zinc finger protein A

Overview
Namezinc finger protein A (AHW52381.1)
Smed IDSMED30005045
Length (bp)2020
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of zinc finger protein A (SMED30005045) t-SNE clustered cells

Violin plots show distribution of expression levels for zinc finger protein A (SMED30005045) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of zinc finger protein A (SMED30005045) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for zinc finger protein A (SMED30005045) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005045

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30005045SMESG000022958.1 KF751216.1smed_ncbi_20200123PMID:24704339
Vogg et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
anterior poleSMED30005045SMESG000022958.1 KF751216.1smed_ncbi_20200123PMID:24704339
Vogg et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
anterior region of the whole animalSMED30005045SMESG000022958.1 dd_Smed_v4_22585_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30005045SMESG000022958.1 dd_Smed_v4_22585_0_1dd_Smed_v4PMID:24992682
Vásquez-Doorman et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30005045SMESG000022958.1 dd_Smed_v4_22585_0_1dd_Smed_v4PMID:24992682
Vásquez-Doorman et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
anterior poleSMED30005045SMESG000022958.1 dd_Smed_v4_22585_0_1dd_Smed_v4PMID:24992682
Vásquez-Doorman et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
anterior pole progenitor cellSMED30005045SMESG000022958.1 dd_Smed_v4_22585_0_1dd_Smed_v4PMID:24992682
Vásquez-Doorman et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
pharynxSMED30005045SMESG000022958.1 KF751216.1smed_ncbi_20200123PMID:24992682
Vásquez-Doorman et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30005045SMESG000022958.1 KF751216.1smed_ncbi_20200123PMID:24992682
Vásquez-Doorman et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
anterior poleSMED30005045SMESG000022958.1 KF751216.1smed_ncbi_20200123PMID:24992682
Vásquez-Doorman et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
anterior pole cellSMED30005045SMESG000022958.1 KF751216.1smed_ncbi_20200123PMID:24992682
Vásquez-Doorman et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
anterior pole progenitor cellSMED30005045SMESG000022958.1 KF751216.1smed_ncbi_20200123PMID:24992682
Vásquez-Doorman et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
headSMED30005045SMESG000022958.1 SmedASXL_003487SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
muscle cellSMED30005045SMESG000022958.1 dd_Smed_v4_22585_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
anterior region of the whole animalSMED30005045SMESG000022958.1 dd_Smed_v4_22585_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30005045SMESG000022958.1 dd_Smed_v6_22585_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30005045SMESG000022958.1 OX_Smed_1.0.13907ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of zinc finger protein A vs. Ensembl Human
Match: ZIC3 (Zic family member 3 [Source:HGNC Symbol;Acc:HGNC:12874])

HSP 1 Score: 277.715 bits (709), Expect = 1.695e-85
Identity = 144/271 (53.14%), Postives = 180/271 (66.42%), Query Frame = 2
Query:  650 QPIMHSHNFPYMSSYNYHYSPFPTTFPGLSNYGRQAALYR---CFKNNLNEPMHINKELRCLWIDPNQ-REGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSPGTISAAIIASKHPDSSTNISRDHPGTIMTQNSPSTNHSGCSISSNIS 1450
            +P+      PY +        FP   P   N G   A +     F   + +P  I +EL C WID  Q     K C + +S++ ++VTH+TM+HVGGPEQ +H CYW++CPR+ K+FKAKYKLVNHIRVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+FEGCDRRFANSSDRKKHMHVH +DKPY CK+  C+KSYTHPSSLRKHM+VH  S G+ S+       P +S+      P  I + NS  T  +  ++ ++ S
Sbjct:  200 RPVASPRTDPYAAGAQ-----FPNYSPMNMNMGVNVAAHHGPGAFFRYMRQP--IKQELSCKWIDEAQLSRPKKSCDRTFSTMHELVTHVTMEHVGGPEQNNHVCYWEECPREGKSFKAKYKLVNHIRVHTGEKPFPCPFPGCGKIFARSENLKIHKRTHTGEKPFKCEFEGCDRRFANSSDRKKHMHVHTSDKPYICKV--CDKSYTHPSSLRKHMKVHE-SQGSDSS-------PAASSGYESSTPPAIASANSKDTTKTPSAVQTSTS 453          
BLAST of zinc finger protein A vs. Ensembl Human
Match: ZIC1 (Zic family member 1 [Source:HGNC Symbol;Acc:HGNC:12872])

HSP 1 Score: 272.707 bits (696), Expect = 7.457e-84
Identity = 134/206 (65.05%), Postives = 159/206 (77.18%), Query Frame = 2
Query:  803 INKELRCLWIDPNQREG-TKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSPGTISAAIIASKHPDSSTNISRDHPGTIMTQNSPSTN 1417
            I +EL C WI+P Q     K C K +S++ ++VTH+T++HVGGPEQ +H C+W++CPR+ K FKAKYKLVNHIRVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+FEGCDRRFANSSDRKKHMHVH +DKPY CK+  C+KSYTHPSSLRKHM+VH  S      +  AS   +SST      P TI+   SPST+
Sbjct:  221 IKQELICKWIEPEQLANPKKSCNKTFSTMHELVTHVTVEHVGGPEQSNHICFWEECPREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFEGCDRRFANSSDRKKHMHVHTSDKPYLCKM--CDKSYTHPSSLRKHMKVHESSSQGSQPSPAASSGYESST------PPTIV---SPSTD 415          
BLAST of zinc finger protein A vs. Ensembl Human
Match: ZIC2 (Zic family member 2 [Source:HGNC Symbol;Acc:HGNC:12873])

HSP 1 Score: 275.404 bits (703), Expect = 7.873e-84
Identity = 130/206 (63.11%), Postives = 158/206 (76.70%), Query Frame = 2
Query:  803 INKELRCLWIDPNQREG-TKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSPGTISAAIIASKHPDSSTNISRDHPGTIMTQNSPSTN 1417
            I +EL C WIDP Q     K C K +S++ ++VTH++++HVGGPEQ +H C+W++CPR+ K FKAKYKLVNHIRVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPF+C+FEGCDRRFANSSDRKKHMHVH +DKPY CK+  C+KSYTHPSSLRKHM+VH  SP    ++  AS   +SST      PG +     P ++
Sbjct:  252 IKQELICKWIDPEQLSNPKKSCNKTFSTMHELVTHVSVEHVGGPEQSNHVCFWEECPREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFQCEFEGCDRRFANSSDRKKHMHVHTSDKPYLCKM--CDKSYTHPSSLRKHMKVHESSPQGSESSPAASSGYESSTP-----PGLVSPSAEPQSS 450          
BLAST of zinc finger protein A vs. Ensembl Human
Match: ZIC4 (Zic family member 4 [Source:HGNC Symbol;Acc:HGNC:20393])

HSP 1 Score: 265.003 bits (676), Expect = 2.970e-82
Identity = 116/169 (68.64%), Postives = 140/169 (82.84%), Query Frame = 2
Query:  803 INKELRCLWIDPNQREGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSP 1309
            I +EL C W+  +       C K +S++ ++VTH+T++HVGGPEQ +H C+W++CPR  K FKAKYKLVNHIRVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPF+C+FEGC+RRFANSSDRKKH HVH +DKPY CK++GC+K YTHPSSLRKHM+VH  SP
Sbjct:  124 IKQELICKWLAADGTATPSLCSKTFSTMHELVTHVTVEHVGGPEQANHICFWEECPRQGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFRCEFEGCERRFANSSDRKKHSHVHTSDKPYTCKVRGCDKCYTHPSSLRKHMKVHGRSP 292          
BLAST of zinc finger protein A vs. Ensembl Human
Match: ZIC4 (Zic family member 4 [Source:HGNC Symbol;Acc:HGNC:20393])

HSP 1 Score: 265.003 bits (676), Expect = 2.970e-82
Identity = 116/169 (68.64%), Postives = 140/169 (82.84%), Query Frame = 2
Query:  803 INKELRCLWIDPNQREGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSP 1309
            I +EL C W+  +       C K +S++ ++VTH+T++HVGGPEQ +H C+W++CPR  K FKAKYKLVNHIRVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPF+C+FEGC+RRFANSSDRKKH HVH +DKPY CK++GC+K YTHPSSLRKHM+VH  SP
Sbjct:  124 IKQELICKWLAADGTATPSLCSKTFSTMHELVTHVTVEHVGGPEQANHICFWEECPRQGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFRCEFEGCERRFANSSDRKKHSHVHTSDKPYTCKVRGCDKCYTHPSSLRKHMKVHGRSP 292          
BLAST of zinc finger protein A vs. Ensembl Celegans
Match: ref-2 (REgulator of Fusion [Source:UniProtKB/TrEMBL;Acc:Q7JNM3])

HSP 1 Score: 182.57 bits (462), Expect = 5.117e-52
Identity = 89/164 (54.27%), Postives = 113/164 (68.90%), Query Frame = 2
Query:  806 NKELRCLWIDPNQREGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVH 1297
            +K+++CLW    Q      C+ +  +  ++ TH++ +H+    +    C WK C R+ K FKAKYKLVNH+RVHTGE+PF C    C K+FARSENLKIHKR H+GEKPF+C   GC + FANSSDRKKHMHVH + KPY C    C K+YTHPSSLRKH +VH
Sbjct:   80 DKQVQCLWETNGQV-----CMHVCQNSGELSTHISSNHITHDSKF--VCLWKGCDREFKMFKAKYKLVNHMRVHTGERPFLCDV--CNKVFARSENLKIHKRIHSGEKPFQCTHNGCTKLFANSSDRKKHMHVHSSHKPYSCMYPDCGKTYTHPSSLRKHTKVH 234          
BLAST of zinc finger protein A vs. Ensembl Celegans
Match: ref-2 (REgulator of Fusion [Source:UniProtKB/TrEMBL;Acc:Q7JNM3])

HSP 1 Score: 182.185 bits (461), Expect = 5.224e-52
Identity = 89/164 (54.27%), Postives = 113/164 (68.90%), Query Frame = 2
Query:  806 NKELRCLWIDPNQREGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVH 1297
            +K+++CLW    Q      C+ +  +  ++ TH++ +H+    +    C WK C R+ K FKAKYKLVNH+RVHTGE+PF C    C K+FARSENLKIHKR H+GEKPF+C   GC + FANSSDRKKHMHVH + KPY C    C K+YTHPSSLRKH +VH
Sbjct:   67 DKQVQCLWETNGQV-----CMHVCQNSGELSTHISSNHITHDSKF--VCLWKGCDREFKMFKAKYKLVNHMRVHTGERPFLCDV--CNKVFARSENLKIHKRIHSGEKPFQCTHNGCTKLFANSSDRKKHMHVHSSHKPYSCMYPDCGKTYTHPSSLRKHTKVH 221          
BLAST of zinc finger protein A vs. Ensembl Celegans
Match: ref-2 (REgulator of Fusion [Source:UniProtKB/TrEMBL;Acc:Q7JNM3])

HSP 1 Score: 182.185 bits (461), Expect = 5.224e-52
Identity = 89/164 (54.27%), Postives = 113/164 (68.90%), Query Frame = 2
Query:  806 NKELRCLWIDPNQREGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVH 1297
            +K+++CLW    Q      C+ +  +  ++ TH++ +H+    +    C WK C R+ K FKAKYKLVNH+RVHTGE+PF C    C K+FARSENLKIHKR H+GEKPF+C   GC + FANSSDRKKHMHVH + KPY C    C K+YTHPSSLRKH +VH
Sbjct:   67 DKQVQCLWETNGQV-----CMHVCQNSGELSTHISSNHITHDSKF--VCLWKGCDREFKMFKAKYKLVNHMRVHTGERPFLCDV--CNKVFARSENLKIHKRIHSGEKPFQCTHNGCTKLFANSSDRKKHMHVHSSHKPYSCMYPDCGKTYTHPSSLRKHTKVH 221          
BLAST of zinc finger protein A vs. Ensembl Celegans
Match: tra-1 (Sex-determining transformer protein 1 [Source:UniProtKB/Swiss-Prot;Acc:P34708])

HSP 1 Score: 157.532 bits (397), Expect = 9.859e-40
Identity = 78/169 (46.15%), Postives = 104/169 (61.54%), Query Frame = 2
Query:  797 MHINKELRCLWIDPNQREGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHT--CYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHM-HVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRV 1294
            M  + +L C W         K C   + ++  +V H+   HV   EQ  H   C W+ C R+ + FKA Y L+ H+R HTGEKP +C +  CGK ++R ENLK H+RTHTGEKP+KC+F  C++ F+N+SDR KH    H N KPY C+I  C KSYT PSSLRKH++ 
Sbjct:  202 MMGDHDLTCRW---------KSCNSSFQTLKALVDHVQESHVQSTEQEHHAWRCEWEGCDRN-ETFKALYMLIVHVRRHTGEKPNKCEYPGCGKEYSRLENLKTHRRTHTGEKPYKCEFADCEKAFSNASDRAKHQNRTHSNLKPYSCQIPQCTKSYTDPSSLRKHIKA 360          
BLAST of zinc finger protein A vs. Ensembl Celegans
Match: ztf-14 (Zinc finger putative Transcription Factor family [Source:UniProtKB/TrEMBL;Acc:Q93902])

