Serine/threonine kinase

Overview
NameSerine/threonine kinase
Smed IDSMED30005039
Length (bp)12483
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine kinase (SMED30005039) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine kinase (SMED30005039) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine/threonine kinase (SMED30005039) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine/threonine kinase (SMED30005039) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005039

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30005039SMESG000022977.1 dd_Smed_v4_7371_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30005039SMESG000022977.1 dd_Smed_v4_7371_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005039SMESG000022977.1 dd_Smed_v4_7371_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30005039SMESG000022977.1 dd_Smed_v4_7371_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30005039SMESG000022977.1 dd_Smed_v4_7371_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30005039SMESG000022977.1 dd_Smed_v4_7371_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30005039SMESG000022977.1 dd_Smed_v4_7371_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30005039SMESG000022977.1 dd_Smed_v4_7371_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005039SMESG000022977.1 Contig45387uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005039SMESG000022977.1 Contig45387newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005039SMESG000022977.1 Contig19974uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005039SMESG000022977.1 Contig19974newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
musculature systemSMED30005039SMESG000022977.1 dd_Smed_v6_7371_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30005039SMESG000022977.1 dd_Smed_v4_7371_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: SPEG (striated muscle enriched protein kinase [Source:HGNC Symbol;Acc:HGNC:16901])

HSP 1 Score: 134.035 bits (336), Expect = 6.644e-30
Identity = 133/603 (22.06%), Postives = 270/603 (44.78%), Query Frame = 2
Query: 8708 REITLSWSPPRISPDLYIPFTVDVECRPVNYSYS------DEEGWSVFKTNIKKNRVDIADLDPNINYQLRIVPVTDFGIGKPSMVIKKIRRSDNLNSPTTEKAMMLQEKHCLAVPMFCCLSQKAELKFTKLMEYKLDKITW-TFNNAKVDVNDERYKIFSAETYGIYFIIKNLEEDDFGEYCALDEVQDPIQ--SFILIKSDAPTILNCLPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIF-SSYRTVITEDKEQGTYSLLISKCILSDGGEYSIRAENAIGFAEVKFNLRVDAHPEKKSVQI-NIGD--------VNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFF--EINNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIM--TGKYNEILKLCGFSNA---VPKE----DFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQ-----------LYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWFIKPGNNLNAALDYI 10393
            R +TL+W+PPR         ++D+   P + +Y+        + W+   T +++       L   + +  R++  T     KPS   + ++  ++   PT E+A  + +K  +   ++    Q A +  T    +   ++ W +   A ++     Y++   +       I  +   D G        +   Q  S  L  ++AP   + + +  +   E    +V ++ +P P+++W ++   +  SS+ + + E+ E    SL++      DGG Y+  A+N  G    K  L V  H  + ++++  +G+        ++D Y   +++ +G++S  + ++E+S+ +EF  KF   +       R E + +  + H  ++   +A     + LV++ E L    L E I +    CES++R  + Q+++ + YLH+  V HLD+KPEN+++       + +++C F NA    P E     +G       T  F APE++   P+   +D+W +G++ FLCL G      E D+            + E +  ++S  A  F+ K +L++   R T+ ++L H WF         + D++
Sbjct: 1297 RMVTLTWNPPR---------SLDMAIDPDSLTYTVQHQVLGSDQWTALVTGLREPGWAATGLRKGVQHIFRVLSTTVKSSSKPSPPSEPVQLLEH--GPTLEEAPAMLDKPDI---VYVVEGQPASVTVT--FNHVEAQVVWRSCRGALLEARAGVYELSQPDDDQYCLRICRVSRRDMGALTCTARNRHGTQTCSVTLELAEAPRFESIMEDVEVGAGETARFAVVVEGKPLPDIMWYKDEVLLTESSHVSFVYEENE---CSLVVLSTGAQDGGVYTCTAQNLAGEVSCKAELAV--HSAQTAMEVEGVGEDEDHRGRRLSDFYDIHQEIGRGAFSYLRRIVERSSGLEFAAKFIPSQAKPKASARREARLLARLQHDCVLYFHEAFER-RRGLVIVTE-LCTEELLERIARKPTVCESEIRAYMRQVLEGIHYLHQSHVLHLDVKPENLLVWDGAAGEQQVRICDFGNAQELTPGEPQYCQYG-------TPEFVAPEIVNQSPVSGVTDIWPVGVVAFLCLTGISPFVGENDRTTLMNIRNYNVAFEETTFLSLSREARGFLIK-VLVQDRLRPTAEETLEHPWFKTQAKGAEVSTDHL 1868          

HSP 2 Score: 115.546 bits (288), Expect = 2.121e-24
Identity = 79/270 (29.26%), Postives = 124/270 (45.93%), Query Frame = 2
Query: 9599 INIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEINNMGIGR--SEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVPKEDFGSR--RHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGH---------------LKVNFEGDQLYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWF 10351
            +  G     Y  +++ A+G +   +   E +T   F+ K       G  R   E++ ++ + H  I+ + +A   P +YLVLI E      L   ++    + E  V   + QL+Q + YLH H V HLDIKP+N+++    +  LK+  F +A P      R   H   T  F APE++KGEPI   +D+W  G+LT++ L G                +   F+  QLY        S SA +F+RK L +    R +  D L+H W 
Sbjct: 2957 LRQGPPQKPYTFLEEKARGRFGVVRACRENATGRTFVAKIVPYAAEGKRRVLQEYEVLRTLHHERIMSLHEAYITP-RYLVLIAESCGNRELLCGLSDRFRYSEDDVATYMVQLLQGLDYLHGHHVLHLDIKPDNLLLA--PDNALKIVDFGSAQPYNPQALRPLGHRTGTLEFMAPEMVKGEPIGSATDIWGAGVLTYIMLSGRSPFYEPDPQETEARIVGGRFDAFQLYPN-----TSQSATLFLRKVLSVHPWSRPSLQDCLAHPWL 3218          

HSP 3 Score: 55.0694 bits (131), Expect = 4.146e-6
Identity = 67/265 (25.28%), Postives = 109/265 (41.13%), Query Frame = 2
Query: 11528 EYIVQRTFKMEDICPAFDLCVRIKYYHFPILFGEICDSSLGNRITFEEFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLE---NCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRYESDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNTNTLLLPVPHTHFRAPKLSMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWFKQDPQTIYEMEHQTISST 12313
            EY V RT   E I    +  +  +Y    +L  E C    GNR           LL  L  R  YSE  V T + QLL  + +LH ++V+H +I+P  +L++   + +  I   G     N Q +  +  +          F APE          +DIW  G+L++++L+ + P  E    +++        +   L  P+T             S+S+  F+   L   P  R +    LAH W  QD   + ++  QT++ T
Sbjct: 3010 EYEVLRTLHHERIMSLHEAYITPRYL---VLIAESC----GNR----------ELLCGLSDRFRYSEDDVATYMVQLLQGLDYLHGHHVLHLDIKPDNLLLA--PDNALKIVDFGSAQPYNPQALRPLGHRTGTLE-----FMAPEMVKGEPIGSATDIWGAGVLTYIMLSGRSPFYEPDPQETEARIVGGRFDAFQL-YPNT-------------SQSATLFLRKVLSVHPWSRPSLQDCLAHPWL-QD-AYLMKLRRQTLTFT 3234          

HSP 4 Score: 55.0694 bits (131), Expect = 4.662e-6
Identity = 36/120 (30.00%), Postives = 57/120 (47.50%), Query Frame = 2
Query: 6074 APLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRIIVKPLCAPVLTAE 6433
            AP+F   L+++ +    ++ L C +  +P P++ W KDG  L S+    R+ +  E    TL++ EA   D+G Y    TN LG  T  A + V    P  S S      P  +P+ + E
Sbjct:  721 APVFEIPLQNVVVAPGADVLLKCIITANPPPQVSWHKDGSALRSE---GRLLLRAEGERHTLLLREARAADAGSYMATATNELGQATCAASLTV---RPGGSTS------PFSSPITSDE 828          
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: DAPK2 (death associated protein kinase 2 [Source:HGNC Symbol;Acc:HGNC:2675])

HSP 1 Score: 119.013 bits (297), Expect = 2.068e-27
Identity = 85/281 (30.25%), Postives = 138/281 (49.11%), Query Frame = 2
Query: 9614 VNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFE-----INNMGIGRSEFQ----CIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEI--LKLCGFSNAVPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQL-------------YNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWFIKPGNNLNAAL 10384
            V D Y   ++L  G ++  +   EKST +E+  KF +      +  G+ R E +     ++ + H N++ + D        +VLI E + G  L +++ Q     E +    I Q++  V+YLH  ++ H D+KPENI++  K   I  +KL  F  A   ED    +++  T  F APE++  EP+   +DMWSIG++T++ L G     F GD               ++E+     S  A  FIRK L+ +T +RLT  ++L H W I P +N  A +
Sbjct:   19 VEDFYDIGEELGSGQFAIVKKCREKSTGLEYAAKFIKKRQSRASRRGVSREEIEREVSILRQVLHHNVITLHDVYENRTD-VVLILELVSGGELFDFLAQKESLSEEEATSFIKQILDGVNYLHTKKIAHFDLKPENIMLLDKNIPIPHIKLIDFGLAHEIEDGVEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSG--ASPFLGDTKQETLANITAVSYDFDEEFFSQTSELAKDFIRKLLVKETRKRLTIQEALRHPW-ITPVDNQQAMV 295          

HSP 2 Score: 63.5438 bits (153), Expect = 4.213e-9
Identity = 39/139 (28.06%), Postives = 67/139 (48.20%), Query Frame = 2
Query: 11669 EFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRY-----ESDIWSLGILSFLLLATQLPAIEDACSDS 12070
            E V GG L   L  +   SE    + I+Q+L  + +LH+  + H +++P  I++  +      IKLI        G   E E     K +IF  PE+    I  Y     E+D+WS+G+++++LL+   P + D   ++
Sbjct:  104 ELVSGGELFDFLAQKESLSEEEATSFIKQILDGVNYLHTKKIAHFDLKPENIMLLDKNIPIPHIKLIDF------GLAHEIEDGVEFK-NIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQET 235          
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: DAPK2 (death associated protein kinase 2 [Source:HGNC Symbol;Acc:HGNC:2675])

HSP 1 Score: 119.013 bits (297), Expect = 2.068e-27
Identity = 85/281 (30.25%), Postives = 138/281 (49.11%), Query Frame = 2
Query: 9614 VNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFE-----INNMGIGRSEFQ----CIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEI--LKLCGFSNAVPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQL-------------YNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWFIKPGNNLNAAL 10384
            V D Y   ++L  G ++  +   EKST +E+  KF +      +  G+ R E +     ++ + H N++ + D        +VLI E + G  L +++ Q     E +    I Q++  V+YLH  ++ H D+KPENI++  K   I  +KL  F  A   ED    +++  T  F APE++  EP+   +DMWSIG++T++ L G     F GD               ++E+     S  A  FIRK L+ +T +RLT  ++L H W I P +N  A +
Sbjct:   19 VEDFYDIGEELGSGQFAIVKKCREKSTGLEYAAKFIKKRQSRASRRGVSREEIEREVSILRQVLHHNVITLHDVYENRTD-VVLILELVSGGELFDFLAQKESLSEEEATSFIKQILDGVNYLHTKKIAHFDLKPENIMLLDKNIPIPHIKLIDFGLAHEIEDGVEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSG--ASPFLGDTKQETLANITAVSYDFDEEFFSQTSELAKDFIRKLLVKETRKRLTIQEALRHPW-ITPVDNQQAMV 295          

HSP 2 Score: 63.5438 bits (153), Expect = 4.213e-9
Identity = 39/139 (28.06%), Postives = 67/139 (48.20%), Query Frame = 2
Query: 11669 EFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRY-----ESDIWSLGILSFLLLATQLPAIEDACSDS 12070
            E V GG L   L  +   SE    + I+Q+L  + +LH+  + H +++P  I++  +      IKLI        G   E E     K +IF  PE+    I  Y     E+D+WS+G+++++LL+   P + D   ++
Sbjct:  104 ELVSGGELFDFLAQKESLSEEEATSFIKQILDGVNYLHTKKIAHFDLKPENIMLLDKNIPIPHIKLIDF------GLAHEIEDGVEFK-NIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQET 235          
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: DAPK2 (death associated protein kinase 2 [Source:HGNC Symbol;Acc:HGNC:2675])

HSP 1 Score: 117.472 bits (293), Expect = 4.191e-26
Identity = 82/276 (29.71%), Postives = 133/276 (48.19%), Query Frame = 2
Query: 9614 VNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFE-----INNMGIGRSEFQ----CIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEI--LKLCGFSNAVPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQL-------------YNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWFIKPGNN 10369
            V D Y   ++L  G ++  +   EKST +E+  KF +      +  G+ R E +     ++ + H N++ + D        +VLI E + G  L +++ Q     E +    I Q++  V+YLH  ++ H D+KPENI++  K   I  +KL  F  A   ED    +++  T  F APE++  EP+   +DMWSIG++T++ L G     F GD               ++E+     S  A  FIRK L+ +T +RLT  ++L H W    G  
Sbjct:   19 VEDFYDIGEELGSGQFAIVKKCREKSTGLEYAAKFIKKRQSRASRRGVSREEIEREVSILRQVLHHNVITLHDVYENRTD-VVLILELVSGGELFDFLAQKESLSEEEATSFIKQILDGVNYLHTKKIAHFDLKPENIMLLDKNIPIPHIKLIDFGLAHEIEDGVEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSG--ASPFLGDTKQETLANITAVSYDFDEEFFSQTSELAKDFIRKLLVKETRKRLTIQEALRHPWITSKGEG 291          

HSP 2 Score: 62.7734 bits (151), Expect = 1.007e-8
Identity = 39/139 (28.06%), Postives = 67/139 (48.20%), Query Frame = 2
Query: 11669 EFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRY-----ESDIWSLGILSFLLLATQLPAIEDACSDS 12070
            E V GG L   L  +   SE    + I+Q+L  + +LH+  + H +++P  I++  +      IKLI        G   E E     K +IF  PE+    I  Y     E+D+WS+G+++++LL+   P + D   ++
Sbjct:  104 ELVSGGELFDFLAQKESLSEEEATSFIKQILDGVNYLHTKKIAHFDLKPENIMLLDKNIPIPHIKLIDF------GLAHEIEDGVEFK-NIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQET 235          
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: DAPK2 (death associated protein kinase 2 [Source:HGNC Symbol;Acc:HGNC:2675])

HSP 1 Score: 117.472 bits (293), Expect = 4.191e-26
Identity = 82/276 (29.71%), Postives = 133/276 (48.19%), Query Frame = 2
Query: 9614 VNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFE-----INNMGIGRSEFQ----CIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEI--LKLCGFSNAVPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQL-------------YNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWFIKPGNN 10369
            V D Y   ++L  G ++  +   EKST +E+  KF +      +  G+ R E +     ++ + H N++ + D        +VLI E + G  L +++ Q     E +    I Q++  V+YLH  ++ H D+KPENI++  K   I  +KL  F  A   ED    +++  T  F APE++  EP+   +DMWSIG++T++ L G     F GD               ++E+     S  A  FIRK L+ +T +RLT  ++L H W    G  
Sbjct:   19 VEDFYDIGEELGSGQFAIVKKCREKSTGLEYAAKFIKKRQSRASRRGVSREEIEREVSILRQVLHHNVITLHDVYENRTD-VVLILELVSGGELFDFLAQKESLSEEEATSFIKQILDGVNYLHTKKIAHFDLKPENIMLLDKNIPIPHIKLIDFGLAHEIEDGVEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSG--ASPFLGDTKQETLANITAVSYDFDEEFFSQTSELAKDFIRKLLVKETRKRLTIQEALRHPWITSKGEG 291          

HSP 2 Score: 62.7734 bits (151), Expect = 1.007e-8
Identity = 39/139 (28.06%), Postives = 67/139 (48.20%), Query Frame = 2
Query: 11669 EFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRY-----ESDIWSLGILSFLLLATQLPAIEDACSDS 12070
            E V GG L   L  +   SE    + I+Q+L  + +LH+  + H +++P  I++  +      IKLI        G   E E     K +IF  PE+    I  Y     E+D+WS+G+++++LL+   P + D   ++
Sbjct:  104 ELVSGGELFDFLAQKESLSEEEATSFIKQILDGVNYLHTKKIAHFDLKPENIMLLDKNIPIPHIKLIDF------GLAHEIEDGVEFK-NIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQET 235          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: unc-89 (Muscle M-line assembly protein unc-89 [Source:UniProtKB/Swiss-Prot;Acc:O01761])

