C+ +TG C C++G +   C+ +CP+GYYGP C   C C   + C+   G C C  G  G  C   C   F+G +C +RC+C   S  C+PV G CVC    SG  CE S +N
Sbjct:  532 CLGGFFGDDCTLSCKDCVNGECTESKDRCHCSPGWTGIICNKTCPKGTYGQACISLCLCQNGGSCDPVTGRCLCPPGVEGRFCEEGCPRGYFGQHCKAKCKCPNNGPCHRLHGACLCSPGFYGRFCHLVCPRWTHGAGCSKECDCDREHSAGCDPKTGSCFCKAEFQGPQCD-RACGPGFFGAGCEQTCDCPGGGSCDPTTGACIQRCPAGFHGDRCKLTCQMGNYGENCGLTCECS-GAPCDHITGQCLCPAGKTGSSCQEDCPDGFWGLKCHYSCPICENSSSCNKKTGLCDCKSGFMGKRCQKECPAGYYGPGCMNPCYCPPDSRCDAQNGHCHCPPGKRGHDCVTLCEPGFWGQSCVNRCQCQGPSVGCDPVDGRCVCEAGYSGDLCEKSCVN 926          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Medaka
Match: megf6b (multiple EGF like domains 6 [Source:NCBI gene;Acc:101160063])

HSP 1 Score: 703.36 bits (1814), Expect = 0.000e+0
Identity = 446/1203 (37.07%), Postives = 596/1203 (49.54%), Query Frame = 3
Query:  660 FYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQ-------------------------------------------NQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCS------------------------------------------ENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK--CEACPSGKWGPTCNQNCDCTY-STGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN-CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKE--SDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCE 3995
            F   C  GY     G    DINEC  +   C H+CVN  G + C+C P   L  D   C+P +  C   N GGC H CV+ S   F C C   + L +D + C + + C + NGGC H C+ D   +   C C+ GY +   D + C+DI+EC  K   C H C N  GS+ C C+  +++G + K CY+++ME+ + C+  NGGC+  C  S +   +C+C  G++L+ D  TC D DEC  G+        C N  G Y C C  GYRL  +  +C+D+DECL   GGC + C NT GS++C C  G  LGKD  +C                                                R  S   +   C   TFG +C   C +C + G CN  +TGC C   ++G +C   C        C    C CKNG +C+  +  C CPPG+SG++C+ GC +G +G+ C K C  A  + RCH+  G CLC PG YG  CHL CP  T+G GCS  C C+Q N + C  ++G C CK GY G  C   C  G +G  C   C       C+H TG+C      G +S  C +DCP G  G+ C + C+C+                                          EN   C++ NG C+C PG+ G+ C+  C  G +GERCQ  C C  +  CD V+G C C     G    + C  G WG  C + C+C+     CD + GQC C AG+ G  C ++CP G++G  C  ECQC  G  CD +SG C C  GW G  CE PC +G+YG  C+++C C NGG+CD     C C  GW G FC  +C  G+YG  C   C C NGG+C   SG C C PGW G NC E C +  YG +C Q C C NG  C+  +G C C +G  G  CEL C   ++G +C   C C+   +CD +TG C+C     G  CE K C +      C + C C    SC+ VTG+CQC PG RG  C + C  G +G  C + C CA G  C+ V G C C +GFTG  C++ C  G +GPNC   C    +N+ CHP +G C C  G     C+  C  G YGP C+Q C+C +G  C+P TGAC+C +GF G  C   CP   YG +C     C   +  +PVTG CVC    +G+ C 
Sbjct:   35 FRPYCYYGYHGYNVGYLPKDINECQVHNGGCQHKCVNTMGSYHCECNPGSRLHVDGRTCLP-VRSCAIRN-GGCEHSCVQQSAANFRCRCKPDYELAEDGKHCMLQNPCANQNGGCMHECRVDGGKA--HCDCKVGYML-AEDGQTCEDIDECETKEDDCAHGCRNSPGSYTCICNAAYELGSNGKQCYRIEMEIVNSCENNNGGCSHHCQHSTSG-PVCTCNHGYRLDDDLKTCLDVDEC--GEQVSCCEQECTNYPGGYECYCSAGYRLNADGCSCDDVDECLAANGGCDHTCQNTAGSFQCFCLWGYRLGKDRLSCMPIEDAVEALSSGGAIELPRIRPQLVLLQEYGQALERYDDYEDDEGELRAESNLAEKFLCLDDTFGSDCSLTCDDCTNGGECNAWKTGCECPDGWTGIVCNQSCPGGYFGKNCS-FPCKCKNGASCDPISGGCRCPPGVSGDLCQEGCPKGLYGKLCNKKCNCA-YNGRCHRTYGACLCDPGLYGRFCHLPCPKWTYGPGCSDECKCDQKNTQECHRRHGTCICKPGYQGNTCREACQSGTYGAGCEKQCACPSGVSCDHVTGRCQKTCHPGRHSENCDQDCPEGRFGAGCMQLCNCTGASCDKVTGQCLCPAGRMGQHCETSCTEGFWGPGCKEACPACENGGVCDKLNGSCNCPPGYMGRLCQSSCPTGRFGERCQLKCVCENNAHCDPVSGRCSCTPGWTGPHCSKVCDVGHWGADCAETCNCSNGDLSCDAVTGQCSCDAGFTGTHCQQKCPAGMFGPTCHHECQCKNGALCDHVSGACTCKAGWTGTFCEKPCPQGFYGLDCQQRCLCQNGGSCDHVSGVCSCPSGWIGRFCNLTCPAGFYGEACNQSCSCRNGGICHPASGGCLCSPGWTGPNCQEECSAGFYGADCQQRCLCQNGAACNKTDGACVCSSGWMGAACELECAAGRFGADCQQQCECENGGQCDRRTGRCSCSAGWLGERCE-KACGAGRFGVGCTERCHCGNGASCHHVTGECQCLPGWRGKHCHKACLPGTYGERCSRPCICARGASCHHVSGQCGCPAGFTGSGCEKTCLPGTFGPNCNQVCRCSEKNQLCHPVSGSCYCAPGFHGLKCEHVCAEGRYGPDCKQDCRCDNGGKCDPFTGACECPAGFIGPHCNTTCPAGRYGLHCAQVALCGVGTQSDPVTGRCVCLPGQTGKDCR 1226          

HSP 2 Score: 522.702 bits (1345), Expect = 8.805e-161
Identity = 394/1152 (34.20%), Postives = 530/1152 (46.01%), Query Frame = 3
Query:  654 GGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMR--FICSCPDGHILDK-DRRSCSVVDLCKDNNGGCSHLCQSDPSSS--VITCK-CRPGYAIDVNDVK-QCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYG------NGGCTQFCNSSPNKR-----AICSCLPGFKLEADGLTCSD-------EDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSN-RCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGK-CHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKES-DCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVSVINRL 4016
            GG+ C C  GY ++ +G +C D++EC+     C H C N  G F+C C     LG DR++C+P     ++ + GG     ++L  +R   +     G  L++ D       +L  ++N     LC  D   S   +TC  C  G   +      +C D     + N  C         SF C C  G         C        D C+ G         C + CN + N R       C C PG       L C          DEC     KC   +T         C C  GY+      TC +  +   Y  GC           +C CP+G +       CQ     G   +   + CP+G FG  C+  C NC     C+     CLC     G  CE  C +      C+     C+NGG C+     CNCPPG  G +C+  C  G FGE C+  C   C +N  C  ++G+C C PGW G  C  +C  G WG  C++TC+C+  +   CD   G+C C  G+ G +C  KC  G FG  C   C      +C+H +G C  K   G     C++ CP G  G DC++ C C +N  SC+  +G+C C  G+ G+ C L C  G YGE C  SC CR   +C   +G C C+    G    E C +G +G  C Q C C     C++ +G C+C +G+ G  C   C  G +G  C ++C+C  G  CD  +G C C+ GW GE CE  C  G +G  C E+C C NG +C     +CQC PGW G+ C K+C  G YG  C   C C  G  C  +SG+C C  G+ G  C++ C   T+GPNCNQVC+C    + CHP +G C C  G HG  CE  C   +YGP+C  +C C    KCD  TG C CP    G  C       +    C Q   C +    + VTG+C C PG  G  C Q C  G FG DC   C C+NG  C+   G C C  G+TG  CD  C  G +G +C LKC  C  N +C   TG C C  G     C+  CP G++G LCQ  C C +GASC+P +G C C  G++G  C   C    YG +C   C C   +PC+PVTG C+CP   +GR C++     L
Sbjct:  285 GGYECYCSAGYRLNADGCSCDDVDECLAANGGCDHTCQNTAGSFQCFCLWGYRLGKDRLSCMPIEDAVEALSSGGA----IELPRIRPQLVLLQEYGQALERYDDYEDDEGELRAESNLAEKFLCLDDTFGSDCSLTCDDCTNGGECNAWKTGCECPDGWTGIVCNQSCPGGYFGKNCSFPCKCKNGASCDPISGGCRCPPGVSGDLCQEGCPKGLYGKLCNKKCNCAYNGRCHRTYGACLCDPGLYGRFCHLPCPKWTYGPGCSDEC-----KCDQKNTQECHRRHGTCICKPGYQ----GNTCREACQSGTYGAGC---------EKQCACPSGVSCDHVTGRCQKTCHPGRHSENCDQDCPEGRFGAGCMQLC-NCT-GASCDKVTGQCLCPAGRMGQHCETSCTEGFWGPGCKEACPACENGGVCDKLNGSCNCPPGYMGRLCQSSCPTGRFGERCQLKC--VCENNAHCDPVSGRCSCTPGWTGPHCSKVCDVGHWGADCAETCNCSNGDLS-CDAVTGQCSCDAGFTGTHCQQKCPAGMFGPTCHHECQCKNGALCDHVSGACTCKA--GWTGTFCEKPCPQGFYGLDCQQRCLC-QNGGSCDHVSGVCSCPSGWIGRFCNLTCPAGFYGEACNQSCSCRNGGICHPASGGCLCSPGWTGPNCQEECSAGFYGADCQQRCLCQNGAACNKTDGACVCSSGWMGAACELECAAGRFGADCQQQCECENGGQCDRRTGRCSCSAGWLGERCEKACGAGRFGVGCTERCHCGNGASCHHVTGECQCLPGWRGKHCHKACLPGTYGERCSRPCICARGASCHHVSGQCGCPAGFTGSGCEKTCLPGTFGPNCNQVCRCSEKNQLCHPVSGSCYCAPGFHGLKCEHVCAEGRYGPDCKQDCRCDNGGKCDPFTGACECPAGFIGPHCNTTCPAGRYGLHCAQVALCGVGTQSDPVTGRCVCLPGQTGKDCRQGCPAGWFGADCASFCNCSNGGVCDSATGNCTCALGWTGEHCDTECPAGRFGADCALKC-NCQNNGSCDRVTGTCRCGPGYYGGLCEHACPPGFHGALCQLQCDCENGASCHPVSGRCICPPGYHGGHCHRVCEQGSYGQDCAKVCDCEDAAPCDPVTGRCICPSGKTGRRCDIDCRADL 1405          