HSP 1 Score: 109.768 bits (273), Expect = 4.055e-25
Identity = 54/115 (46.96%), Postives = 70/115 (60.87%), Query Frame = 2
Query:  950 CYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKH-MHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMR 1291
            C W+ C R   +FK  Y+   H R HT +K + C    C K + R ENLK H+RTHTGEKP+ C+   C++ F N+SDR KH    H N+KPY C    C  +YT PSSLRKH++
Sbjct:  263 CKWRYCER---SFKQTYEFTAHKRTHTKQKLYCCEV--CPKRYGRLENLKTHRRTHTGEKPYHCNVPNCNKSFTNASDRSKHSKRTHSNEKPYCCDFGSCACAYTDPSSLRKHVK 372          
BLAST of zinc finger protein A vs. Ensembl Fly
Match: opa (gene:FBgn0003002 transcript:FBtr0078836)

HSP 1 Score: 265.774 bits (678), Expect = 1.177e-79
Identity = 119/171 (69.59%), Postives = 139/171 (81.29%), Query Frame = 2
Query:  803 INKELRCLWIDPNQRE-----GTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHN 1300
            + +E++CLWIDP+Q       G K C K++ S+ +IVTHLT++HVGGPE   H C+W  C R+ + FKAKYKLVNHIRVHTGEKPF CP   CGK+FARSENLKIHKRTHTGEKPFKC+ EGCDRRFANSSDRKKH HVH +DKPY C+I GC+KSYTHPSSLRKHM+VH 
Sbjct:  206 VKQEMQCLWIDPDQPGLVPPGGRKTCNKVFHSMHEIVTHLTVEHVGGPECTTHACFWVGCSRNGRPFKAKYKLVNHIRVHTGEKPFACPHPGCGKVFARSENLKIHKRTHTGEKPFKCEHEGCDRRFANSSDRKKHSHVHTSDKPYNCRINGCDKSYTHPSSLRKHMKVHG 376          
BLAST of zinc finger protein A vs. Ensembl Fly
Match: lmd (gene:FBgn0039039 transcript:FBtr0084364)

HSP 1 Score: 168.703 bits (426), Expect = 1.630e-43
Identity = 74/137 (54.01%), Postives = 97/137 (70.80%), Query Frame = 2
Query:  893 IVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNL 1303
             V H+   HV   +  D +C+W DCPR  K F A+YKL+ H+RVH+GEKP +CPF  C K F+R ENLKIH+R+HTGE+P+ C ++GC + F+NSSDR KH   H + KPY C++ GC K YT PSSLRKH++ H L
Sbjct:  452 FVEHIEKCHVDVRKGEDFSCFWLDCPRRYKPFNARYKLLIHMRVHSGEKPNKCPFPGCNKAFSRLENLKIHQRSHTGERPYGCQYKGCLKAFSNSSDRAKHQRTHYDTKPYACQLPGCTKRYTDPSSLRKHVKNHAL 588          
BLAST of zinc finger protein A vs. Ensembl Fly
Match: ci (gene:FBgn0004859 transcript:FBtr0306168)

HSP 1 Score: 157.532 bits (397), Expect = 1.366e-39
Identity = 74/162 (45.68%), Postives = 100/162 (61.73%), Query Frame = 2
Query:  812 ELRCLWIDPNQREGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMH-VHQNDKPYFCKIKGCEKSYTHPSSLRKHMRV 1294
            E  C W         + C   + +  ++V H+  DH+   ++    C W+DC R  K FKA+Y LV H+R HTGEKP +C F  C K ++R ENLK H R+HTGEKP+ C++ GC + F+N+SDR KH +  H N+KPY CK  GC K YT PSSLRKH++ 
Sbjct:  332 ETNCHW---------RSCRIEFITQDELVKHINNDHIQTNKKA-FVCRWEDCTRGEKPFKAQYMLVVHMRRHTGEKPHKCTFEGCFKAYSRLENLKTHLRSHTGEKPYTCEYPGCSKAFSNASDRAKHQNRTHSNEKPYICKAPGCTKRYTDPSSLRKHVKT 483          
BLAST of zinc finger protein A vs. Ensembl Fly
Match: ci (gene:FBgn0004859 transcript:FBtr0089178)

HSP 1 Score: 157.532 bits (397), Expect = 1.501e-39
Identity = 74/162 (45.68%), Postives = 100/162 (61.73%), Query Frame = 2
Query:  812 ELRCLWIDPNQREGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMH-VHQNDKPYFCKIKGCEKSYTHPSSLRKHMRV 1294
            E  C W         + C   + +  ++V H+  DH+   ++    C W+DC R  K FKA+Y LV H+R HTGEKP +C F  C K ++R ENLK H R+HTGEKP+ C++ GC + F+N+SDR KH +  H N+KPY CK  GC K YT PSSLRKH++ 
Sbjct:  450 ETNCHW---------RSCRIEFITQDELVKHINNDHIQTNKKA-FVCRWEDCTRGEKPFKAQYMLVVHMRRHTGEKPHKCTFEGCFKAYSRLENLKTHLRSHTGEKPYTCEYPGCSKAFSNASDRAKHQNRTHSNEKPYICKAPGCTKRYTDPSSLRKHVKT 601          
BLAST of zinc finger protein A vs. Ensembl Fly
Match: sug (gene:FBgn0033782 transcript:FBtr0331985)

HSP 1 Score: 146.747 bits (369), Expect = 8.675e-39
Identity = 72/169 (42.60%), Postives = 102/169 (60.36%), Query Frame = 2
Query:  821 CLWIDPNQREGTKPCLKLYSSILDIVTHLTMDH-VGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSPGTISA 1324
            C W D         C +++ ++  +  H+T  H +       + C W+ C R  + F A+YK++ H R HT EKP +C    C K F+R+ENLKIH R+H+GEKP+KC FEGC + ++NSSDR KH   H  +KPY CK+ GC+K YT PSSLRKH++    S   I++
Sbjct:   68 CNWTD---------CDRVFDTLDALAQHVTQRHAIASLTDGLYYCRWRGCQRSERGFNARYKMLVHTRTHTKEKPHRCHL--CEKSFSRAENLKIHIRSHSGEKPYKCSFEGCQKAYSNSSDRFKHTRTHSMEKPYMCKVAGCQKRYTDPSSLRKHVKTFKHSIHLIAS 225          
BLAST of zinc finger protein A vs. Ensembl Zebrafish
Match: zic5 (zic family member 5 (odd-paired homolog, Drosophila) [Source:ZFIN;Acc:ZDB-GENE-040622-1])

HSP 1 Score: 286.574 bits (732), Expect = 1.058e-88
Identity = 128/186 (68.82%), Postives = 155/186 (83.33%), Query Frame = 2
Query:  803 INKELRCLWIDPNQREGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSPGTISAAIIASKHPDSST 1360
            I +EL C WID  ++   KPC K +S++ ++V H+T++HVGGPEQ  H C+W++CPR+ KAFKAKYKL+NHIRVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+F+GCDR+FANSSDRKKH HVH +DKPYFCK++GC+KSYTHPSSLRKHM+VH  SP   SA   +S HP S+T
Sbjct:  245 IKQELICKWID-QEQTAKKPCSKTFSTMHELVNHVTVEHVGGPEQSTHVCFWEECPREGKAFKAKYKLINHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFDGCDRKFANSSDRKKHSHVHTSDKPYFCKVRGCDKSYTHPSSLRKHMKVHCKSPPPPSANTGSSYHPSSTT 429          
BLAST of zinc finger protein A vs. Ensembl Zebrafish
Match: zic4 (zic family member 4 [Source:ZFIN;Acc:ZDB-GENE-040622-4])

HSP 1 Score: 276.944 bits (707), Expect = 4.476e-85
Identity = 121/169 (71.60%), Postives = 145/169 (85.80%), Query Frame = 2
Query:  803 INKELRCLWIDPNQREGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSP 1309
            I +EL C W++P +    K C K YS++ ++VTH+T++HVGGPEQ +H C+W++CPR+ K FKAKYKLVNHIRVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+F+GCDRRFANSSDRKKH HVH +DKPY CK++GC+KSYTHPSSLRKHM+VH  SP
Sbjct:  244 IKQELICKWLEP-EHSAKKLCSKTYSTMHELVTHVTVEHVGGPEQANHICFWEECPREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFDGCDRRFANSSDRKKHSHVHTSDKPYNCKVRGCDKSYTHPSSLRKHMKVHCKSP 411          
BLAST of zinc finger protein A vs. Ensembl Zebrafish
Match: zic4 (zic family member 4 [Source:ZFIN;Acc:ZDB-GENE-040622-4])

HSP 1 Score: 277.715 bits (709), Expect = 7.472e-85
Identity = 121/169 (71.60%), Postives = 145/169 (85.80%), Query Frame = 2
Query:  803 INKELRCLWIDPNQREGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSP 1309
            I +EL C W++P +    K C K YS++ ++VTH+T++HVGGPEQ +H C+W++CPR+ K FKAKYKLVNHIRVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+F+GCDRRFANSSDRKKH HVH +DKPY CK++GC+KSYTHPSSLRKHM+VH  SP
Sbjct:  280 IKQELICKWLEP-EHSAKKLCSKTYSTMHELVTHVTVEHVGGPEQANHICFWEECPREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFDGCDRRFANSSDRKKHSHVHTSDKPYNCKVRGCDKSYTHPSSLRKHMKVHCKSP 447          
BLAST of zinc finger protein A vs. Ensembl Zebrafish
Match: zic3 (zic family member 3 heterotaxy 1 (odd-paired homolog, Drosophila) [Source:ZFIN;Acc:ZDB-GENE-030708-2])

HSP 1 Score: 274.633 bits (701), Expect = 1.078e-84
Identity = 133/218 (61.01%), Postives = 163/218 (74.77%), Query Frame = 2
Query:  803 INKELRCLWIDPNQR-EGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSPGTISAAIIASKHPDSSTNISRDHPGTIMTQNSPSTNHSGCSISSNISA 1453
            I +EL C WID NQ     K C + +S++ ++VTH++M+HVGGPEQ +H CYW+DCPR+ K+FKAKYKLVNHIRVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+F+GCDRRFANSSDRKKHMHVH +DKPY CK+  C+KSYTHPSSLRKHM+VH  S G+ S+       P +S+      P  +++ N+     +  S   N SA
Sbjct:  227 IKQELSCKWIDENQMNRPKKTCDRTFSTMHEMVTHVSMEHVGGPEQSNHVCYWEDCPREGKSFKAKYKLVNHIRVHTGEKPFPCPFPGCGKIFARSENLKIHKRTHTGEKPFKCEFDGCDRRFANSSDRKKHMHVHTSDKPYICKV--CDKSYTHPSSLRKHMKVHE-SQGSESS-------PAASSGYESSTPPVLVSANTEDPTKTPTSAVQNSSA 434          
BLAST of zinc finger protein A vs. Ensembl Zebrafish
Match: zic1 (zic family member 1 (odd-paired homolog, Drosophila) [Source:ZFIN;Acc:ZDB-GENE-000208-4])

HSP 1 Score: 270.781 bits (691), Expect = 2.582e-83
Identity = 134/206 (65.05%), Postives = 157/206 (76.21%), Query Frame = 2
Query:  803 INKELRCLWIDPNQREG-TKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSPGTISAAIIASKHPDSSTNISRDHPGTIMTQNSPSTN 1417
            I +EL C WI+P Q     K C K +S++ ++VTHLT++HVGGPEQ +H C+W++C R+ K FKAKYKLVNHIRVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+FEGCDRRFANSSDRKKHMHVH +DKPY CK+  C+KSYTHPSSLRKHM+VH  S      +  AS   +SST      P TI+   SPST 
Sbjct:  216 IKQELICKWIEPEQLTNPKKSCNKTFSTMHELVTHLTVEHVGGPEQSNHICFWEECGREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFEGCDRRFANSSDRKKHMHVHTSDKPYLCKM--CDKSYTHPSSLRKHMKVHESSSQGSQPSPAASSGYESST------PPTIV---SPSTE 410          
BLAST of zinc finger protein A vs. Ensembl Xenopus
Match: bcam (basal cell adhesion molecule (Lutheran blood group) [Source:Xenbase;Acc:XB-GENE-921467])

HSP 1 Score: 274.633 bits (701), Expect = 9.580e-84
Identity = 127/205 (61.95%), Postives = 155/205 (75.61%), Query Frame = 2
Query:  773 FKNNLNEPMHINKELRCLWIDPNQREGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSPGTISAAIIASKHPDSSTNISRDHPGT 1387
            F   + +P  I +EL C WID +Q    KPC K +S++ ++V H+T++HVGGPEQ  H C+W++C R+ K FKAKYKLVNHIRVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+F+GCDR+FANSSDRKKH HVH +DKPY+CK++GC+KSYTHPSSLRKHM++H  SP            P S TN S  +P  
Sbjct:  260 FLRYMRQP--IKQELICKWIDQDQ-SSKKPCSKTFSTMHELVNHVTVEHVGGPEQSTHVCFWEECSREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFDGCDRKFANSSDRKKHSHVHTSDKPYYCKVRGCDKSYTHPSSLRKHMKIHCKSP------------PGSPTNGSMGYPAV 449          
BLAST of zinc finger protein A vs. Ensembl Xenopus
Match: lpcat4 (lysophosphatidylcholine acyltransferase 4 [Source:Xenbase;Acc:XB-GENE-5731127])