HSP 1 Score: 137.117 bits (344), Expect = 3.377e-31
Identity = 157/617 (25.45%), Postives = 269/617 (43.60%), Query Frame = 2
Query: 8714 ITLSWSPPRISPDLYIPFTVDVECRPVNYSYSDEEGWSVFKTNIKKNRVDIADLDPNINYQLRIVPVTDFGI-------------GKPSMVIKKIRRSDN---LNSPTTEKA--MMLQEKHCLAVPMFC--------CLSQKAELKFTKLMEYKLDKITWTFNNAKVDVND--ERYKIFSAETYGIYFIIKNLEEDDFGEY-C-ALDEVQDPIQSFILIKSDAPTILNCLPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIFSSYRTVITEDKEQGTY--SLLISKCILSDGGEYSIRAENAIGFAEVKFNLRVDAHPE-------KKSVQINIGDVNDRYYTMKK----LAKGSYSRCQIVIEKSTQIEFIGKFFEINNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIY-----EKLQGLS-LAEYITQLSHWC----ESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVPKEDFGSRRHM--GL------TSP-FSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQ--LYNEDS----NDAISN---SACVFIRKCLLLKTGERLTSSDSLSHEWF 10351
            +TLSW P + +P  Y   T  +E R +      E+ WS+ + NI +    + +L+   +YQ R+     +GI               P  V    RR++    L  P  EKA  M   E++  A P F         C           +  +    I W F    +D +    + K+++         I    +++ G+Y C A ++  D  Q+ ++  +  P  +  L N + +  +   + V++D +P PE+ W + W+ I  S R    +D   G Y  SL+I+  +  D G YS  A N  G A     + V+A  +       ++ V I    V + Y   +K     A+G+  R   V EK+T  EF+ +   I++  +   +     ++ H  IV++   +   D+ L L+        + GLS LA    +++       E+ VR+ + QL+ A+ ++H+ R+ HLD++PE I++    ++ LKL          DFG  R +  GL       SP F +PE+++  P+   +DMWS G+LT++ L G    + + D   L N DS    +  + N    A  F++K L      RLT  ++L H W 
Sbjct: 5652 LTLSWIPTKRAPPRYPQVTYVIEIREL-----PEKQWSLLEYNIPEPVCKVRNLELGKSYQFRVRAENIYGISDPSPASPPSRLMAPPQPVFD--RRTNKVIPLLDPYAEKALDMRYSEQYACA-PWFSPGVVEKRYCAENDTLTIVLNVSGFPDPDIKWKFRGWDIDTSSPTSKCKVYTYGGSETTLAITGFSKENVGQYQCFAKNDYGDAQQNIMVDLATRPNFIQPLVNKTFSSAQPMRMDVRVDGEPFPELKWMKEWRPIVESSRIKFVQD---GPYLCSLIINDPMWRDSGIYSCVAVNDAGQATTSCTVTVEAEGDYNDVELPRRRVTIESRRVRELYEISEKDEKLAAEGAPFR---VKEKATGREFLAQLRPIDDALMRHVDIH--NSLDHPGIVQMHRVLR--DEKLALVVFDNANSTIDGLSSLAHPGVEIAEPKGVNRETCVRVFVRQLLLALKHMHDLRIAHLDLRPETILL---QDDKLKLA---------DFGQARRLLRGLITGEIKGSPEFVSPEIVRSYPLTLATDMWSTGVLTYVLLTGLSPFHGDNDNETLANVDSCQFDSSPLGNFSYDAGDFVKKLLTEIPVSRLTVDEALDHPWI 6238          

HSP 2 Score: 98.5969 bits (244), Expect = 1.219e-19
Identity = 170/765 (22.22%), Postives = 301/765 (39.35%), Query Frame = 2
Query: 4283 GFSKKDIKWKVLEDDLKQDKILQE---KRITQKFNNNLSFLLIDSVKLEDSGTYICQGFTNKELISECKITLNVVDNISDTLQCQVKFEKDKYSIEINQDVTMRALIECTSTHYSVSWFFNGEILEM-KSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDD--IDCSNNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGMVD-GKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMPFGDPCVLDNPFI----------DLYIESPQVNEHSGLYKCIVTNEKSETEF-VEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDE-KLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLK-INESSVDILV---KVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSC--DNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCI-----------------------APLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKI-LDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVT-DSEPKESDSSRIIVKPLCAPVLT 6427
            G S  D++W       K DK + E     + +     +  L++      D+G Y  +  +N    +E      V  ++      +   E     ++IN+  T+   ++      SV W  +G+ ++   S +++ ++ +G  + + I++      G Y C   N  G + T      V+N+           +E+ E     L V      +   +W KDD  I   N  +         F+LT   A   D G+Y      + G+ L   +F +  + I    T  +    L   + E +  D K  +I   V N     ++W ++D P      +DN  I           L I+  +  E  G+Y C  TNE  E +    + V+   E++ +P+  + L     E    + +  EL V  RV  K      W KD   +  +    +    +   + L+++D    D G Y+ +  N++  D  V   K+      KQT E  K L I    +PL++ F   E +TV  E +V +  +   I FF+N++   E  + +Q     D    LTI  A ++  G Y  +  N  G   ++  L +   +++ E + +                           AP F + L+   +  K+   L C++  +P+PKI WTK+G+ ++   ++ RV+    +    TL        D+G Y C   N  G   TE  IIVT +  PK    +   ++P+   V+T
Sbjct: 2573 GGSAPDVEW------FKDDKPVSEDGNHEMKKNPETGVFTLVVKQAATTDAGKYTAKA-SNPAGTAESSAEAEVTQSLEKPTFVR---ELVTTEVKINETATLSVTVKGVPDP-SVEWLKDGQPVQTDSSHVIAKVEGSGSYS-ITIKDARLEDSGKYACRATNPAGEAKTEANFAVVKNLVPPEFVEKLSPLEVKEKESTTLSVKVVGTPEPSVEWFKDDTPISIDNVHVIQKQTAVGSFSLTINDARQGDVGIYSCRARNEAGEALTTANFGIIRDSIPPEFT--QKLRPLEVREQETL--DLKVTVIGTPVPN-----VEWFKDDKPIN----IDNSHIFAKDEGSGHHTLTIKQAR-GEDVGVYTCKATNEAGEAKTTANMAVQ---EEIEAPLFVQGLKPYEVE----QGKPAELVV--RVEGKPEPEVKWFKDGVPIAIDNQHVIEKKGENGSHTLVIKDTNNADFGKYTCQATNKAGKDETVGELKIPKYSFEKQTAEEVKPLFI----EPLKETFAV-EGDTVVLECKVNKE-SHPQIKFFKNDQ-PVEIGQHMQLEVLEDGNIKLTIQNAKKEDVGAYRCEAVNVAGKANTNADLKIQFAAKVEEHVTDESGQLEEIGQFETVGDTASSKTDTGRGAPEFVELLRSCTVTEKQQAILKCKVKGEPRPKIKWTKEGKEVE---MSARVRAEHKDDGTLTLTFDNVTQADAGEYRCEAENEYGSAWTEGPIIVTLEGAPKIDGEAPDFLQPVKPAVVT 3292          

HSP 3 Score: 93.9745 bits (232), Expect = 3.494e-18
Identity = 131/612 (21.41%), Postives = 246/612 (40.20%), Query Frame = 2
Query: 10619 TPNDNSSEEVKSDRSETFPSADRLSVSNTTKELLFTVPLKDQTFKSDSTAGKITVTLTCQLSLLGSEPISISWYKNQELLTDDSRIKLEVIKGGFLSCTILN-ATETDVGIFRCIARCHSLRTETSARLVLGDVPPQPEQLSVYYTNQEEVLLKWSP-----YLSAIDDVIYRIDIRTIDSRNKIRNWKTIGYSVDNR-YLLENLDRTQQYIARIIAQNKYGYSPYSIATSVFQNKIRN-----IHSLKQALIFNRKWMLTSRQSNHFNDL--------------HDLIKDIS--SDDI-------------RMNVIREHYSTLSQKSSGFAVLKLKNTNVNFPEYIVQRTFKMEDICPAFDLCVRIKYYHFPILFGEICDSSLGNRITFEEFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFV-GTVKEQESLTTHKPSIFKAPEYRY-ESITRYESDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNT--NTLLLPVPHTHFRAPKLSMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWFKQDPQTIYEMEHQTISSTPL 12319
             P+  + E +K+D  +  P A + +  + T   +FT  L+D   + +  A        C +S   S    ++W    ++L  + R+ +E  +   ++  ILN A   D+G + C A       ++S RL+ G+ P +P +     ++  E+ ++W       YL  I    YR++ R     +    W T+   +D+   ++++L     Y  R+ AQN +G    S+++ + Q   +      I  LK  +  N   M   + +N    +               D+  ++   +DD              R +VIR+   + ++  +  AV     ++    EY   R  + E++     L       +F  L  E     + +R  F ++               Y+E  V   +RQ+   + FLH   + H ++ P  I+   ++ +S+ +KL+     Q V G VK  +  T      + +PE+   E+    +SD+W +G+++F LLA   P   +   + ++   V N   +  L+PV                S+    F   +LKKSP  R   D  L+H +   DP  +   E    S++ L
Sbjct: 6857 APSATAIERIKADIEKVTPCATKKN-DDGTFAPIFTARLRDVYLRKNQPA-----IFECAVS--ASPAPKVTWDFQGKILESNDRVTIE--QDNNVARLILNHAAPYDLGEYVCTAINEYGTDKSSCRLISGETPSRPGRPEAELSSDTEIFIQWEAPEGPTYLEGI---TYRLEYRVAGPNDHGDPWITVSEKIDDESVIVKHLSPLGIYQFRVTAQNGFGLGLPSLSSRIVQTHGKGAPKLQIDVLKSEIRLNVVSM-PQKSTNQLGGISEESEEDSEARTANEDMKSNLQLQTDDPTGRFQIGGLKFKGRFSVIRDAVDSTTEGHAHCAVKIRHPSSEAISEYESLRDGQHENVQ---RLIAAFNNSNFLYLLSERLYEDVFSRFVFNDY---------------YTEEQVALTMRQVTSALHFLHFKGIAHLDVNPHNIMF--QSKRSWVVKLVDFGRAQKVSGAVKPVDFDTK-----WASPEFHIPETPVTVQSDMWGMGVVTFCLLAGFHPFTSEYDREEEIKENVINVKCDPNLIPV--------------NASQECLSFATWALKKSPVRRMRTDEALSHKFLSSDPSMVRRRESIKYSASRL 7415          

HSP 4 Score: 83.1889 bits (204), Expect = 5.606e-15
Identity = 185/831 (22.26%), Postives = 333/831 (40.07%), Query Frame = 2
Query: 4013 QWFWNDEAVKNINCKKDFTSNLAQLEIAHCQLSDSGQYKICF-NPLEASKCGKVTGLFLVSIAPIKKNLKPIDSNIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNN--NLSFLLIDSVKLEDSGTY--ICQGFTNKELISECKITLNVV---DNISDTLQCQVKFEKDKYSIEINQDVTMRALIECTSTHYSVSWFFNGEIL---EMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCSNNGIFN-STKNKNCFNLTKLKAEITDSGVYKFEGMVDGKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLR--NDMPFGDPCVL---DNPFIDLYIESPQVNEHSGLYKCIVTNEKSETEFVEITVKFKDEKVVSPILGEL-----LSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLKINESSVD-----ILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAI-WFFENEEI--DAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETL--DSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRIIVKPL 6409
            +W+ N + + N   K +   + + LEI + QL D+  YK+   N    +       + L  IA I K L+    + E   G+   L V+      K+IKW       K  K +      Q  ++  N   L+I     +D+  Y  +          S C +T+ +      I   L+ QV        + I   + +   IE + +  +V W+ NG+ L     K+  +  I +N  + E+      ++  G Y+  + N+ G S+ +  ++ VE  +I  L  + K+  ITEG      V +  +  +  +W K+  +   N  F    K    + L    A   D+  YK        +LE      + +   ++        K++    + +++    ++  V++    + V +WLR  N +  G   ++   D+    L I S  + + +G Y   V NE                K  S   GE+     +   +E +   E +     VE   P + +    W K+++ +          + P  Y L +   ++ D   Y + ++ ++ D      L  V+P  ++              I   L+D+ +  EP+ V+ + +VE  G  K I W+   +E+  DA+  +F +      F+LTIP++ +   G Y + + ND G V S G +  +  ++ SE    +  ++PL     KD E+   + + L C +  +P P+++W KDG  L  D +   R    LD     TL I  A+  D G+Y     N  G  T++  + VT  E  E  S    V PL
Sbjct: 3791 KWYKNGKEIPNAKAKDNGDGSYS-LEIPNAQLDDTADYKVVVSNDAGDADSSAALTVKLPGIA-IVKGLE----DAEVPKGKKAVLQVETNK-KPKEIKW------YKNGKEITPSDKAQPGSDGDNKPQLVIPDAGDDDAAEYKVVLTDEDGNTADSSCALTVKLPAKEPKIIKGLEDQV--------VSIGSPIKLE--IETSGSPKTVKWYKNGKELPGAAAKTIKIQKIDDNKYVLEIPSSVVEDT--GDYKVEVANEAG-SANSSGKITVEP-KITFLKPL-KDQSITEGENAEFSVETNTKPRI-VKWYKNGQEIKPNSRFIIEQKTDTKYQLVIKNAVRDDADTYKI-------VLENTAGEAESSAQLTVKKAKAGLCKIVKGLEDQVVAKGAKMVFEVKIQGEPEDV-RWLRDANVISAGANAIIEKIDDTTYRLIIPSADLKD-AGEYTVEVINESG--------------KAKSDAKGEVDEKPEIVRGLENIEIPEGDDDVFKVEVSAPVRQVK---WYKNDQEIKPNSHLEAKKIGPKKYELAINRAQLDDGADYKVVLSNAAGDCDSSAALTVVKPNVLK--------------IVDGLKDVDVE-EPQPVELKVKVE--GIPKVIKWYKNGQELKPDADGFKFEEKPESGEFSLTIPSSKKSDGGAYRVVLGNDKGEVYS-GSVVHVKSAKSSEPTSGANFLSPL-----KDTEVEEGDMLTLQCTIAGEPFPEVIWEKDGVVLQKDDRITMRVA--LDG--TATLRIRSAKKSDIGQYRVTAKNEAGSATSDCKVTVT--EQGEQPSKPKFVIPL 4537          

HSP 5 Score: 74.7146 bits (182), Expect = 2.097e-12
Identity = 168/795 (21.13%), Postives = 299/795 (37.61%), Query Frame = 2
Query: 4082 QLEIAHCQLSDSGQYKICFNPLEASKCGKVTGLFLVSIAP-IKKNLKPIDSNIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNNNLSFLLIDSVKLEDSGTY-ICQGFTNKELISECKIT------LNVVDNISDTLQCQVKFEKDKYSIEINQDVTMRALIECTSTHYSVSWFFNGEILEMKSD--ILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTA-----RTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCS-NNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGMVD-GKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMP--FGDPCVLDNPFIDLYIESPQ--VNEHSGLYKCIVTNEKSETEFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELS----VESRVPTKSIDSAVWLKDEK---------LLNETDPRLTIIMQPFCYNLILRDVKMTDAGMY-SLKINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNF--TLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIV 6355
            +L I    L D+G+Y +    +  S   K      V   P I + L+    NIE   G+     V+V    ++ +KW   + ++K +  L+ K+I  K       L I+  +L+D   Y +       +  S   +T      L +VD + D              +E  Q V ++  +E       + W+ NG+ L+  +D     +   +G+ + L I +  +S  G Y  ++ N  G   +      ++  + E        S  K+ E+ EG+ L L+     E   +  W KD +    ++ I           L    A+ +D G Y+     + G        TV     Q      + +  +  +    +  D K    +V+V    +  +QW  N +P  F D   LD+     Y  + +    E  G  KCI  NE    E V    +F+          + L         + D +I +     +E  V         W KD K         + N  D    I + PF         + +D G+Y  + +NE             I +  +E  +    P+I  PL+D  + N  + ++   +V+       +W+ +   + A++   IQ+  D    L I  + E+  G Y     N  G + +    S  +  ++ +Q ++     P FTK L D+     ++  L C +  DP P+I W ++G+ L     N    +++  P+   +L + E+ + D G Y C   N  G   T+A   V
Sbjct: 4196 RLIIPSADLKDAGEYTVEV--INESGKAKSDAKGEVDEKPEIVRGLE----NIEIPEGDDDVFKVEVSAPVRQ-VKWYKNDQEIKPNSHLEAKKIGPKKYE----LAINRAQLDDGADYKVVLSNAAGDCDSSAALTVVKPNVLKIVDGLKDV------------DVEEPQPVELKVKVEGIPK--VIKWYKNGQELKPDADGFKFEEKPESGEFS-LTIPSSKKSDGGAYRVVLGNDKGEVYSGSVVHVKSAKSSEPTSGANFLSPLKDTEVEEGDMLTLQCTIAGEPFPEVIWEKDGVVLQKDDRITMRVALDGTATLRIRSAKKSDIGQYRVTAKNEAGSATSDCKVTVTEQGEQP----SKPKFVIPLKTGAALPGDKKEF--NVKVRGLPKPTLQWFLNGIPIKFDDRITLDDMADGNYCLTIRDVREEDFGTLKCIAKNENGTDETV---CEFQQGAGHDDGSRDDLRYPPRFNVPLWDRRIPVGDPMFIECHVDANPTAEVEWFKDGKKIEHTAHTEIRNTVDGACRIKIIPF---------EESDIGVYMCVAVNELGQAETQATYQVEILEHVEEEKRREYAPKINPPLEDKTV-NGGQPIRLSCKVDAIPRASVVWYKDGLPLRADSRTSIQYEEDGTATLAINDSTEEDIGAYRCVATNAHGTINT----SCSVNVKVPKQEVKKEGEEPFFTKGLVDLWADRGDSFTLKCAVTGDPFPEIKWYRNGQLL----RNGPRTVIETSPDGSCSLTVNESTMSDEGIYRCEAENAHGKAKTQATAHV 4937          