HSP 3 Score: 391.349 bits (1004), Expect = 1.585e-113
Identity = 274/770 (35.58%), Postives = 376/770 (48.83%), Query Frame = 3
Query: 1446 CTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTG-CLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN--CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIK-NCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCK 3737
            C CP GY  R  + +C         TG  G +C       +CVC N       +  C    T G +     + C  G +G +C   C NC +     D  TG C C   ++GT C+  C        C   +C CKNG  C+  +  C C  G +G  CE  C +GF+G +C++ C    +   C  ++G C C  GW G  C+L CP G +G  C+++CSC       C P +G C C  G+ G NC  +C  G++G DC   C       CN   G C   +  G     C+ +C  G  G+DC++ C+C EN   C+ + G C C+ G+ G+RCE  C  G +G  C   C C     C HVTG C C     GK   +AC  G +G  C++ C C     C  ++GQC C AG+ G  C K C  G +G  C++ C+C   N  C P+SG C C PG+HG  CE+ C EG YG  CK+ C+C NGG CD F   C+C  G+ G  C  +C  G YG +C     C  G   D ++G+C C+PG  G +C + CP+  +G +C   C C NGG C    G C C  G  G+ C+  CP  ++G +C   C C+    CD  TG C C    +G  CE         + C+  C C    SC+ V+G+C C PG  G  C ++CE G++G DC + C C +  PC+PV G C+C SG TG  CD  C    YGP+C   C  C     C P++G+C C    I   C+
Sbjct:  696 CNCPPGYMGRLCQSSCP--------TGRFGERC-----QLKCVCENNAHCDPVSGRCSC--TPGWTGPHCSKVCDVGHWGADCAETC-NCSNGDLSCDAVTGQCSCDAGFTGTHCQQKCPAGMFGPTCH-HECQCKNGALCDHVSGACTCKAGWTGTFCEKPCPQGFYGLDCQQRCLCQ-NGGSCDHVSGVCSCPSGWIGRFCNLTCPAGFYGEACNQSCSCRNGGI--CHPASGGCLCSPGWTGPNCQEECSAGFYGADCQQRCLCQNGAACNKTDGACVCSS--GWMGAACELECAAGRFGADCQQQCEC-ENGGQCDRRTGRCSCSAGWLGERCEKACGAGRFGVGCTERCHCGNGASCHHVTGECQCLPGWRGKHCHKACLPGTYGERCSRPCICARGASCHHVSGQCGCPAGFTGSGCEKTCLPGTFGPNCNQVCRCSEKNQLCHPVSGSCYCAPGFHGLKCEHVCAEGRYGPDCKQDCRCDNGGKCDPFTGACECPAGFIGPHCNTTCPAGRYGLHCAQVALCGVGTQSDPVTGRCVCLPGQTGKDCRQGCPAGWFGADCASFCNCSNGGVCDSATGNCTCALGWTGEHCDTECPAGRFGADCALKCNCQNNGSCDRVTGTCRCGPGYYGGLCEHACPPGFHGALCQLQCDCENGASCHPVSGRCICPPGYHGGHCHRVCEQGSYGQDCAKVCDCEDAAPCDPVTGRCICPSGKTGRRCDIDCRADLYGPDCSETC-TCQNQAQCDPRSGRCRCSHSWIGPSCQ 1441          

HSP 4 Score: 342.428 bits (877), Expect = 8.906e-97
Identity = 242/691 (35.02%), Postives = 314/691 (45.44%), Query Frame = 3
Query: 1551 TDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQC--------------------------------------------RKDRLCDHVTGICYCADVAFG-KCE-ACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN-CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIK-NCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQ 3479
             D +  C C NG+ L  D  T Q     G +     ++CP G FG  C   C  C +   C+     C C   ++GT CE  C Q    ++CQ  +C C+NGG+C+  +  C+CP G  G  C + C  GF+GE C ++C    +   CH  +G CLC PGW G +C   C  G +G  C + C C   N   C+  +G C C  G+ G  C  +C  G FG DC   C  +    C+  TG+C      G     C++ C  G  G  C + C C  N  SC    G C C PG+ GK C   C  G YGERC   C C                                             K++LC  V+G CYCA    G KCE  C  G++GP C Q+C C     CD   G C C AG+ GP C+  CP G YG  C++   C  G   DP++G C C PG  G+ C   C  G++G  C   C C NGG CD     C C  GW GE C+  C  G +G +C  +C C N G CD ++G C C PG+ G  C+  CP   +G  C   C C NG  CHP +G C CP G HG  C   C    YG +C   C C+    CD  TG C CP    G  C+I    D    DC + C C  +  C+  +G+C+C     GP C +
Sbjct:  761 ADCAETCNCSNGD-LSCDAVTGQCSCDAGFTGTHCQQKCPAGMFGPTCHHEC-QCKNGALCDHVSGACTCKAGWTGTFCEKPCPQGFYGLDCQ-QRCLCQNGGSCDHVSGVCSCPSGWIGRFCNLTCPAGFYGEACNQSCSCR-NGGICHPASGGCLCSPGWTGPNCQEECSAGFYGADCQQRCLCQ--NGAACNKTDGACVCSSGWMGAACELECAAGRFGADCQQQCECENGGQCDRRTGRCSCSA--GWLGERCEKACGAGRFGVGCTERCHCG-NGASCHHVTGECQCLPGWRGKHCHKACLPGTYGERCSRPCICARGASCHHVSGQCGCPAGFTGSGCEKTCLPGTFGPNCNQVCRCSEKNQLCHPVSGSCYCAPGFHGLKCEHVCAEGRYGPDCKQDCRCDNGGKCDPFTGACECPAGFIGPHCNTTCPAGRYGLHCAQVALCGVGTQSDPVTGRCVCLPGQTGKDCRQGCPAGWFGADCASFCNCSNGGVCDSATGNCTCALGWTGEHCDTECPAGRFGADCALKCNCQNNGSCDRVTGTCRCGPGYYGGLCEHACPPGFHGALCQLQCDCENGASCHPVSGRCICPPGYHGGHCHRVCEQGSYGQDCAKVCDCEDAAPCDPVTGRCICPSGKTGRRCDIDCRADLYGPDCSETCTCQNQAQCDPRSGRCRCSHSWIGPSCQE 1442          

HSP 5 Score: 341.273 bits (874), Expect = 2.059e-96
Identity = 252/735 (34.29%), Postives = 343/735 (46.67%), Query Frame = 3
Query: 1167 SFICDCHPGWQIGHDHKSC----YKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN-CDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCE 3350
            S  C C PGW   H  K C    +  D   T  C  G+  C             CSC  GF        C       T  H+C   +  + D  S  CTC  G+        CE           C       D   RC+C NG +    +  C   +  G   +     CP G +GE C  +CS C + G C+    GCLC P ++G  C+ +C       +CQ  +C C+NG  C      C C  G  G  CE+ C  G FG +C++ C    +  +C + TG+C C  GW G  C   C  G +G+GC++ C C   N   C    G+C+C  G+ G +C   C PG +G  CS  C       C+H +GQC      G    GC++ C  G  G +C + C CSE +  C   +G C+CAPGF G +CE  C +G YG  C+  C+C     CD  TG C C     G      CP+G++G  C Q   C   T  D + G+C+CL G  G  C + CP G +G  C+  C C  G  CD  +G C C  GW GE C+  C  G +G  C  KC C N G+CD     C+C PG++G  CE +C  G++G  C+ +C C NG  C  +SG+C C PG+ G +C   C   +YG +C +VC C +   C P  G C CP+G+ G  C++ C  D YGP+C   C C+   +CD ++G C C  S  G SC+
Sbjct:  736 SGRCSCTPGWTGPHCSKVCDVGHWGADCAETCNCSNGDLSCDAV-------TGQCSCDAGFTGTHCQQKCPAGMFGPTCHHECQCKNGALCDHVSGACTCKAGW----TGTFCEKP---------CPQGFYGLDCQQRCLCQNGGSCDHVSGVCSCPS--GWIGRFCNLTCPAGFYGEACNQSCS-CRNGGICHPASGGCLCSPGWTGPNCQEECSAGFYGADCQ-QRCLCQNGAACNKTDGACVCSSGWMGAACELECAAGRFGADCQQQCECE-NGGQCDRRTGRCSCSAGWLGERCEKACGAGRFGVGCTERCHCG--NGASCHHVTGECQCLPGWRGKHCHKACLPGTYGERCSRPCICARGASCHHVSGQCGCPA--GFTGSGCEKTCLPGTFGPNCNQVCRCSEKNQLCHPVSGSCYCAPGFHGLKCEHVCAEGRYGPDCKQDCRCDNGGKCDPFTGACECPAGFIGPHCNTTCPAGRYGLHCAQVALCGVGTQSDPVTGRCVCLPGQTGKDCRQGCPAGWFGADCASFCNCSNGGVCDSATGNCTCALGWTGEHCDTECPAGRFGADCALKCNCQNNGSCDRVTGTCRCGPGYYGGLCEHACPPGFHGALCQLQCDCENGASCHPVSGRCICPPGYHGGHCHRVCEQGSYGQDCAKVCDCEDAAPCDPVTGRCICPSGKTGRRCDIDCRADLYGPDCSETCTCQNQAQCDPRSGRCRCSHSWIGPSCQ 1441          

HSP 6 Score: 249.595 bits (636), Expect = 1.074e-66
Identity = 219/671 (32.64%), Postives = 294/671 (43.82%), Query Frame = 3
Query: 1110 NECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYK--VDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQ-NQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGK-CEA-CPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCP 3104
            +EC  KNG    +C +V G+  C C  GW      K C +    ++    C   NGG      S  +   +CSC  G+      LTC            C   +  I    S  C C  G+     +  C             G+     D   RC+C NG    K +  C  +    G++ + +   C  G FG +C   C  C + G C+     C C   + G  CE  C      V C   +CHC NG +C   T +C C PG  G+ C   C  G +GE C + C  A     CH ++G+C C  G+ GS C   C  GT+G  C++ C C++ N + C P +G C C  G+HG+ C + C  G +G DC   C  D    C+  TG C      G     C   CP G  G  C +   C   + S +   G C C PG TGK C   C  G +G  C S C C    +CD  TG C CA    G+ C+  CP+G++G  C   C+C  +  CD++ G C C  GYYG  C   CP G +G  C  +C C  G +C P+SG C C PG+HG  C   C++G YG  C + C C +   CD    +C C  G  G  C+  C    YG +C   C C N   CD  SG+C C   W G +C E  P
Sbjct:  809 HECQCKNGA---LCDHVSGA--CTCKAGWTGTFCEKPCPQGFYGLDCQQRCLCQNGG------SCDHVSGVCSCPSGWIGRFCNLTCPAGFYGEACNQSCSCRNGGICHPASGGCLCSPGWTGPNCQEECSA-----------GF--YGADCQQRCLCQNGAACNKTDGACVCSSGWMGAACELE---CAAGRFGADCQQQCE-CENGGQCDRRTGRCSCSAGWLGERCEKACGAGRFGVGCTE-RCHCGNGASCHHVTGECQCLPGWRGKHCHKACLPGTYGERCSRPCICA-RGASCHHVSGQCGCPAGFTGSGCEKTCLPGTFGPNCNQVCRCSEKN-QLCHPVSGSCYCAPGFHGLKCEHVCAEGRYGPDCKQDCRCDNGGKCDPFTGACECPA--GFIGPHCNTTCPAGRYGLHCAQVALCGVGTQS-DPVTGRCVCLPGQTGKDCRQGCPAGWFGADCASFCNCSNGGVCDSATGNCTCALGWTGEHCDTECPAGRFGADCALKCNCQNNGSCDRVTGTCRCGPGYYGGLCEHACPPGFHGALCQLQCDCENGASCHPVSGRCICPPGYHGGHCHRVCEQGSYGQDCAKVCDCEDAAPCDPVTGRCICPSGKTGRRCDIDCRADLYGPDCSETCTCQNQAQCDPRSGRCRCSHSWIGPSCQEGGP 1445          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Medaka
Match: zgc:158328 (multiple epidermal growth factor-like domains protein 6 [Source:NCBI gene;Acc:101169224])