HSP 1 Score: 271.937 bits (694), Expect = 1.298e-83
Identity = 136/220 (61.82%), Postives = 165/220 (75.00%), Query Frame = 2
Query:  803 INKELRCLWID--PNQREGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSPGTISAAIIASKHPDSSTNISRDHPGTIMTQNS--PSTNHSGCSISSNIS 1450
            I +EL C W++  P  R   K C + +SS+ ++VTH+TM+HVGGPEQ +H CYW++CPR  K+FKAKYKLVNHIRVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+FEGCDRRFANSSDRKKHMHVH +DKPY CK+  C+KSYTHPSSLRKHM+VH  S G+ S+       P +S+      P  +++ NS  PS N S    ++N S
Sbjct:  218 IKQELSCKWLEESPMNRP-QKTCDRTFSSMHELVTHMTMEHVGGPEQTNHICYWEECPRGGKSFKAKYKLVNHIRVHTGEKPFPCPFPGCGKIFARSENLKIHKRTHTGEKPFKCEFEGCDRRFANSSDRKKHMHVHTSDKPYICKV--CDKSYTHPSSLRKHMKVHE-SQGSDSS-------PAASSGYESATPPAMVSANSEEPSKNSSATHQTNNSS 426          
BLAST of zinc finger protein A vs. Ensembl Xenopus
Match: nt5dc3 (5'-nucleotidase domain containing 3 [Source:Xenbase;Acc:XB-GENE-940463])

HSP 1 Score: 271.937 bits (694), Expect = 5.214e-83
Identity = 121/169 (71.60%), Postives = 144/169 (85.21%), Query Frame = 2
Query:  803 INKELRCLWIDPNQREGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSP 1309
            I +EL C WI+  +    K C K +S++ ++VTH+T++HVGGPEQ +H C+W++CPR+ K FKAKYKLVNHIRVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+FEGCDRRFANSSDRKKH HVH +DKPY CK++GC+KSYTHPSSLRKHM+VH  SP
Sbjct:  247 IKQELICKWIE-EEHHPKKLCSKTFSTMHELVTHVTVEHVGGPEQSNHICFWEECPREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFEGCDRRFANSSDRKKHSHVHTSDKPYNCKVRGCDKSYTHPSSLRKHMKVHCKSP 414          
BLAST of zinc finger protein A vs. Ensembl Xenopus
Match: cnot10 (CCR4-NOT transcription complex subunit 10 [Source:Xenbase;Acc:XB-GENE-5755016])

HSP 1 Score: 269.626 bits (688), Expect = 8.432e-83
Identity = 126/187 (67.38%), Postives = 149/187 (79.68%), Query Frame = 2
Query:  803 INKELRCLWIDPNQREG-TKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSPGTISAAIIASKHPDSST 1360
            I +EL C WI+P Q     K C K +S++ ++VTH+T++HVGGPEQ +H C+W++C R+ K FKAKYKLVNHIRVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+FEGCDRRFANSSDRKKHMHVH +DKPY CK+  C+KSYTHPSSLRKHM+VH  S      +  AS   +SST
Sbjct:  217 IKQELICKWIEPEQLANPKKSCNKTFSTMHELVTHVTVEHVGGPEQSNHICFWEECAREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFEGCDRRFANSSDRKKHMHVHTSDKPYLCKM--CDKSYTHPSSLRKHMKVHESSSQGSQPSPAASSGYESST 401          
BLAST of zinc finger protein A vs. Ensembl Xenopus
Match: zic2 (Zic family member 2 [Source:NCBI gene;Acc:549779])

HSP 1 Score: 271.552 bits (693), Expect = 1.041e-82
Identity = 130/206 (63.11%), Postives = 159/206 (77.18%), Query Frame = 2
Query:  803 INKELRCLWIDPNQREG-TKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSPGTISAAIIASKHPDSSTNISRDHPGTIMTQNSPSTN 1417
            I +EL C WIDP Q     K C K +S++ ++VTH++++HVGGPEQ +H C+W++C R+ K FKAKYKLVNHIRVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPF+C+FEGCDRRFANSSDRKKHMHVH +DKPY CK+  C+KSYTHPSSLRKHM+VH  SP    ++  AS   +SST      P  +++ NS + N
Sbjct:  271 IKQELICKWIDPEQLSNPKKSCNKTFSTMHELVTHVSVEHVGGPEQSNHICFWEECSREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFQCEFEGCDRRFANSSDRKKHMHVHTSDKPYLCKM--CDKSYTHPSSLRKHMKVHESSPQGSESSPAASSGYESST------PPGLVSPNSETQN 468          
BLAST of zinc finger protein A vs. Ensembl Mouse
Match: Zic3 (zinc finger protein of the cerebellum 3 [Source:MGI Symbol;Acc:MGI:106676])

HSP 1 Score: 271.166 bits (692), Expect = 3.949e-86
Identity = 132/217 (60.83%), Postives = 163/217 (75.12%), Query Frame = 2
Query:  803 INKELRCLWIDPNQ-REGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSPGTISAAIIASKHPDSSTNISRDHPGTIMTQNSPSTNHSGCSISSNIS 1450
            I +EL C WI+  Q     K C + +S++ ++VTH+TM+HVGGPEQ +H CYW++CPR+ K+FKAKYKLVNHIRVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+FEGCDRRFANSSDRKKHMHVH +DKPY CK+  C+KSYTHPSSLRKHM+VH  S G+ S+       P +S+      P  I + NS  T  +  ++ ++ S
Sbjct:   26 IKQELSCKWIEEAQLSRPKKSCDRTFSTMHELVTHVTMEHVGGPEQNNHVCYWEECPREGKSFKAKYKLVNHIRVHTGEKPFPCPFPGCGKIFARSENLKIHKRTHTGEKPFKCEFEGCDRRFANSSDRKKHMHVHTSDKPYICKV--CDKSYTHPSSLRKHMKVHE-SQGSDSS-------PAASSGYESSTPPAIASANSKDTTKTPSAVQTSTS 232          
BLAST of zinc finger protein A vs. Ensembl Mouse
Match: Zic3 (zinc finger protein of the cerebellum 3 [Source:MGI Symbol;Acc:MGI:106676])

HSP 1 Score: 277.33 bits (708), Expect = 1.637e-85
Identity = 144/271 (53.14%), Postives = 181/271 (66.79%), Query Frame = 2
Query:  650 QPIMHSHNFPYMSSYNYHYSPFPTTFPGLSNYGRQAALYR---CFKNNLNEPMHINKELRCLWIDPNQ-REGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSPGTISAAIIASKHPDSSTNISRDHPGTIMTQNSPSTNHSGCSISSNIS 1450
            +P+      PY +S       FP   P   N G   A +     F   + +P  I +EL C WI+  Q     K C + +S++ ++VTH+TM+HVGGPEQ +H CYW++CPR+ K+FKAKYKLVNHIRVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+FEGCDRRFANSSDRKKHMHVH +DKPY CK+  C+KSYTHPSSLRKHM+VH  S G+ S+       P +S+      P  I + NS  T  +  ++ ++ S
Sbjct:  199 RPVASPRTDPYAASAQ-----FPNYSPMNMNMGVNVAAHHGPGAFFRYMRQP--IKQELSCKWIEEAQLSRPKKSCDRTFSTMHELVTHVTMEHVGGPEQNNHVCYWEECPREGKSFKAKYKLVNHIRVHTGEKPFPCPFPGCGKIFARSENLKIHKRTHTGEKPFKCEFEGCDRRFANSSDRKKHMHVHTSDKPYICKV--CDKSYTHPSSLRKHMKVHE-SQGSDSS-------PAASSGYESSTPPAIASANSKDTTKTPSAVQTSTS 452          
BLAST of zinc finger protein A vs. Ensembl Mouse
Match: Zic4 (zinc finger protein of the cerebellum 4 [Source:MGI Symbol;Acc:MGI:107201])

HSP 1 Score: 272.322 bits (695), Expect = 3.162e-85
Identity = 117/169 (69.23%), Postives = 142/169 (84.02%), Query Frame = 2
Query:  803 INKELRCLWIDPNQREGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSP 1309
            I +EL C W+  +     +PC K +S++ ++VTH+T++HVGGPEQ +H C+W++CPR  K FKAKYKLVNHIRVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPF+C+FEGC+RRFANSSDRKKH HVH +DKPY CK++GC+K YTHPSSLRKHM+VH  SP
Sbjct:  124 IKQELICKWLGDDSPMSPRPCSKTFSTMHELVTHVTVEHVGGPEQANHICFWEECPRQGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFRCEFEGCERRFANSSDRKKHSHVHTSDKPYMCKVRGCDKCYTHPSSLRKHMKVHGRSP 292          
BLAST of zinc finger protein A vs. Ensembl Mouse
Match: Zic4 (zinc finger protein of the cerebellum 4 [Source:MGI Symbol;Acc:MGI:107201])

HSP 1 Score: 272.322 bits (695), Expect = 3.162e-85
Identity = 117/169 (69.23%), Postives = 142/169 (84.02%), Query Frame = 2
Query:  803 INKELRCLWIDPNQREGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSP 1309
            I +EL C W+  +     +PC K +S++ ++VTH+T++HVGGPEQ +H C+W++CPR  K FKAKYKLVNHIRVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPF+C+FEGC+RRFANSSDRKKH HVH +DKPY CK++GC+K YTHPSSLRKHM+VH  SP
Sbjct:  124 IKQELICKWLGDDSPMSPRPCSKTFSTMHELVTHVTVEHVGGPEQANHICFWEECPRQGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFRCEFEGCERRFANSSDRKKHSHVHTSDKPYMCKVRGCDKCYTHPSSLRKHMKVHGRSP 292          
BLAST of zinc finger protein A vs. Ensembl Mouse
Match: Zic4 (zinc finger protein of the cerebellum 4 [Source:MGI Symbol;Acc:MGI:107201])

HSP 1 Score: 271.552 bits (693), Expect = 6.348e-85
Identity = 117/169 (69.23%), Postives = 142/169 (84.02%), Query Frame = 2
Query:  803 INKELRCLWIDPNQREGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSP 1309
            I +EL C W+  +     +PC K +S++ ++VTH+T++HVGGPEQ +H C+W++CPR  K FKAKYKLVNHIRVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPF+C+FEGC+RRFANSSDRKKH HVH +DKPY CK++GC+K YTHPSSLRKHM+VH  SP
Sbjct:  131 IKQELICKWLGDDSPMSPRPCSKTFSTMHELVTHVTVEHVGGPEQANHICFWEECPRQGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFRCEFEGCERRFANSSDRKKHSHVHTSDKPYMCKVRGCDKCYTHPSSLRKHMKVHGRSP 299          
BLAST of zinc finger protein A vs. UniProt/SwissProt
Match: sp|O60481|ZIC3_HUMAN (Zinc finger protein ZIC 3 OS=Homo sapiens OX=9606 GN=ZIC3 PE=1 SV=1)

HSP 1 Score: 277.715 bits (709), Expect = 8.138e-85
Identity = 144/271 (53.14%), Postives = 180/271 (66.42%), Query Frame = 2
Query:  650 QPIMHSHNFPYMSSYNYHYSPFPTTFPGLSNYGRQAALYR---CFKNNLNEPMHINKELRCLWIDPNQ-REGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSPGTISAAIIASKHPDSSTNISRDHPGTIMTQNSPSTNHSGCSISSNIS 1450
            +P+      PY +        FP   P   N G   A +     F   + +P  I +EL C WID  Q     K C + +S++ ++VTH+TM+HVGGPEQ +H CYW++CPR+ K+FKAKYKLVNHIRVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+FEGCDRRFANSSDRKKHMHVH +DKPY CK+  C+KSYTHPSSLRKHM+VH  S G+ S+       P +S+      P  I + NS  T  +  ++ ++ S
Sbjct:  200 RPVASPRTDPYAAGAQ-----FPNYSPMNMNMGVNVAAHHGPGAFFRYMRQP--IKQELSCKWIDEAQLSRPKKSCDRTFSTMHELVTHVTMEHVGGPEQNNHVCYWEECPREGKSFKAKYKLVNHIRVHTGEKPFPCPFPGCGKIFARSENLKIHKRTHTGEKPFKCEFEGCDRRFANSSDRKKHMHVHTSDKPYICKV--CDKSYTHPSSLRKHMKVHE-SQGSDSS-------PAASSGYESSTPPAIASANSKDTTKTPSAVQTSTS 453          
BLAST of zinc finger protein A vs. UniProt/SwissProt
Match: sp|Q62521|ZIC3_MOUSE (Zinc finger protein ZIC 3 OS=Mus musculus OX=10090 GN=Zic3 PE=1 SV=2)

HSP 1 Score: 277.33 bits (708), Expect = 1.145e-84
Identity = 144/271 (53.14%), Postives = 181/271 (66.79%), Query Frame = 2
Query:  650 QPIMHSHNFPYMSSYNYHYSPFPTTFPGLSNYGRQAALYR---CFKNNLNEPMHINKELRCLWIDPNQ-REGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSPGTISAAIIASKHPDSSTNISRDHPGTIMTQNSPSTNHSGCSISSNIS 1450
            +P+      PY +S       FP   P   N G   A +     F   + +P  I +EL C WI+  Q     K C + +S++ ++VTH+TM+HVGGPEQ +H CYW++CPR+ K+FKAKYKLVNHIRVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+FEGCDRRFANSSDRKKHMHVH +DKPY CK+  C+KSYTHPSSLRKHM+VH  S G+ S+       P +S+      P  I + NS  T  +  ++ ++ S
Sbjct:  199 RPVASPRTDPYAASAQ-----FPNYSPMNMNMGVNVAAHHGPGAFFRYMRQP--IKQELSCKWIEEAQLSRPKKSCDRTFSTMHELVTHVTMEHVGGPEQNNHVCYWEECPREGKSFKAKYKLVNHIRVHTGEKPFPCPFPGCGKIFARSENLKIHKRTHTGEKPFKCEFEGCDRRFANSSDRKKHMHVHTSDKPYICKV--CDKSYTHPSSLRKHMKVHE-SQGSDSS-------PAASSGYESSTPPAIASANSKDTTKTPSAVQTSTS 452          
BLAST of zinc finger protein A vs. UniProt/SwissProt
Match: sp|Q8JJC0|ZIC1_CHICK (Zinc finger protein ZIC 1 OS=Gallus gallus OX=9031 GN=ZIC1 PE=1 SV=1)