HSP 6 Score: 74.7146 bits (182), Expect = 2.397e-12
Identity = 62/273 (22.71%), Postives = 127/273 (46.52%), Query Frame = 2
Query: 9584 KKSVQINIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQ--IEFIGKFFEINNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVPKEDFGSRRHMGLTSPFSAPEL-LKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQLYNEDSNDAISNSAC-------VFIRKCLLLKTG-------ERLTSSDSLSHEWF 10351
            K ++Q+   D   R+       KG +S  +  ++ +T+       K    ++  I  SE++ +++  H N+  +  A    + +L L+ E+L     + ++    ++ E QV + + Q+  A+ +LH   + HLD+ P NI+   K + ++KL  F  A  ++  G+ + +   + +++PE  +   P+   SDMW +G++TF  L G      E D+   E+  + + N  C          ++CL   T         R+ + ++LSH++ 
Sbjct: 7131 KSNLQLQTDDPTGRFQIGGLKFKGRFSVIRDAVDSTTEGHAHCAVKIRHPSSEAI--SEYESLRDGQHENVQRLIAAFNNSN-FLYLLSERLYEDVFSRFVFN-DYYTEEQVALTMRQVTSALHFLHFKGIAHLDVNPHNIMFQSKRSWVVKLVDFGRA--QKVSGAVKPVDFDTKWASPEFHIPETPVTVQSDMWGMGVVTFCLLAGFHPFTSEYDR--EEEIKENVINVKCDPNLIPVNASQECLSFATWALKKSPVRRMRTDEALSHKFL 7395          

HSP 7 Score: 72.0182 bits (175), Expect = 1.278e-11
Identity = 200/875 (22.86%), Postives = 340/875 (38.86%), Query Frame = 2
Query: 3932 LNISENERILLEAKIISGNINSYKTPPQWFWNDEAVKNINCK---KDFTSNLAQLEIAHCQLSDSGQYKICFNPLEASKCGKVTGLFLVSI---API-KKNLKPIDSNIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNNNLSFLLIDSVKLEDSGTYICQGFTNK----ELISECKITLNVVDNISDTLQCQVKFEKDKYSIEINQDVTMRALIEC---TSTHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSST---------ARTELNV--ENIQI----------DCLNSVT-------------KNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCSNNG-IFNSTKNKNCFNLTKLKAEITDSGVYKFEGMVDGKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISV---EVLNWK-----QGVIQWLRN--DMPFGDPCV---LDNPFIDLYIESPQVNEHSGLYKCIVTNEKSETEFVEITVKFKDEKVVSP-ILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTI-IMQPFCYNLILRDVKMTDAGMYSLKINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAI-WFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSE-ISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVT 6358
            L + E E + L+  +I   + +     +WF +D+ +   N     KD  S    L I   +  D G Y  C    EA +  K T    V     AP+  + LKP     E   G+   L V VEG  + ++KW   +D +    I  +  I +K  N    L+I      D G Y CQ  TNK    E + E KI     +  +      +  E  K +  +  D     ++EC     +H  + +F N + +E+   +  ++  +G I +L IQN  +   G Y C   N  G ++T         A+ E +V  E+ Q+          D  +S T             ++  +TE  +  L+   + E   + +W+K+  +   +  +    K+     LT       D+G Y+ E        E  + +        I+ T E   K+  E  +  L   KP +++V    VL  K     +  ++W +N  ++   D      LD+    L + + ++++    Y+C  +NE  +  + ++T+  K+   V+P    EL +  V+E  T    K E  V    P        W KD   L E D R+           L++ D K  D G Y +++   S D  V     P+     E  K      IKK L D+   N  +  K    VE  G  K + W+   E + +     I    ++ + L I +A     G Y + ++ D   V S   +++   +E IS          P F K L D  +     + L   +   PK  + W K+G+ +     + +V+ L     + L I + + +D G Y     N  G   ++A + V+
Sbjct: 2851 LEVREQETLDLKVTVIGTPVPNV----EWFKDDKPINIDNSHIFAKDEGSGHHTLTIKQARGEDVGVY-TCKATNEAGEA-KTTANMAVQEEIEAPLFVQGLKPY----EVEQGKPAELVVRVEGKPEPEVKW--FKDGVPI-AIDNQHVIEKKGENGSHTLVIKDTNNADFGKYTCQA-TNKAGKDETVGELKIPKYSFEKQTAEEVKPLFIEPLKETFAVEGDT---VVLECKVNKESHPQIKFFKNDQPVEIGQHMQLEVLEDGNI-KLTIQNAKKEDVGAYRCEAVNVAGKANTNADLKIQFAAKVEEHVTDESGQLEEIGQFETVGDTASSKTDTGRGAPEFVELLRSCTVTEKQQAILKCKVKGEPRPKIKWTKEGKEVEMSARVRAEHKDDGTLTLTFDNVTQADAGEYRCEA-------ENEYGSAWTE--GPIIVTLEGAPKIDGEAPD-FLQPVKPAVVTVGETAVLEGKISGKPKPSVKWYKNGEELKPSDRVKIENLDDGTQRLTVTNAKLDDMD-EYRCEASNEFGDV-WSDVTLTVKEPAQVAPGFFKELSAIQVKETETA---KFECKVSGTKP-----DVKWFKDGTPLKE-DKRVHFESTDDGTQRLVIEDSKTDDQGNYRIEV---SNDAGVANSKVPLTVVPSETLK------IKKGLTDV---NVTQGTKILLSVEVEGKPKTVKWYKGTETVTSSQTTKIVQVTESEYKLEIESAEMSDTGAYRVVLSTDSFSVESSATVTVTKAAEKIS---------LPSFKKGLADQSVPKGTPLVLEVEIEGKPK-DVKWYKNGDEIK----DGKVEDLGNG-KYRLTIPDFQEKDVGEYSVTAANEAGEIESKAKVNVS 3659          

HSP 8 Score: 70.8626 bits (172), Expect = 2.901e-11
Identity = 116/503 (23.06%), Postives = 200/503 (39.76%), Query Frame = 2
Query: 4919 WSKDDIDCSNN--GIFNSTKNKNCFNLTKLKAEITDSGVY------KFEGMVDGKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMPFGDP----CVLDNPFIDLYIESPQVNEHSGLYKCIVTNEKSETEF-VEITVKFK-DEKVVSPILGELLSCTVEEVNTIEDEKIEL-SVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMY----SLKINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFE--NEEI--DAENMEFIQWSCDNYFALTIP-AAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIV 6355
            W KDD+    +    F S ++   F +T    ++TD+G Y      ++          ++    +  P   +    +      C++ ++I           EV  W +  + WL +D P           D     L I   Q ++ +G+Y   + NE    E   E+ V+   D+  V+P        T+E V   E E++   SV +  P   I   +W  + K L+E++    I     C  L ++DV     GM     S ++  +S D  +KVR  P              P   KPL+D  ++ +   V   FEV+ SG  +    F    +E+    E +E +    D ++ ++IP  + +KH G+   +  N+ G   S  RL++       EQ  E    AP F K ++D  + + E       +  +P P++ W  +G  +D       VKI     +  L I  A+   +G   C   N +G   T+A ++V
Sbjct:  581 WYKDDVQLHEDERHTFYSDED-GFFAMTIDPVQVTDTGRYTCMATNEYGQASTSAFFRVLKVEKEAAPPAFVTKLRDKE----CKEGDVI-------DFECEVEGWPEPELVWLVDDQPLRPSHDFRLQYDGQTAKLEIRDAQPDD-TGVYTVKIQNEFGSIESKAELFVQADPDKNHVAP----EFQATIEYVECDEGEEVRFKSVITGDPNPEI---IWFINGKPLSESEKVKFISEDGICI-LTIKDVTRHFDGMVTCQGSNRLGSASCDGRLKVRVPPAP------------PTFNKPLEDKTVQEKSTVV---FEVDVSGWPEPTLTFTLCGKELKNGEEGVEIV--GHDGFYRISIPNTSMDKHDGEIVAKAQNEHGTAESRARLTV-------EQEEEESRSAPTFLKDIEDQTVKTGEFAVFETTVRGNPNPEVTWFINGHKMDQGSPG--VKIEAHNHDHKLTIDSAQY--AGTVLCRAENAVGRFETKARLVV 1034          

HSP 9 Score: 70.4774 bits (171), Expect = 3.954e-11
Identity = 83/318 (26.10%), Postives = 138/318 (43.40%), Query Frame = 2
Query: 5792 EPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDG--------RLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFT--LIITEAEVEDSGRYCCLGTNFLGYDTT--EAVIIVTDSEPKESDSS-RIIVKPLCAPVLTAEYSKGADVILSWTSVATTDTLNIIYNIEKQKSLTSTNWKKIMKNLTETTYSLSSSCLPPQESHLLRCVAISEYGFETVSNIIEIPIRANSPI 6706
            E + +K E +V+ S   + +W+ +   +   +   I  S D    L IP+      G Y +   N  G  +  G        R S   RS  +++ +     AP   + L++I I  K++ RL C+   DPKP I W KDGE +       R++++ E P+    L++  A  +D+G Y C+  N  G   T  +  +I  D +P++ DSS R    P     LT   +K  D + ++  +   +    I  ++    L S + K  M+   + T  L  S +        RCVA +E+G  T S   E+ I  +  I
Sbjct: 5074 EGQPLKLECKVDASPLPEMVWYKDGAIVTPSDRIQISLSPDGVATLLIPSCVYDDDGIYRVIATNPSGTAQDKGTATVKKLPRDSGARRS--ADRDVFDANKAPKLMEPLENIRIPEKQSFRLRCKFSGDPKPTIKWFKDGERV---FPYGRLQLI-ESPDGVCELVVDSATRQDAGGYRCVAENTYGSARTSCDVNVIRGDRKPRDIDSSIREGKAPGFTTPLTIRRAKPGDSV-TFECLPFGNPFPSIKWLKDGLELFS-DEKIKMEAAADGTQRLILSDVTFLSEGYFRCVATNEHG--TASTKAELVIEGDRTI 5381          

HSP 10 Score: 69.707 bits (169), Expect = 7.102e-11
Identity = 221/1065 (20.75%), Postives = 425/1065 (39.91%), Query Frame = 2
Query: 3260 FFTNLKQIETISGENLHVQFKAYNIVLDTLKKGSWFVNNELLDFKKWNGSVNVSESQVEINFPKSTNELSGIWQFRIDKPMKLFSPEISVNVLAKEVAPLSTGFLDCEIEEIDLKIGETLSLTLNAKDIPIMTLKNGGWFLNSEPIHAVKFRGNEVIEENKVKIVIPNVTKEFSGLLQYRIVKPVELYSPEIIIKIRGSLIKQTPKIEEEKFESNLILELHNVSLNISENERILLEAKIISGNINSYKTPPQWFWNDEAVKNINCKKDFTSNLAQLEIAHCQLSDSGQYKICFNPLEASKCGKVTGLFLVSIAPIKKNLKP--IDSNIETC--PGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNNNLSFLL-IDSVKLEDSGTY-ICQGFTNKELISECKITLNVVDNISDTLQCQVKFEKDKYSIEINQDVTMRALIECTSTHYSVSWFFNG-EILEMKSDILSDIKNNGKIA-ELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCS-NNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGM-VDGKLLEL-VHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRN--DMPFGDPCVL------DNPFIDLYIESPQVNEHSGLYKCIVTNEK-SETEFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFC---YNLILRDVKMTDAGMYSLKIN------ESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIF---IRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLG-YDTTEAVIIV 6355
            FF  L  I+    E    + K      D      WF +   L   K     +  +    +    S  +  G ++  +     + + ++ + V+  E   +  G  D  + +     G  + L++  +  P    K   W+  +E + + +      + E++ K+ I +   E S    YR+V   + +S E    +  ++ K   KI    F+  L         ++ +   ++LE +I  G     K    W+ N + +K+   + D  +   +L I   Q  D G+Y +      A++ G++      S A +  + KP  +   + T    GE+ T  V V+G   K +KW       K  K + + +   K N + S+ L I + ++ED+  Y +       +  S   +T+ + D+  D ++ ++       +++  +  T    ++       V W+ NG EI   K+      K+NG  +  L+I N        Y+ ++ N  G++ ++   L V+   I  +  + ++ E+ +G +  L+V +  +K  + +W K+  + + ++     +   N   L    A   D+  YK      DG   +     TV+       L   E ++    ED   ++S   P+ + +E     +  ++W +N  ++P      +      DN ++ L I S  V E +G YK  V NE  S     +ITV+ K    + P+  + ++         E E  E SVE+    + +    W K+ +   E  P    I++      Y L++++    DA  Y + +       ESS  + VK     + K    I K L+   + K  + +F   I+ EPE V+              W  +   I A     I+   D  + L IP+A  K  G+YT++V N+ G  +SD       + E+ E+        P   + L++IEI   ++      +   P  ++ W K+ + +         KI  +   + L I  A+++D   Y  + +N  G  D++ A+ +V
Sbjct: 3380 FFKELSAIQVKETETAKFECKVSGTKPDV----KWFKDGTPLKEDKRVHFESTDDGTQRLVIEDSKTDDQGNYRIEVSNDAGVANSKVPLTVVPSETLKIKKGLTDVNVTQ-----GTKILLSVEVEGKP----KTVKWYKGTETVTSSQTTKIVQVTESEYKLEIESA--EMSDTGAYRVVLSTDSFSVESSATV--TVTKAAEKISLPSFKKGL------ADQSVPKGTPLVLEVEI-EGKPKDVK----WYKNGDEIKDGKVE-DLGNGKYRLTIPDFQEKDVGEYSVT----AANEAGEIE-----SKAKVNVSAKPEIVSGLVPTTVKQGETATFNVKVKG-PVKGVKW------YKNGKEIPDAKT--KDNGDGSYSLEIPNAQVEDAADYKVVVSNDAGDADSSAALTVKLADDGKDKVKPEIVSGLIPTTVKQGETATFNVKVKGPVKQ--VKWYKNGKEIPNAKA------KDNGDGSYSLEIPNAQLDDTADYKVVVSNDAGDADSS-AALTVKLPGIAIVKGL-EDAEVPKGKKAVLQVETN-KKPKEIKWYKNGKEITPSDKAQPGSDGDNKPQLVIPDAGDDDAAEYKVVLTDEDGNTADSSCALTVK-------LPAKEPKIIKGLEDQ--VVSIGSPIKLEIETSGSPK-TVKWYKNGKELPGAAAKTIKIQKIDDNKYV-LEIPS-SVVEDTGDYKVEVANEAGSANSSGKITVEPKI-TFLKPLKDQSIT---------EGENAEFSVETNTKPRIVK---WYKNGQ---EIKPNSRFIIEQKTDTKYQLVIKNAVRDDADTYKIVLENTAGEAESSAQLTVKKAKAGLCK----IVKGLEDQVVAKGAKMVFEVKIQGEPEDVR--------------WLRDANVISAGANAIIEKIDDTTYRLIIPSADLKDAGEYTVEVINESGKAKSDA------KGEVDEK--------PEIVRGLENIEIPEGDDDVFKVEVSA-PVRQVKWYKNDQEIKPNSHLEAKKIGPK--KYELAINRAQLDDGADYKVVLSNAAGDCDSSAALTVV 4323          

HSP 11 Score: 68.5514 bits (166), Expect = 1.547e-10
Identity = 157/732 (21.45%), Postives = 287/732 (39.21%), Query Frame = 2
Query: 4394 LLIDSVKLEDSGTYICQGF-------TNKELISE--CKITLNVVD------------NISDTLQCQVKFEKDKYS-IEINQDVTM----RALIEC---TSTHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNS-------STARTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCS-NNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGMVD-GKLLELVHFTV----QVNP-----IQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMPFGDPCVL-----DNPFIDLYIESPQVNEHSGLYKCIVTNEKS-ETEFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLKIN------ESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAI-WFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDG-ETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRIIVKP 6406
            L I + K ED G Y C+         TN +L  +   K+  +V D             + DT   +    +     +E+ +  T+    +A+++C         + W   G+ +EM + + ++ K++G +  L   N  ++  G Y C  EN+ G++        T      ++    D L  V   + +T G    LE     +     +W K+  +   ++ +     +     LT   A++ D   Y+ E   + G +   V  TV    QV P     + +I   +    K  C+     +S +KP              ++W ++  P  +   +     D+    L IE  + ++  G Y+  V+N+       V +TV      V S  L   +   + +VN  +  KI LSVE     K++    W K  + +  +     + +    Y L +   +M+D G Y + ++      ESS  + V          TK   K + +P  KK L D  +   P+      EVE  G  K + W+   +EI    +E +    +  + LTIP   EK  G+Y++  AN+ G + S  ++++  + EI   ++ +               +   E    N ++   P   + W K+G E  D+K  +      +   +++L I  A+VED+  Y  + +N  G   + A + V     K +D  +  VKP
Sbjct: 3104 LTIQNAKKEDVGAYRCEAVNVAGKANTNADLKIQFAAKVEEHVTDESGQLEEIGQFETVGDTASSKTDTGRGAPEFVELLRSCTVTEKQQAILKCKVKGEPRPKIKWTKEGKEVEMSARVRAEHKDDGTLT-LTFDNVTQADAGEYRCEAENEYGSAWTEGPIIVTLEGAPKIDGEAPDFLQPVKPAV-VTVGETAVLEGKISGKPKPSVKWYKNGEELKPSDRVKIENLDDGTQRLTVTNAKLDDMDEYRCEASNEFGDVWSDVTLTVKEPAQVAPGFFKELSAIQVKETETAKFECK-----VSGTKP-------------DVKWFKDGTPLKEDKRVHFESTDDGTQRLVIEDSKTDDQ-GNYRIEVSNDAGVANSKVPLTV------VPSETLK--IKKGLTDVNVTQGTKILLSVEVEGKPKTVK---WYKGTETVTSSQTTKIVQVTESEYKLEIESAEMSDTGAYRVVLSTDSFSVESSATVTV----------TKAAEK-ISLPSFKKGLADQSV---PKGTPLVLEVEIEGKPKDVKWYKNGDEIKDGKVEDL---GNGKYRLTIPDFQEKDVGEYSVTAANEAGEIESKAKVNVSAKPEIVSGLVPTT--------------VKQGETATFNVKVKG-PVKGVKWYKNGKEIPDAKTKD------NGDGSYSLEIPNAQVEDAADYKVVVSNDAGDADSSAALTV-----KLADDGKDKVKP 3760          