HSP 1 Score: 694.115 bits (1790), Expect = 0.000e+0
Identity = 469/1353 (34.66%), Postives = 659/1353 (48.71%), Query Frame = 3
Query:  147 FAIIFFLTIQIIPKLSGAGSQKLELGMPNVCEVEQRQMIRVRRTVEVPRSKEVKVWKANCRFKGDWCLVHENKSFVEKTETSQIQMVPSIKYECCEGYAELSGYRGCIPKPNCEERIGKYCQNGAFCYQSGYNAKCICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGC---------GYKCVNTDG------SYRCVCPNG------------------------------------ETLGKDNKTCQNQNTRGS----SLQKDPR---------RCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQ-CRKDRLCDHVTGICYCADVAFGK--CEACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCI--YGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHN-GGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKES-DCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFC 3992
            F  IF   + +   +  A S +L+  MPNVC  ++  ++  R+      +  VKVWK  C     WC  +E ++    T      MV    YECC G+ +     GC    +   R G  C NG    ++G +  C+CP GF GT+C  D+NECE N GGCE +CCN  G +YCKC  G  +  +G++C D+NEC      C   C+N  G + C+C     +  D   CI  ++ C   N GGC H CV +    + C C   + L +D R C + + C+DNNGGC+ LC  +   +  +C C+ G+ +   D + C DI+EC+  +  C H C+N  GSF C CHPG+++G   K CY+++ME+ + C+  NGGC+  C  +     +CSC  G++L  D  TC D DEC + +  C     C N  G Y C+C  G  L  +   C+D+DECL  T GC          YKC    G       + C+  NG                                     +  + + +  +   R S     +Q+ PR          C  G FG++C  +C +C++ G C + +  C C P ++G IC   C +      C  L C C+NGG+C+  T +C CPPG+ G  CE GC  G+FG++C+  C    ++  CH++ G CLC PG+YG  CHL+CP  T G GCSK C C++ +  GCDPK G C CK  + G  C   C PG+FG  C  +C       C+  TG C  +   G +   C+  C  G  G +C  TC+CS     C+   G C C  G TG  C+  C  G +G +C  SC  C     C+  TG+C C     GK   + CP+G +GP C   C C   + CD  NG C C  G  G  C   C  G +G+ C   CQC      CDP+ G C C  G+ G++CE  C  G YG  C ++C+C NG  CD     C C PG+ G FCE+ C  G +G+NC   CQC      C  ++G C C PG+ G  C+ RCP+ ++GP C   C C+NGG C    G C C  G  G  C   CP   YG NC+  C C    +C+  TG C C     G++C+      +    CR  C C     C+ V G C+C  G  GP+C   C  G +GL+C + C+C N   C+   G+C C +G+ G  C   C  G++G NC   C  C   + C   TG+C C  G     C+ +C +G +G  C Q C C   A C+P TG C C  G  G  C+  C  + +G +C  +C C H++ C+ V+G C+CP    G  C
Sbjct:    2 FQNIFVFCVNVFCLIYTASSLQLQHSMPNVCTDQKMFVLGKRQPCVHAFTHMVKVWKQGCTSH-LWCSRYERRTAYYMTYQQVYGMVLHTVYECCPGWTQKDDEMGCF---HTGMRNGDSCHNGGRFAETG-DRICLCPSGFKGTYCQYDVNECEFNKGGCEGQCCNTIGSYYCKCSEGSRLGSDGRSCDDVNECEEFNGGCQQTCINTAGSYHCECSKGFRMHTDGRTCIA-LNSCSILN-GGCEHKCVDMGPNHYKCECQRNYKLKRDGRHCELRNPCQDNNGGCAQLCHFNVGHA--SCSCQSGFRL-ARDGRNCADIDECSSGSARCSHGCVNTVGSFRCVCHPGFELGAGGKQCYRIEMEIVNSCEKNNGGCSHHCEHTTGG-PLCSCNHGYQLSHDRKTCIDSDECASEESCCT--HVCRNYPGGYDCSCRAGLTLNPDGCGCDDVDECLAETSGCEHYCVNTLGSYKCFCPKGFRLNHDKHSCISLNGEEELEEEEEEDKDEKQLELSRFQDLLLHGNPQLMHYTSALRSHPSVYDAGVRDSKEDVEMQRGPRGELMLDSHIVCLGGFFGDDCTLSCKDCVN-GECTESKDRCHCSPGWTGIICNKTCPKGTYGQACISL-CLCQNGGSCDPVTGRCLCPPGVEGRFCEEGCPRGYFGQHCKAKCKCP-NNGPCHRLHGACLCSPGFYGRFCHLVCPRWTHGAGCSKECDCDREHSAGCDPKTGSCFCKAEFQGPQCDRACGPGFFGAGCEQTCDCPGGGSCDPTTGACIQRCPAGFHGDRCKLTCQMGNYGENCGLTCECS--GAPCDHITGQCLCPAGKTGSSCQEDCPDGFWGLKCHYSCPICENSSSCNKKTGLCDCKSGFMGKRCQKECPAGYYGPGCMNPCYCPPDSRCDAQNGHCHCPPGKRGHDCVTLCEPGFWGQSCVNRCQCQGPSVGCDPVDGRCVCEAGYSGDLCEKSCVNGSYGPGCSQRCQCQNGALCDHVSGACTCSPGFTGTFCERICLAGTFGQNCSRLCQCTELHDWCHPVTGTCSCSPGYYGKRCELRCPAGSFGPGCKSRCSCINGGSCDSRTGACYCSPGYIGAYCSRRCPQGYYGRNCVKQCFCGEGGQCNPATGRCICGPGRMGMTCQQACPRGRYGPQCRNACSCQNGALCDPVDGSCKCGLGWIGPRCDTACSQGKYGLNCAEDCQCLNNGTCDRFTGSCSCAAGYYGFTCQHTCPSGYHGVNCSHACY-CKTGQDCDHVTGKCICAPGYHGPQCQRRCEAGRFGAGCAQLCDCADEAPCDPQTGRCLCPPGRTGQRCEKHCNGDHFGPDCSLQCHCSHSARCDGVSGRCMCPLNWIGPVC 1335          

HSP 2 Score: 342.428 bits (877), Expect = 7.362e-97
Identity = 220/569 (38.66%), Postives = 294/569 (51.67%), Query Frame = 3
Query: 2331 CPTGGSGSDCRKTC-DCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIY---GNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKC--QCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQ-CLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSK--ESDCRQDCQCS-IKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVS 4001
            C  G  G DC  +C DC      C E    CHC+PG+TG  C   C KG YG+ C S C C+    CD VTG C C     G+   E CP G +G  C   C C  +  C +++G C+C  G+YG  C   CP   +G GCSKEC C       CDP +G C C   + G  C+  C  G++G  C++ C C  GG+CD     C  +C  G+HG+ C+ +C +G YG NC   C+C +G  CD I+G+C C  G  G +C E CP   +G  C+  C  C N   C+ + G+C C +G  G  C+  CP   YGP C++ C C    +CD + G C CP    G  C +  C+       C   CQC      C+ V G+C C+ G  G  C + C  G++G  C Q+C+C NG  C+ V G C C  GFTG  C+++C  G +G NC   C     +  CHP TG CSC  G     C+ +CP+G +GP C+  C C++G SC+  TGAC C  G+ GA C  RCP  +YG NC  +C C     CNP TG C+C     G  C+ +
Sbjct:  559 CLGGFFGDDCTLSCKDCVNGE--CTESKDRCHCSPGWTGIICNKTCPKGTYGQACISLCLCQNGGSCDPVTGRCLCPPGVEGRFCEEGCPRGYFGQHCKAKCKCPNNGPCHRLHGACLCSPGFYGRFCHLVCPRWTHGAGCSKECDCDREHSAGCDPKTGSCFCKAEFQGPQCDRACGPGFFGAGCEQTCDCPGGGSCDPTTGACIQRCPAGFHGDRCKLTCQMGNYGENCGLTCEC-SGAPCDHITGQCLCPAGKTGSSCQEDCPDGFWGLKCHYSCPICENSSSCNKKTGLCDCKSGFMGKRCQKECPAGYYGPGCMNPCYCPPDSRCDAQNGHCHCPPGKRGHDC-VTLCEPGFWGQSCVNRCQCQGPSVGCDPVDGRCVCEAGYSGDLCEKSCVNGSYGPGCSQRCQCQNGALCDHVSGACTCSPGFTGTFCERICLAGTFGQNCSRLCQCTELHDWCHPVTGTCSCSPGYYGKRCELRCPAGSFGPGCKSRCSCINGGSCDSRTGACYCSPGYIGAYCSRRCPQGYYGRNCVKQCFCGEGGQCNPATGRCICGPGRMGMTCQQA 1123          

HSP 3 Score: 328.176 bits (840), Expect = 4.772e-92
Identity = 226/614 (36.81%), Postives = 306/614 (49.84%), Query Frame = 3
Query: 2196 CDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKC--EACPSGKWGPTCNQNCDC--TYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYG-NCDPISGIC--RCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQ-CHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKA-TEKCDLKTGECTCPKSAFGLSCEIKNC--DSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCAN-GEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVS 4001
            C  G+FG DC+ SC +     C     +C      G   I C + CP G  G  C   C C +N  SC+   G C C PG  G+ CE  C +G +G+ C++ C+C  +  C  + G C C+   +G+     CP    G  C++ CDC   +S GCD   G C C A + GP+C + C  G +G GC + C C  G +CDP +G C  RC  G+HG+ C+  C  G YG+ C   C+C +G  CD    +C C  G  G  C++ C  G++G  C   C  C N   C+  +G CDC  G+ G  C + CP+  YGP C   C C    +C  +NG C CP G+ G  C   C P  +G +C++ C C+  +  CD   G C C     G  CE K+C   S    C Q CQC     C+ V+G C C PG  G  C ++C  G FG +C + C+C    + C+PV GTC C  G+ G  C+  C  G +GP CK +C  C    +C  +TG C C  G I   C  +CP GYYG  C + C C  G  CNP+TG C C  G  G  CQ  CP   YG  C++ C C + + C+PV G C C     G  C+ +
Sbjct:  559 CLGGFFGDDCTLSCKDCVNGECTESKDRC--HCSPGWTGIICNKTCPKGTYGQACISLCLC-QNGGSCDPVTGRCLCPPGVEGRFCEEGCPRGYFGQHCKAKCKCPNNGPCHRLHGACLCSPGFYGRFCHLVCPRWTHGAGCSKECDCDREHSAGCDPKTGSCFCKAEFQGPQCDRACGPGFFGAGCEQTCDCPGGGSCDPTTGACIQRCPAGFHGDRCKLTCQMGNYGENCGLTCEC-SGAPCDHITGQCLCPAGKTGSSCQEDCPDGFWGLKCHYSCPICENSSSCNKKTGLCDCKSGFMGKRCQKECPAGYYGPGCMNPCYCPPDSRCDAQNGHCHCPPGKRGHDCVTLCEPGFWGQSCVNRCQCQGPSVGCDPVDGRCVCEAGYSGDLCE-KSCVNGSYGPGCSQRCQCQNGALCDHVSGACTCSPGFTGTFCERICLAGTFGQNCSRLCQCTELHDWCHPVTGTCSCSPGYYGKRCELRCPAGSFGPGCKSRC-SCINGGSCDSRTGACYCSPGYIGAYCSRRCPQGYYGRNCVKQCFCGEGGQCNPATGRCICGPGRMGMTCQQACPRGRYGPQCRNACSCQNGALCDPVDGSCKCGLGWIGPRCDTA 1166          

HSP 4 Score: 238.039 bits (606), Expect = 4.054e-63
Identity = 152/397 (38.29%), Postives = 204/397 (51.39%), Query Frame = 3
Query: 2841 CDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCIC--KATEKCDLKTGECTCPKSAFGLSCEIKNCDSK--ESDCRQDCQCSIKKSCNQVTGKC--QCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSP-CNPVTGHCVCPKKLSGRFCEVSVIN 4010
            C  G++GD C   CK    G C     +C C PGW G  C K+C  G YG+ C   C C NGG CD ++G+C C PG  G  C+E CP   +G +C   C+C N G CH  +G C C  G +G  C L CP   +G  C   C C  + +  CD KTG C C     G  C+ + C      + C Q C C    SC+  TG C  +C  G  G +C   C+ GN+G +C   C C+ G PC+ + G CLC +G TG  C + C  G++G  C   C +C  + +C+ +TG C C++G +   C+ +CP+GYYGP C   C C   + C+   G C C  G  G  C   C   F+G +C +RC+C   S  C+PV G CVC    SG  CE S +N
Sbjct:  559 CLGGFFGDDCTLSCKDCVNGECTESKDRCHCSPGWTGIICNKTCPKGTYGQACISLCLCQNGGSCDPVTGRCLCPPGVEGRFCEEGCPRGYFGQHCKAKCKCPNNGPCHRLHGACLCSPGFYGRFCHLVCPRWTHGAGCSKECDCDREHSAGCDPKTGSCFCKAEFQGPQCD-RACGPGFFGAGCEQTCDCPGGGSCDPTTGACIQRCPAGFHGDRCKLTCQMGNYGENCGLTCECS-GAPCDHITGQCLCPAGKTGSSCQEDCPDGFWGLKCHYSCPICENSSSCNKKTGLCDCKSGFMGKRCQKECPAGYYGPGCMNPCYCPPDSRCDAQNGHCHCPPGKRGHDCVTLCEPGFWGQSCVNRCQCQGPSVGCDPVDGRCVCEAGYSGDLCEKSCVN 953          

HSP 5 Score: 90.1225 bits (222), Expect = 1.277e-17
Identity = 50/130 (38.46%), Postives = 67/130 (51.54%), Query Frame = 3
Query: 3609 VCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEV 3998
            VC  G++G +C L C  C  N  C     +C C  G     C   CP G YG  C   C C +G SC+P TG C C  G  G  C+  CP  ++G +C+ +CKC +N PC+ + G C+C     GRFC +
Sbjct:  558 VCLGGFFGDDCTLSCKDC-VNGECTESKDRCHCSPGWTGIICNKTCPKGTYGQACISLCLCQNGGSCDPVTGRCLCPPGVEGRFCEEGCPRGYFGQHCKAKCKCPNNGPCHRLHGACLCSPGFYGRFCHL 686          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Planmine SMEST
Match: SMESG000002074.1 (SMESG000002074.1)