HSP 1 Score: 276.174 bits (705), Expect = 1.744e-84
Identity = 142/229 (62.01%), Postives = 172/229 (75.11%), Query Frame = 2
Query:  803 INKELRCLWIDPNQREG-TKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSPGTISAAIIASKHPDSSTNISRDHPGTIMTQNSPST-NHSGCSISSNISAGNHASPIANL 1483
            I +EL C WI+P Q     K C K +S++ ++VTH+T++HVGGPEQ +H C+W++CPR+ K FKAKYKLVNHIRVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+FEGCDRRFANSSDRKKHMHVH +DKPY CK+  C+KSYTHPSSLRKHM+VH  S      +  AS   +SST      P TI+   SPST N +  S+S + SAG+H +  + L
Sbjct:  218 IKQELICKWIEPEQLANPKKSCNKTFSTMHELVTHVTVEHVGGPEQSNHICFWEECPREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFEGCDRRFANSSDRKKHMHVHTSDKPYLCKM--CDKSYTHPSSLRKHMKVHESSSQGSQPSPAASSGYESST------PPTIV---SPSTENQTASSLSPSSSAGHHTASHSTL 435          
BLAST of zinc finger protein A vs. UniProt/SwissProt
Match: sp|A0JC51|ZIC4_XENLA (Zinc finger protein ZIC 4 OS=Xenopus laevis OX=8355 GN=zic4 PE=2 SV=1)

HSP 1 Score: 278.87 bits (712), Expect = 1.755e-84
Identity = 132/212 (62.26%), Postives = 162/212 (76.42%), Query Frame = 2
Query:  803 INKELRCLWIDPNQREGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSPGTISAAIIASKHPDSSTNISRDHPGTIMTQNSPSTNHSGCSIS 1438
            I +EL C WI+ +Q    K C K +S++ ++VTH+T++HVGGPEQ +H C+W++CPR+ K FKAKYKLVNHIRVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+FEGCDRRFANSSDRKKH HVH +DKPY CK++GC+KSYTHPSSLRKHM+VH  SP   S    +     S ++ S   PG   +Q  P T+  G ++S
Sbjct:  280 IKQELICKWIEEDQLP-KKLCSKTFSTMHELVTHVTVEHVGGPEQSNHICFWEECPREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFEGCDRRFANSSDRKKHSHVHTSDKPYNCKVRGCDKSYTHPSSLRKHMKVHCKSPPPSSGYESSIPSLVSPSSDSGQDPGATSSQPEPPTSSQGANLS 490          
BLAST of zinc finger protein A vs. UniProt/SwissProt
Match: sp|Q61467|ZIC4_MOUSE (Zinc finger protein ZIC 4 OS=Mus musculus OX=10090 GN=Zic4 PE=1 SV=2)

HSP 1 Score: 271.552 bits (693), Expect = 4.441e-84
Identity = 117/169 (69.23%), Postives = 142/169 (84.02%), Query Frame = 2
Query:  803 INKELRCLWIDPNQREGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSP 1309
            I +EL C W+  +     +PC K +S++ ++VTH+T++HVGGPEQ +H C+W++CPR  K FKAKYKLVNHIRVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPF+C+FEGC+RRFANSSDRKKH HVH +DKPY CK++GC+K YTHPSSLRKHM+VH  SP
Sbjct:  131 IKQELICKWLGDDSPMSPRPCSKTFSTMHELVTHVTVEHVGGPEQANHICFWEECPRQGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFRCEFEGCERRFANSSDRKKHSHVHTSDKPYMCKVRGCDKCYTHPSSLRKHMKVHGRSP 299          
BLAST of zinc finger protein A vs. TrEMBL
Match: X5CWX3 (Zinc finger protein A OS=Schmidtea mediterranea OX=79327 GN=ZicA PE=2 SV=1)

HSP 1 Score: 993.801 bits (2568), Expect = 0.000e+0
Identity = 498/500 (99.60%), Postives = 498/500 (99.60%), Query Frame = 2
Query:  323 MYQHQDTDQLNSANGFSSLPSDSTVHSSRTFGKSSFTSRDGQFFNDIDNFSTGSNFFSLKNRYNRFEHSNSVDQLLPTPIETGNRNLGGFCYSNQIMPATLSQSPSNLLQPIMHSHNFPYMSSYNYHYSPFPTTFPGLSNYGRQAALYRCFKNNLNEPMHINKELRCLWIDPNQREGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSPGTISAAIIASKHPDSSTNISRDHPGTIMTQNSPSTNHSGCSISSNISAGNHASPIANLLFESSQNPSKSTISNIFPDNCCPISSNKPTNNIKTENELSANYFHKNASQNGQXXXXXXXXXXXXXXXDNCPINPQYQSWVQYSDKVDSIKSENQIFSFSNSNETFPNNNFFQ 1822
            MYQHQDTDQLNSANGFSSLPSDSTVHSSRTFGKSSFTSRDGQFFNDIDNFSTGSNFFSLKNRYNRFEHSNSVDQLLPTPIETGNRNLGGFCYSNQIMPATLSQSPSNLLQPIMHSHNFPYMSSYNYHYSPFPTTFPGLSNYGRQAALYRCFKNNLNEPMHINKELRCLWIDPNQREGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGE PFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSPGTISAAIIASKHPDSSTNISRDHPGTIMT NSPSTNHSGCSISSNISAGNHASPIANLLFESSQNPSKSTISNIFPDNCCPISSNKPTNNIKTENELSANYFHKNASQNGQFFLNNPFYNYSYNYFDNCPINPQYQSWVQYSDKVDSIKSENQIFSFSNSNETFPNNNFFQ
Sbjct:    1 MYQHQDTDQLNSANGFSSLPSDSTVHSSRTFGKSSFTSRDGQFFNDIDNFSTGSNFFSLKNRYNRFEHSNSVDQLLPTPIETGNRNLGGFCYSNQIMPATLSQSPSNLLQPIMHSHNFPYMSSYNYHYSPFPTTFPGLSNYGRQAALYRCFKNNLNEPMHINKELRCLWIDPNQREGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEXPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSPGTISAAIIASKHPDSSTNISRDHPGTIMTXNSPSTNHSGCSISSNISAGNHASPIANLLFESSQNPSKSTISNIFPDNCCPISSNKPTNNIKTENELSANYFHKNASQNGQFFLNNPFYNYSYNYFDNCPINPQYQSWVQYSDKVDSIKSENQIFSFSNSNETFPNNNFFQ 500          
BLAST of zinc finger protein A vs. TrEMBL
Match: Q1JV17 (Zinc finger protein Dj-ZicA OS=Dugesia japonica OX=6161 GN=Dj-ZicA PE=2 SV=1)

HSP 1 Score: 837.025 bits (2161), Expect = 0.000e+0
Identity = 422/485 (87.01%), Postives = 452/485 (93.20%), Query Frame = 2
Query:  323 MYQHQDTDQLNSANGFSSLPSDSTVHSSRTFGKSSFTSRDGQFFNDIDNFSTGSNFFSLKNRYNRFEHSNSVDQLLPTPIETGNRNLGGFCYSNQIMPATLSQSPSNLLQPIMHSHNFPYMSSYNYHYSPFPTTFPGLSNYGRQAALYRCFKNNLNEPMHINKELRCLWIDPNQREGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSPGTISAAIIASKHPDSSTNISRDHPGTIMTQNSPSTNHSGCSISSNISAGNHASPIANLLFESSQNPSKSTISNIFPDN-CCPISSNKPTNNIKTENELSANYFHKNASQNGQXXXXXXXXXXXXXXXDNCPINPQYQSWVQYSDKVDSIKSENQIF 1774
            MYQHQ+TDQLNS NGF+SLP DSTVHSSR FGKSSFTSRDGQFFNDIDNFSTGSNFFSLKNRYNRFEHSN+ DQ LP+ IE GNR + GFCYSNQIMPATLSQSPSNLLQPIMHS+NFPYMS YNYHY+PFP+TF GLS+YGRQAALYRCF+NNLNEP+HINKELRCLWIDPNQR+G+KPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPY+CKIKGCEKSYTHPSSLRKHMRVHNLSPGTISAAI+ASKHPDSSTNISRD+   ++ QNSPSTNHSGCSISSNISAGNH SPI+N +F+ SQN SKSTISNIF +N CCPI +NKP  N KTENE   +YFHKN  QN QFFLNNPFYNYSYNYFDNCP+NPQ QSWVQYS+K +S+K+ENQ+F
Sbjct:    1 MYQHQETDQLNSVNGFNSLPIDSTVHSSRPFGKSSFTSRDGQFFNDIDNFSTGSNFFSLKNRYNRFEHSNTTDQXLPSQIEPGNRGISGFCYSNQIMPATLSQSPSNLLQPIMHSNNFPYMSPYNYHYTPFPSTFSGLSSYGRQAALYRCFRNNLNEPIHINKELRCLWIDPNQRDGSKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYYCKIKGCEKSYTHPSSLRKHMRVHNLSPGTISAAIVASKHPDSSTNISRDNSVPVINQNSPSTNHSGCSISSNISAGNHPSPISNSIFD-SQNLSKSTISNIFNENGCCPILANKPI-NYKTENEFPNSYFHKNVPQNSQFFLNNPFYNYSYNYFDNCPVNPQNQSWVQYSEKFESVKTENQLF 483          
BLAST of zinc finger protein A vs. TrEMBL
Match: Q1JV16 (Zinc finger protein Dj-ZicB OS=Dugesia japonica OX=6161 GN=Dj-ZicB PE=2 SV=1)

HSP 1 Score: 316.235 bits (809), Expect = 5.283e-97
Identity = 144/194 (74.23%), Postives = 162/194 (83.51%), Query Frame = 2
Query:  728 PGLSNYGRQAALYRCFKNNLNEPMHINKELRCLWIDPNQREGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSP 1309
            P +S+Y  QAA Y+ F  N         E +CLW+D + +E  + C KL+ +I +IV HLT+DHVGGPEQLDHTCYWK+C RD K FKAKYKLVNH+RVHTGEKPFQCPF +CGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVH NDKPYFCK +GC+KSYTHPSSLRKHMR+HNLSP
Sbjct:  151 PSMSSYTHQAAFYQFFHRN--AVTGFRSEFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNLSP 342          
BLAST of zinc finger protein A vs. TrEMBL
Match: A0A159X5T5 (Zinc finger protein of the cerebellum 2 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=zic-2 PE=2 SV=1)

HSP 1 Score: 288.5 bits (737), Expect = 6.937e-90
Identity = 135/186 (72.58%), Postives = 152/186 (81.72%), Query Frame = 2
Query:  722 TFPGLSNYGRQAALYRCFKNNLNEPMHINKELRCLWIDPNQREGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLR 1279
            T P +S+Y  QAA Y+ F  N         E +CLW+D + +E  + C KL+ +I +IV HLT+DHVGGPEQLDHTCYWK+C RD K FKAKYKLVNH+RVHTGEKPFQCPF +CGKLFARSEN KIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVH NDKPYFCK +GC+KSYTHPSSLR
Sbjct:   34 THPAMSSYSHQAAFYQFFHRNAVSG--FRTEFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENPKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLR 217          
BLAST of zinc finger protein A vs. TrEMBL
Match: Q1JV34 (Zic family member OS=Branchiostoma floridae OX=7739 GN=AmphiZic PE=4 SV=1)

HSP 1 Score: 293.893 bits (751), Expect = 4.232e-88
Identity = 132/182 (72.53%), Postives = 152/182 (83.52%), Query Frame = 2
Query:  755 AALYRCFKNNLNEPMHINKELRCLWIDPNQREGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHN 1300
            AA +R  +        I +EL CLWIDP+Q E  KPC K +S++ +IVTH+T++HVGGPE  +H C+WKDCPRD +AFKAKYKLVNHIRVHTGEKPF CPF  CGKLFARSENLKIHKRTHTGEKPFKC+FEGCDRRFANSSDRKKH HVH +DKPY CK++GC+KSYTHPSSLRKHM+VH 
Sbjct:  235 AAFFRYMRQP------IKQELSCLWIDPDQPEPKKPCNKSFSTMHEIVTHVTVEHVGGPECTNHACFWKDCPRDGRAFKAKYKLVNHIRVHTGEKPFPCPFPGCGKLFARSENLKIHKRTHTGEKPFKCEFEGCDRRFANSSDRKKHSHVHTSDKPYNCKVRGCDKSYTHPSSLRKHMKVHG 410          
BLAST of zinc finger protein A vs. Ensembl Cavefish
Match: zic5 (zic family member 5 (odd-paired homolog, Drosophila) [Source:ZFIN;Acc:ZDB-GENE-040622-1])