HSP 12 Score: 66.2402 bits (160), Expect = 7.973e-10
Identity = 85/362 (23.48%), Postives = 148/362 (40.88%), Query Frame = 2
Query: 5333 YKCIVTNE-KSETEFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQP--FCYNLILRDVKMTDAGMYSLKIN------ESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFI-QWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDE---FPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVI-IVTDSEPKE 6376
            YK I TN   + T   +IT K     V +P+  + L  T   V   E+ K+E+ V    P        W KD+K ++E D    +   P    + L+++    TDAG Y+ K +      ESS +               E+ ++L+ P   + L    ++   ET      V+        W  + + +  ++   I +      +++TI  A  +  GKY  +  N  G  +++   +++              + P F +KL  +E+  KE+  L+ +++  P+P + W KD    D+      V ++ +     +F+L I +A   D G Y C   N  G   T A   I+ DS P E
Sbjct: 2525 YKAIATNSIGTATSTSKITTK-----VEAPVFEQGLKKT--SVKEKEEIKMEVKVGGSAP-----DVEWFKDDKPVSE-DGNHEMKKNPETGVFTLVVKQAATTDAGKYTAKASNPAGTAESSAEA--------------EVTQSLEKPTFVRELVTTEVKIN-ETATLSVTVKGVPDPSVEWLKDGQPVQTDSSHVIAKVEGSGSYSITIKDARLEDSGKYACRATNPAGEAKTEANFAVV-----------KNLVPPEFVEKLSPLEVKEKESTTLSVKVVGTPEPSVEWFKD----DTPISIDNVHVIQKQTAVGSFSLTINDARQGDVGIYSCRARNEAGEALTTANFGIIRDSIPPE 2843          

HSP 13 Score: 65.0846 bits (157), Expect = 1.903e-9
Identity = 174/820 (21.22%), Postives = 297/820 (36.22%), Query Frame = 2
Query: 4085 LEIAHCQLSDSGQYKI-CFNPLEASKCGKVTGLFLVSIAPIKKNLKPID-----SNIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNNNLSF-LLIDSVKLEDSGTYICQGFTNKELISECKITLNVVDNISDTLQCQVKFEKDKYSIEINQDVTMRALIECTSTHY-SVSWFFNGEILEM-KSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCS--NNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGM-VDGKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMP--FGDPC---VLDNPFIDLYIESPQVNEHSGLYKCIVTN-------------------------------EKSETEFVEITVKFK-DEKVVSPILGELL-SCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLKI--------NESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILD-EFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSE 6367
            + I   +L DSG+Y     NP   +K       F V      KNL P +     S +E    ES TL V V G  +  ++W   +  +  D +     + QK     SF L I+  +  D G Y C+    +    E   T N    I D++  +  F +    +E+ +  T+   +    T   +V WF + + + +  S I +  + +G    L I+       G+Y C   N+ G + T       E I+        K  E+ +G    L V  E + + + +W KD +  +  N  +           L        D G Y  +     GK   +    +     +   T +E +   I    E    +   +++  +V       I++ +ND P   G      VL++  I L I++ +  E  G Y+C   N                               E  + E V  T   K D    +P   ELL SCTV E       K +  ++ +V  +      W K+ K +  +              L   +V   DAG Y  +          E  + + ++  PK           + + P   +P++   +    ET   E ++         W+   EE+   +   I+   D    LT+  A      +Y  + +N+ G V SD  L++           E   +AP F K+L  I++   E  +  C+ +   KP + W KDG  L     ++RV     +     L+I +++ +D G Y    +N  G   ++  + V  SE
Sbjct: 2705 ITIKDARLEDSGKYACRATNPAGEAK---TEANFAVV-----KNLVPPEFVEKLSPLEVKEKESTTLSVKVVGTPEPSVEWFKDDTPISIDNV----HVIQKQTAVGSFSLTINDARQGDVGIYSCRA---RNEAGEALTTANF-GIIRDSIPPE--FTQKLRPLEVREQETLDLKVTVIGTPVPNVEWFKDDKPINIDNSHIFAKDEGSGHHT-LTIKQARGEDVGVYTCKATNEAGEAKTTANMAVQEEIEAPLFVQGLKPYEVEQGKPAELVVRVEGKPEPEVKWFKDGVPIAIDNQHVIEKKGENGSHTLVIKDTNNADFGKYTCQATNKAGKDETVGELKIPKYSFEK-QTAEEVKPLFIEPLKETFAVEGDTVVLECKVNKESHPQIKFFKNDQPVEIGQHMQLEVLEDGNIKLTIQNAK-KEDVGAYRCEAVNVAGKANTNADLKIQFAAKVEEHVTDESGQLEEIGQFETVGDTASSKTDTGRGAPEFVELLRSCTVTE-------KQQAILKCKVKGEPRPKIKWTKEGKEVEMSARVRAEHKDDGTLTLTFDNVTQADAGEYRCEAENEYGSAWTEGPIIVTLEGAPK----------IDGEAPDFLQPVKPAVV-TVGETAVLEGKISGKPKPSVKWYKNGEELKPSDRVKIENLDDGTQRLTVTNAKLDDMDEYRCEASNEFGDVWSDVTLTVK----------EPAQVAPGFFKELSAIQVKETETAKFECK-VSGTKPDVKWFKDGTPLKE---DKRVHFESTDDGTQRLVIEDSKTDDQGNYRIEVSNDAGVANSKVPLTVVPSE 3471          

HSP 14 Score: 60.4622 bits (145), Expect = 4.069e-8
Identity = 94/384 (24.48%), Postives = 157/384 (40.89%), Query Frame = 2
Query: 5282 FIDLYIESPQVNEHSGLYKCIVTNEKSETEFVEITVKFKDEKVVSP--ILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNET-DPRLTIIMQPFCYNLILRDVKMTDAGMYSLKIN------ESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEI-DAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRIIVK 6403
            F  + I+  QV + +G Y C+ TNE  +          K EK  +P   + +L     +E + I+    E  VE   P   +   VWL D++ L  + D RL    Q     L +RD +  D G+Y++KI       ES  ++ V+  P           KN   P+ +  ++ +   +E E V+F+  +      + IWF   + + ++E ++FI  S D    LTI        G  T Q +N +G    DGRL + +               P F K L+D  +  K  +     +   P+P + +T  G+ L +      +   D F   ++  T  +  D G       N  G   + A + V + E +ES S+   +K
Sbjct:  603 FFAMTIDPVQVTD-TGRYTCMATNEYGQASTSAFFRVLKVEKEAAPPAFVTKLRDKECKEGDVID---FECEVEG-WPEPEL---VWLVDDQPLRPSHDFRLQYDGQ--TAKLEIRDAQPDDTGVYTVKIQNEFGSIESKAELFVQADPD----------KNHVAPEFQATIEYVEC-DEGEEVRFKSVITGDPNPEIIWFINGKPLSESEKVKFI--SEDGICILTIKDVTRHFDGMVTCQGSNRLGSASCDGRLKVRVPP-----------APPTFNKPLEDKTVQEKSTVVFEVDVSGWPEPTLTFTLCGKELKNGEEGVEIVGHDGFYRISIPNTSMDKHD-GEIVAKAQNEHGTAESRARLTV-EQEEEESRSAPTFLK 950          

HSP 15 Score: 58.151 bits (139), Expect = 1.850e-7
Identity = 40/179 (22.35%), Postives = 79/179 (44.13%), Query Frame = 2
Query: 9050 LSQKAELKFTKLMEYKLDKITWTFNNAKVDVNDERYKIFSAETYGIY-FIIKNLEEDDFGEYCA-----LDEVQDPIQSFILIKSDAPTILNCLPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIFSSYRTVITEDKEQGTYSLLISKCILSDGGEYSIRAENAIGFAEVKFNLRV 9568
            + +K E+K    +      + W F + K    D  +++      G++  ++K     D G+Y A         +   ++ +    + PT +  L    + ++E  ++SV +   P P V W ++ + + +    VI + +  G+YS+ I    L D G+Y+ RA N  G A+ + N  V
Sbjct: 2560 VKEKEEIKMEVKVGGSAPDVEW-FKDDKPVSEDGNHEMKKNPETGVFTLVVKQAATTDAGKYTAKASNPAGTAESSAEAEVTQSLEKPTFVRELVTTEVKINETATLSVTVKGVPDPSVEWLKDGQPVQTDSSHVIAKVEGSGSYSITIKDARLEDSGKYACRATNPAGEAKTEANFAV 2737          

HSP 16 Score: 56.9954 bits (136), Expect = 5.354e-7
Identity = 41/138 (29.71%), Postives = 66/138 (47.83%), Query Frame = 2
Query: 5957 CGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEP 6370
             GKYT  V N  G    +  L+++   E  E+  E    AP F   L+D    + E + L C+++ +PKPK+ W  D +T+  + +   V+ ++     T  IT +E+   G+Y C+  N  G   TEA + V    P
Sbjct: 2319 AGKYTCIVENTAGKDTCEATLTVI---ESLEKKSEKK--APEFIVALQDKTTKTSEKVVLECKVIGEPKPKVSWLHDNKTITQESIT--VESVEGVERVT--ITSSELSHQGKYTCIAENTEGTSKTEAFLTVQGEAP 2447          

HSP 17 Score: 56.225 bits (134), Expect = 7.868e-7
Identity = 84/362 (23.20%), Postives = 144/362 (39.78%), Query Frame = 2
Query: 5327 GLYKCIVTNEKSETEF-----VEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVE-SRVPTKSIDSAVWLKDEKLLNETDPRLTI-IMQPFCYNLILRDVKMTDAGMYSL-------KINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPN--FTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDS 6364
            G+Y C+  NE  + E      VEI    ++EK         ++  +E+      + I LS +   +P  S+   VW KD   L   D R +I   +     L + D    D G Y          IN +S  + VKV  + ++K+ +E F         K L D++  +  ++   +  V      +  W+   + +       I+ S D   +LT+  +     G Y  +  N  G  ++     + +    +E+        P F  +L D+ +     I L C++   P P + W+KDG  L     + R +  +E     + L I  A V D G Y C+ TN  G  TT++ + + D 
Sbjct: 4706 GVYMCVAVNELGQAETQATYQVEILEHVEEEKRRE--YAPKINPPLEDKTVNGGQPIRLSCKVDAIPRASV---VWYKDGLPLR-ADSRTSIQYEEDGTATLAINDSTEEDIGAYRCVATNAHGTIN-TSCSVNVKVPKQEVKKEGEEPF-------FTKGLVDLWA-DRGDSFTLKCAVTGDPFPEIKWYRNGQLLRNGPRTVIETSPDGSCSLTVNESTMSDEGIYRCEAENAHGKAKTQATAHVQMALGKTEKPKMDEGKPPKFILELSDMSVSLGNVIDLECKVTGLPNPSVKWSKDGGPL---IEDSRFEWSNEASKGVYQLRIKNATVHDEGTYRCVATNENGSATTKSFVRMDDG 5049          

HSP 18 Score: 55.8398 bits (133), Expect = 1.046e-6
Identity = 208/1044 (19.92%), Postives = 402/1044 (38.51%), Query Frame = 2
Query: 3362 WFVNNELLDFKKWNGSVNVSESQVEINFPKSTNELSGIWQFRIDKPMKLFSPEISVNV-LAKEVAPLSTGFLDCEIEEIDLKIGETLSLTLNAKDIPIMTLKNGGWFLNSEPIHAVKFRGNEVIEENKVKIVIPNVTKEFSGLLQYRIVKPVELYSPEIIIKIRGSLIKQTPKIEEEKFESNLILELHNVSLNISENERILLEAKIISGNINSYKTPPQWFWNDEAVKNINCKKDFTSNLAQLEIAHCQLSDSGQYKICFNPLEASKCGKVTGLFLVSIAPIKKNLKP--IDSNIETC--PGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNNNLSFLL-IDSVKLEDSGTYICQGFTNKELISECKITLNVVDNISDTLQCQVKFE-----KDKYSIEINQDVTMRALIECTSTHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVTKNIE---ITEGNELNLEV-VSEIEKDLQFQWSKDDIDCSNNGIFNSTK-NKNCFNLTKLKAEITDSGVYKFEGMVDGKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMPFGDPCVLDNPFI---------DLYIESPQVNEHSGLYKCIVTNEKSETEF-VEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLK-INESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAI-WFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRIIVKPL 6409
            W+   E +   +    V V+ES+ ++     + E+S    +R+      FS E S  V + K    +S       + +  +  G  L L +  +  P    K+  W+ N + I   K    E +   K ++ IP+  ++  G  +Y +    E    E   K+    +   P+I      S L      V   + + E      K+  G +   K    W+ N + + +   K +   + + LEI + Q+ D+  YK+  +  +A        L +      K  +KP  +   I T    GE+ T  V V+G  K+ +KW       K  K +   +   K N + S+ L I + +L+D+  Y       K ++S      N   +   +    VK       K     E+ +       +E       + W+ NG+ +   SD      +     +L I +  +     Y+ ++ ++DGN++ +   L V+    +    + K +E   ++ G+ + LE+  S   K +++  +  ++  +        K + N + L    + + D+G YK         +E+ +     N    I  T E ++  +    +  +++ +    SVE  N K  +++W +N    G     ++ FI          L I++  V + +  YK ++ N   E E   ++TVK     +   + G       +    + + KI+   E            WL+D  +++     +   +    Y LI+    + DAG Y+++ INES          K       E+ +    P+I + L++I I   PE     F+VE S   + + W+  ++EI   +    +      + L I  A       Y + ++N  G   S   L+++  + +                 LKD+++   + + L  ++   PK  I W K+G+ L       + +   E   F+L I  ++  D G Y  +  N  G   + +V+ V  ++  E  S    + PL
Sbjct: 3505 WYKGTETVTSSQTTKIVQVTESEYKLEI--ESAEMSDTGAYRVVLSTDSFSVESSATVTVTKAAEKISLPSFKKGLADQSVPKGTPLVLEVEIEGKP----KDVKWYKNGDEIKDGKV---EDLGNGKYRLTIPDFQEKDVG--EYSVTAANEAGEIESKAKVN---VSAKPEIV-----SGL------VPTTVKQGETATFNVKV-KGPVKGVK----WYKNGKEIPDAKTKDNGDGSYS-LEIPNAQVEDAADYKVVVS-NDAGDADSSAALTVKLADDGKDKVKPEIVSGLIPTTVKQGETATFNVKVKGPVKQ-VKW------YKNGKEIPNAKA--KDNGDGSYSLEIPNAQLDDTADY-------KVVVS------NDAGDADSSAALTVKLPGIAIVKGLEDAEVPKGKKAVLQVETNKKPKEIKWYKNGKEI-TPSDKAQPGSDGDNKPQLVIPDAGDDDAAEYKVVLTDEDGNTADSSCALTVKLPAKEP--KIIKGLEDQVVSIGSPIKLEIETSGSPKTVKWYKNGKELPGAAAKTIKIQKIDDNKYVLEIPSSVVEDTGDYK---------VEVANEAGSANSSGKI--TVEPKITFLKPLKDQSITEGENAEFSVET-NTKPRIVKWYKN----GQEIKPNSRFIIEQKTDTKYQLVIKN-AVRDDADTYKIVLENTAGEAESSAQLTVKKAKAGLCKIVKGLEDQVVAKGAKMVFEVKIQGEPED---------VRWLRDANVISAGANAIIEKIDDTTYRLIIPSADLKDAGEYTVEVINESG---------KAKSDAKGEVDEK---PEIVRGLENIEI---PEGDDDVFKVEVSAPVRQVKWYKNDQEIKPNSHLEAKKIGPKKYELAINRAQLDDGADYKVVLSNAAGDCDSSAALTVVKPNVLK------------IVDGLKDVDVEEPQPVELKVKVEGIPK-VIKWYKNGQELKPDADGFKFEEKPESGEFSLTIPSSKKSDGGAYRVVLGNDKGEVYSGSVVHVKSAKSSEPTSGANFLSPL 4437          