HSP 1 Score: 2518.42 bits (6526), Expect = 0.000e+0
Identity = 1291/1297 (99.54%), Postives = 1294/1297 (99.77%), Query Frame = 3
Query:  141 MRFAIIFFLTIQIIPKLSGAGSQKLELGMPNVCEVEQRQMIRVRRTVEVPRSKEVKVWKANCRFKGDWCLVHENKSFVEKTETSQIQMVPSIKYECCEGYAELSGYRGCIPKPNCEERIGKYCQNGAFCYQSGYNAKCICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKCEACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVSVINRLKLSFI 4031
            MRFAIIFFLTIQIIPKLSGAGSQKLELGMPNVCEVEQRQMIRVRRTVEVPRSKEVKVWKANCRFKGDWCLVHENKSFVEKTETSQIQMVPSIKYECCEGYAELSGY GCIPKPNCE RIGKYCQNGAFCYQSGYNAKCICPKGFLGTFCDKDLNECEENNGGCEKECCNIDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGE+CEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSV CEEK+GICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKCEACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENG+CQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVSVINRLKLSFI
Sbjct:    1 MRFAIIFFLTIQIIPKLSGAGSQKLELGMPNVCEVEQRQMIRVRRTVEVPRSKEVKVWKANCRFKGDWCLVHENKSFVEKTETSQIQMVPSIKYECCEGYAELSGYLGCIPKPNCEARIGKYCQNGAFCYQSGYNAKCICPKGFLGTFCDKDLNECEENNGGCEKECCNIDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGELCEIGCTEGFFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVFCEEKDGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKCEACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGNCDPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGICQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVSVINRLKLSFI 1297          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Planmine SMEST
Match: SMESG000063217.1 (SMESG000063217.1)

HSP 1 Score: 105.145 bits (261), Expect = 3.371e-22
Identity = 267/982 (27.19%), Postives = 371/982 (37.78%), Query Frame = 3
Query: 1353 GLTCS-DEDECVTGKHK-CVPPSTCINDLGSYLCTCPVGYRLRKNKMTCE-DIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCN--DDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCES---ETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQIT--GKCLCFPGWYGSSCHLL-------------------------CPTGTWGIGCSKTCSCNQNNYEGCDPK---NGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSEN---------SVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFG-KCEACPSGKWGPTCNQNCDCTYSTGCDQING-QCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGNCDPISGICRCNPG---WHGEICENPCDE--------GYYGDQCKEKCK-----CLNGGTCDIFGRK--CQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISG--KCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKC--HPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCE--IKNCDSKESDCRQDCQCSIKKSCNQVTG--KCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKGQ---------------CPSGYYGPLCQQACQ------CMHGASCNPSTGA--CQCLSGFYGALCQFRCPNNFYGANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVSV 4004
            G TCS D DEC + +   C    TCIN +GSY C C  G+    N   CE DI +C + T   G  C++  GSYRCVCPN    G +   C+N+ T                     L     C + G C   D+   C+C   ++G  C  D ++NP ++        CKN G CES   +  KC C  G  G+ CE         +NC+K   +  +   C  +   GKC C PG+ G++C +                          CP G  G  C       + N + C P    NG  +C+    G  C  +C  G+ GL C     E    IC   T    ++ C   N+      C       +C+K     +N          V+ EEK   C C PGF G+ CE++  +  +   CQ   QC +D   D+   +C C     G KCE   +      C  N  C      D++ G +C C+  Y GP C+ +  +      C  +  CI GN    S  C C+     + G  CE   DE          YG             CLN   C        C+C   + G  CEK         NC     C NG  CD ++   +C C+ G+ G  C+       + P       C N  KC  H  +  C C +G  G  CE+    D    +CL +  C       +   EC C ++  G +CE   + CDS     +  C   I +  NQ T    C C+ G  GP+C    ++          CR   G PC       +C +      C   C   + G  C++K     + +TC     +      LIN  CK                 C SGY G  C+          C++G  C   TG   C+C  GF G  CQ    N  Y  +C +  KC            CVCP+ +SGRFCE  V
Sbjct:  167 GDTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGF----NGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNN-YFGTN---CENKRT---------------------LCELKPCKNGGICRDFDEDYQCICGNQWTGKNC--DDVKNPCKIN------PCKNNGFCESVNYQDYKCICQRGFEGKRCETSI------DNCQK--ISCFNGGSCINMIEGGKCNCLPGFEGNNCEINVNECENKPCQNNAKCIDLNNDYTCDCPEGLTGKNC-------EINIDECTPNPCLNG-ARCEDRVGGFTC--QCLQGFVGLRC-----ETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCVNGQCVDVNNEEK---CICIPGFEGRTCEIEINE-CFNNPCQHGSQC-QDLFNDY---LCICLPGFKGKKCEININECAHNPCGLNGQCI-----DEVYGFRCQCMLPYSGPTCANKL-DPCNPNACYNDAICIPGN-KYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLALLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKPL------NNCRND-PCRNGATCDNLADGFRCRCVAGFTGERCEIEINECQHNP-------CSNDAKCIDHINDYQCICQSGFSGKNCEIN-DNDCTESSCLGHGQCVDK----VNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSC---INRKVNQNTPGYLCNCRRGFTGPRCEIKMDW----------CR---GNPCGDFG---VCETDLDSFKCK--CNSEYIGERCEIK-----KTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVN-TNECYSNSC-NTGKCIDQIN----NFSCVCPRGVSGRFCETIV 1022          

HSP 2 Score: 68.1662 bits (165), Expect = 5.057e-11
Identity = 282/1138 (24.78%), Postives = 433/1138 (38.05%), Query Frame = 3
Query:  507 CQNGAFCYQSGY-NAKCICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGFYCKCPPGYEMSENGKNC-IDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRIN---CIPFIHPCDSANK-----GGCTHHCVK-LSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSC-YKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCS-DEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCED-IDECLDYTGGCGYKCV--NTDGSYRCVCPNGETLGKDNKTCQNQNTRGSSLQKDPRRC----PKGTFGEECLFNCSNCMHKGYCNDDQ-------TGCLCHPNYSGTICEI---DCLQNPSQVECQPLQCHCKNGGTCE--SETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSN-RC--HQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKN--GKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNHE----TGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCD------CSENSV-SCEEKNGICHCAPGFTGKRCELKCT---KGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKCEACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGNCDPISGI--CRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISG--KCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLN-GGKCHPENGM----------CQCPAGRHGDVCELT---CPPDKYGPN--CLHNCICKATEKCDLKTG---ECTCPKSAFGLSCEIKNCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFTGILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQ 3698
            C+N  FC    Y + KCIC +GF G  C+  ++ C++ +      C N+  G  C C PG+E    G NC I++NEC       + +C++L   + C CP  +      IN   C P  +PC +  +     GG T  C++    +R    C     + K    C   ++C + N           + S   C C  G      ++ +CK+I   N +       C++V     C C PG++     ++C  +++    +PC++G   C    N       +C CLPGFK    G  C  + +EC    + C     CI+++  + C C + Y    +  TC + +D C          C+  N   SY C C     LG+           GS  +KD   C     +       L + SN       ND+Q         C C   Y G  CE    +C  +P           C+NG TC+  ++  +C C  G +GE CEI   E      C+ N    CS++ +C  H    +C+C  G+ G +C +                    N   C   +  G  +C    +G  C  KC+  Y G +C     E  K  C+       G C ++     N+ G   +C  G +G  C    D      C +  V   +  +  C C   + G+RCE+K T   K    E+ ++  +   +++C H  G C+      G   +C SG  G  C  N D   S  C  ING                                  G C   +G+  C+C PG+ G  C+   +E Y  + C    KC++     I    C C  G  G FCE    V Y    C+ + +C NGG+C  + G  +C+C  G+ G  C+       Y    N      N  G C P   +          C C     G  CE     C   +   N  C +N IC    + ++       C CP    G  C+I +   + + C+ +  C   +  ++++ KC+C PG+ G      CE          KC   NG           C++GF   +C   C KG  G  C++    CN     + QT Q
Sbjct:  299 CKNNGFCESVNYQDYKCICQRGFEGKRCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFE----GNNCEINVNECENKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTP--NPCLNGARCEDRVGGFTCQCLQGFVGLR----CETKSDICKQLTPCKTEEICLNVNN----------TRSGYKCICPDGVQNCKKELSKCKNIVCVNGQ-------CVDVNNEEKCICIPGFE----GRTCEIEINECFNNPCQHG-SQCQDLFND-----YLCICLPGFK----GKKCEININEC--AHNPCGLNGQCIDEVYGFRCQCMLPY----SGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNC--STALGR---------YEGSKCEKDVDECNLDRTQLALYGLALLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKPLNNCRNDP-----------CRNGATCDNLADGFRCRCVAGFTGERCEIEINE------CQHN---PCSNDAKCIDHINDYQCICQSGFSGKNCEI--------------------NDNDCTESSCLGHGQCVDKVNGFEC--KCNENYIGTNC-----EHLKRPCDSNPCLNKGSCINRKVN-QNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKN--ESLINKICKH-HGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPC--ING----------------------------------GECGDGTGMYFCKCQPGFQGVNCQVNTNECY-SNSCNTG-KCID----QINNFSCVCPRGVSGRFCET--IVDY----CK-KMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGG----LFCEIDYVNECLSTKCY-NNGS----------CVNGFGKAICH--CNKGSCGEKCEITGSACNLASIDNSQTYQ 1261          

HSP 3 Score: 59.6918 bits (143), Expect = 2.023e-8
Identity = 251/1000 (25.10%), Postives = 348/1000 (34.80%), Query Frame = 3
Query:  447 LSGYRGCIPKPNCEERIGKYCQNGAFCYQSGYNAKCICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMR--FICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQC------------KDINECNIKNGGCQH--ICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDE-DECVTGKHKCVPPSTCI--NDLGSYLCTCPVGYRLRKNKMTCEDIDEC-LDYTGGCGY-------------------KCVNTDGSYRCVCPN---GETLGKDNKTCQNQNTRGSS----LQKDPR-RCPKGTFGEECLFNCSNCMHKGYCND-------DQTGCLCHPNYSGTICEID-------------------------CLQNPSQVECQPLQCHCK-----NGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQI--------TGKCLCFPGWYGSSCHLLCPTG--TWGIG-------CSKTCSCNQNNYEGCDPKNG--KCKCKKGYHGVNC-----------------------LY--KCDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEE----KNGI----CHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCAD---VAFGKCEACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGY-------YGPKCSKRCPEGLYGEGC---SKECQCIY----GNCDP------ISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTC-DIFGRK-CQCEPGWHGEFCE 2963
            L G+ G   + N  E   K CQN A C     +  C CP+G  G  C+                                         I+I+EC  N       C +  GGF CQC    + G   + C      C           C+ +++ R  + C CPDG            V  CK     C ++             C  G  +DVN+ ++C             +INEC   N  CQH   C ++   ++C C PG++     K    ++    +PC   NG C             C C+    L   G TC+++ D C    + C   + CI  N   SY C C       +     +D+DEC LD T    Y                   +C+NT+GS+ C C +   G    K    C+N   R  +    L    R RC  G  GE C    + C H    ND       +   C+C   +SG  CEI+                         C +N     C+ L+  C      N G+C +  +  N P    G +C   C  GF G  CE      C  N C           + KC C   + G  C +       ++ +         +K C  + N +   DP+ G  KC C+ GY G  C                       +Y  KC PG+ G++C  +  E     CN  TG+C D+     N+  C   CP G SG  C    D  +  + C+     KN I    C+C  GF GK CE    +  Y     ++            TG   C D        C+   +GK+  T    C+    +G        ICL  Y       Y   C   CP G  GE C   SK+CQ       G C P      +S  C C PG  G  CE       Y ++C    KC N G+C + FG+  C C  G  GE CE
Sbjct:  356 LPGFEGNNCEINVNECENKPCQNNAKCIDLNNDYTCDCPEGLTGKNCE-----------------------------------------INIDECTPNPCLNGARCEDRVGGFTCQC----LQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDG------------VQNCKKELSKCKNIV------------CVNGQCVDVNNEEKCICIPGFEGRTCEIEINEC--FNNPCQHGSQCQDLFNDYLCICLPGFK---GKKCEININECAHNPCGL-NGQCIDEVYGFR-----CQCM----LPYSGPTCANKLDPC--NPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLALLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKPLNNCRNDPCRNGATCDNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTP----GYLC--NCRRGFTGPRCEIKM-DWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFN--DPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCN--TGKCIDQI----NNFSCV--CPRGVSGRFCETIVDYCK-KMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCI--CPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEID-----YVNECLST-KCYNNGSCVNGFGKAICHCNKGSCGEKCE 1243          