HSP 1 Score: 285.804 bits (730), Expect = 9.676e-89
Identity = 135/216 (62.50%), Postives = 166/216 (76.85%), Query Frame = 2
Query:  803 INKELRCLWIDPNQREGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSPGTISAAIIASKHPDSSTNISRDHPGTIMTQNSPSTNHSGCSISSNIS 1450
            I +EL C WID  ++   KPC K +S++ ++V H+T++HVGGPEQ +H C+W++CPR+ KAFKAKYKL+NHIRVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+F+GCDR+FANSSDRKKH HVH +DKPY+CK++GC+KSYTHPSSLRKHM+VH  SP   SA   A  HP S         G   T +SPS   +  S S+N+S
Sbjct:  213 IKQELICKWID-QEQTAKKPCSKTFSTMHELVNHVTVEHVGGPEQSNHVCFWEECPREGKAFKAKYKLINHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFDGCDRKFANSSDRKKHSHVHTSDKPYYCKVRGCDKSYTHPSSLRKHMKVHCKSPPPPSANSGAGYHPSSG--------GLGDTLSSPSAGEAHRSRSTNLS 419          
BLAST of zinc finger protein A vs. Ensembl Cavefish
Match: zic5 (zic family member 5 (odd-paired homolog, Drosophila) [Source:ZFIN;Acc:ZDB-GENE-040622-1])

HSP 1 Score: 286.189 bits (731), Expect = 2.029e-88
Identity = 137/227 (60.35%), Postives = 170/227 (74.89%), Query Frame = 2
Query:  770 CFKNNLNEPMHINKELRCLWIDPNQREGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSPGTISAAIIASKHPDSSTNISRDHPGTIMTQNSPSTNHSGCSISSNIS 1450
             F   + +P  I +EL C WID  ++   KPC K +S++ ++V H+T++HVGGPEQ +H C+W++CPR+ KAFKAKYKL+NHIRVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+F+GCDR+FANSSDRKKH HVH +DKPY+CK++GC+KSYTHPSSLRKHM+VH  SP   SA   A  HP S         G   T +SPS   +  S S+N+S
Sbjct:  246 AFLRYMRQP--IKQELICKWID-QEQTAKKPCSKTFSTMHELVNHVTVEHVGGPEQSNHVCFWEECPREGKAFKAKYKLINHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFDGCDRKFANSSDRKKHSHVHTSDKPYYCKVRGCDKSYTHPSSLRKHMKVHCKSPPPPSANSGAGYHPSSG--------GLGDTLSSPSAGEAHRSRSTNLS 461          
BLAST of zinc finger protein A vs. Ensembl Cavefish
Match: zic4 (zinc finger protein ZIC 4 [Source:NCBI gene;Acc:103028672])

HSP 1 Score: 279.641 bits (714), Expect = 1.146e-85
Identity = 123/180 (68.33%), Postives = 149/180 (82.78%), Query Frame = 2
Query:  770 CFKNNLNEPMHINKELRCLWIDPNQREGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSP 1309
             F   + +P  I +EL C W++P +    K C K YS++ ++VTH+T++HVGGPEQ +H C+W++CPR+ K FKAKYKLVNHIRVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+F+GCDRRFANSSDRKKH HVH +DKPY CK++GC+KSYTHPSSLRKHM+VH  SP
Sbjct:  281 AFLRYMRQP--IKQELICKWLEP-EHSAKKLCSKTYSTMHELVTHVTVEHVGGPEQANHVCFWQECPREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFDGCDRRFANSSDRKKHSHVHTSDKPYNCKVRGCDKSYTHPSSLRKHMKVHCKSP 457          
BLAST of zinc finger protein A vs. Ensembl Cavefish
Match: zic3 (Zic family member 3 [Source:NCBI gene;Acc:103039856])

HSP 1 Score: 276.174 bits (705), Expect = 3.032e-85
Identity = 132/217 (60.83%), Postives = 163/217 (75.12%), Query Frame = 2
Query:  803 INKELRCLWIDPNQ-REGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSPGTISAAIIASKHPDSSTNISRDHPGTIMTQNSPSTNHSGCSISSNIS 1450
            I +EL C WID NQ     K C + +S++ ++VTH++M+HVGGPEQ +H CYW+DCPR+ K+FKAKYKLVNHIRVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+F+GCDRRFANSSDRKKHMHVH +DKPY CK+  C+KSYTHPSSLRKHM+VH  S G+ S+   +S +  S+  +         T+  PS   S  + S  ++
Sbjct:  235 IKQELSCKWIDENQLNRPKKTCDRTFSTMHEMVTHVSMEHVGGPEQSNHICYWEDCPREGKSFKAKYKLVNHIRVHTGEKPFPCPFPGCGKIFARSENLKIHKRTHTGEKPFKCEFDGCDRRFANSSDRKKHMHVHTSDKPYICKV--CDKSYTHPSSLRKHMKVHE-SQGSESSPAASSGYESSTPPVLVSASTEDPTKTPPSAVQSAAAHSEGLA 448          
BLAST of zinc finger protein A vs. Ensembl Cavefish
Match: zic1 (zic family member 1 (odd-paired homolog, Drosophila) [Source:ZFIN;Acc:ZDB-GENE-000208-4])

HSP 1 Score: 268.085 bits (684), Expect = 4.554e-82
Identity = 129/206 (62.62%), Postives = 156/206 (75.73%), Query Frame = 2
Query:  803 INKELRCLWIDPNQREG-TKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSPGTISAAIIASKHPDSSTNISRDHPGTIMTQNSPSTN 1417
            I +EL C W++P Q     K C K +S++ ++VTHLT++HVGGPEQ +H C+W++C R+ K FKAKYKLVNHIRVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+F+GCDRRFANSSDRKKHMHVH +DKPY CK+  C+KSYTHPSSLRKHM+VH       S +  +   P +S+      P TI+   SPST 
Sbjct:  236 IKQELICKWVEPEQLSSPKKSCNKTFSTMHELVTHLTVEHVGGPEQSNHICFWEECSREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFDGCDRRFANSSDRKKHMHVHTSDKPYLCKM--CDKSYTHPSSLRKHMKVHE------STSQGSQPSPAASSGYESSTPPTIV---SPSTE 430          
BLAST of zinc finger protein A vs. Ensembl Sea Lamprey
Match: glis2b (GLIS family zinc finger 2b [Source:ZFIN;Acc:ZDB-GENE-091204-120])

HSP 1 Score: 159.073 bits (401), Expect = 2.677e-45
Identity = 76/159 (47.80%), Postives = 103/159 (64.78%), Query Frame = 2
Query:  863 CLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSPGTISAAIIAS 1339
            C +++ S  ++V H+   HV    ++ + C+W+ C R  + F A+YK++ H+R HT EKP QCP   C K F+R ENLKIH R+HTGEKP+ C ++GC +R++NSSDR KH   H  DKPY CK  GC K YT PSSLRKH++ H    G    A I+S
Sbjct:    3 CQQVFDSQQELVEHVHDAHVRADREVGYCCHWEGCARMGRGFNARYKMLIHVRTHTNEKPHQCPI--CNKSFSRLENLKIHGRSHTGEKPYACPYQGCSKRYSNSSDRFKHTRTHYVDKPYACKTPGCLKRYTDPSSLRKHVKAHGHQHGPPPNAPISS 159          
BLAST of zinc finger protein A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008614.1 (pep scaffold:Pmarinus_7.0:GL479003:10005:19084:-1 gene:ENSPMAG00000007806.1 transcript:ENSPMAT00000008614.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 153.68 bits (387), Expect = 2.859e-44
Identity = 72/131 (54.96%), Postives = 94/131 (71.76%), Query Frame = 2
Query:  902 HLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHM-HVHQNDKPYFCKIKGCEKSYTHPSSLRKHMR 1291
            H+  +H+ G E+ +  C W+DC R+ K FKA+Y LV H+R HTGEKP +C F  C K ++R ENLK H R+HTGEKP+ C+ EGC++ F+N+SDR KH    H N+KPY CKI GC K YT PSSLRKH++
Sbjct:    1 HINNEHIHG-ERKEFVCRWRDCSREKKPFKAQYMLVVHMRRHTGEKPHKCTFEGCAKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYVCKISGCTKRYTDPSSLRKHVK 130          
BLAST of zinc finger protein A vs. Ensembl Sea Lamprey
Match: znf143b (zinc finger protein 143b [Source:NCBI gene;Acc:393954])

HSP 1 Score: 121.709 bits (304), Expect = 3.855e-30
Identity = 64/148 (43.24%), Postives = 83/148 (56.08%), Query Frame = 2
Query:  863 CLKLYSSILDIVTHLTMDHVGGPEQL--DHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHN 1300
            C K +S+   + +HL   H G    L  D TC         K FK    L  HIR HTGEKPF+CPF  CG+ F  S   K+H RTHTGE+P+ C   GC R F+++++ K H+ +H  +KPY C + GC K +T  SSL KH  VH 
Sbjct:  172 CGKAFSTGYGLKSHLRT-HTGEKPYLCPDETCR--------KGFKTSGDLQKHIRTHTGEKPFKCPFEGCGRSFTTSNIRKVHIRTHTGERPYLCPEPGCGRGFSSATNYKNHVRIHTGEKPYVCTVPGCGKRFTEYSSLYKHQVVHT 310          

HSP 2 Score: 95.1301 bits (235), Expect = 2.965e-21
Identity = 45/117 (38.46%), Postives = 66/117 (56.41%), Query Frame = 2
Query:  950 CYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHN 1300
            C ++ C R    +   + L  H R HTG++P++C    CGK F+    LK H RTHTGEKP+ C  E C + F  S D +KH+  H  +KP+ C  +GC +S+T  +  + H+R H 
Sbjct:  137 CRYEGCGR---LYTTAHHLKVHERAHTGDRPYRCNQPCCGKAFSTGYGLKSHLRTHTGEKPYLCPDETCRKGFKTSGDLQKHIRTHTGEKPFKCPFEGCGRSFTTSNIRKVHIRTHT 250          
BLAST of zinc finger protein A vs. Ensembl Sea Lamprey
Match: znf143b (zinc finger protein 143b [Source:NCBI gene;Acc:393954])

HSP 1 Score: 120.939 bits (302), Expect = 5.296e-30
Identity = 64/148 (43.24%), Postives = 83/148 (56.08%), Query Frame = 2
Query:  863 CLKLYSSILDIVTHLTMDHVGGPEQL--DHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHN 1300
            C K +S+   + +HL   H G    L  D TC         K FK    L  HIR HTGEKPF+CPF  CG+ F  S   K+H RTHTGE+P+ C   GC R F+++++ K H+ +H  +KPY C + GC K +T  SSL KH  VH 
Sbjct:  141 CGKAFSTGYGLKSHLRT-HTGEKPYLCPDETCR--------KGFKTSGDLQKHIRTHTGEKPFKCPFEGCGRSFTTSNIRKVHIRTHTGERPYLCPEPGCGRGFSSATNYKNHVRIHTGEKPYVCTVPGCGKRFTEYSSLYKHQVVHT 279          

HSP 2 Score: 94.7449 bits (234), Expect = 3.301e-21
Identity = 45/117 (38.46%), Postives = 66/117 (56.41%), Query Frame = 2
Query:  950 CYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHN 1300
            C ++ C R    +   + L  H R HTG++P++C    CGK F+    LK H RTHTGEKP+ C  E C + F  S D +KH+  H  +KP+ C  +GC +S+T  +  + H+R H 
Sbjct:  106 CRYEGCGR---LYTTAHHLKVHERAHTGDRPYRCNQPCCGKAFSTGYGLKSHLRTHTGEKPYLCPDETCRKGFKTSGDLQKHIRTHTGEKPFKCPFEGCGRSFTTSNIRKVHIRTHT 219          

HSP 3 Score: 92.0485 bits (227), Expect = 3.096e-20
Identity = 45/93 (48.39%), Postives = 54/93 (58.06%), Query Frame = 2
Query: 1013 HIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMR 1291
            HIR HTGE+P+ CP   CG+ F+ + N K H R HTGEKP+ C   GC +RF   S   KH  VH   KPY C    C K+Y  PS+L  H R
Sbjct:  214 HIRTHTGERPYLCPEPGCGRGFSSATNYKNHVRIHTGEKPYVCTVPGCGKRFTEYSSLYKHQVVHTPVKPYSC--SNCSKTYRQPSTLATHKR 304          

HSP 4 Score: 86.6557 bits (213), Expect = 1.907e-18
Identity = 33/91 (36.26%), Postives = 54/91 (59.34%), Query Frame = 2
Query: 1028 TGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHN 1300
            +GEK F C +  CG+L+  + +LK+H+R HTG++P++C+   C + F+     K H+  H  +KPY C  + C K +     L+KH+R H 
Sbjct:   99 SGEKAFHCRYEGCGRLYTTAHHLKVHERAHTGDRPYRCNQPCCGKAFSTGYGLKSHLRTHTGEKPYLCPDETCRKGFKTSGDLQKHIRTHT 189          

HSP 5 Score: 56.225 bits (134), Expect = 1.091e-8
Identity = 28/81 (34.57%), Postives = 39/81 (48.15%), Query Frame = 2
Query: 1058 SNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHN 1300
            S CG  F +S N        +GEK F C +EGC R +  +   K H   H  D+PY C    C K+++    L+ H+R H 
Sbjct:   79 SVCGHHFCQSMNRASSSGQPSGEKAFHCRYEGCGRLYTTAHHLKVHERAHTGDRPYRCNQPCCGKAFSTGYGLKSHLRTHT 159          
BLAST of zinc finger protein A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003448.1 (pep scaffold:Pmarinus_7.0:GL477543:42863:56609:1 gene:ENSPMAG00000003158.1 transcript:ENSPMAT00000003448.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 112.849 bits (281), Expect = 2.028e-29
Identity = 60/145 (41.38%), Postives = 82/145 (56.55%), Query Frame = 2
Query:  863 CLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFA--NSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMR 1291
            C   +     +  H+   HV      +  C W+ C R  + F A+YKL+ H+RVH+GEKP +C    C + F+ S+  K   R H   K  +C FEGC + F+  NSSDR KH   HQ+ KPY C++ GC K YT PSSLRKH++
Sbjct:   13 CRAAFGRREQLCRHIEKSHVEPQRGEEFACQWEACGRRRRPFNARYKLLIHMRVHSGEKPNRCML--CCETFSHSDTHKHSTRPHQDIKRLQCTFEGCPKAFSRLNSSDRAKHQRTHQDTKPYVCQVPGCSKRYTDPSSLRKHVK 155          
BLAST of zinc finger protein A vs. Ensembl Yeast
Match: AZF1 (Zinc-finger transcription factor; involved in diauxic shift; in the presence of glucose, activates transcription of genes involved in growth and carbon metabolism; in nonfermentable carbon sources, activates transcription of genes involved in maintenance of cell wall integrity; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000005639])