HSP 19 Score: 53.9138 bits (128), Expect = 4.300e-6
Identity = 128/612 (20.92%), Postives = 242/612 (39.54%), Query Frame = 2
Query: 4625 WFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNS-STARTELNVEN---IQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCSNNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGM----VDGKLLEL-VHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGV-IQWLRNDMPFGDP---CVLDNPFIDLYIESPQVN-EHSGLYKCIVTNEKSETEF-VEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVW-LKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLKINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRM-MCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRIIVKPL 6409
            W+ NG +LE   + ++ IKN    + L I N  +S +   E    N+ G+S S+A+  +N  +   I +D   SVT  I+ TE  E    +       ++  W+ ++     +    + K ++ + L    A+I  +G  K         D K  +L V   V+    +S LT             + +  + +PL  ++E+     G  + WL N  P        V+D+     ++   +   E SG       N   E E   ++TV   ++K       E +        T+E E ++ S  + V  K + +  W L ++KL+   + ++  + +    ++ ++   M   G   ++    S  +    + K        + K  ++P+    + D  ++ E E VKF   VE        W    E + +++        D    + I A   +  G+ + +  N +G  + D +L++           +    AP F K L+D  I   E   ++ ++ +  PKPKI W KDG  + S    + V+  +E  +  L I + ++ED GR      +  G     A + V    P    + +  + P+
Sbjct: 1373 WYQNGNLLEDGKNGVT-IKNEENKSSLIIPNAQDSGKITVEA--SNEVGSSESSAQLTVNPPSTTPIVVDGPKSVT--IKETETAEFKATISGFPAPTVK--WTINEKIVEESRTITTIKTEDVYTLKISNAKIEQTGTVKVTAQNSAGQDSKQADLKVEPNVKAPKFKSQLT-------------DKVADEGEPLRWNLELDGPSPGTEVSWLLNGQPLTKSDTVQVVDHGDGTYHVTIAEAKPEMSGTLTAKAKNAAGECETSAKVTVNGGNKKP------EFVQAPQNHETTLE-ESVKFS--AIVTGKPMPNVTWYLNNKKLIQSEEVKVKYVHETGKTSIRIQKPLMEHNGTIRVEAENVSGKVQATAQLK--------VDKKTEVPKFTTNMDDRQVK-EGEDVKFTANVEGYPEPSVAWTLNGEPV-SKHPNITVTDKDGEHTIEISAVTPEQAGELSCEATNPVGSKKRDVQLAV-----------KKVGDAPTFAKNLEDRLITEGELTLMDAKLNIVKPKPKITWLKDGVEITSDGHYKIVE--EEDGSLKLSILQTKLEDKGRITIKAESEFGVAECSASLGVVKGRPMAKPAFQSDIAPI 1932          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: unc-89 (Muscle M-line assembly protein unc-89 [Source:UniProtKB/Swiss-Prot;Acc:O01761])

HSP 1 Score: 136.732 bits (343), Expect = 3.618e-31
Identity = 157/617 (25.45%), Postives = 269/617 (43.60%), Query Frame = 2
Query: 8714 ITLSWSPPRISPDLYIPFTVDVECRPVNYSYSDEEGWSVFKTNIKKNRVDIADLDPNINYQLRIVPVTDFGI-------------GKPSMVIKKIRRSDN---LNSPTTEKA--MMLQEKHCLAVPMFC--------CLSQKAELKFTKLMEYKLDKITWTFNNAKVDVND--ERYKIFSAETYGIYFIIKNLEEDDFGEY-C-ALDEVQDPIQSFILIKSDAPTILNCLPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIFSSYRTVITEDKEQGTY--SLLISKCILSDGGEYSIRAENAIGFAEVKFNLRVDAHPE-------KKSVQINIGDVNDRYYTMKK----LAKGSYSRCQIVIEKSTQIEFIGKFFEINNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIY-----EKLQGLS-LAEYITQLSHWC----ESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVPKEDFGSRRHM--GL------TSP-FSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQ--LYNEDS----NDAISN---SACVFIRKCLLLKTGERLTSSDSLSHEWF 10351
            +TLSW P + +P  Y   T  +E R +      E+ WS+ + NI +    + +L+   +YQ R+     +GI               P  V    RR++    L  P  EKA  M   E++  A P F         C           +  +    I W F    +D +    + K+++         I    +++ G+Y C A ++  D  Q+ ++  +  P  +  L N + +  +   + V++D +P PE+ W + W+ I  S R    +D   G Y  SL+I+  +  D G YS  A N  G A     + V+A  +       ++ V I    V + Y   +K     A+G+  R   V EK+T  EF+ +   I++  +   +     ++ H  IV++   +   D+ L L+        + GLS LA    +++       E+ VR+ + QL+ A+ ++H+ R+ HLD++PE I++    ++ LKL          DFG  R +  GL       SP F +PE+++  P+   +DMWS G+LT++ L G    + + D   L N DS    +  + N    A  F++K L      RLT  ++L H W 
Sbjct: 5179 LTLSWIPTKRAPPRYPQVTYVIEIREL-----PEKQWSLLEYNIPEPVCKVRNLELGKSYQFRVRAENIYGISDPSPASPPSRLMAPPQPVFD--RRTNKVIPLLDPYAEKALDMRYSEQYACA-PWFSPGVVEKRYCAENDTLTIVLNVSGFPDPDIKWKFRGWDIDTSSPTSKCKVYTYGGSETTLAITGFSKENVGQYQCFAKNDYGDAQQNIMVDLATRPNFIQPLVNKTFSSAQPMRMDVRVDGEPFPELKWMKEWRPIVESSRIKFVQD---GPYLCSLIINDPMWRDSGIYSCVAVNDAGQATTSCTVTVEAEGDYNDVELPRRRVTIESRRVRELYEISEKDEKLAAEGAPFR---VKEKATGREFLAQLRPIDDALMRHVDIH--NSLDHPGIVQMHRVLR--DEKLALVVFDNANSTIDGLSSLAHPGVEIAEPKGVNRETCVRVFVRQLLLALKHMHDLRIAHLDLRPETILL---QDDKLKLA---------DFGQARRLLRGLITGEIKGSPEFVSPEIVRSYPLTLATDMWSTGVLTYVLLTGLSPFHGDNDNETLANVDSCQFDSSPLGNFSYDAGDFVKKLLTEIPVSRLTVDEALDHPWI 5765          

HSP 2 Score: 98.5969 bits (244), Expect = 1.266e-19
Identity = 170/765 (22.22%), Postives = 302/765 (39.48%), Query Frame = 2
Query: 4283 GFSKKDIKWKVLEDDLKQDKILQE---KRITQKFNNNLSFLLIDSVKLEDSGTYICQGFTNKELISECKITLNVVDNISDTLQCQVKFEKDKYSIEINQDVTMRALIECTSTHYSVSWFFNGEILEM-KSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDD--IDCSNNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGMVD-GKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMPFGDPCVLDNPFI----------DLYIESPQVNEHSGLYKCIVTNEKSETEF-VEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDE-KLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLK-INESSVDILV---KVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSC--DNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCI-----------------------APLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKI-LDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVT-DSEPKESDSSRIIVKPLCAPVLT 6427
            G S  D++W       K DK + E     + +     +  L++      D+G Y  +  +N    +E      V  ++      +   E     ++IN+  T+   ++      SV W  +G+ ++   S +++ ++ +G  + + I++      G Y C   N  G + T      V+N+           +E+ E     L V      +   +W KDD  I   N  +         F+LT   A   D G+Y      + G+ L   +F +  + I    T     L++   + E +  D K  +I   V N     ++W ++D P      +DN  I           L I+  +  E  G+Y C  TNE  E +    + V+   E++ +P+  + L     E    + +  EL V  RV  K      W KD   +  +    +    +   + L+++D    D G Y+ +  N++  D  V   K+      KQT E  K L I    +PL++ F   E +TV  E +V +  +   I FF+N++   E  + +Q     D    LTI  A ++  G Y  +  N  G   ++  L +   +++ E + +                           AP F + L+   +  K+   L C++  +P+PKI WTK+G+ ++   ++ RV+    +    TL        D+G Y C   N  G   TE  IIVT +  PK    +   ++P+   V+T
Sbjct: 2100 GGSAPDVEW------FKDDKPVSEDGNHEMKKNPETGVFTLVVKQAATTDAGKYTAKA-SNPAGTAESSAEAEVTQSLEKPTFVR---ELVTTEVKINETATLSVTVKGVPDP-SVEWLKDGQPVQTDSSHVIAKVEGSGSYS-ITIKDARLEDSGKYACRATNPAGEAKTEANFAVVKNLVPPEFVEKLSPLEVKEKESTTLSVKVVGTPEPSVEWFKDDTPISIDNVHVIQKQTAVGSFSLTINDARQGDVGIYSCRARNEAGEALTTANFGIIRDSIPPEFTQKLRPLEV--REQETL--DLKVTVIGTPVPN-----VEWFKDDKPIN----IDNSHIFAKDEGSGHHTLTIKQAR-GEDVGVYTCKATNEAGEAKTTANMAVQ---EEIEAPLFVQGLKPYEVE----QGKPAELVV--RVEGKPEPEVKWFKDGVPIAIDNQHVIEKKGENGSHTLVIKDTNNADFGKYTCQATNKAGKDETVGELKIPKYSFEKQTAEEVKPLFI----EPLKETFAV-EGDTVVLECKVNKE-SHPQIKFFKNDQ-PVEIGQHMQLEVLEDGNIKLTIQNAKKEDVGAYRCEAVNVAGKANTNADLKIQFAAKVEEHVTDESGQLEEIGQFETVGDTASSKTDTGRGAPEFVELLRSCTVTEKQQAILKCKVKGEPRPKIKWTKEGKEVE---MSARVRAEHKDDGTLTLTFDNVTQADAGEYRCEAENEYGSAWTEGPIIVTLEGAPKIDGEAPDFLQPVKPAVVT 2819          

HSP 3 Score: 93.9745 bits (232), Expect = 3.569e-18
Identity = 131/612 (21.41%), Postives = 246/612 (40.20%), Query Frame = 2
Query: 10619 TPNDNSSEEVKSDRSETFPSADRLSVSNTTKELLFTVPLKDQTFKSDSTAGKITVTLTCQLSLLGSEPISISWYKNQELLTDDSRIKLEVIKGGFLSCTILN-ATETDVGIFRCIARCHSLRTETSARLVLGDVPPQPEQLSVYYTNQEEVLLKWSP-----YLSAIDDVIYRIDIRTIDSRNKIRNWKTIGYSVDNR-YLLENLDRTQQYIARIIAQNKYGYSPYSIATSVFQNKIRN-----IHSLKQALIFNRKWMLTSRQSNHFNDL--------------HDLIKDIS--SDDI-------------RMNVIREHYSTLSQKSSGFAVLKLKNTNVNFPEYIVQRTFKMEDICPAFDLCVRIKYYHFPILFGEICDSSLGNRITFEEFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFV-GTVKEQESLTTHKPSIFKAPEYRY-ESITRYESDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNT--NTLLLPVPHTHFRAPKLSMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWFKQDPQTIYEMEHQTISSTPL 12319
             P+  + E +K+D  +  P A + +  + T   +FT  L+D   + +  A        C +S   S    ++W    ++L  + R+ +E  +   ++  ILN A   D+G + C A       ++S RL+ G+ P +P +     ++  E+ ++W       YL  I    YR++ R     +    W T+   +D+   ++++L     Y  R+ AQN +G    S+++ + Q   +      I  LK  +  N   M   + +N    +               D+  ++   +DD              R +VIR+   + ++  +  AV     ++    EY   R  + E++     L       +F  L  E     + +R  F ++               Y+E  V   +RQ+   + FLH   + H ++ P  I+   ++ +S+ +KL+     Q V G VK  +  T      + +PE+   E+    +SD+W +G+++F LLA   P   +   + ++   V N   +  L+PV                S+    F   +LKKSP  R   D  L+H +   DP  +   E    S++ L
Sbjct: 6384 APSATAIERIKADIEKVTPCATKKN-DDGTFAPIFTARLRDVYLRKNQPA-----IFECAVS--ASPAPKVTWDFQGKILESNDRVTIE--QDNNVARLILNHAAPYDLGEYVCTAINEYGTDKSSCRLISGETPSRPGRPEAELSSDTEIFIQWEAPEGPTYLEGI---TYRLEYRVAGPNDHGDPWITVSEKIDDESVIVKHLSPLGIYQFRVTAQNGFGLGLPSLSSRIVQTHGKGAPKLQIDVLKSEIRLNVVSM-PQKSTNQLGGISEESEEDSEARTANEDMKSNLQLQTDDPTGRFQIGGLKFKGRFSVIRDAVDSTTEGHAHCAVKIRHPSSEAISEYESLRDGQHENVQ---RLIAAFNNSNFLYLLSERLYEDVFSRFVFNDY---------------YTEEQVALTMRQVTSALHFLHFKGIAHLDVNPHNIMF--QSKRSWVVKLVDFGRAQKVSGAVKPVDFDTK-----WASPEFHIPETPVTVQSDMWGMGVVTFCLLAGFHPFTSEYDREEEIKENVINVKCDPNLIPV--------------NASQECLSFATWALKKSPVRRMRTDEALSHKFLSSDPSMVRRRESIKYSASRL 6942          

HSP 4 Score: 82.8037 bits (203), Expect = 7.062e-15
Identity = 186/832 (22.36%), Postives = 336/832 (40.38%), Query Frame = 2
Query: 4013 QWFWNDEAVKNINCKKDFTSNLAQLEIAHCQLSDSGQYKICF--NPLEASKCGKVTGLFLVSIAPIKKNLKPIDSNIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNN--NLSFLLIDSVKLEDSGTY--ICQGFTNKELISECKITLNVV---DNISDTLQCQVKFEKDKYSIEINQDVTMRALIECTSTHYSVSWFFNGEIL---EMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCSNNGIFN-STKNKNCFNLTKLKAEITDSGVYKFEGMVDGKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLR--NDMPFGDPCVL---DNPFIDLYIESPQVNEHSGLYKCIVTNEKSETEFVEITVKFKDEKVVSPILGEL-----LSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLKINESSVD-----ILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAI-WFFENEEI--DAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETL--DSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRIIVKPL 6409
            +W+ N + + N   K +   + + LEI + QL D+  YK+    +  +A     +T + L  IA I K L+    + E   G+   L V+      K+IKW       K  K +      Q  ++  N   L+I     +D+  Y  +          S C +T+ +      I   L+ QV        + I   + +   IE + +  +V W+ NG+ L     K+  +  I +N  + E+      ++  G Y+  + N+ G S+ +  ++ VE  +I  L  + K+  ITEG      V +  +  +  +W K+  +   N  F    K    + L    A   D+  YK        +LE      + +   ++        K++    + +++    ++  V++    + V +WLR  N +  G   ++   D+    L I S  + + +G Y   V NE                K  S   GE+     +   +E +   E +     VE   P + +    W K+++ +          + P  Y L +   ++ D   Y + ++ ++ D      L  V+P  ++              I   L+D+ +  EP+ V+ + +VE  G  K I W+   +E+  DA+  +F +      F+LTIP++ +   G Y + + ND G V S G +  +  ++ SE    +  ++PL     KD E+   + + L C +  +P P+++W KDG  L  D +   R    LD     TL I  A+  D G+Y     N  G  T++  + VT  E  E  S    V PL
Sbjct: 3318 KWYKNGKEIPNAKAKDNGDGSYS-LEIPNAQLDDTADYKVVVSNDAGDADSSAALT-VKLPGIA-IVKGLE----DAEVPKGKKAVLQVETNK-KPKEIKW------YKNGKEITPSDKAQPGSDGDNKPQLVIPDAGDDDAAEYKVVLTDEDGNTADSSCALTVKLPAKEPKIIKGLEDQV--------VSIGSPIKLE--IETSGSPKTVKWYKNGKELPGAAAKTIKIQKIDDNKYVLEIPSSVVEDT--GDYKVEVANEAG-SANSSGKITVEP-KITFLKPL-KDQSITEGENAEFSVETNTKPRI-VKWYKNGQEIKPNSRFIIEQKTDTKYQLVIKNAVRDDADTYKI-------VLENTAGEAESSAQLTVKKAKAGLCKIVKGLEDQVVAKGAKMVFEVKIQGEPEDV-RWLRDANVISAGANAIIEKIDDTTYRLIIPSADLKD-AGEYTVEVINESG--------------KAKSDAKGEVDEKPEIVRGLENIEIPEGDDDVFKVEVSAPVRQVK---WYKNDQEIKPNSHLEAKKIGPKKYELAINRAQLDDGADYKVVLSNAAGDCDSSAALTVVKPNVLK--------------IVDGLKDVDVE-EPQPVELKVKVE--GIPKVIKWYKNGQELKPDADGFKFEEKPESGEFSLTIPSSKKSDGGAYRVVLGNDKGEVYS-GSVVHVKSAKSSEPTSGANFLSPL-----KDTEVEEGDMLTLQCTIAGEPFPEVIWEKDGVVLQKDDRITMRVA--LDG--TATLRIRSAKKSDIGQYRVTAKNEAGSATSDCKVTVT--EQGEQPSKPKFVIPL 4064          