HSP 4 Score: 56.225 bits (134), Expect = 2.195e-7
Identity = 277/1102 (25.14%), Postives = 403/1102 (36.57%), Query Frame = 3
Query:  507 CQNGAFCYQSGYNAKCICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGFYCKCPPGYEMSENGKNCID------INECIRN--------------------------------RTDCSH--ECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHH--CVKLSDMRFICSCPDGHILDKDRRSCSV-VDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQ--CKDINECNIKNGGCQHICLNVEGS---FICDCHPGWQIGHDHKSCYKVDMELTDPCKY---GNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDE-DECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCE-DIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQ---------------------------------NTRGSSLQKDPRRC----PKGTFGEECLFNCSNCMHKGYCNDDQ-------TGCLCHPNYSGTICEI---DCLQNPSQVECQPLQCHCKNGGTCE--SETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSN-RC--HQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKN--GKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCPEDCKTICNH----ETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCD------CSENSV-SCEEKNGICHCAPGFTGKRCELKCT---KGLYGERCQSSCQCRKDRLCDHVTGICYCADVAFGKCEACPSGKWGPTCNQNCDCTYSTGCDQIN-GQCICLAGYYGPKCSKRCPEGLYGEGCSKECQCIYGN-------CDPISGI-CRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTC-DIFGR-KCQCEPGWHGEFCE---KSCAVGYYGR------NCEGRCQCHNGGLCDGISGK--CDCMPGWRGINCDERCPS-QTYGPNCNQVCQCLNGGKCHPE---------NGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEI 3353
            C+NG  C     + +C+CP  + GT C+     CE         C + D  + C C   +     GKNC D      IN C  N                                +  C +   C+N+  G +C C P    G +  NC   ++ C++     C ++  C+ L++  + C CP+G       ++C + +D C  N   C +  + +      TC+C  G+     + K   CK +  C       + ICLNV  +   + C C  G Q      +C K   EL+  CK     NG C        N    C C+PGF    +G TC  E +EC    + C   S C +    YLC C  G++ +K    CE +I+EC     G   +C++    +RC C     L     TC N+                                    GS  +KD   C     +       L + SN       ND+Q         C C   Y G  CE    +C  +P           C+NG TC+  ++  +C C  G +GE CEI   E      C+ N    CS++ +C  H    +C+C  G+ G +C +                    N   C   +  G  +C    +G  C  KC+  Y G +C     E  K  C+       G C ++     N+ G   +C  G +G  C    D      C +  V   +  +  C C   + G+RCE+K T   K    E+ ++  +   +++C H  G C+      G   +C SG  G  C  N D   S  C  IN G+C    G Y  KC      G  G  C       Y N        D I+   C C  G  G  CE         D CK K +C NGG C ++ G  +C C  G+ G+ CE     C     G       N  G C       C    G   C C   + G  C+ R    + +  + N    C N G C  +         N  C CP G  G+ C++     +    C +N IC+  E  D  + +C CP    GL CEI
Sbjct:  223 CKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQW----TGKNCDDVKNPCKINPCKNNGFCESVNYQDYKCICQRGFEGKRCETSIDNCQKISCFNGGSCINMIEGGKCNCLP----GFEGNNCEINVNECENK---PCQNNAKCIDLNN-DYTCDCPEGLT----GKNCEINIDECTPN--PCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKT-----EEICLNVNNTRSGYKCICPDGVQ------NCKK---ELSK-CKNIVCVNGQCVDV-----NNEEKCICIPGF----EGRTCEIEINECFN--NPCQHGSQCQDLFNDYLCICLPGFKGKK----CEININECAHNPCGLNGQCIDEVYGFRCQC----MLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLALLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKPLNNCRNDP-----------CRNGATCDNLADGFRCRCVAGFTGERCEIEINE------CQHN---PCSNDAKCIDHINDYQCICQSGFSGKNCEI--------------------NDNDCTESSCLGHGQCVDKVNGFEC--KCNENYIGTNC-----EHLKRPCDSNPCLNKGSCINRKV-NQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKN--ESLINKICKH-HGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPC--INGGECGDGTGMYFCKCQP----GFQGVNCQVNTNECYSNSCNTGKCIDQINNFSCVCPRGVSGRFCETIV------DYCK-KMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGN--IPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNV-CKNNGICRPFEIDDRMSFKCECPPGVGGLFCEI 1205          

HSP 5 Score: 51.2174 bits (121), Expect = 7.179e-6
Identity = 99/366 (27.05%), Postives = 146/366 (39.89%), Query Frame = 3
Query: 3012 QCHNGGLCDG-ISGK--CDCMPGWRGINCDER--CPSQTYGPNCNQVCQCLNGGKCH--PENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNCDSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQMCEFGNFGLDCK--QKCRCANGEPCNPVDGT--CLCLSGFTGILCDQVCAKGWYGPNCKLKCL--VCNRNKTCHPQTGQCSCEAGLINYDCKGQCPSGYYGPLCQ------QACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANC---QHRCK---CFHNSPCNPVTGH---CVCPKKLSGRFCEVSVINRLKLS 4025
            +C NG  C   I+GK  C+C  G++G  C+++  CP          +  C NGG C     N +CQC     G+ CE +   +     C +  ICK+ E   +   EC CPK+  G++CE+ N    ++ C  + +C +    N    KC C  G  G  C       N   +C   +   C NG  C    G+  C C +GF G  C+          N  + C    C    TC  + G   C            CP+ Y+G  C+      +   C +G  C       QC+           C N + G NC   ++ CK   C +N  C  V      C+C +   G+ CE S+ N  K+S
Sbjct:   28 KCKNGATCQSDINGKYVCECAYGYKGTYCEQKSNCP----------ITPCQNGGTCKLIAGNYVCQCLNEWVGEFCEFS--SNCASSPCRNGGICKSLE---IHKYECQCPKNYLGMNCELPNSCGSQNPCGVNGKCIL---ANDGEVKCHCNKGYTGDTC------SNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCE----------NDIVDCTNDTCKNGGTCLDKIGSYRC-----------VCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCI-----------CGNQWTGKNCDDVKNPCKINPCKNNGFCESVNYQDYKCICQRGFEGKRCETSIDNCQKIS 337          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Planmine SMEST
Match: SMESG000077889.1 (SMESG000077889.1)

HSP 1 Score: 101.293 bits (251), Expect = 2.628e-21
Identity = 182/683 (26.65%), Postives = 261/683 (38.21%), Query Frame = 3
Query:  498 GKYCQNGAFCYQSGYNAKCICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXI----DGGFYCKCPPGYEMSENGKNCI------------------------------DINECIRNRTDCSHECVNLPGGFRCQCPPDMIL---GPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSV-VDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIK--NGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDED--ECVTG---KHKCVPPS----------------------TCINDLGSYLCTCPVGYRLRKNKMTC-----------------------------------EDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNT---RGSSLQKDPRRCPKGTFGE-------ECLFNCSNCMHKGYCNDDQTGCLCH-PNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEGFFGENCEKNCPTACSSNRCHQITG--KCLCFPGWYGSSCHLLCPTGTWGIGCSKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCD 2201
             K CQNG  C+Q     +C C +GF G  C  ++N C     G            +  F CKC  G+++  +GK+CI                              D++EC+     C   CVN  G ++C C     L   G   INC+      ++ NK G          +  IC C  G         CS+ +D CK N+ GC HLC + P S    C+C  G+ + +N  K C     CNI+  NGG   +C   +    C C PG+ +GH        + E  D C +    C   C ++ N   +CSCLPG+ L  D  TC   +  +CV G   ++KC  P                        C N +GS+ C C  G++L ++K +C                                   EDI+EC  Y+  C + C+NT+GSY+C C  G  L  ++ +CQ+  +    G     +  +C  G  GE       ECL N   C H    ++    C C+ P Y  T+    CL+             CKNGG C +   KC C PG  G+ CE    E      C+           C    G  +C+C PG+        C   T    C+  C        G      +C C  G+HG++C    D
Sbjct:  259 SKGCQNGGTCFQ----GRCQCTEGFEGDQCQLEINSCSSGQMGNRTCEHICVNEGENNFQCKCQSGFQLDNDGKSCIKEECSKFGTTEVVSGNCKCKQGWKGKFCNDDVDECL--FPVCQQICVNTIGSYQCSCREGFTLLSNGKCAINCL------NNCNKNG--------DCLNGICYCFSGW----HGEDCSLDIDECKYNH-GCEHLCVNVPGS--FNCQCHSGFTLQINK-KTCIS-KSCNIECLNGG---LCDKDK----CKCPPGY-VGH--------NCEFNDFCHFI-SPCEHNC-TTINDNMVCSCLPGYDLMPDKKTCKKLECPKCVRGTCNENKCKCPKGFTGLLCENDINECLNQTICQHVCTNTIGSFFCRCKNGHKLAEDKRSCIPPNKKTCLDKDCIHGQCFNSKCICKSGYRGKRCDEDINECKKYSHICEHFCMNTEGSYKCSCMPGFILSANSHSCQSVCSLCKNGKCDFNNKCKCKTGWTGELCDVDIDECLLNQHKCQHNCVNSNGSYSCSCNLPFYLSTVDGRSCLEKNDSCSSP-----CKNGGKCVNS--KCKCKPGYKGDSCEEDINE------CQWPISKHGCIGECRNTFGNYECICPPGYLVLDDQKTCQISTKDTMCNPHCL-----NGGVCRDMSRCYCPIGFHGIDCGVDVD 876          

HSP 2 Score: 93.5893 bits (231), Expect = 5.969e-19
Identity = 121/402 (30.10%), Postives = 172/402 (42.79%), Query Frame = 3
Query:  549 KCICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSH-ECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSC-SVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCH-PGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCS-DEDECV--TGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCE-------------------------------------DIDECLDYTGGCGYK--CVNTDGSYRCVCPNGETLGKDNKTCQ 1619
            KC CPKGF G  C+ D+NEC             I G F+C+C  G++++E+ ++CI  N+      DC H +C N     +C C      G     C   I+ C   +   C H C+  ++  + CSC  G IL  +  SC SV  LCK  NG C    +         CKC+ G+  ++ DV    DI+EC +    CQH C+N  GS+ C C+ P +    D +SC + +   + PCK G G C           + C C PG+K    G +C  D +EC     KH C+    C N  G+Y C CP GY +  ++ TC+                                     D+DEC  Y      +  C NT GS+ C C +   L  D  +C 
Sbjct:  557 KCKCPKGFTGLLCENDINECLNQTICQHVCTNTI-GSFFCRCKNGHKLAEDKRSCIPPNKKTCLDKDCIHGQCFNS----KCICKS----GYRGKRCDEDINECKKYSHI-CEHFCMN-TEGSYKCSCMPGFILSANSHSCQSVCSLCK--NGKCDFNNK---------CKCKTGWTGELCDV----DIDECLLNQHKCQHNCVNSNGSYSCSCNLPFYLSTVDGRSCLEKNDSCSSPCKNG-GKCVN---------SKCKCKPGYK----GDSCEEDINECQWPISKHGCI--GECRNTFGNYECICPPGYLVLDDQKTCQISTKDTMCNPHCLNGGVCRDMSRCYCPIGFHGIDCGVDVDECQRYAPCDKLRGICYNTYGSFYCQCSSNYVLMYDGTSCM 916          

HSP 3 Score: 90.5077 bits (223), Expect = 5.597e-18
Identity = 125/449 (27.84%), Postives = 169/449 (37.64%), Query Frame = 3
Query:  666 CKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHP----------------------CDS-----ANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLR------------------KNKMTC-----------------EDIDECL--DYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQ--------NQNTRGSSLQKDPRR--CPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICE 1790
            CKCPPGY     G NC + N+     + C H C  +     C C P   L PD+  C     P                      C++      N+  C H C   +   F C C +GH L +D+RSC   +     +  C H            C C+ GY     D    +DINEC   +  C+H C+N EGS+ C C PG+ +  +  SC  V       C     G   F N        C C  G+  E   L   D DEC+  +HKC     C+N  GSY C+C + + L                   KN   C                 EDI+EC       GC  +C NT G+Y C+CP G  +  D KTCQ        N +     + +D  R  CP G  G +C  +   C     C  D+   +C+  Y    C+
Sbjct:  489 CKCPPGYV----GHNC-EFNDFCHFISPCEHNCTTINDNMVCSCLPGYDLMPDKKTCKKLECPKCVRGTCNENKCKCPKGFTGLLCENDINECLNQTICQHVCTN-TIGSFFCRCKNGHKLAEDKRSCIPPNKKTCLDKDCIH-----GQCFNSKCICKSGYRGKRCD----EDINECKKYSHICEHFCMNTEGSYKCSCMPGFILSANSHSCQSV-------CSLCKNGKCDFNNK-------CKCKTGWTGE---LCDVDIDECLLNQHKC--QHNCVNSNGSYSCSCNLPFYLSTVDGRSCLEKNDSCSSPCKNGGKCVNSKCKCKPGYKGDSCEEDINECQWPISKHGCIGECRNTFGNYECICPPGYLVLDDQKTCQISTKDTMCNPHCLNGGVCRDMSRCYCPIGFHGIDCGVDVDECQRYAPC--DKLRGICYNTYGSFYCQ 901          