HSP 1 Score: 100.138 bits (248), Expect = 3.002e-22
Identity = 53/159 (33.33%), Postives = 86/159 (54.09%), Query Frame = 2
Query:  872 LYSSILDIVTHLTMDHVGGPEQLDHTCYWK-----DCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHM-RVHNLSPGTISAAI 1330
            L++  +DI+   + + VGG E+   T   +     +CP   + F     L  H+R H G KPF C +  CGK F +  NL+ H+R HTGEKP+ CD   CD++F+   +   H+  HQ  KP+ CK++ C K++T   +++ H  R H  +   ++A +
Sbjct:  560 LFNQTMDILPPKS-ELVGGVEKPKGTQNTRAVKKHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDY--CGKRFTQGGNLRTHERLHTGEKPYSCDI--CDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQNRFHKETLNALTAKL 713          
BLAST of zinc finger protein A vs. Ensembl Yeast
Match: ZAP1 (Zinc-regulated transcription factor; binds to zinc-responsive promoters to induce transcription of certain genes in presence of zinc, represses other genes in low zinc; regulates its own transcription; contains seven zinc-finger domains [Source:SGD;Acc:S000003592])

HSP 1 Score: 98.5969 bits (244), Expect = 9.570e-22
Identity = 55/145 (37.93%), Postives = 82/145 (56.55%), Query Frame = 2
Query:  863 CLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVH 1297
            C K +SS  ++  HL   H+   +  ++ C W DC R    F  + KL+ H++VH+  KP++C    C + F+  E L  H RTH+GEKP+KC    C+++FA SS  K H+  H  +KP  CKI  C K +   S+L KH++ H
Sbjct:  712 CNKSFSSAQELNDHLEAVHLTRGKS-EYQCLWHDCHR---TFPQRQKLIRHLKVHSKYKPYKC--KTCKRCFSSEETLVQHTRTHSGEKPYKCHI--CNKKFAISSSLKIHIRTHTGEKPLQCKI--CGKRFNESSNLSKHIKTH 846          

HSP 2 Score: 68.1662 bits (165), Expect = 2.592e-12
Identity = 42/129 (32.56%), Postives = 67/129 (51.94%), Query Frame = 2
Query:  920 VGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIR-VHT--GEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVH 1297
            +  PEQ+   C W  C    K+F +  +L +H+  VH   G+  +QC + +C + F + + L  H + H+  KP+KC  + C R F++     +H   H  +KPY C I  C K +   SSL+ H+R H
Sbjct:  699 IKQPEQV--ICQWDGCN---KSFSSAQELNDHLEAVHLTRGKSEYQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKC--KTCKRCFSSEETLVQHTRTHSGEKPYKCHI--CNKKFAISSSLKIHIRTH 818          
BLAST of zinc finger protein A vs. Ensembl Yeast
Match: CRZ1 (Transcription factor, activates transcription of stress response genes; nuclear localization is positively regulated by calcineurin-mediated dephosphorylation; rapidly localizes to the nucleus under blue light stress; can be activated in stochastic pulses of nuclear localization in response to calcium [Source:SGD;Acc:S000004972])

HSP 1 Score: 66.6254 bits (161), Expect = 6.276e-12
Identity = 37/92 (40.22%), Postives = 46/92 (50.00%), Query Frame = 2
Query: 1043 FQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFC--KIK-----GCEKSYTHPSSLRKHMRVH 1297
            F C    CGK F R  NLK H RTHT E+PF C    C + FA   DRK+H  +H   K Y C  K+K     GC K +    +L +H +  
Sbjct:  569 FACDV--CGKKFTRPYNLKSHLRTHTNERPFICSI--CGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHFKTE 656          

HSP 2 Score: 60.077 bits (144), Expect = 8.087e-10
Identity = 31/83 (37.35%), Postives = 42/83 (50.60%), Query Frame = 2
Query:  980 KAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFE-------GCDRRFANSSDRKKHMHVH 1207
            K F   Y L +H+R HT E+PF C    CGK FAR  + K H+  HTG+K + C  +       GC ++FA S    +H    
Sbjct:  576 KKFTRPYNLKSHLRTHTNERPFICSI--CGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHFKTE 656          
BLAST of zinc finger protein A vs. Ensembl Yeast
Match: SWI5 (Transcription factor that recruits Mediator and Swi/Snf complexes; activates transcription of genes expressed at the M/G1 phase boundary and in G1 phase; required for expression of the HO gene controlling mating type switching; localization to nucleus occurs during G1 and appears to be regulated by phosphorylation by Cdc28p kinase; SWI5 has a paralog, ACE2, that arose from the whole genome duplication [Source:SGD;Acc:S000002553])

HSP 1 Score: 62.7734 bits (151), Expect = 1.106e-10
Identity = 40/137 (29.20%), Postives = 62/137 (45.26%), Query Frame = 2
Query: 1034 EKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSPGTISAAIIASKHP--------DSST---------NISRDHPGTIM 1393
            +K F+C F  C K F R  N++ H +TH  ++P+ CD  GCD+ F  + D  +H   HQ +K Y C    C K +    +L  H      S G     ++  + P        D ++         NI++DH G +M
Sbjct:  547 DKTFECLFPGCTKTFKRRYNIRSHIQTHLEDRPYSCDHPGCDKAFVRNHDLIRHKKSHQ-EKAYACP---CGKKFNREDALVVHRSRMICSGGKKYENVVIKRSPRKRGRPRKDGTSSVSSSPIKENINKDHNGQLM 679          
BLAST of zinc finger protein A vs. Ensembl Yeast
Match: FZF1 (Transcription factor involved in sulfite metabolism; sole identified regulatory target is SSU1; overexpression suppresses sulfite-sensitivity of many unrelated mutants due to hyperactivation of SSU1, contains five zinc fingers; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000003223])

HSP 1 Score: 60.4622 bits (145), Expect = 1.822e-10
Identity = 34/119 (28.57%), Postives = 57/119 (47.90%), Query Frame = 2
Query: 1028 TGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSPGTISAAIIASKHPDSSTNISRDHPG 1384
            T  + ++C F  C K++ R   L+ H+ +HT +KP+ CD  GC ++F      + H   H   KP  C +  C+K +     LR+H+  H     +  A+ I  KH   + N+  +  G
Sbjct:    7 TKSRNYKCSFDGCEKVYNRPSLLQQHQNSHTNQKPYHCDEPGCGKKFIRPCHLRVHKWTHSQIKPKACTL--CQKRFVTNQQLRRHLNSHERK--SKLASRIDRKHEGVNANVKAELNG 121          

HSP 2 Score: 55.0694 bits (131), Expect = 1.336e-8
Identity = 30/100 (30.00%), Postives = 49/100 (49.00%), Query Frame = 2
Query:  911 MDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQ 1210
            M  +G  +  ++ C +  C    K +     L  H   HT +KP+ C    CGK F R  +L++HK TH+  KP  C    C +RF  +   ++H++ H+
Sbjct:    1 MTDIGRTKSRNYKCSFDGCE---KVYNRPSLLQQHQNSHTNQKPYHCDEPGCGKKFIRPCHLRVHKWTHSQIKPKACTL--CQKRFVTNQQLRRHLNSHE 95          
BLAST of zinc finger protein A vs. Ensembl Nematostella
Match: NV-ZICC (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK36])

HSP 1 Score: 254.603 bits (649), Expect = 3.987e-80
Identity = 117/172 (68.02%), Postives = 135/172 (78.49%), Query Frame = 2
Query:  785 LNEPMHINKELRCLWIDPNQREGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHN 1300
            L +P+  +  + C WI+P  +   KPC + +  + DIV HL+ DHVGGPE   H CYWKDC R+   FKAKYKL+NHIRVHTGEKPF CPF  CGKLFARSENLKIHKRTHTGEKPF C+F GCDRRFANSSDRKKH HVH +DKPY CK+ GC KSYTHPSSLRKHM++H+
Sbjct:   21 LRQPL--SHVVMCEWIEPGSK--GKPCGRQFFRMHDIVAHLSEDHVGGPESTTHVCYWKDCARNGLPFKAKYKLINHIRVHTGEKPFACPFPGCGKLFARSENLKIHKRTHTGEKPFICEFPGCDRRFANSSDRKKHSHVHTSDKPYICKVDGCNKSYTHPSSLRKHMKLHS 188          
BLAST of zinc finger protein A vs. Ensembl Nematostella
Match: NV-ZICD (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK35])

HSP 1 Score: 241.506 bits (615), Expect = 4.105e-76
Identity = 113/166 (68.07%), Postives = 131/166 (78.92%), Query Frame = 2
Query:  806 NKELRCLWIDPNQREGT-KPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHN 1300
            N+ L C+WID     G  KPC K Y+ + DIV+H++ +HV   +   H CYW++C R+ + FKAKYKLVNHIRVHTGEKPF CPF  CGKLFARSENLKIHKRTHTGEKPF C+F GCDRRFANSSDRKKH HVH +DKPY CK+ GC KSYTHPSSLRKHM++H 
Sbjct:   14 NQVLTCMWIDQGPIPGKRKPCGKQYTHMPDIVSHISDEHVSANDSSLHVCYWQECSRNGQPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKLFARSENLKIHKRTHTGEKPFMCEFPGCDRRFANSSDRKKHSHVHTSDKPYICKVDGCNKSYTHPSSLRKHMKLHE 179          
BLAST of zinc finger protein A vs. Ensembl Nematostella
Match: NV-ZICE (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK34])

HSP 1 Score: 235.728 bits (600), Expect = 5.011e-74
Identity = 112/168 (66.67%), Postives = 129/168 (76.79%), Query Frame = 2
Query:  806 NKELRCLWIDPNQREGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSP 1309
            NK + C W+DP      K C K +S + DIV H+  +HV   +   H C+W++C R+   FKAKYKLVNHIRVHTGEKPF CPF  CGKLFARSENLKIHKRTHTGEKPF C+F GCDRRFANSSDRKKH HVH +DKPY CK +GC KSYTHPSSLRKHM++H +SP
Sbjct:   10 NKIMTCEWVDPQNYGKGKICGKQFSVLHDIVRHINDEHVSQNDSPLHVCHWRNCTRNGLPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKLFARSENLKIHKRTHTGEKPFICEFPGCDRRFANSSDRKKHSHVHTSDKPYNCKYEGCNKSYTHPSSLRKHMKLHGMSP 177          
BLAST of zinc finger protein A vs. Ensembl Nematostella
Match: NV-ZICA (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8M8])

HSP 1 Score: 228.024 bits (580), Expect = 4.491e-71
Identity = 106/159 (66.67%), Postives = 127/159 (79.87%), Query Frame = 2
Query:  821 CLWIDPNQREGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVH 1297
            C WID  ++     C K++S + ++V H+T++HV G +   H C W+ C R  K FKAKYKLVNHIRVHTGEKPF CPFS+C KLFARSENLKIHKRTHTGEKPF+C+F+GC+RRFANSSDRKKH HVH +DKPY C+  GCEKSYTHPSSLRKH++ H
Sbjct:   17 CKWIDCTEKVSL-LCDKVFSCMDELVKHITIEHVNGRDSTQHVCCWESCDRAGKPFKAKYKLVNHIRVHTGEKPFVCPFSSCNKLFARSENLKIHKRTHTGEKPFECEFKGCNRRFANSSDRKKHSHVHTSDKPYNCRYSGCEKSYTHPSSLRKHLKAH 174          
BLAST of zinc finger protein A vs. Ensembl Nematostella
Match: NV-ZICB (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK39])

HSP 1 Score: 193.741 bits (491), Expect = 1.871e-58
Identity = 88/142 (61.97%), Postives = 110/142 (77.46%), Query Frame = 2
Query:  875 YSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHN 1300
            +  I ++V H+T  H+         C W++CPR+   FKAKYKL+NHIRVHTGEKPF C    CGK FAR+ENLKIH RTHTGE+PF C+++GCD+RFANSSDR+KH+HVH  +KPY C+  GC+KSYTHPSSLRKHM+VH+
Sbjct:    1 FYRIEELVFHITESHLVTGVTSAFVCNWRECPRNGLPFKAKYKLINHIRVHTGEKPFTCSQPGCGKSFARAENLKIHIRTHTGERPFACEYKGCDKRFANSSDRRKHIHVHTLEKPYCCRFVGCDKSYTHPSSLRKHMKVHS 142          
BLAST of zinc finger protein A vs. Ensembl Medaka
Match: zic5 (Zic family member 5 [Source:NCBI gene;Acc:101159624])