HSP 5 Score: 74.7146 bits (182), Expect = 2.390e-12
Identity = 156/744 (20.97%), Postives = 280/744 (37.63%), Query Frame = 2
Query: 4232 NIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNNNLSFLLIDSVKLEDSGTY-ICQGFTNKELISECKIT------LNVVDNISDTLQCQVKFEKDKYSIEINQDVTMRALIECTSTHYSVSWFFNGEILEMKSD--ILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTA-----RTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCS-NNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGMVD-GKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMP--FGDPCVLDNPFIDLYIESPQ--VNEHSGLYKCIVTNEKSETEFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELS----VESRVPTKSIDSAVWLKDEK---------LLNETDPRLTIIMQPFCYNLILRDVKMTDAGMY-SLKINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNF--TLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIV 6355
            NIE   G+     V+V    ++ +KW   + ++K +  L+ K+I  K       L I+  +L+D   Y +       +  S   +T      L +VD + D              +E  Q V ++  +E       + W+ NG+ L+  +D     +   +G+ + L I +  +S  G Y  ++ N  G   +      ++  + E        S  K+ E+ EG+ L L+     E   +  W KD +    ++ I           L    A+ +D G Y+     + G        TV     Q      + +  +  +    +  D K    +V+V    +  +QW  N +P  F D   LD+     Y  + +    E  G  KCI  NE    E V    +F+          + L         + D +I +     +E  V         W KD K         + N  D    I + PF         + +D G+Y  + +NE             I +  +E  +    P+I  PL+D  + N  + ++   +V+       +W+ +   + A++   IQ+  D    L I  + E+  G Y     N  G + +    S  +  ++ +Q ++     P FTK L D+     ++  L C +  DP P+I W ++G+ L     N    +++  P+   +L + E+ + D G Y C   N  G   T+A   V
Sbjct: 3768 NIEIPEGDDDVFKVEVSAPVRQ-VKWYKNDQEIKPNSHLEAKKIGPKKYE----LAINRAQLDDGADYKVVLSNAAGDCDSSAALTVVKPNVLKIVDGLKDV------------DVEEPQPVELKVKVEGIPK--VIKWYKNGQELKPDADGFKFEEKPESGEFS-LTIPSSKKSDGGAYRVVLGNDKGEVYSGSVVHVKSAKSSEPTSGANFLSPLKDTEVEEGDMLTLQCTIAGEPFPEVIWEKDGVVLQKDDRITMRVALDGTATLRIRSAKKSDIGQYRVTAKNEAGSATSDCKVTVTEQGEQP----SKPKFVIPLKTGAALPGDKKEF--NVKVRGLPKPTLQWFLNGIPIKFDDRITLDDMADGNYCLTIRDVREEDFGTLKCIAKNENGTDETV---CEFQQGAGHDDGSRDDLRYPPRFNVPLWDRRIPVGDPMFIECHVDANPTAEVEWFKDGKKIEHTAHTEIRNTVDGACRIKIIPF---------EESDIGVYMCVAVNELGQAETQATYQVEILEHVEEEKRREYAPKINPPLEDKTV-NGGQPIRLSCKVDAIPRASVVWYKDGLPLRADSRTSIQYEEDGTATLAINDSTEEDIGAYRCVATNAHGTINT----SCSVNVKVPKQEVKKEGEEPFFTKGLVDLWADRGDSFTLKCAVTGDPFPEIKWYRNGQLL----RNGPRTVIETSPDGSCSLTVNESTMSDEGIYRCEAENAHGKAKTQATAHV 4464          

HSP 6 Score: 74.3294 bits (181), Expect = 2.971e-12
Identity = 62/273 (22.71%), Postives = 127/273 (46.52%), Query Frame = 2
Query: 9584 KKSVQINIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQ--IEFIGKFFEINNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVPKEDFGSRRHMGLTSPFSAPEL-LKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQLYNEDSNDAISNSAC-------VFIRKCLLLKTG-------ERLTSSDSLSHEWF 10351
            K ++Q+   D   R+       KG +S  +  ++ +T+       K    ++  I  SE++ +++  H N+  +  A    + +L L+ E+L     + ++    ++ E QV + + Q+  A+ +LH   + HLD+ P NI+   K + ++KL  F  A  ++  G+ + +   + +++PE  +   P+   SDMW +G++TF  L G      E D+   E+  + + N  C          ++CL   T         R+ + ++LSH++ 
Sbjct: 6658 KSNLQLQTDDPTGRFQIGGLKFKGRFSVIRDAVDSTTEGHAHCAVKIRHPSSEAI--SEYESLRDGQHENVQRLIAAFNNSN-FLYLLSERLYEDVFSRFVFN-DYYTEEQVALTMRQVTSALHFLHFKGIAHLDVNPHNIMFQSKRSWVVKLVDFGRA--QKVSGAVKPVDFDTKWASPEFHIPETPVTVQSDMWGMGVVTFCLLAGFHPFTSEYDR--EEEIKENVINVKCDPNLIPVNASQECLSFATWALKKSPVRRMRTDEALSHKFL 6922          

HSP 7 Score: 72.4034 bits (176), Expect = 1.162e-11
Identity = 199/874 (22.77%), Postives = 339/874 (38.79%), Query Frame = 2
Query: 3932 LNISENERILLEAKIISGNINSYKTPPQWFWNDEAVKNINCK---KDFTSNLAQLEIAHCQLSDSGQYKICFNPLEASKCGKVTGLFLVSI---API-KKNLKPIDSNIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNNNLSFLLIDSVKLEDSGTYICQGFTNK----ELISECKITLNVVDNISDTLQCQVKFEKDKYSIEINQDVTMRALIEC---TSTHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSST---------ARTELNV--ENIQI----------DCLNSVT-------------KNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCSNNG-IFNSTKNKNCFNLTKLKAEITDSGVYKFEGMVDGKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISV---EVLNWK-----QGVIQWLRN--DMPFGDPCV---LDNPFIDLYIESPQVNEHSGLYKCIVTNEKSETEFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTI-IMQPFCYNLILRDVKMTDAGMYSLKINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAI-WFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSE-ISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVT 6358
            L + E E + L+  +I   + +     +WF +D+ +   N     KD  S    L I   +  D G Y  C    EA +  K T    V     AP+  + LKP     E   G+   L V VEG  + ++KW   +D +    I  +  I +K  N    L+I      D G Y CQ  TNK    E + E KI     +  +      +  E  K +  +  D     ++EC     +H  + +F N + +E+   +  ++  +G I +L IQN  +   G Y C   N  G ++T         A+ E +V  E+ Q+          D  +S T             ++  +TE  +  L+   + E   + +W+K+  +   +  +    K+     LT       D+G Y+ E        E  + +        I+ T E   K+  E  +  L   KP +++V    VL  K     +  ++W +N  ++   D      LD+    L + + ++++    Y+C  +NE  +  + ++T+  K+   V+P   + LS    +V   E  K E  V    P        W KD   L E D R+           L++ D K  D G Y +++   S D  V     P+     E  K      IKK L D+   N  +  K    VE  G  K + W+   E + +     I    ++ + L I +A     G Y + ++ D   V S   +++   +E IS          P F K L D  +     + L   +   PK  + W K+G+ +     + +V+ L     + L I + + +D G Y     N  G   ++A + V+
Sbjct: 2378 LEVREQETLDLKVTVIGTPVPNV----EWFKDDKPINIDNSHIFAKDEGSGHHTLTIKQARGEDVGVY-TCKATNEAGEA-KTTANMAVQEEIEAPLFVQGLKPY----EVEQGKPAELVVRVEGKPEPEVKW--FKDGVPI-AIDNQHVIEKKGENGSHTLVIKDTNNADFGKYTCQA-TNKAGKDETVGELKIPKYSFEKQTAEEVKPLFIEPLKETFAVEGDT---VVLECKVNKESHPQIKFFKNDQPVEIGQHMQLEVLEDGNI-KLTIQNAKKEDVGAYRCEAVNVAGKANTNADLKIQFAAKVEEHVTDESGQLEEIGQFETVGDTASSKTDTGRGAPEFVELLRSCTVTEKQQAILKCKVKGEPRPKIKWTKEGKEVEMSARVRAEHKDDGTLTLTFDNVTQADAGEYRCEA-------ENEYGSAWTE--GPIIVTLEGAPKIDGEAPD-FLQPVKPAVVTVGETAVLEGKISGKPKPSVKWYKNGEELKPSDRVKIENLDDGTQRLTVTNAKLDDMD-EYRCEASNEFGDV-WSDVTLTVKEPAQVAPGFFKELSAI--QVKETETAKFECKVSGTKP-----DVKWFKDGTPLKE-DKRVHFESTDDGTQRLVIEDSKTDDQGNYRIEV---SNDAGVANSKVPLTVVPSETLK------IKKGLTDV---NVTQGTKILLSVEVEGKPKTVKWYKGTETVTSSQTTKIVQVTESEYKLEIESAEMSDTGAYRVVLSTDSFSVESSATVTVTKAAEKIS---------LPSFKKGLADQSVPKGTPLVLEVEIEGKPK-DVKWYKNGDEIK----DGKVEDLGNG-KYRLTIPDFQEKDVGEYSVTAANEAGEIESKAKVNVS 3186          

HSP 8 Score: 70.4774 bits (171), Expect = 3.750e-11
Identity = 101/402 (25.12%), Postives = 166/402 (41.29%), Query Frame = 2
Query: 5198 EVLNWKQGVIQWLRNDMPFGDP----CVLDNPFIDLYIESPQVNEHSGLYKCIVTNEKSETEF-VEITVKFK-DEKVVSPILGELLSCTVEEVNTIEDEKIEL-SVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMY----SLKINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFE--NEEI--DAENMEFIQWSCDNYFALTIP-AAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIV 6355
            EV  W +  + WL +D P           D     L I   Q ++ +G+Y   + NE    E   E+ V+   D+  V+P        T+E V   E E++   SV +  P   I   +W  + K L+E++    I     C  L ++DV     GM     S ++  +S D  +KVR  P              P   KPL+D  ++ +   V   FEV+ SG  +    F    +E+    E +E +    D ++ ++IP  + +KH G+   +  N+ G   S  RL++       EQ  E    AP F K ++D  + + E       +  +P P++ W  +G  +D       VKI     +  L I  A+   +G   C   N +G   T+A ++V
Sbjct:  197 EVEGWPEPELVWLVDDQPLRPSHDFRLQYDGQTAKLEIRDAQPDD-TGVYTVKIQNEFGSIESKAELFVQADPDKNHVAP----EFQATIEYVECDEGEEVRFKSVITGDPNPEI---IWFINGKPLSESEKVKFISEDGICI-LTIKDVTRHFDGMVTCQGSNRLGSASCDGRLKVRVPPAP------------PTFNKPLEDKTVQEKSTVV---FEVDVSGWPEPTLTFTLCGKELKNGEEGVEIV--GHDGFYRISIPNTSMDKHDGEIVAKAQNEHGTAESRARLTV-------EQEEEESRSAPTFLKDIEDQTVKTGEFAVFETTVRGNPNPEVTWFINGHKMDQGSPG--VKIEAHNHDHKLTIDSAQY--AGTVLCRAENAVGRFETKARLVV 561          

HSP 9 Score: 70.4774 bits (171), Expect = 4.433e-11
Identity = 83/318 (26.10%), Postives = 138/318 (43.40%), Query Frame = 2
Query: 5792 EPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDG--------RLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFT--LIITEAEVEDSGRYCCLGTNFLGYDTT--EAVIIVTDSEPKESDSS-RIIVKPLCAPVLTAEYSKGADVILSWTSVATTDTLNIIYNIEKQKSLTSTNWKKIMKNLTETTYSLSSSCLPPQESHLLRCVAISEYGFETVSNIIEIPIRANSPI 6706
            E + +K E +V+ S   + +W+ +   +   +   I  S D    L IP+      G Y +   N  G  +  G        R S   RS  +++ +     AP   + L++I I  K++ RL C+   DPKP I W KDGE +       R++++ E P+    L++  A  +D+G Y C+  N  G   T  +  +I  D +P++ DSS R    P     LT   +K  D + ++  +   +    I  ++    L S + K  M+   + T  L  S +        RCVA +E+G  T S   E+ I  +  I
Sbjct: 4601 EGQPLKLECKVDASPLPEMVWYKDGAIVTPSDRIQISLSPDGVATLLIPSCVYDDDGIYRVIATNPSGTAQDKGTATVKKLPRDSGARRS--ADRDVFDANKAPKLMEPLENIRIPEKQSFRLRCKFSGDPKPTIKWFKDGERV---FPYGRLQLI-ESPDGVCELVVDSATRQDAGGYRCVAENTYGSARTSCDVNVIRGDRKPRDIDSSIREGKAPGFTTPLTIRRAKPGDSV-TFECLPFGNPFPSIKWLKDGLELFS-DEKIKMEAAADGTQRLILSDVTFLSEGYFRCVATNEHG--TASTKAELVIEGDRTI 4908          

HSP 10 Score: 69.707 bits (169), Expect = 7.510e-11
Identity = 222/1065 (20.85%), Postives = 427/1065 (40.09%), Query Frame = 2
Query: 3260 FFTNLKQIETISGENLHVQFKAYNIVLDTLKKGSWFVNNELLDFKKWNGSVNVSESQVEINFPKSTNELSGIWQFRIDKPMKLFSPEISVNVLAKEVAPLSTGFLDCEIEEIDLKIGETLSLTLNAKDIPIMTLKNGGWFLNSEPIHAVKFRGNEVIEENKVKIVIPNVTKEFSGLLQYRIVKPVELYSPEIIIKIRGSLIKQTPKIEEEKFESNLILELHNVSLNISENERILLEAKIISGNINSYKTPPQWFWNDEAVKNINCKKDFTSNLAQLEIAHCQLSDSGQYKICFNPLEASKCGKVTGLFLVSIAPIKKNLKP--IDSNIETC--PGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNNNLSFLL-IDSVKLEDSGTY-ICQGFTNKELISECKITLNVVDNISDTLQCQVKFEKDKYSIEINQDVTMRALIECTSTHYSVSWFFNG-EILEMKSDILSDIKNNGKIA-ELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCS-NNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGM-VDGKLLEL-VHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRN--DMPFGDPCVL------DNPFIDLYIESPQVNEHSGLYKCIVTNEK-SETEFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFC---YNLILRDVKMTDAGMYSLKIN------ESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIF---IRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLG-YDTTEAVIIV 6355
            FF  L  I+    E    + K      D      WF +   L   K     +  +    +    S  +  G ++  +     + + ++ + V+  E   +  G  D  + +     G  + L++  +  P  T+K   W+  +E + + +      + E++ K+ I +   E S    YR+V   + +S E    +  ++ K   KI    F+  L         ++ +   ++LE +I  G     K    W+ N + +K+   + D  +   +L I   Q  D G+Y +      A++ G++      S A +  + KP  +   + T    GE+ T  V V+G   K +KW       K  K + + +   K N + S+ L I + ++ED+  Y +       +  S   +T+ + D+  D ++ ++       +++  +  T    ++       V W+ NG EI   K+      K+NG  +  L+I N        Y+ ++ N  G++ ++   L V+   I  +  + ++ E+ +G +  L+V +  +K  + +W K+  + + ++     +   N   L    A   D+  YK      DG   +     TV+       L   E ++    ED   ++S   P+ + +E     +  ++W +N  ++P      +      DN ++ L I S  V E +G YK  V NE  S     +ITV+ K    + P+  + ++         E E  E SVE+    + +    W K+ +   E  P    I++      Y L++++    DA  Y + +       ESS  + VK     + K    I K L+   + K  + +F   I+ EPE V+              W  +   I A     I+   D  + L IP+A  K  G+YT++V N+ G  +SD       + E+ E+        P   + L++IEI   ++      +   P  ++ W K+ + +         KI  +   + L I  A+++D   Y  + +N  G  D++ A+ +V
Sbjct: 2907 FFKELSAIQVKETETAKFECKVSGTKPDV----KWFKDGTPLKEDKRVHFESTDDGTQRLVIEDSKTDDQGNYRIEVSNDAGVANSKVPLTVVPSETLKIKKGLTDVNVTQ-----GTKILLSVEVEGKP-KTVK---WYKGTETVTSSQTTKIVQVTESEYKLEIESA--EMSDTGAYRVVLSTDSFSVESSATV--TVTKAAEKISLPSFKKGL------ADQSVPKGTPLVLEVEI-EGKPKDVK----WYKNGDEIKDGKVE-DLGNGKYRLTIPDFQEKDVGEYSVT----AANEAGEIE-----SKAKVNVSAKPEIVSGLVPTTVKQGETATFNVKVKG-PVKGVKW------YKNGKEIPDAKT--KDNGDGSYSLEIPNAQVEDAADYKVVVSNDAGDADSSAALTVKLADDGKDKVKPEIVSGLIPTTVKQGETATFNVKVKGPVKQ--VKWYKNGKEIPNAKA------KDNGDGSYSLEIPNAQLDDTADYKVVVSNDAGDADSS-AALTVKLPGIAIVKGL-EDAEVPKGKKAVLQVETN-KKPKEIKWYKNGKEITPSDKAQPGSDGDNKPQLVIPDAGDDDAAEYKVVLTDEDGNTADSSCALTVK-------LPAKEPKIIKGLEDQ--VVSIGSPIKLEIETSGSPK-TVKWYKNGKELPGAAAKTIKIQKIDDNKYV-LEIPS-SVVEDTGDYKVEVANEAGSANSSGKITVEPKI-TFLKPLKDQSIT---------EGENAEFSVETNTKPRIVK---WYKNGQ---EIKPNSRFIIEQKTDTKYQLVIKNAVRDDADTYKIVLENTAGEAESSAQLTVKKAKAGLCK----IVKGLEDQVVAKGAKMVFEVKIQGEPEDVR--------------WLRDANVISAGANAIIEKIDDTTYRLIIPSADLKDAGEYTVEVINESGKAKSDA------KGEVDEK--------PEIVRGLENIEIPEGDDDVFKVEVSA-PVRQVKWYKNDQEIKPNSHLEAKKIGPK--KYELAINRAQLDDGADYKVVLSNAAGDCDSSAALTVV 3850          