HSP 4 Score: 73.559 bits (179), Expect = 1.027e-12
Identity = 186/719 (25.87%), Postives = 267/719 (37.13%), Query Frame = 3
Query: 2196 CDPGYFGLDCSFSCPEDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCS---ENSVSCEEKNGICHCAPGFTGKRCELK---CTKGLYGERC-----------QSSCQCRKDRLCDHVTGICY--------CADVAFGKCEACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSKRCPEGLYGEG-CSKECQCIYGNC----DPISGICRCNPGWHGEICENPCDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCD--------ERCPSQTYGPNCNQVCQCLNGGKCHPE------------------NGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEKCDLKTGECTCPKSAFGLSCEIKNC--DSKESDCRQDCQCSIKKSCNQVTGKCQCKPGLRGPQCLQ----------MCEFGNFGLDCKQKCRC-------ANGEPCNPV-----------DGTCLCLSGFTGILCDQ----------------VCAKGWYGPNCKLKCLVCNRN-KTCHPQTGQCS--CEAGLINYDCKGQCPSGYYGPLCQQAC-QCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFYGANCQHRCKC-FHNSPCNPV---------TGHCVCPKKLSGRFCEVSV 4004
            C+ G+FG  C    PE CK     +   C          +     C    + ++C +   CS   +N  +C +  G C C  GF G +C+L+   C+ G  G R               C+C+     D+    C           +V  G C+ C  G  G  CN + D      C QI   C+   G Y  +CS R    L   G C+  C     NC    D ++GIC C  GWHGE C    DE  Y   C+  C  + G         CQC  G+  +  +K+C      ++C    +C NGGLCD    KC C PG+ G NC+          C       N N VC CL G    P+                     C+CP G  G +CE           CL+  IC+      + +  C C K+   L+ + ++C   +K++   +DC   I   C     KC CK G RG +C +          +CE      +   KC C       AN   C  V           +  C C +G+TG LCD                 V + G Y  +C L   +   + ++C  +   CS  C+ G    + K +C  GY G  C++   +C    S +   G C+   G Y  +    CP  +   + Q  C+    ++ CNP             C CP    G  C V V
Sbjct:  201 CETGWFGERCVILEPELCKQ---RKLLFCVHGCSFDKRKLDFSCICGIKETQNNCLELRTCSKGCQNGGTCFQ--GRCQCTEGFEGDQCQLEINSCSSGQMGNRTCEHICVNEGENNFQCKCQSGFQLDNDGKSCIKEECSKFGTTEVVSGNCK-CKQGWKGKFCNDDVDECLFPVCQQI---CVNTIGSY--QCSCREGFTLLSNGKCAINC---LNNCNKNGDCLNGICYCFSGWHGEDCSLDIDECKYNHGCEHLCVNVPGSF------NCQCHSGFTLQINKKTCI----SKSC--NIECLNGGLCD--KDKCKCPPGYVGHNCEFNDFCHFISPCEHNCTTINDNMVCSCLPGYDLMPDKKTCKKLECPKCVRGTCNENKCKCPKGFTGLLCENDINE------CLNQTICQHVCTNTIGSFFCRC-KNGHKLAEDKRSCIPPNKKTCLDKDC---IHGQC--FNSKCICKSGYRGKRCDEDINECKKYSHICEHFCMNTEGSYKCSCMPGFILSANSHSCQSVCSLCKNGKCDFNNKCKCKTGWTGELCDVDIDECLLNQHKCQHNCVNSNGSYSCSCNLPFYLSTVDGRSCLEKNDSCSSPCKNGGKCVNSKCKCKPGYKGDSCEEDINECQWPISKHGCIGECRNTFGNYECI----CPPGYLVLDDQKTCQISTKDTMCNPHCLNGGVCRDMSRCYCPIGFHGIDCGVDV 875          

HSP 5 Score: 65.4698 bits (158), Expect = 2.830e-10
Identity = 96/363 (26.45%), Postives = 145/363 (39.94%), Query Frame = 3
Query:  405 VPSIKYECCEGYAELSGYRGCIPKPNCEERIGKYCQNGAFCYQSGYNAKCICPKGFLGTFCDKDLXXXXXXXXXXXXXXXXIDGGFYCKCPPGYEMSENGKNC------------------------------IDINECIRNRTDCSHECVNLPGGFRCQC-PPDMILGPDRINCIPFIHPCDS--ANKGGCT----------------------------HHCV---KLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGY-AIDVN-DVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDP-CKY---GNGGCTQ 1283
            + S    C  G+      R CIP PN +  + K C +G       +N+KCIC  G+ G  CD+D+NEC++ +  CE  C N +G + C C PG+ +S N  +C                              +DI+EC+ N+  C H CVN  G + C C  P  +   D  +C+     C S   N G C                             H C+   + +   + C CP G+++  D+++C +    KD      H         +  C C  G+  ID   DV +C+    C+   G    IC N  GSF C C   + + +D  SC  +   +  P  +Y   GN G T+
Sbjct:  590 IGSFFCRCKNGHKLAEDKRSCIP-PNKKTCLDKDCIHG-----QCFNSKCICKSGYRGKRCDEDINECKKYSHICEHFCMNTEGSYKCSCMPGFILSANSHSCQSVCSLCKNGKCDFNNKCKCKTGWTGELCDVDIDECLLNQHKCQHNCVNSNGSYSCSCNLPFYLSTVDGRSCLEKNDSCSSPCKNGGKCVNSKCKCKPGYKGDSCEEDINECQWPISKHGCIGECRNTFGNYECICPPGYLVLDDQKTCQIST--KDTMCN-PHCLNGGVCRDMSRCYCPIGFHGIDCGVDVDECQRYAPCDKLRG----ICYNTYGSFYCQCSSNYVLMYDGTSCMTMKEAVLKPHLRYRGRGNKGVTK 939          

HSP 6 Score: 64.6994 bits (156), Expect = 4.400e-10
Identity = 175/705 (24.82%), Postives = 240/705 (34.04%), Query Frame = 3
Query: 1563 YRCVCPNGETLGK--DNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCL---QNPSQVECQP-----------LQCHCKNGGTCESETLKCNCPPGISGEIC-----------------------EIGCTEGFF---GENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGCSKTC-----SCNQNNYEGCDPKNGKCKCKKGYHGVNCLY---------KCDPGYFGLDCSFS--------CPEDCKTICNHETGQC-PDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENSVSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVTGICYCA-----DVAFGKCEACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGYYGPKCSK-------------------------RCPEGLYGEGCSKECQ-----CIYGNCDPISGICRCNPGWHGEICENPCDE----------------GYY--------------GDQCKEK-----CKCLNGGTCDIFGRKCQCEPGWHGEFCEK---SCAVGYYGRNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVCQCLNGGKCHPENGMCQCPAGRHG-------DVCELTCPPDK 3242
            + C+C   ET     + +TC      G +  +   +C +G  G++C    ++      C+  Q G           CE  C+   +N  Q +CQ            ++  C   GT E  +  C C  G  G+ C                       +  C EGF       C  NC   C+ N    + G C CF GW+G  C L      +  GC   C     S N   + G   +  K  C      + CL          KC PGY G +C F+        C  +C TI ++    C P      +     + +CP    G+       C+EN          C C  GFTG  CE    + L    CQ         +C +  G  +C       +A  K    P  K   TC    DC +       N +CIC +GY G +C +                          C  G      S  CQ     C  G CD  +  C+C  GW GE+C+   DE                G Y              G  C EK       C NGG C     KC+C+PG+ G+ CE+    C        C G C+   G        +C C PG+  ++  + C   T    CN    CLNGG C  +   C CP G HG       D C+   P DK
Sbjct:  239 FSCICGIKETQNNCLELRTCSKGCQNGGTCFQGRCQCTEGFEGDQCQLEINS------CSSGQMG--------NRTCEHICVNEGENNFQCKCQSGFQLDNDGKSCIKEECSKFGTTEVVSGNCKCKQGWKGKFCNDDVDECLFPVCQQICVNTIGSYQCSCREGFTLLSNGKCAINCLNNCNKNG-DCLNGICYCFSGWHGEDCSLDIDECKYNHGCEHLCVNVPGSFNCQCHSGFTLQINKKTCISKSCNIECLNGGLCDKDKCKCPPGYVGHNCEFNDFCHFISPCEHNCTTINDNMVCSCLPGYDLMPDKKTCKKLECPKCVRGT-------CNENK---------CKCPKGFTGLLCENDINECLNQTICQ--------HVCTNTIGSFFCRCKNGHKLAEDKRSCIPPNK--KTCLDK-DCIHGQC---FNSKCICKSGYRGKRCDEDINECKKYSHICEHFCMNTEGSYKCSCMPGFILSANSHSCQSVCSLCKNGKCD-FNNKCKCKTGWTGELCDVDIDECLLNQHKCQHNCVNSNGSYSCSCNLPFYLSTVDGRSCLEKNDSCSSPCKNGGKC--VNSKCKCKPGYKGDSCEEDINECQWPISKHGCIGECRNTFGNY------ECICPPGYLVLDDQKTCQISTKDTMCNP--HCLNGGVCR-DMSRCYCPIGFHGIDCGVDVDECQRYAPCDK 886          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Planmine SMEST
Match: SMESG000021248.1 (SMESG000021248.1)

HSP 1 Score: 97.8265 bits (242), Expect = 5.239e-20
Identity = 106/356 (29.78%), Postives = 147/356 (41.29%), Query Frame = 3
Query:  660 FYCKCPPGYEMSENGKNCIDINECIRNRTDCS---HECVNLPGGFRC--QCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNG--GCQHICLNVEGSFICD--CHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFK-------LEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCE-------------------DIDECLDYTG--GCGYKCVNTDGSYRCVCPNGETLGKDNKTC 1616
            F C C  G+ +S +GK+C DINEC +N + CS   HEC+N PG + C  +C P +    D++ C             G  + CV+  +   IC                   LC + +G                C CR GY    N    C DI+EC++     G    C N  GSF C+  C+ G+Q+ ++   CY +     D C  G   C+        K + C+ LPG             G TC D +EC T   +C+    C N  GSY C CP  +   ++K +C                    DIDEC  YT    C Y+C+NT GSY C+CP G +L      C
Sbjct: 3677 FKCNCRSGFMLSSDGKSCQDINECSKNISPCSEPNHECINTPGSYMCKPKCAPGLRRSFDKLTC-------------GDINECVEKPN---ICDS----------------QLCINTHGSY-------------YCLCRHGYKKMKNS---CIDIDECSLGIAKCGLHQKCRNTPGSFFCENLCYDGYQLINEQ--CYDL-----DECSSGTANCS--------KSSTCTNLPGSYRCECNDGFYTSGSTCIDVNECQTNSSQCI--YGCKNTYGSYECICPPNFIQSRDKKSCLKKHEICKTGFTWTSDRGCIDIDECTSYTNPHSCQYQCINTYGSYHCLCPPGFSLNPKTMKC 3967          

HSP 2 Score: 91.2781 bits (225), Expect = 5.074e-18
Identity = 100/325 (30.77%), Postives = 139/325 (42.77%), Query Frame = 3
Query:  672 CPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRI--NCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCS---HLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGC-QHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNG--GCTQFCNSSPNKRAICS--CLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTC 1616
            CPPG+ + ++ + C D+NEC   +    H+C                   D+I  N +P                       RF C+C  G +L  D +SC  ++ C  N   CS   H C + P S +   KC PG     + +  C DINEC  K   C   +C+N  GS+ C C  G++      SC  +D      C  G    G  Q C ++P     C   C  G++L  +   C D DEC +G   C   STC N  GSY C C  G+    +  TC D++EC   +  C Y C NT GSY C+CP      +D K+C
Sbjct: 3639 CPPGFTLIKSQRFCEDVNEC---KNAKLHKC-------------------DQICENTVP-----------------------RFKCNCRSGFMLSSDGKSCQDINECSKNISPCSEPNHECINTPGSYMCKPKCAPGLRRSFDKL-TCGDINECVEKPNICDSQLCINTHGSYYCLCRHGYK--KMKNSCIDID-----ECSLGIAKCGLHQKCRNTPGS-FFCENLCYDGYQLINE--QCYDLDECSSGTANCSKSSTCTNLPGSYRCECNDGFYTSGS--TCIDVNECQTNSSQCIYGCKNTYGSYECICPPNFIQSRDKKSC 3905          