HSP 1 Score: 276.559 bits (706), Expect = 4.949e-85
Identity = 121/169 (71.60%), Postives = 145/169 (85.80%), Query Frame = 2
Query:  803 INKELRCLWIDPNQREGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSP 1309
            I +EL C WID  +    KPC K YS++ ++V H+T++HVGGPEQ  H C+W++CPR+ KAFKAKYKL+NHIRVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+F+GCDR+FANSSDRKKH HVH +DKPY+CK++GC+KSYTHPSSLRKHM+VH  SP
Sbjct:  242 IKQELICKWID-QELSQKKPCSKTYSTMHELVNHVTVEHVGGPEQSSHVCFWEECPREGKAFKAKYKLINHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFDGCDRKFANSSDRKKHSHVHTSDKPYYCKVRGCDKSYTHPSSLRKHMKVHCKSP 409          
BLAST of zinc finger protein A vs. Ensembl Medaka
Match: zic4 (Zic family member 4 [Source:NCBI gene;Acc:101170551])

HSP 1 Score: 276.559 bits (706), Expect = 1.791e-84
Identity = 121/169 (71.60%), Postives = 145/169 (85.80%), Query Frame = 2
Query:  803 INKELRCLWIDPNQREGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSP 1309
            I +EL C W++P +    K C K YS++ ++VTH+T++HVGGPEQ +H C+W++CPR+ K FKAKYKLVNHIRVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+F+GCDRRFANSSDRKKH HVH +DKPY CK++GC+KSYTHPSSLRKHM+VH  SP
Sbjct:  283 IKQELICKWLEP-EHSPKKLCSKTYSTMHELVTHVTVEHVGGPEQANHICFWEECPREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFDGCDRRFANSSDRKKHSHVHTSDKPYNCKVRGCDKSYTHPSSLRKHMKVHCKSP 450          
BLAST of zinc finger protein A vs. Ensembl Medaka
Match: zic3 (zinc finger protein ZIC 3 [Source:NCBI gene;Acc:101166969])

HSP 1 Score: 271.166 bits (692), Expect = 1.637e-83
Identity = 125/189 (66.14%), Postives = 154/189 (81.48%), Query Frame = 2
Query:  803 INKELRCLWIDPNQR-EGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSPGTISAAIIASKHPDSSTNI 1366
            I +EL C WI+ NQ     K C + +S++ ++VTH++M+HVGGPEQ +H C+W+DCPR+ K+FKAKYKLVNHIRVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+F+GCDRRFANSSDRKKHMHVH +DKPY CK+  C+KSYTHPSSLRKHM+VH  S G+ S+   +S +  S+  +
Sbjct:  224 IKQELSCKWIEENQMNRPKKTCDRTFSTMHEMVTHVSMEHVGGPEQSNHVCFWEDCPREGKSFKAKYKLVNHIRVHTGEKPFPCPFPGCGKIFARSENLKIHKRTHTGEKPFKCEFDGCDRRFANSSDRKKHMHVHTSDKPYICKV--CDKSYTHPSSLRKHMKVHE-SQGSESSPAASSGYESSTPPV 409          
BLAST of zinc finger protein A vs. Ensembl Medaka
Match: zic2a (Zic family member 2 [Source:NCBI gene;Acc:101159393])

HSP 1 Score: 269.24 bits (687), Expect = 7.527e-83
Identity = 120/167 (71.86%), Postives = 142/167 (85.03%), Query Frame = 2
Query:  803 INKELRCLWIDPNQREGTKPCL-KLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHN 1300
            I +EL C WIDP+Q    K C  K +S++ ++VTH++++HVGGPEQ +H C+W+DC R+ K FKAKYKLVNHIRVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPF+C+FEGCDRRFANSSDRKKHMHVH +DKPY CK+  C+KSYTHPSSLRKHM+VH 
Sbjct:  218 IKQELICKWIDPDQLSNPKKCCNKTFSTMHELVTHVSVEHVGGPEQTNHVCFWEDCSRESKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFQCEFEGCDRRFANSSDRKKHMHVHTSDKPYLCKM--CDKSYTHPSSLRKHMKVHE 382          
BLAST of zinc finger protein A vs. Ensembl Medaka
Match: zic1 (Zic family member 1 [Source:NCBI gene;Acc:101170307])

HSP 1 Score: 267.7 bits (683), Expect = 1.926e-82
Identity = 121/168 (72.02%), Postives = 142/168 (84.52%), Query Frame = 2
Query:  803 INKELRCLWIDPNQREG-TKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNL 1303
            I +EL C WI+P Q     K C K +S++ ++VTHLT++HVGGPEQ +H CYW+DC R+ K FKAKYKLVNHIRVHTGEKPF CPF  CGK+FARSENLKIHKRTHTGEKPFKC+F+GCDRRFANSSDRKKHMHVH +DKPY CK+  C+KSYTHPSSLRKHM+V ++
Sbjct:  214 IKQELICKWIEPEQLTNPKKSCNKTFSTMHELVTHLTVEHVGGPEQTNHVCYWEDCSREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFDGCDRRFANSSDRKKHMHVHTSDKPYLCKM--CDKSYTHPSSLRKHMKVKSM 379          
BLAST of zinc finger protein A vs. Planmine SMEST
Match: SMESG000022958.1 (SMESG000022958.1)

HSP 1 Score: 1045.42 bits (2702), Expect = 0.000e+0
Identity = 522/524 (99.62%), Postives = 522/524 (99.62%), Query Frame = 2
Query:  251 MYHSPKQVKMEPGEELNLPTVLHCMYQHQDTDQLNSANGFSSLPSDSTVHSSRTFGKSSFTSRDGQFFNDIDNFSTGSNFFSLKNRYNRFEHSNSVDQLLPTPIETGNRNLGGFCYSNQIMPATLSQSPSNLLQPIMHSHNFPYMSSYNYHYSPFPTTFPGLSNYGRQAALYRCFKNNLNEPMHINKELRCLWIDPNQREGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSPGTISAAIIASKHPDSSTNISRDHPGTIMTQNSPSTNHSGCSISSNISAGNHASPIANLLFESSQNPSKSTISNIFPDNCCPISSNKPTNNIKTENELSANYFHKNASQNGQXXXXXXXXXXXXXXXDNCPINPQYQSWVQYSDKVDSIKSENQIFSFSNSNETFPNNNFFQ 1822
            MYHSPKQVKMEPGEELNLPTVLHCMYQHQDTDQLNSANGFSSLPSDSTVHSSRTFGKSSFTSRDGQFFNDIDNFSTGSNFFSLKNRYNRFEHSNSVDQLLPTPIETGNRNLGGFCYSNQIMPATLSQSPSNLLQPIMHSHNFPYMSSYNYHYSPFPTTFPGLSNYGRQAALYRCFKNNLNEPMHINKELRCLWIDPNQREGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSPGTISAAIIASKHPDSSTNISRDHPGTIM QNSPSTNHSGCSISSNISAGNHASPIANLLFESSQNPSKSTISNIFPDNCCPISSNKPTNNIKTENEL ANYFHKNASQNGQFFLNNPFYNYSYNYFDNCPINPQYQSWVQYSDKVDSIKSENQIFSFSNSNETFPNNNFFQ
Sbjct:    1 MYHSPKQVKMEPGEELNLPTVLHCMYQHQDTDQLNSANGFSSLPSDSTVHSSRTFGKSSFTSRDGQFFNDIDNFSTGSNFFSLKNRYNRFEHSNSVDQLLPTPIETGNRNLGGFCYSNQIMPATLSQSPSNLLQPIMHSHNFPYMSSYNYHYSPFPTTFPGLSNYGRQAALYRCFKNNLNEPMHINKELRCLWIDPNQREGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSPGTISAAIIASKHPDSSTNISRDHPGTIMAQNSPSTNHSGCSISSNISAGNHASPIANLLFESSQNPSKSTISNIFPDNCCPISSNKPTNNIKTENELPANYFHKNASQNGQFFLNNPFYNYSYNYFDNCPINPQYQSWVQYSDKVDSIKSENQIFSFSNSNETFPNNNFFQ 524          
BLAST of zinc finger protein A vs. Planmine SMEST
Match: SMESG000052644.1 (SMESG000052644.1)

HSP 1 Score: 317.005 bits (811), Expect = 8.513e-101
Identity = 144/196 (73.47%), Postives = 163/196 (83.16%), Query Frame = 2
Query:  722 TFPGLSNYGRQAALYRCFKNNLNEPMHINKELRCLWIDPNQREGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSP 1309
            T P +S+Y  QAA Y+ F  N         E +CLW+D + +E  + C KL+ +I +IV HLT+DHVGGPEQLDHTCYWK+C RD K FKAKYKLVNH+RVHTGEKPFQCPF +CGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVH NDKPYFCK +GC+KSYTHPSSLRKHMR+HN+SP
Sbjct:  150 THPAMSSYSHQAAFYQFFHRNAVSGFRT--EFQCLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLDHTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIHNISP 343          
BLAST of zinc finger protein A vs. Planmine SMEST
Match: SMESG000073727.1 (SMESG000073727.1)

HSP 1 Score: 175.252 bits (443), Expect = 8.977e-46
Identity = 79/162 (48.77%), Postives = 105/162 (64.81%), Query Frame = 2
Query:  812 ELRCLWIDPNQREGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMH-VHQNDKPYFCKIKGCEKSYTHPSSLRKHMRV 1294
            E  C W D         C+K + +  ++V H++  H+ G  +    C WKDC R  + FKA+Y LV H+R HTGEKP QC F NC K ++R ENLK H R+HTGEKP++C+F GC + F+N+SDR KH +  H N KPY CK++GC K YT PSSLRKH++ 
Sbjct:  300 ETNCHWND---------CVKTFDTQAELVKHISTIHISGSGKQTFVCQWKDCVRSGRPFKAQYMLVVHMRRHTGEKPHQCTFPNCNKRYSRLENLKTHIRSHTGEKPYECEFPGCHKAFSNASDRAKHQNRTHSNTKPYVCKVEGCAKRYTDPSSLRKHVKT 452          
BLAST of zinc finger protein A vs. Planmine SMEST
Match: SMESG000073727.1 (SMESG000073727.1)

HSP 1 Score: 175.252 bits (443), Expect = 1.131e-45
Identity = 79/162 (48.77%), Postives = 105/162 (64.81%), Query Frame = 2
Query:  812 ELRCLWIDPNQREGTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMH-VHQNDKPYFCKIKGCEKSYTHPSSLRKHMRV 1294
            E  C W D         C+K + +  ++V H++  H+ G  +    C WKDC R  + FKA+Y LV H+R HTGEKP QC F NC K ++R ENLK H R+HTGEKP++C+F GC + F+N+SDR KH +  H N KPY CK++GC K YT PSSLRKH++ 
Sbjct:  322 ETNCHWND---------CVKTFDTQAELVKHISTIHISGSGKQTFVCQWKDCVRSGRPFKAQYMLVVHMRRHTGEKPHQCTFPNCNKRYSRLENLKTHIRSHTGEKPYECEFPGCHKAFSNASDRAKHQNRTHSNTKPYVCKVEGCAKRYTDPSSLRKHVKT 474          
BLAST of zinc finger protein A vs. Planmine SMEST
Match: SMESG000078300.1 (SMESG000078300.1)