HSP 11 Score: 68.1662 bits (165), Expect = 1.839e-10
Identity = 157/732 (21.45%), Postives = 287/732 (39.21%), Query Frame = 2
Query: 4394 LLIDSVKLEDSGTYICQGF-------TNKELISE--CKITLNVVD------------NISDTLQCQVKFEKDKYS-IEINQDVTM----RALIEC---TSTHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNS-------STARTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCS-NNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGMVD-GKLLELVHFTV----QVNP-----IQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMPFGDPCVL-----DNPFIDLYIESPQVNEHSGLYKCIVTNEKS-ETEFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLKIN------ESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAI-WFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDG-ETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRIIVKP 6406
            L I + K ED G Y C+         TN +L  +   K+  +V D             + DT   +    +     +E+ +  T+    +A+++C         + W   G+ +EM + + ++ K++G +  L   N  ++  G Y C  EN+ G++        T      ++    D L  V   + +T G    LE     +     +W K+  +   ++ +     +     LT   A++ D   Y+ E   + G +   V  TV    QV P     + +I   +    K  C+     +S +KP              ++W ++  P  +   +     D+    L IE  + ++  G Y+  V+N+       V +TV      V S  L   +   + +VN  +  KI LSVE     K++    W K  + +  +     + +    Y L +   +M+D G Y + ++      ESS  + V          TK   K + +P  KK L D  +   P+      EVE  G  K + W+   +EI    +E +    +  + LTIP   EK  G+Y++  AN+ G + S  ++++  + EI   ++ +               +   E    N ++   P   + W K+G E  D+K  +      +   +++L I  A+VED+  Y  + +N  G   + A + V     K +D  +  VKP
Sbjct: 2631 LTIQNAKKEDVGAYRCEAVNVAGKANTNADLKIQFAAKVEEHVTDESGQLEEIGQFETVGDTASSKTDTGRGAPEFVELLRSCTVTEKQQAILKCKVKGEPRPKIKWTKEGKEVEMSARVRAEHKDDGTLT-LTFDNVTQADAGEYRCEAENEYGSAWTEGPIIVTLEGAPKIDGEAPDFLQPVKPAV-VTVGETAVLEGKISGKPKPSVKWYKNGEELKPSDRVKIENLDDGTQRLTVTNAKLDDMDEYRCEASNEFGDVWSDVTLTVKEPAQVAPGFFKELSAIQVKETETAKFECK-----VSGTKP-------------DVKWFKDGTPLKEDKRVHFESTDDGTQRLVIEDSKTDDQ-GNYRIEVSNDAGVANSKVPLTV------VPSETL--KIKKGLTDVNVTQGTKILLSVEVEGKPKTVK---WYKGTETVTSSQTTKIVQVTESEYKLEIESAEMSDTGAYRVVLSTDSFSVESSATVTV----------TKAAEK-ISLPSFKKGLADQSV---PKGTPLVLEVEIEGKPKDVKWYKNGDEIKDGKVEDL---GNGKYRLTIPDFQEKDVGEYSVTAANEAGEIESKAKVNVSAKPEIVSGLVPTT--------------VKQGETATFNVKVKG-PVKGVKWYKNGKEIPDAKTKD------NGDGSYSLEIPNAQVEDAADYKVVVSNDAGDADSSAALTV-----KLADDGKDKVKP 3287          

HSP 12 Score: 66.2402 bits (160), Expect = 8.502e-10
Identity = 85/362 (23.48%), Postives = 148/362 (40.88%), Query Frame = 2
Query: 5333 YKCIVTNE-KSETEFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQP--FCYNLILRDVKMTDAGMYSLKIN------ESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFI-QWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDE---FPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVI-IVTDSEPKE 6376
            YK I TN   + T   +IT K     V +P+  + L  T   V   E+ K+E+ V    P        W KD+K ++E D    +   P    + L+++    TDAG Y+ K +      ESS +               E+ ++L+ P   + L    ++   ET      V+        W  + + +  ++   I +      +++TI  A  +  GKY  +  N  G  +++   +++              + P F +KL  +E+  KE+  L+ +++  P+P + W KD    D+      V ++ +     +F+L I +A   D G Y C   N  G   T A   I+ DS P E
Sbjct: 2052 YKAIATNSIGTATSTSKITTK-----VEAPVFEQGLKKT--SVKEKEEIKMEVKVGGSAP-----DVEWFKDDKPVSE-DGNHEMKKNPETGVFTLVVKQAATTDAGKYTAKASNPAGTAESSAEA--------------EVTQSLEKPTFVRELVTTEVKIN-ETATLSVTVKGVPDPSVEWLKDGQPVQTDSSHVIAKVEGSGSYSITIKDARLEDSGKYACRATNPAGEAKTEANFAVV-----------KNLVPPEFVEKLSPLEVKEKESTTLSVKVVGTPEPSVEWFKD----DTPISIDNVHVIQKQTAVGSFSLTINDARQGDVGIYSCRARNEAGEALTTANFGIIRDSIPPE 2370          

HSP 13 Score: 64.6994 bits (156), Expect = 2.400e-9
Identity = 174/820 (21.22%), Postives = 297/820 (36.22%), Query Frame = 2
Query: 4085 LEIAHCQLSDSGQYKI-CFNPLEASKCGKVTGLFLVSIAPIKKNLKPID-----SNIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNNNLSF-LLIDSVKLEDSGTYICQGFTNKELISECKITLNVVDNISDTLQCQVKFEKDKYSIEINQDVTMRALIECTSTHY-SVSWFFNGEILEM-KSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCS--NNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGM-VDGKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMP--FGDPC---VLDNPFIDLYIESPQVNEHSGLYKCIVTN-------------------------------EKSETEFVEITVKFK-DEKVVSPILGELL-SCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLKI--------NESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILD-EFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSE 6367
            + I   +L DSG+Y     NP   +K       F V      KNL P +     S +E    ES TL V V G  +  ++W   +  +  D +     + QK     SF L I+  +  D G Y C+    +    E   T N    I D++  +  F +    +E+ +  T+   +    T   +V WF + + + +  S I +  + +G    L I+       G+Y C   N+ G + T       E I+        K  E+ +G    L V  E + + + +W KD +  +  N  +           L        D G Y  +     GK   +    +     +   T +E +   I    E    +   +++  +V       I++ +ND P   G      VL++  I L I++ +  E  G Y+C   N                               E  + E V  T   K D    +P   ELL SCTV E       K +  ++ +V  +      W K+ K +  +              L   +V   DAG Y  +          E  + + ++  PK           + + P   +P++   +    ET   E ++         W+   EE+   +   I+   D    LT+  A      +Y  + +N+ G V SD  L++           E   +AP F K+L  I++   E  +  C+ +   KP + W KDG  L     ++RV     +     L+I +++ +D G Y    +N  G   ++  + V  SE
Sbjct: 2232 ITIKDARLEDSGKYACRATNPAGEAK---TEANFAVV-----KNLVPPEFVEKLSPLEVKEKESTTLSVKVVGTPEPSVEWFKDDTPISIDNV----HVIQKQTAVGSFSLTINDARQGDVGIYSCRA---RNEAGEALTTANF-GIIRDSIPPE--FTQKLRPLEVREQETLDLKVTVIGTPVPNVEWFKDDKPINIDNSHIFAKDEGSGHHT-LTIKQARGEDVGVYTCKATNEAGEAKTTANMAVQEEIEAPLFVQGLKPYEVEQGKPAELVVRVEGKPEPEVKWFKDGVPIAIDNQHVIEKKGENGSHTLVIKDTNNADFGKYTCQATNKAGKDETVGELKIPKYSFEK-QTAEEVKPLFIEPLKETFAVEGDTVVLECKVNKESHPQIKFFKNDQPVEIGQHMQLEVLEDGNIKLTIQNAK-KEDVGAYRCEAVNVAGKANTNADLKIQFAAKVEEHVTDESGQLEEIGQFETVGDTASSKTDTGRGAPEFVELLRSCTVTE-------KQQAILKCKVKGEPRPKIKWTKEGKEVEMSARVRAEHKDDGTLTLTFDNVTQADAGEYRCEAENEYGSAWTEGPIIVTLEGAPK----------IDGEAPDFLQPVKPAVV-TVGETAVLEGKISGKPKPSVKWYKNGEELKPSDRVKIENLDDGTQRLTVTNAKLDDMDEYRCEASNEFGDVWSDVTLTVK----------EPAQVAPGFFKELSAIQVKETETAKFECK-VSGTKPDVKWFKDGTPLKE---DKRVHFESTDDGTQRLVIEDSKTDDQGNYRIEVSNDAGVANSKVPLTVVPSE 2998          

HSP 14 Score: 62.003 bits (149), Expect = 1.604e-8
Identity = 61/272 (22.43%), Postives = 112/272 (41.18%), Query Frame = 2
Query: 5531 VWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYS-LKINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKP------LQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLG 6325
             W KD+  L+E +       +   + + +  V++TD G Y+ +  NE              +  T   F+ LK+ +   P      L+D   + E + + FE EVE     + +W  +++ +   +   +Q+       L I  A     G YT+++ N+ G + S   L +    + +        +AP F   ++ +E    E +R    +  DP P+I+W  +G+ L     + +VK + E     L I +      G   C G+N LG
Sbjct:  107 TWYKDDVQLHEDERHTFYSDEDGFFAMTIDPVQVTDTGRYTCMATNEYG------------QASTSAFFRVLKVEKEAAPPAFVTKLRDKECK-EGDVIDFECEVEGWPEPELVWLVDDQPLRPSHDFRLQYDGQTA-KLEIRDAQPDDTGVYTVKIQNEFGSIESKAELFVQADPDKNH-------VAPEFQATIEYVECDEGEEVRFKSVITGDPNPEIIWFINGKPLSE---SEKVKFISEDGICILTIKDVTRHFDGMVTCQGSNRLG 354          

HSP 15 Score: 60.4622 bits (145), Expect = 4.377e-8
Identity = 94/384 (24.48%), Postives = 157/384 (40.89%), Query Frame = 2
Query: 5282 FIDLYIESPQVNEHSGLYKCIVTNEKSETEFVEITVKFKDEKVVSP--ILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNET-DPRLTIIMQPFCYNLILRDVKMTDAGMYSLKIN------ESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEI-DAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRIIVK 6403
            F  + I+  QV + +G Y C+ TNE  +          K EK  +P   + +L     +E + I+    E  VE   P   +   VWL D++ L  + D RL    Q     L +RD +  D G+Y++KI       ES  ++ V+  P           KN   P+ +  ++ +   +E E V+F+  +      + IWF   + + ++E ++FI  S D    LTI        G  T Q +N +G    DGRL + +               P F K L+D  +  K  +     +   P+P + +T  G+ L +      +   D F   ++  T  +  D G       N  G   + A + V + E +ES S+   +K
Sbjct:  130 FFAMTIDPVQVTD-TGRYTCMATNEYGQASTSAFFRVLKVEKEAAPPAFVTKLRDKECKEGDVID---FECEVEG-WPEPEL---VWLVDDQPLRPSHDFRLQYDGQ--TAKLEIRDAQPDDTGVYTVKIQNEFGSIESKAELFVQADPD----------KNHVAPEFQATIEYVEC-DEGEEVRFKSVITGDPNPEIIWFINGKPLSESEKVKFI--SEDGICILTIKDVTRHFDGMVTCQGSNRLGSASCDGRLKVRVPP-----------APPTFNKPLEDKTVQEKSTVVFEVDVSGWPEPTLTFTLCGKELKNGEEGVEIVGHDGFYRISIPNTSMDKHD-GEIVAKAQNEHGTAESRARLTV-EQEEEESRSAPTFLK 477          

HSP 16 Score: 58.5362 bits (140), Expect = 1.756e-7
Identity = 40/179 (22.35%), Postives = 79/179 (44.13%), Query Frame = 2
Query: 9050 LSQKAELKFTKLMEYKLDKITWTFNNAKVDVNDERYKIFSAETYGIY-FIIKNLEEDDFGEYCA-----LDEVQDPIQSFILIKSDAPTILNCLPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIFSSYRTVITEDKEQGTYSLLISKCILSDGGEYSIRAENAIGFAEVKFNLRV 9568
            + +K E+K    +      + W F + K    D  +++      G++  ++K     D G+Y A         +   ++ +    + PT +  L    + ++E  ++SV +   P P V W ++ + + +    VI + +  G+YS+ I    L D G+Y+ RA N  G A+ + N  V
Sbjct: 2087 VKEKEEIKMEVKVGGSAPDVEW-FKDDKPVSEDGNHEMKKNPETGVFTLVVKQAATTDAGKYTAKASNPAGTAESSAEAEVTQSLEKPTFVRELVTTEVKINETATLSVTVKGVPDPSVEWLKDGQPVQTDSSHVIAKVEGSGSYSITIKDARLEDSGKYACRATNPAGEAKTEANFAV 2264          

HSP 17 Score: 56.6102 bits (135), Expect = 5.907e-7
Identity = 39/138 (28.26%), Postives = 64/138 (46.38%), Query Frame = 2
Query: 5957 CGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEP 6370
             GKYT  V N  G    +  L+++   E   +       AP F   L+D    + E + L C+++ +PKPK+ W  D +T+  + +   V+ ++     T  IT +E+   G+Y C+  N  G   TEA + V    P
Sbjct: 1846 AGKYTCIVENTAGKDTCEATLTVIESLEKKSEKK-----APEFIVALQDKTTKTSEKVVLECKVIGEPKPKVSWLHDNKTITQESIT--VESVEGVERVT--ITSSELSHQGKYTCIAENTEGTSKTEAFLTVQGEAP 1974          

HSP 18 Score: 56.225 bits (134), Expect = 7.221e-7
Identity = 84/362 (23.20%), Postives = 144/362 (39.78%), Query Frame = 2
Query: 5327 GLYKCIVTNEKSETEF-----VEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVE-SRVPTKSIDSAVWLKDEKLLNETDPRLTI-IMQPFCYNLILRDVKMTDAGMYSL-------KINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPN--FTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDS 6364
            G+Y C+  NE  + E      VEI    ++EK         ++  +E+      + I LS +   +P  S+   VW KD   L   D R +I   +     L + D    D G Y          IN +S  + VKV  + ++K+ +E F         K L D++  +  ++   +  V      +  W+   + +       I+ S D   +LT+  +     G Y  +  N  G  ++     + +    +E+        P F  +L D+ +     I L C++   P P + W+KDG  L     + R +  +E     + L I  A V D G Y C+ TN  G  TT++ + + D 
Sbjct: 4233 GVYMCVAVNELGQAETQATYQVEILEHVEEEKRRE--YAPKINPPLEDKTVNGGQPIRLSCKVDAIPRASV---VWYKDGLPLR-ADSRTSIQYEEDGTATLAINDSTEEDIGAYRCVATNAHGTIN-TSCSVNVKVPKQEVKKEGEEPF-------FTKGLVDLWA-DRGDSFTLKCAVTGDPFPEIKWYRNGQLLRNGPRTVIETSPDGSCSLTVNESTMSDEGIYRCEAENAHGKAKTQATAHVQMALGKTEKPKMDEGKPPKFILELSDMSVSLGNVIDLECKVTGLPNPSVKWSKDGGPL---IEDSRFEWSNEASKGVYQLRIKNATVHDEGTYRCVATNENGSATTKSFVRMDDG 4576          