HSP 3 Score: 75.8702 bits (185), Expect = 2.327e-13
Identity = 94/317 (29.65%), Postives = 119/317 (37.54%), Query Frame = 3
Query:  654 GGFYCKCPPGYEMSENGKNCIDINECIRNRTDC--SHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSH--LCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHPGWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFKLEADGLTCSDEDECV--TGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYTGGCGYK--CVNTDGSYRCVCP 1580
            G +YC C  GY+  +N  +CIDI+EC      C    +C N PG F C+                                            C DG+ L  ++  C  +D C      CS    C + P S    C+C  G+         C D+NEC   +  C + C N  GS+ C C P +    D KSC K                         K  IC    GF   +D   C D DEC   T  H C     CIN  GSY C CP G+ L    M C D+DEC    G C  K  C+NT G+Y C+ P
Sbjct: 3763 GSYYCLCRHGYKKMKN--SCIDIDECSLGIAKCGLHQKCRNTPGSFFCE------------------------------------------NLCYDGYQLINEQ--CYDLDECSSGTANCSKSSTCTNLPGS--YRCECNDGF---YTSGSTCIDVNECQTNSSQCIYGCKNTYGSYECICPPNFIQSRDKKSCLK-------------------------KHEICKT--GFTWTSDR-GCIDIDECTSYTNPHSC--QYQCINTYGSYHCLCPPGFSLNPKTMKCLDVDECRTNLGICSEKKLCINTPGNYSCIEP 3998          

HSP 4 Score: 58.5362 bits (140), Expect = 4.548e-8
Identity = 59/201 (29.35%), Postives = 87/201 (43.28%), Query Frame = 3
Query:  648 IDGGFYCKCPPGYEMSENGKNCIDINECIRNRTDCSHECVNLPGGFRCQCPPDMILGPDRINCIP--------FIHPCDS-----------ANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSH--LCQSDPSS-SVITCKCRPGYAIDVND---VKQCKDINE-CNIKNGGCQHICLNVEGSF 1172
            + G + C+C  G+  S  G  CID+NEC  N + C + C N  G + C CPP+ I   D+ +C+         F    D             N   C + C+      + C CP G  L+     C  VD C+ N G CS   LC + P + S I  KC   Y  D+     V  C + +E C  ++   Q+I +++ GS 
Sbjct: 3845 LPGSYRCECNDGFYTS--GSTCIDVNECQTNSSQCIYGCKNTYGSYECICPPNFIQSRDKKSCLKKHEICKTGFTWTSDRGCIDIDECTSYTNPHSCQYQCINTYG-SYHCLCPPGFSLNPKTMKCLDVDECRTNLGICSEKKLCINTPGNYSCIEPKCPKSYHFDIKLKACVSNCTEKSEICLSQSSRIQYIVVHMTGSL 4042          
BLAST of Multiple epidermal growth factor domains protein 6 vs. Planmine SMEST
Match: SMESG000032548.1 (SMESG000032548.1)

HSP 1 Score: 91.6633 bits (226), Expect = 2.576e-18
Identity = 104/341 (30.50%), Postives = 142/341 (41.64%), Query Frame = 3
Query:  681 GYEMSENGKNCIDINECIRNRTDCS--HECVNLPGGFRCQ---CPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDN----NGGC--SHLCQSDPSSS--VITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQ--HICLNVEGSFIC---DCHPGWQIGHDHKSC-----YKVDMEL----TDPCKYGNG----GCTQFCNSSPNKRA---ICSCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMTCEDIDECLDYT-----GGCGYKCVNTDGSYRCVCPNG 1586
            G++   +  +C+D++EC      C    +CVN+ G  RC+   CP +M                   NKG C+              C DG    K+ RSC  +D C  N    NG C  + +C + P S   +   KCRPG  +  N +  C DI+EC      C+   IC+N   S+ C    C P  Q  +    C     Y+ + +      D C    G    G    C + P   A      C PG    +    C D DEC TG+ KC     C+N +GSY C C  GY L  N  TC D++ECL +           +CVNT GSY+C CP G
Sbjct:  396 GWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINM----------------KRNNKGICSR-------------CKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGI-ACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNN-TCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKG 705          