HSP 1 Score: 168.703 bits (426), Expect = 9.358e-44
Identity = 79/174 (45.40%), Postives = 108/174 (62.07%), Query Frame = 2
Query:  812 ELRCLWIDPNQREGTKPCLKLYSSILDIVTHLTMDHVGGPEQLD-HTCYWKDCPRDCKAFKAKYKLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHNLSPGTISAAI 1330
            +L C WID         C + +     +V H+   HV      D +TC+W+ C R  K F A+YKL+ H+RVH+GEKP +C +S C K F+R ENLKIH+R+HTGE+P++C + GC + F+NSSDR KH   H + KPY C + GC K YT PSSLRKH + H      ++A+I
Sbjct:  386 KLICFWID---------CYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSHQNFQSQLNASI 550          
The following BLAST results are available for this feature:
BLAST of zinc finger protein A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZIC31.695e-8553.14Zic family member 3 [Source:HGNC Symbol;Acc:HGNC:1... [more]
ZIC17.457e-8465.05Zic family member 1 [Source:HGNC Symbol;Acc:HGNC:1... [more]
ZIC27.873e-8463.11Zic family member 2 [Source:HGNC Symbol;Acc:HGNC:1... [more]
ZIC42.970e-8268.64Zic family member 4 [Source:HGNC Symbol;Acc:HGNC:2... [more]
ZIC42.970e-8268.64Zic family member 4 [Source:HGNC Symbol;Acc:HGNC:2... [more]
back to top
BLAST of zinc finger protein A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ref-25.117e-5254.27REgulator of Fusion [Source:UniProtKB/TrEMBL;Acc:... [more]
ref-25.224e-5254.27REgulator of Fusion [Source:UniProtKB/TrEMBL;Acc:... [more]
ref-25.224e-5254.27REgulator of Fusion [Source:UniProtKB/TrEMBL;Acc:... [more]
tra-19.859e-4046.15Sex-determining transformer protein 1 [Source:Uni... [more]
ztf-144.055e-2546.96Zinc finger putative Transcription Factor family ... [more]
back to top
BLAST of zinc finger protein A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
opa1.177e-7969.59gene:FBgn0003002 transcript:FBtr0078836[more]
lmd1.630e-4354.01gene:FBgn0039039 transcript:FBtr0084364[more]
ci1.366e-3945.68gene:FBgn0004859 transcript:FBtr0306168[more]
ci1.501e-3945.68gene:FBgn0004859 transcript:FBtr0089178[more]
sug8.675e-3942.60gene:FBgn0033782 transcript:FBtr0331985[more]
back to top
BLAST of zinc finger protein A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zic51.058e-8868.82zic family member 5 (odd-paired homolog, Drosophil... [more]
zic44.476e-8571.60zic family member 4 [Source:ZFIN;Acc:ZDB-GENE-0406... [more]
zic47.472e-8571.60zic family member 4 [Source:ZFIN;Acc:ZDB-GENE-0406... [more]
zic31.078e-8461.01zic family member 3 heterotaxy 1 (odd-paired homol... [more]
zic12.582e-8365.05zic family member 1 (odd-paired homolog, Drosophil... [more]
back to top
BLAST of zinc finger protein A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bcam9.580e-8461.95basal cell adhesion molecule (Lutheran blood group... [more]
lpcat41.298e-8361.82lysophosphatidylcholine acyltransferase 4 [Source:... [more]
nt5dc35.214e-8371.605'-nucleotidase domain containing 3 [Source:Xenbas... [more]
cnot108.432e-8367.38CCR4-NOT transcription complex subunit 10 [Source:... [more]
zic21.041e-8263.11Zic family member 2 [Source:NCBI gene;Acc:549779][more]
back to top
BLAST of zinc finger protein A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Zic33.949e-8660.83zinc finger protein of the cerebellum 3 [Source:MG... [more]
Zic31.637e-8553.14zinc finger protein of the cerebellum 3 [Source:MG... [more]
Zic43.162e-8569.23zinc finger protein of the cerebellum 4 [Source:MG... [more]
Zic43.162e-8569.23zinc finger protein of the cerebellum 4 [Source:MG... [more]
Zic46.348e-8569.23zinc finger protein of the cerebellum 4 [Source:MG... [more]
back to top
BLAST of zinc finger protein A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O60481|ZIC3_HUMAN8.138e-8553.14Zinc finger protein ZIC 3 OS=Homo sapiens OX=9606 ... [more]
sp|Q62521|ZIC3_MOUSE1.145e-8453.14Zinc finger protein ZIC 3 OS=Mus musculus OX=10090... [more]
sp|Q8JJC0|ZIC1_CHICK1.744e-8462.01Zinc finger protein ZIC 1 OS=Gallus gallus OX=9031... [more]
sp|A0JC51|ZIC4_XENLA1.755e-8462.26Zinc finger protein ZIC 4 OS=Xenopus laevis OX=835... [more]
sp|Q61467|ZIC4_MOUSE4.441e-8469.23Zinc finger protein ZIC 4 OS=Mus musculus OX=10090... [more]
back to top
BLAST of zinc finger protein A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
X5CWX30.000e+099.60Zinc finger protein A OS=Schmidtea mediterranea OX... [more]
Q1JV170.000e+087.01Zinc finger protein Dj-ZicA OS=Dugesia japonica OX... [more]
Q1JV165.283e-9774.23Zinc finger protein Dj-ZicB OS=Dugesia japonica OX... [more]
A0A159X5T56.937e-9072.58Zinc finger protein of the cerebellum 2 (Fragment)... [more]
Q1JV344.232e-8872.53Zic family member OS=Branchiostoma floridae OX=773... [more]
back to top
BLAST of zinc finger protein A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zic59.676e-8962.50zic family member 5 (odd-paired homolog, Drosophil... [more]
zic52.029e-8860.35zic family member 5 (odd-paired homolog, Drosophil... [more]
zic41.146e-8568.33zinc finger protein ZIC 4 [Source:NCBI gene;Acc:10... [more]
zic33.032e-8560.83Zic family member 3 [Source:NCBI gene;Acc:10303985... [more]
zic14.554e-8262.62zic family member 1 (odd-paired homolog, Drosophil... [more]
back to top
BLAST of zinc finger protein A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glis2b2.677e-4547.80GLIS family zinc finger 2b [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000008614.12.859e-4454.96pep scaffold:Pmarinus_7.0:GL479003:10005:19084:-1 ... [more]
znf143b3.855e-3043.24zinc finger protein 143b [Source:NCBI gene;Acc:393... [more]
znf143b5.296e-3043.24zinc finger protein 143b [Source:NCBI gene;Acc:393... [more]
ENSPMAT00000003448.12.028e-2941.38pep scaffold:Pmarinus_7.0:GL477543:42863:56609:1 g... [more]
back to top
BLAST of zinc finger protein A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
AZF13.002e-2233.33Zinc-finger transcription factor; involved in diau... [more]
ZAP19.570e-2237.93Zinc-regulated transcription factor; binds to zinc... [more]
CRZ16.276e-1240.22Transcription factor, activates transcription of s... [more]
SWI51.106e-1029.20Transcription factor that recruits Mediator and Sw... [more]
FZF11.822e-1028.57Transcription factor involved in sulfite metabolis... [more]
back to top
BLAST of zinc finger protein A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
NV-ZICC3.987e-8068.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
NV-ZICD4.105e-7668.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
NV-ZICE5.011e-7466.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
NV-ZICA4.491e-7166.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
NV-ZICB1.871e-5861.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of zinc finger protein A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zic54.949e-8571.60Zic family member 5 [Source:NCBI gene;Acc:10115962... [more]
zic41.791e-8471.60Zic family member 4 [Source:NCBI gene;Acc:10117055... [more]
zic31.637e-8366.14zinc finger protein ZIC 3 [Source:NCBI gene;Acc:10... [more]
zic2a7.527e-8371.86Zic family member 2 [Source:NCBI gene;Acc:10115939... [more]
zic11.926e-8272.02Zic family member 1 [Source:NCBI gene;Acc:10117030... [more]
back to top
BLAST of zinc finger protein A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022958.10.000e+099.62SMESG000022958.1[more]
SMESG000052644.18.513e-10173.47SMESG000052644.1[more]
SMESG000073727.18.977e-4648.77SMESG000073727.1[more]
SMESG000073727.11.131e-4548.77SMESG000073727.1[more]
SMESG000078300.19.358e-4445.40SMESG000078300.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30005045
GenBankAHW52381.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005045 ID=SMED30005045|Name=zinc finger protein A|organism=Schmidtea mediterranea sexual|type=transcript|length=2020bp
TAAATTATAAACTAACCAAATCAATTGACCAATCAAAAATTAAGAGCTGA
TTTGAGCGATTTCTCAAACTGTAGAAAGTATTATTAATAGACTAAAATAA
AGTTAATTAATAAACCAATCAAATCACTGATGCTTTGCTGACATAATTTT
CCAAAGTGTGCGCCTTCAATTTCCAGCAACCAATCAAATTCGTTCAACAT
TAAATATGATAATCAACAATAAGACAACGAAAGCGGGAGTCCTAATTTAA
ATGTATCATTCTCCCAAGCAAGTAAAAATGGAACCTGGGGAGGAACTAAA
TTTACCAACTGTTTTACACTGCATGTATCAACACCAAGATACTGATCAGC
TGAATTCTGCAAACGGGTTTAGCTCCCTACCAAGTGATTCAACAGTTCAT
TCATCTAGAACTTTTGGAAAATCTTCGTTCACTTCTCGTGATGGGCAATT
TTTCAATGACATTGACAACTTTTCGACAGGATCAAATTTTTTTTCACTCA
AAAATCGTTATAATCGGTTTGAACATTCAAACAGTGTAGATCAACTGCTA
CCAACACCAATCGAAACTGGAAATAGAAATCTTGGTGGATTTTGCTATTC
AAATCAAATAATGCCTGCAACTTTGTCACAATCTCCATCGAATCTATTAC
AACCGATTATGCATAGTCACAATTTTCCTTATATGTCTTCATACAATTAT
CACTACTCGCCATTTCCGACCACGTTTCCGGGATTGTCGAACTATGGCAG
ACAAGCAGCCCTGTATAGATGTTTCAAAAACAATCTCAATGAACCTATGC
ATATCAATAAAGAATTACGATGTCTTTGGATTGACCCAAATCAACGAGAA
GGAACAAAACCTTGTTTAAAACTATATTCCAGTATATTGGATATTGTCAC
TCATTTGACAATGGACCACGTTGGTGGTCCGGAACAGCTTGATCACACTT
GCTATTGGAAAGATTGTCCGCGTGACTGCAAAGCTTTCAAGGCTAAATAT
AAACTAGTCAATCACATTCGAGTTCACACTGGAGAAAAACCATTTCAATG
CCCTTTCAGTAATTGTGGGAAACTGTTTGCTCGTAGTGAAAATTTAAAAA
TACATAAGAGAACTCACACCGGAGAAAAACCATTTAAATGCGATTTTGAA
GGCTGTGACAGACGATTTGCAAATAGTTCGGATAGAAAGAAGCATATGCA
TGTCCATCAAAACGATAAACCATATTTTTGTAAAATTAAGGGCTGTGAAA
AAAGCTACACTCATCCGAGTTCTTTGAGAAAACACATGAGAGTTCACAAT
CTGTCTCCGGGAACCATTTCAGCAGCCATTATTGCTTCGAAACACCCAGA
TTCCTCAACAAACATATCTCGCGACCATCCAGGGACAATAATGACTCAGA
ATTCCCCATCGACAAATCACAGTGGCTGTTCAATATCAAGCAATATATCA
GCTGGCAATCACGCATCACCGATTGCAAATCTTCTATTTGAATCGTCGCA
AAACCCATCAAAATCTACAATTTCAAACATTTTCCCTGACAACTGCTGTC
CGATTTCCTCAAATAAGCCAACGAACAACATCAAAACCGAAAACGAATTA
TCCGCGAATTATTTCCACAAAAATGCCTCACAAAACGGACAGTTCTTTCT
CAATAATCCCTTTTATAATTATTCATACAATTATTTCGACAACTGTCCGA
TAAATCCTCAGTACCAGTCCTGGGTACAATATTCCGACAAGGTTGACTCC
ATTAAATCCGAAAATCAAATTTTTTCCTTTTCAAATTCGAATGAAACATT
TCCTAATAATAATTTTTTTCAATCGAAAAGATCATCGTAAAGTCGTTGAC
TCGGTCTGCCAACCCCATAACGGTGGGAGAATTGTTTTGTATTCGTTGTT
TTTAACAGAGGTAATGCTATTAAAAAACTCCCTTCAAAGCGATGGACTAC
TAAAAATAAAGTGTGAAGATCACTTATCAAGTACTGTTATATAAATAAAA
ATTTGAAAGTTTAAAAAAAA
back to top

protein sequence of SMED30005045-orf-1

>SMED30005045-orf-1 ID=SMED30005045-orf-1|Name=SMED30005045-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=530bp
MYHSPKQVKMEPGEELNLPTVLHCMYQHQDTDQLNSANGFSSLPSDSTVH
SSRTFGKSSFTSRDGQFFNDIDNFSTGSNFFSLKNRYNRFEHSNSVDQLL
PTPIETGNRNLGGFCYSNQIMPATLSQSPSNLLQPIMHSHNFPYMSSYNY
HYSPFPTTFPGLSNYGRQAALYRCFKNNLNEPMHINKELRCLWIDPNQRE
GTKPCLKLYSSILDIVTHLTMDHVGGPEQLDHTCYWKDCPRDCKAFKAKY
KLVNHIRVHTGEKPFQCPFSNCGKLFARSENLKIHKRTHTGEKPFKCDFE
GCDRRFANSSDRKKHMHVHQNDKPYFCKIKGCEKSYTHPSSLRKHMRVHN
LSPGTISAAIIASKHPDSSTNISRDHPGTIMTQNSPSTNHSGCSISSNIS
AGNHASPIANLLFESSQNPSKSTISNIFPDNCCPISSNKPTNNIKTENEL
SANYFHKNASQNGQFFLNNPFYNYSYNYFDNCPINPQYQSWVQYSDKVDS
IKSENQIFSFSNSNETFPNNNFFQSKRSS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
PLANA:0003109anterior pole cell
PLANA:0007524anterior pole
PLANA:0007547anterior pole progenitor cell
Vocabulary: INTERPRO
TermDefinition
IPR041643Znf_ZIC
IPR036236Znf_C2H2_sf
IPR015880Znf_C2H2-like
IPR013087Znf_C2H2_type
IPR007087Znf_C2H2
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 232..259
e-value: 6.7
score: 14.8
coord: 325..349
e-value: 1.1E-4
score: 31.6
coord: 295..319
e-value: 0.0022
score: 27.3
coord: 265..289
e-value: 8.6E-4
score: 28.6
IPR013087Zinc finger C2H2-typePFAMPF00096zf-C2H2coord: 325..349
e-value: 9.1E-5
score: 22.7
coord: 265..289
e-value: 2.1E-4
score: 21.5
coord: 295..319
e-value: 0.0087
score: 16.5
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 297..319
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 327..349
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 267..289
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 325..349
score: 11.074
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 237..264
score: 11.219
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 265..294
score: 16.83
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 295..324
score: 12.819
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 178..262
e-value: 1.2E-21
score: 78.9
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 289..323
e-value: 2.1E-12
score: 48.6
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 263..288
e-value: 7.2E-15
score: 56.5
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 324..350
e-value: 2.5E-11
score: 45.3
NoneNo IPR availablePANTHERPTHR19818:SF91ZINC FINGER PROTEIN ZIC 4coord: 184..407
NoneNo IPR availablePANTHERPTHR19818ZINC FINGER PROTEIN ZIC AND GLIcoord: 184..407
IPR041643ZIC protein, zinc finger domainPFAMPF18366zf_ZICcoord: 185..227
e-value: 2.0E-17
score: 63.0
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 306..349
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 245..301