HSP 2 Score: 65.855 bits (159), Expect = 2.106e-10
Identity = 118/466 (25.32%), Postives = 167/466 (35.84%), Query Frame = 3
Query:  756 HECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHHCVKL-SDMR---------------------FICSCPDGHILDK-----DRRSCSVVDLCKD-----NNGGCSHLCQSDPSSSVITCKCRPGYAIDVNDVKQCKDINECNIKNGGC--QHICLNVEGSFICD------------------CHPGWQIGHDHKSCYKVDMELTDPCKYGNGGC--TQFCNSSPNKRAIC---SCLPGFKLEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCT------------------CPVGYRLRKNKMTCEDIDECLDYTG----GCGYKCVNTDGSYRCV----CPNGETLGKDNKTCQNQNTRGSSLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICEIDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGI 1904
            H CV L       CP + IL P+   C+P + P    +KG   +  +++  D+                      F C C  G    K     D   C  V++C D     NN G     +S P        C  G+  D  D   C D++EC      C     C+N+ GS  C+                  C  G+    + +SC  +D E T    + NG C  T  C + P          C PG  L  +G+ C+D DEC   K +C P   C+N   SY C                   C  GYR  ++ + C D+DEC +  G    G  Y C+N  GSY C+    CP G         CQ+ +      +    +CP+         +C N +    C  D+   L   N    + E  CL    +  C  L+  C N       + KC CP G 
Sbjct:  273 HVCVQLI----ISCPKNFILHPNTSKCVPVVKPKVPCSKGFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIP--------CGFGWKEDP-DTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDID-ECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQDSI-CTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVD----ECETGEGKCPQN-------MHCVNVVGSYKCMCDRGYILTSNNTCADVNE--CLLFRPEESCPDLEARCVNTAG----SYKCQCPKGF 706          
The following BLAST results are available for this feature:
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MEGF63.835e-17135.60multiple EGF like domains 6 [Source:HGNC Symbol;Ac... [more]
MEGF60.000e+035.87multiple EGF like domains 6 [Source:HGNC Symbol;Ac... [more]
MEGF66.214e-11534.44multiple EGF like domains 6 [Source:HGNC Symbol;Ac... [more]
MEGF112.272e-13640.60multiple EGF like domains 11 [Source:HGNC Symbol;A... [more]
MEGF111.255e-13540.00multiple EGF like domains 11 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Y64G10A.71.299e-15036.01pep chromosome:WBcel235:IV:14291901:14319564:1 gen... [more]
Y64G10A.72.260e-9335.51pep chromosome:WBcel235:IV:14291901:14319564:1 gen... [more]
Y64G10A.73.594e-17134.93pep chromosome:WBcel235:IV:14291901:14319564:1 gen... [more]
Y64G10A.72.045e-17334.50pep chromosome:WBcel235:IV:14291901:14319564:1 gen... [more]
Y64G10A.74.109e-17933.40pep chromosome:WBcel235:IV:14291901:14319564:1 gen... [more]
back to top
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
drpr2.102e-11335.56gene:FBgn0027594 transcript:FBtr0334080[more]
drpr5.419e-11335.56gene:FBgn0027594 transcript:FBtr0072799[more]
drpr7.975e-11335.56gene:FBgn0027594 transcript:FBtr0334079[more]
frac3.052e-4032.64gene:FBgn0035798 transcript:FBtr0290277[more]
frac3.052e-4032.64gene:FBgn0035798 transcript:FBtr0301222[more]
back to top
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
megf6a2.837e-17037.21multiple EGF-like-domains 6a [Source:ZFIN;Acc:ZDB-... [more]
megf6a5.573e-16637.21multiple EGF-like-domains 6a [Source:ZFIN;Acc:ZDB-... [more]
megf6b5.428e-14336.79multiple EGF-like-domains 6b [Source:ZFIN;Acc:ZDB-... [more]
BX004787.27.429e-16236.75multiple EGF-like-domains 6a [Source:NCBI gene;Acc... [more]
zgc:1583281.071e-14036.21zgc:158328 [Source:ZFIN;Acc:ZDB-GENE-070112-1202][more]
back to top
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc5b1.029e-15740.09unc-5 netrin receptor B [Source:Xenbase;Acc:XB-GEN... [more]
unc5b9.013e-12938.85unc-5 netrin receptor B [Source:Xenbase;Acc:XB-GEN... [more]
unc5b7.167e-7736.33unc-5 netrin receptor B [Source:Xenbase;Acc:XB-GEN... [more]
unc5b4.172e-14637.17unc-5 netrin receptor B [Source:Xenbase;Acc:XB-GEN... [more]
MEGF113.066e-12638.71multiple EGF-like-domains 11 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Megf62.373e-17834.88multiple EGF-like-domains 6 [Source:MGI Symbol;Acc... [more]
Megf62.652e-9636.00multiple EGF-like-domains 6 [Source:MGI Symbol;Acc... [more]
Megf118.833e-13540.43multiple EGF-like-domains 11 [Source:MGI Symbol;Ac... [more]
Megf115.621e-13440.43multiple EGF-like-domains 11 [Source:MGI Symbol;Ac... [more]
Megf111.213e-13039.72multiple EGF-like-domains 11 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Multiple epidermal growth factor domains protein 6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O88281|MEGF6_RAT6.903e-17835.65Multiple epidermal growth factor-like domains prot... [more]
sp|Q80V70|MEGF6_MOUSE5.712e-17734.88Multiple epidermal growth factor-like domains prot... [more]
sp|O75095|MEGF6_HUMAN1.842e-17035.60Multiple epidermal growth factor-like domains prot... [more]
sp|A6BM72|MEG11_HUMAN6.337e-13440.00Multiple epidermal growth factor-like domains prot... [more]
sp|Q80T91|MEG11_MOUSE3.932e-13340.43Multiple epidermal growth factor-like domains prot... [more]
back to top
BLAST of Multiple epidermal growth factor domains protein 6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RMW61.204e-12438.66Multiple epidermal growth factor domains protein 6... [more]
A0A4Z2DCC16.384e-10239.13Multiple epidermal growth factor-like domains prot... [more]
A0A4S2LUT33.451e-16237.95Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2LTQ92.769e-16237.95Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2LTR02.472e-16037.48Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MEGF65.612e-14837.32multiple EGF like domains 6 [Source:NCBI gene;Acc:... [more]
MEGF62.863e-14836.93multiple EGF like domains 6 [Source:NCBI gene;Acc:... [more]
megf6b1.568e-17437.53multiple EGF-like-domains 6b [Source:ZFIN;Acc:ZDB-... [more]
megf113.538e-13238.45multiple EGF like domains 11 [Source:NCBI gene;Acc... [more]
megf111.373e-12939.86multiple EGF like domains 11 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009938.15.851e-15535.64pep scaffold:Pmarinus_7.0:GL476399:1110574:1308132... [more]
ENSPMAT00000007575.16.254e-9040.97pep scaffold:Pmarinus_7.0:GL479777:18063:31178:-1 ... [more]
megf105.039e-5140.89multiple EGF-like-domains 10 [Source:NCBI gene;Acc... [more]
megf106.779e-5140.89multiple EGF-like-domains 10 [Source:NCBI gene;Acc... [more]
ENSPMAT00000007940.11.967e-3941.63pep scaffold:Pmarinus_7.0:GL476818:32523:83161:-1 ... [more]
back to top
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO383182.099e-13138.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO455435.228e-5036.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO443982.604e-4637.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO346832.739e-4535.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO398824.180e-4037.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Multiple epidermal growth factor domains protein 6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
megf6b6.051e-16036.65multiple EGF like domains 6 [Source:NCBI gene;Acc:... [more]
zgc:1583288.421e-9636.09multiple epidermal growth factor-like domains prot... [more]
zgc:1583287.457e-12035.31multiple epidermal growth factor-like domains prot... [more]
megf6b8.805e-16137.07multiple EGF like domains 6 [Source:NCBI gene;Acc:... [more]
zgc:1583287.362e-9734.66multiple epidermal growth factor-like domains prot... [more]
back to top
BLAST of Multiple epidermal growth factor domains protein 6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000002074.10.000e+099.54SMESG000002074.1[more]
SMESG000063217.13.371e-2227.19SMESG000063217.1[more]
SMESG000077889.12.628e-2126.65SMESG000077889.1[more]
SMESG000021248.15.239e-2029.78SMESG000021248.1[more]
SMESG000032548.12.576e-1830.50SMESG000032548.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005066 ID=SMED30005066|Name=Multiple epidermal growth factor domains protein 6|organism=Schmidtea mediterranea sexual|type=transcript|length=4095bp
TTGTATAAAATAATGGCGCATACAAACATATACAAATTCTGATTCATTTT
TTTGACAAAAACTGCAAAGCTAGCTGATATCAGAGGCATCAGATCATTTT
TATATACCAATTGTCTTAACAAATTTTATGAAAATATGAAATGAGATTTG
CAATTATTTTTTTCTTGACAATCCAAATCATTCCGAAGCTGTCGGGCGCC
GGCTCTCAGAAGTTGGAACTGGGAATGCCAAATGTCTGTGAAGTTGAACA
ACGACAAATGATACGAGTCCGACGGACTGTGGAGGTACCACGATCGAAGG
AAGTAAAAGTATGGAAAGCCAACTGCAGGTTCAAAGGAGATTGGTGTCTT
GTCCATGAAAACAAAAGCTTTGTGGAGAAAACAGAGACTTCCCAAATTCA
GATGGTGCCAAGCATAAAATATGAATGTTGCGAAGGTTATGCAGAATTGT
CAGGATATCGAGGCTGCATACCAAAACCGAATTGTGAGGAGAGAATTGGA
AAGTATTGCCAGAATGGAGCGTTCTGTTATCAAAGTGGCTATAATGCCAA
GTGTATTTGTCCCAAAGGGTTTTTGGGAACATTCTGTGACAAAGATCTCA
ATGAATGTGAAGAGAACAATGGAGGGTGTGAAAAGGAATGCTGTAATATC
GATGGCGGCTTTTATTGCAAATGCCCTCCCGGATACGAAATGTCAGAAAA
CGGAAAGAATTGCATAGACATCAATGAATGTATCAGAAATCGGACCGACT
GCTCACACGAATGCGTCAATTTGCCTGGAGGGTTCAGATGTCAATGTCCA
CCTGACATGATTCTTGGTCCGGATCGAATCAACTGCATTCCATTTATTCA
CCCCTGTGACAGTGCAAACAAGGGCGGCTGCACTCATCATTGCGTCAAAC
TCAGCGATATGAGATTCATTTGCTCATGTCCCGATGGCCATATCCTTGAC
AAGGACAGGAGAAGCTGCTCAGTTGTGGATCTGTGCAAAGACAACAATGG
TGGATGCAGTCATTTGTGCCAGTCCGATCCGTCATCATCAGTAATAACAT
GTAAATGCCGTCCGGGTTACGCAATAGATGTAAATGATGTAAAGCAATGC
AAAGACATCAATGAATGTAATATCAAAAATGGCGGATGCCAACATATCTG
TCTAAATGTCGAAGGTTCATTCATTTGTGACTGTCATCCAGGGTGGCAAA
TTGGACATGATCACAAATCGTGCTATAAAGTGGATATGGAGTTGACAGAC
CCATGCAAATATGGCAATGGCGGATGCACCCAATTCTGTAATTCCTCACC
AAATAAACGGGCAATATGTTCGTGTTTGCCCGGCTTTAAACTTGAAGCAG
ATGGCTTGACTTGCAGTGATGAGGATGAGTGCGTCACCGGGAAGCATAAA
TGCGTACCCCCTTCTACATGTATCAATGATTTGGGATCATATTTATGTAC
TTGTCCAGTTGGATATCGTTTGAGAAAAAATAAAATGACTTGTGAAGATA
TAGATGAATGCCTCGACTATACCGGAGGCTGTGGGTATAAATGTGTGAAT
ACCGACGGTTCTTACAGATGCGTTTGTCCGAACGGGGAAACCCTTGGAAA
AGATAACAAAACTTGTCAGAATCAGAACACCAGGGGATCCAGTTTGCAGA
AAGATCCGAGAAGGTGCCCTAAAGGTACATTTGGGGAAGAATGTCTATTC
AATTGCTCCAATTGTATGCACAAGGGATATTGCAATGATGACCAGACTGG
ATGCCTTTGCCATCCTAATTATTCCGGGACTATTTGTGAAATTGACTGCC
TCCAGAATCCATCCCAAGTCGAATGCCAACCCCTGCAATGTCATTGTAAA
AATGGTGGCACTTGTGAATCAGAAACTCTAAAATGTAATTGTCCTCCTGG
GATATCTGGAGAAATCTGTGAGATTGGATGTACAGAAGGATTCTTCGGAG
AAAACTGTGAAAAGAATTGTCCTACTGCATGTTCATCAAATCGGTGCCAT
CAAATTACAGGAAAGTGCCTATGCTTTCCTGGATGGTATGGCAGCAGTTG
CCATTTGCTATGTCCAACCGGAACTTGGGGAATCGGTTGCTCCAAGACTT
GTTCATGCAATCAAAATAATTATGAAGGTTGCGATCCAAAAAATGGTAAA
TGTAAGTGCAAAAAAGGTTATCATGGTGTAAATTGCTTGTATAAATGCGA
TCCTGGATACTTTGGGTTAGATTGCAGTTTTAGTTGTCCAGAAGATTGCA
AAACCATTTGTAATCACGAAACTGGTCAATGTCCGGATAAAACATGCCAA
GGAAATAACTCAATCGGATGCCAAAGAGATTGTCCTACCGGCGGAAGTGG
AAGTGATTGCCGCAAAACTTGTGACTGTTCAGAGAATTCTGTATCCTGTG
AAGAGAAAAACGGAATCTGCCACTGCGCGCCAGGTTTCACTGGGAAAAGA
TGTGAACTAAAATGCACTAAAGGTCTTTACGGAGAAAGATGTCAATCGAG
CTGTCAGTGTAGAAAGGATAGGCTATGTGACCATGTTACTGGAATATGTT
ATTGCGCTGATGTTGCTTTCGGAAAATGTGAAGCATGCCCATCAGGGAAA
TGGGGACCGACCTGTAACCAGAACTGCGACTGCACCTACAGCACAGGATG
CGATCAAATAAACGGCCAATGTATATGCCTTGCAGGATATTATGGTCCAA
AATGTTCAAAGAGATGTCCTGAAGGTCTTTATGGGGAAGGTTGCAGCAAA
GAGTGTCAATGCATTTATGGAAATTGTGATCCTATTTCTGGAATATGCCG
ATGTAATCCTGGATGGCATGGGGAAATTTGTGAAAACCCCTGTGATGAGG
GATATTATGGAGATCAGTGTAAAGAGAAATGTAAATGTTTAAATGGGGGA
ACGTGCGACATATTCGGTAGGAAATGCCAATGTGAACCTGGATGGCATGG
AGAATTTTGTGAAAAATCATGCGCAGTGGGATATTATGGAAGAAATTGTG
AAGGTCGTTGTCAGTGTCACAATGGAGGTCTATGTGATGGGATATCGGGG
AAATGTGATTGTATGCCTGGTTGGAGAGGTATAAACTGCGATGAAAGATG
TCCCAGTCAAACATATGGACCAAACTGTAATCAAGTTTGTCAATGCTTGA
ATGGTGGAAAGTGCCATCCAGAAAATGGTATGTGTCAATGCCCAGCTGGA
CGACATGGTGATGTCTGCGAGTTAACTTGCCCACCAGATAAATACGGTCC
GAATTGCTTACATAACTGCATTTGCAAAGCGACAGAGAAATGCGACTTGA
AAACTGGAGAATGCACTTGTCCGAAATCGGCTTTTGGATTAAGTTGTGAA
ATTAAAAATTGTGATTCAAAGGAATCCGATTGCCGCCAAGATTGTCAGTG
TTCAATAAAGAAATCATGCAATCAGGTAACTGGAAAATGCCAATGTAAAC
CTGGACTTCGAGGTCCTCAATGTTTGCAAATGTGTGAATTTGGTAATTTC
GGACTTGACTGTAAACAAAAATGTCGTTGTGCAAACGGCGAACCCTGCAA
TCCTGTAGACGGAACATGTTTATGTTTGTCAGGGTTCACTGGAATACTAT
GTGATCAAGTTTGTGCGAAAGGTTGGTATGGACCTAATTGTAAACTAAAA
TGTTTGGTTTGTAATCGGAATAAGACGTGCCACCCACAGACTGGTCAGTG
TTCTTGTGAAGCAGGTTTGATCAATTATGACTGCAAGGGTCAGTGCCCTA
GTGGATATTATGGACCTCTATGTCAACAAGCCTGTCAATGCATGCACGGA
GCGTCTTGTAATCCCTCAACCGGAGCATGTCAATGCTTATCCGGATTCTA
TGGGGCTCTATGTCAATTCAGGTGTCCGAATAATTTTTATGGGGCAAACT
GCCAGCACCGCTGCAAATGCTTCCACAACTCCCCGTGCAATCCAGTCACC
GGCCACTGTGTGTGTCCGAAAAAATTATCAGGAAGATTCTGTGAAGTTTC
GGTTATTAATCGTTTAAAATTATCATTTATTTAAATTTTCTCTCTGGAAC
AATGAATAATTACCTCAAAACAGATATTTATAATTTATTCGTCAC
back to top

protein sequence of SMED30005066-orf-1

>SMED30005066-orf-1 ID=SMED30005066-orf-1|Name=SMED30005066-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1298bp
MRFAIIFFLTIQIIPKLSGAGSQKLELGMPNVCEVEQRQMIRVRRTVEVP
RSKEVKVWKANCRFKGDWCLVHENKSFVEKTETSQIQMVPSIKYECCEGY
AELSGYRGCIPKPNCEERIGKYCQNGAFCYQSGYNAKCICPKGFLGTFCD
KDLNECEENNGGCEKECCNIDGGFYCKCPPGYEMSENGKNCIDINECIRN
RTDCSHECVNLPGGFRCQCPPDMILGPDRINCIPFIHPCDSANKGGCTHH
CVKLSDMRFICSCPDGHILDKDRRSCSVVDLCKDNNGGCSHLCQSDPSSS
VITCKCRPGYAIDVNDVKQCKDINECNIKNGGCQHICLNVEGSFICDCHP
GWQIGHDHKSCYKVDMELTDPCKYGNGGCTQFCNSSPNKRAICSCLPGFK
LEADGLTCSDEDECVTGKHKCVPPSTCINDLGSYLCTCPVGYRLRKNKMT
CEDIDECLDYTGGCGYKCVNTDGSYRCVCPNGETLGKDNKTCQNQNTRGS
SLQKDPRRCPKGTFGEECLFNCSNCMHKGYCNDDQTGCLCHPNYSGTICE
IDCLQNPSQVECQPLQCHCKNGGTCESETLKCNCPPGISGEICEIGCTEG
FFGENCEKNCPTACSSNRCHQITGKCLCFPGWYGSSCHLLCPTGTWGIGC
SKTCSCNQNNYEGCDPKNGKCKCKKGYHGVNCLYKCDPGYFGLDCSFSCP
EDCKTICNHETGQCPDKTCQGNNSIGCQRDCPTGGSGSDCRKTCDCSENS
VSCEEKNGICHCAPGFTGKRCELKCTKGLYGERCQSSCQCRKDRLCDHVT
GICYCADVAFGKCEACPSGKWGPTCNQNCDCTYSTGCDQINGQCICLAGY
YGPKCSKRCPEGLYGEGCSKECQCIYGNCDPISGICRCNPGWHGEICENP
CDEGYYGDQCKEKCKCLNGGTCDIFGRKCQCEPGWHGEFCEKSCAVGYYG
RNCEGRCQCHNGGLCDGISGKCDCMPGWRGINCDERCPSQTYGPNCNQVC
QCLNGGKCHPENGMCQCPAGRHGDVCELTCPPDKYGPNCLHNCICKATEK
CDLKTGECTCPKSAFGLSCEIKNCDSKESDCRQDCQCSIKKSCNQVTGKC
QCKPGLRGPQCLQMCEFGNFGLDCKQKCRCANGEPCNPVDGTCLCLSGFT
GILCDQVCAKGWYGPNCKLKCLVCNRNKTCHPQTGQCSCEAGLINYDCKG
QCPSGYYGPLCQQACQCMHGASCNPSTGACQCLSGFYGALCQFRCPNNFY
GANCQHRCKCFHNSPCNPVTGHCVCPKKLSGRFCEVSVINRLKLSFI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000421tail
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR002049Laminin_EGF
IPR000742EGF-like_dom
IPR001881EGF-like_Ca-bd_dom
IPR026823cEGF
IPR013032EGF-like_CS
IPR018097EGF_Ca-bd_CS
IPR000152EGF-type_Asp/Asn_hydroxyl_site
IPR011489EMI_domain
IPR009030Growth_fac_rcpt_cys_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01