HSP 19 Score: 55.8398 bits (133), Expect = 1.052e-6
Identity = 208/1044 (19.92%), Postives = 402/1044 (38.51%), Query Frame = 2
Query: 3362 WFVNNELLDFKKWNGSVNVSESQVEINFPKSTNELSGIWQFRIDKPMKLFSPEISVNV-LAKEVAPLSTGFLDCEIEEIDLKIGETLSLTLNAKDIPIMTLKNGGWFLNSEPIHAVKFRGNEVIEENKVKIVIPNVTKEFSGLLQYRIVKPVELYSPEIIIKIRGSLIKQTPKIEEEKFESNLILELHNVSLNISENERILLEAKIISGNINSYKTPPQWFWNDEAVKNINCKKDFTSNLAQLEIAHCQLSDSGQYKICFNPLEASKCGKVTGLFLVSIAPIKKNLKP--IDSNIETC--PGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNNNLSFLL-IDSVKLEDSGTYICQGFTNKELISECKITLNVVDNISDTLQCQVKFE-----KDKYSIEINQDVTMRALIECTSTHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVTKNIE---ITEGNELNLEV-VSEIEKDLQFQWSKDDIDCSNNGIFNSTK-NKNCFNLTKLKAEITDSGVYKFEGMVDGKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMPFGDPCVLDNPFI---------DLYIESPQVNEHSGLYKCIVTNEKSETEF-VEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLK-INESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAI-WFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRIIVKPL 6409
            W+   E +   +    V V+ES+ ++     + E+S    +R+      FS E S  V + K    +S       + +  +  G  L L +  +  P    K+  W+ N + I   K    E +   K ++ IP+  ++  G  +Y +    E    E   K+    +   P+I      S L      V   + + E      K+  G +   K    W+ N + + +   K +   + + LEI + Q+ D+  YK+  +  +A        L +      K  +KP  +   I T    GE+ T  V V+G  K+ +KW       K  K +   +   K N + S+ L I + +L+D+  Y       K ++S      N   +   +    VK       K     E+ +       +E       + W+ NG+ +   SD      +     +L I +  +     Y+ ++ ++DGN++ +   L V+    +    + K +E   ++ G+ + LE+  S   K +++  +  ++  +        K + N + L    + + D+G YK         +E+ +     N    I  T E ++  +    +  +++ +    SVE  N K  +++W +N    G     ++ FI          L I++  V + +  YK ++ N   E E   ++TVK     +   + G       +    + + KI+   E            WL+D  +++     +   +    Y LI+    + DAG Y+++ INES          K       E+ +    P+I + L++I I   PE     F+VE S   + + W+  ++EI   +    +      + L I  A       Y + ++N  G   S   L+++  + +                 LKD+++   + + L  ++   PK  I W K+G+ L       + +   E   F+L I  ++  D G Y  +  N  G   + +V+ V  ++  E  S    + PL
Sbjct: 3032 WYKGTETVTSSQTTKIVQVTESEYKLEI--ESAEMSDTGAYRVVLSTDSFSVESSATVTVTKAAEKISLPSFKKGLADQSVPKGTPLVLEVEIEGKP----KDVKWYKNGDEIKDGKV---EDLGNGKYRLTIPDFQEKDVG--EYSVTAANEAGEIESKAKVN---VSAKPEIV-----SGL------VPTTVKQGETATFNVKV-KGPVKGVK----WYKNGKEIPDAKTKDNGDGSYS-LEIPNAQVEDAADYKVVVS-NDAGDADSSAALTVKLADDGKDKVKPEIVSGLIPTTVKQGETATFNVKVKGPVKQ-VKW------YKNGKEIPNAKA--KDNGDGSYSLEIPNAQLDDTADY-------KVVVS------NDAGDADSSAALTVKLPGIAIVKGLEDAEVPKGKKAVLQVETNKKPKEIKWYKNGKEI-TPSDKAQPGSDGDNKPQLVIPDAGDDDAAEYKVVLTDEDGNTADSSCALTVKLPAKEP--KIIKGLEDQVVSIGSPIKLEIETSGSPKTVKWYKNGKELPGAAAKTIKIQKIDDNKYVLEIPSSVVEDTGDYK---------VEVANEAGSANSSGKI--TVEPKITFLKPLKDQSITEGENAEFSVET-NTKPRIVKWYKN----GQEIKPNSRFIIEQKTDTKYQLVIKN-AVRDDADTYKIVLENTAGEAESSAQLTVKKAKAGLCKIVKGLEDQVVAKGAKMVFEVKIQGEPED---------VRWLRDANVISAGANAIIEKIDDTTYRLIIPSADLKDAGEYTVEVINESG---------KAKSDAKGEVDEK---PEIVRGLENIEI---PEGDDDVFKVEVSAPVRQVKWYKNDQEIKPNSHLEAKKIGPKKYELAINRAQLDDGADYKVVLSNAAGDCDSSAALTVVKPNVLK------------IVDGLKDVDVEEPQPVELKVKVEGIPK-VIKWYKNGQELKPDADGFKFEEKPESGEFSLTIPSSKKSDGGAYRVVLGNDKGEVYSGSVVHVKSAKSSEPTSGANFLSPL 3964          

HSP 20 Score: 53.5286 bits (127), Expect = 4.589e-6
Identity = 128/612 (20.92%), Postives = 242/612 (39.54%), Query Frame = 2
Query: 4625 WFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNS-STARTELNVEN---IQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCSNNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGM----VDGKLLEL-VHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGV-IQWLRNDMPFGDP---CVLDNPFIDLYIESPQVN-EHSGLYKCIVTNEKSETEF-VEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVW-LKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLKINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRM-MCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRIIVKPL 6409
            W+ NG +LE   + ++ IKN    + L I N  +S +   E    N+ G+S S+A+  +N  +   I +D   SVT  I+ TE  E    +       ++  W+ ++     +    + K ++ + L    A+I  +G  K         D K  +L V   V+    +S LT             + +  + +PL  ++E+     G  + WL N  P        V+D+     ++   +   E SG       N   E E   ++TV   ++K       E +        T+E E ++ S  + V  K + +  W L ++KL+   + ++  + +    ++ ++   M   G   ++    S  +    + K        + K  ++P+    + D  ++ E E VKF   VE        W    E + +++        D    + I A   +  G+ + +  N +G  + D +L++           +    AP F K L+D  I   E   ++ ++ +  PKPKI W KDG  + S    + V+  +E  +  L I + ++ED GR      +  G     A + V    P    + +  + P+
Sbjct:  900 WYQNGNLLEDGKNGVT-IKNEENKSSLIIPNAQDSGKITVEA--SNEVGSSESSAQLTVNPPSTTPIVVDGPKSVT--IKETETAEFKATISGFPAPTVK--WTINEKIVEESRTITTIKTEDVYTLKISNAKIEQTGTVKVTAQNSAGQDSKQADLKVEPNVKAPKFKSQLT-------------DKVADEGEPLRWNLELDGPSPGTEVSWLLNGQPLTKSDTVQVVDHGDGTYHVTIAEAKPEMSGTLTAKAKNAAGECETSAKVTVNGGNKKP------EFVQAPQNHETTLE-ESVKFS--AIVTGKPMPNVTWYLNNKKLIQSEEVKVKYVHETGKTSIRIQKPLMEHNGTIRVEAENVSGKVQATAQLK--------VDKKTEVPKFTTNMDDRQVK-EGEDVKFTANVEGYPEPSVAWTLNGEPV-SKHPNITVTDKDGEHTIEISAVTPEQAGELSCEATNPVGSKKRDVQLAV-----------KKVGDAPTFAKNLEDRLITEGELTLMDAKLNIVKPKPKITWLKDGVEITSDGHYKIVE--EEDGSLKLSILQTKLEDKGRITIKAESEFGVAECSASLGVVKGRPMAKPAFQSDIAPI 1459          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: unc-89 (Muscle M-line assembly protein unc-89 [Source:UniProtKB/Swiss-Prot;Acc:O01761])

HSP 1 Score: 136.732 bits (343), Expect = 4.521e-31
Identity = 157/617 (25.45%), Postives = 269/617 (43.60%), Query Frame = 2
Query: 8714 ITLSWSPPRISPDLYIPFTVDVECRPVNYSYSDEEGWSVFKTNIKKNRVDIADLDPNINYQLRIVPVTDFGI-------------GKPSMVIKKIRRSDN---LNSPTTEKA--MMLQEKHCLAVPMFC--------CLSQKAELKFTKLMEYKLDKITWTFNNAKVDVND--ERYKIFSAETYGIYFIIKNLEEDDFGEY-C-ALDEVQDPIQSFILIKSDAPTILNCLPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIFSSYRTVITEDKEQGTY--SLLISKCILSDGGEYSIRAENAIGFAEVKFNLRVDAHPE-------KKSVQINIGDVNDRYYTMKK----LAKGSYSRCQIVIEKSTQIEFIGKFFEINNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIY-----EKLQGLS-LAEYITQLSHWC----ESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVPKEDFGSRRHM--GL------TSP-FSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQ--LYNEDS----NDAISN---SACVFIRKCLLLKTGERLTSSDSLSHEWF 10351
            +TLSW P + +P  Y   T  +E R +      E+ WS+ + NI +    + +L+   +YQ R+     +GI               P  V    RR++    L  P  EKA  M   E++  A P F         C           +  +    I W F    +D +    + K+++         I    +++ G+Y C A ++  D  Q+ ++  +  P  +  L N + +  +   + V++D +P PE+ W + W+ I  S R    +D   G Y  SL+I+  +  D G YS  A N  G A     + V+A  +       ++ V I    V + Y   +K     A+G+  R   V EK+T  EF+ +   I++  +   +     ++ H  IV++   +   D+ L L+        + GLS LA    +++       E+ VR+ + QL+ A+ ++H+ R+ HLD++PE I++    ++ LKL          DFG  R +  GL       SP F +PE+++  P+   +DMWS G+LT++ L G    + + D   L N DS    +  + N    A  F++K L      RLT  ++L H W 
Sbjct: 5572 LTLSWIPTKRAPPRYPQVTYVIEIREL-----PEKQWSLLEYNIPEPVCKVRNLELGKSYQFRVRAENIYGISDPSPASPPSRLMAPPQPVFD--RRTNKVIPLLDPYAEKALDMRYSEQYACA-PWFSPGVVEKRYCAENDTLTIVLNVSGFPDPDIKWKFRGWDIDTSSPTSKCKVYTYGGSETTLAITGFSKENVGQYQCFAKNDYGDAQQNIMVDLATRPNFIQPLVNKTFSSAQPMRMDVRVDGEPFPELKWMKEWRPIVESSRIKFVQD---GPYLCSLIINDPMWRDSGIYSCVAVNDAGQATTSCTVTVEAEGDYNDVELPRRRVTIESRRVRELYEISEKDEKLAAEGAPFR---VKEKATGREFLAQLRPIDDALMRHVDIH--NSLDHPGIVQMHRVLR--DEKLALVVFDNANSTIDGLSSLAHPGVEIAEPKGVNRETCVRVFVRQLLLALKHMHDLRIAHLDLRPETILL---QDDKLKLA---------DFGQARRLLRGLITGEIKGSPEFVSPEIVRSYPLTLATDMWSTGVLTYVLLTGLSPFHGDNDNETLANVDSCQFDSSPLGNFSYDAGDFVKKLLTEIPVSRLTVDEALDHPWI 6158          

HSP 2 Score: 92.0485 bits (227), Expect = 1.165e-17
Identity = 131/611 (21.44%), Postives = 246/611 (40.26%), Query Frame = 2
Query: 10622 PNDNSSEEVKSDRSETFPSADRLSVSNTTKELLFTVPLKDQTFKSDSTAGKITVTLTCQLSLLGSEPISISWYKNQELLTDDSRIKLEVIKGGFLSCTILN-ATETDVGIFRCIARCHSLRTETSARLVLGDVPPQPEQLSVYYTNQEEVLLKWSP-----YLSAIDDVIYRIDIRTIDSRNKIRNWKTIGYSVDNR-YLLENLDRTQQYIARIIAQNKYGYSPYSIATSVFQNKIRN-----IHSLKQALIFNRKWMLTSRQSNHFNDL--------------HDLIKDIS--SDDI-------------RMNVIREHYSTLSQKSSGFAVLKLKNTNVNFPEYIVQRTFKMEDICPAFDLCVRIKYYHFPILFGEICDSSLGNRITFEEFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFV-GTVKEQESLTTHKPSIFKAPEYRY-ESITRYESDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNT--NTLLLPVPHTHFRAPKLSMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWFKQDPQTIYEMEHQTISSTPL 12319
            P+  + E +K+D  +  P A + +  + T   +FT  L+D   + +  A        C +S   S    ++W    ++L  + R+ +E  +   ++  ILN A   D+G + C A       ++S RL+ G+ P +P +     ++  E+ ++W       YL  I    YR++ R     +    W T+   +D+   ++++L     Y  R+ AQN +G    S+++ + Q   +      I  LK  +  N   M   + +N    +               D+  ++   +DD              R +VIR+   + ++  +  AV     ++    EY   R  + E++     L       +F  L  E     + +R  F ++               Y+E  V   +RQ+   + FLH   + H ++ P  I+   ++ +S+ +KL+     Q V G VK  +  T      + +PE+   E+    +SD+W +G+++F LLA   P   +   + ++   V N   +  L+PV                S+    F   +LKKSP  R   D  L+H +   DP  +   E    S++ L
Sbjct: 6778 PSATAIERIKADIEKVTPCATKKN-DDGTFAPIFTARLRDVYLRKNQPA-----IFECAVS--ASPAPKVTWDFQGKILESNDRVTIE--QDNNVARLILNHAAPYDLGEYVCTAINEYGTDKSSCRLISGETPSRPGRPEAELSSDTEIFIQWEAPEGPTYLEGI---TYRLEYRVAGPNDHGDPWITVSEKIDDESVIVKHLSPLGIYQFRVTAQNGFGLGLPSLSSRIVQTHGKGAPKLQIDVLKSEIRLNVVSM-PQKSTNQLGGISEESEEDSEARTANEDMKSNLQLQTDDPTGRFQIGGLKFKGRFSVIRDAVDSTTEGHAHCAVKIRHPSSEAISEYESLRDGQHENVQ---RLIAAFNNSNFLYLLSERLYEDVFSRFVFNDY---------------YTEEQVALTMRQVTSALHFLHFKGIAHLDVNPHNIMF--QSKRSWVVKLVDFGRAQKVSGAVKPVDFDTK-----WASPEFHIPETPVTVQSDMWGMGVVTFCLLAGFHPFTSEYDREEEIKENVINVKCDPNLIPV--------------NASQECLSFATWALKKSPVRRMRTDEALSHKFLSSDPSMVRRRESIKYSASRL 7335          

HSP 3 Score: 84.3445 bits (207), Expect = 2.798e-15
Identity = 180/816 (22.06%), Postives = 331/816 (40.56%), Query Frame = 2
Query: 4013 QWFWNDEAVKNINCKKDFTSNLAQLEIAHCQLSDSGQYKICF--NPLEASKCGKVTGLFLVSIAPIKKNLKPIDSNIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNN--NLSFLLIDSVKLEDSGTY--ICQGFTNKELISECKITLNVV---DNISDTLQCQVKFEKDKYSIEINQDVTMRALIECTSTHYSVSWFFNGEIL---EMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCSNNGIFN-STKNKNCFNLTKLKAEITDSGVYKFEGMVDGKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLR--NDMPFGDPCVL---DNPFIDLYIESPQVNEHSGLYKCIVTNEKSETEFVEITVKFKDEKVVSPILGEL-----LSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLKINESSVD-----ILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAI-WFFENEEI--DAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETL--DSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTD 6361
            +W+ N + + N   K +   + + LEI + QL D+  YK+    +  +A     +T + L  IA I K L+    + E   G+   L V+      K+IKW       K  K +      Q  ++  N   L+I     +D+  Y  +          S C +T+ +      I   L+ QV        + I   + +   IE + +  +V W+ NG+ L     K+  +  I +N  + E+      ++  G Y+  + N+ G S+ +  ++ VE  +I  L  + K+  ITEG      V +  +  +  +W K+  +   N  F    K    + L    A   D+  YK        +LE      + +   ++        K++    + +++    ++  V++    + V +WLR  N +  G   ++   D+    L I S  + + +G Y   V NE                K  S   GE+     +   +E +   E +     VE   P + +    W K+++ +          + P  Y L +   ++ D   Y + ++ ++ D      L  V+P  ++              I   L+D+ +  EP+ V+ + +VE  G  K I W+   +E+  DA+  +F +      F+LTIP++ +   G Y + + ND G V S G +  +  ++ SE    +  ++PL     KD E+   + + L C +  +P P+++W KDG  L  D +   R    LD     TL I  A+  D G+Y     N  G  T++  + VT+
Sbjct: 3711 KWYKNGKEIPNAKAKDNGDGSYS-LEIPNAQLDDTADYKVVVSNDAGDADSSAALT-VKLPGIA-IVKGLE----DAEVPKGKKAVLQVETNK-KPKEIKW------YKNGKEITPSDKAQPGSDGDNKPQLVIPDAGDDDAAEYKVVLTDEDGNTADSSCALTVKLPAKEPKIIKGLEDQV--------VSIGSPIKLE--IETSGSPKTVKWYKNGKELPGAAAKTIKIQKIDDNKYVLEIPSSVVEDT--GDYKVEVANEAG-SANSSGKITVEP-KITFLKPL-KDQSITEGENAEFSVETNTKPRI-VKWYKNGQEIKPNSRFIIEQKTDTKYQLVIKNAVRDDADTYKI-------VLENTAGEAESSAQLTVKKAKAGLCKIVKGLEDQVVAKGAKMVFEVKIQGEPEDV-RWLRDANVISAGANAIIEKIDDTTYRLIIPSADLKD-AGEYTVEVINESG--------------KAKSDAKGEVDEKPEIVRGLENIEIPEGDDDVFKVEVSAPVRQVK---WYKNDQEIKPNSHLEAKKIGPKKYELAINRAQLDDGADYKVVLSNAAGDCDSSAALTVVKPNVLK--------------IVDGLKDVDV-EEPQPVELKVKVE--GIPKVIKWYKNGQELKPDADGFKFEEKPESGEFSLTIPSSKKSDGGAYRVVLGNDKGEVYS-GSVVHVKSAKSSEPTSGANFLSPL-----KDTEVEEGDMLTLQCTIAGEPFPEVIWEKDGVVLQKDDRITMRVA--LDG--TATLRIRSAKKSDIGQYRVTAKNEAGSATSDCKVTVTE 4443          

HSP 4 Score: 79.7221 bits (195), Expect = 6.186e-14
Identity = 167/756 (22.09%), Postives = 300/756 (39.68%), Query Frame = 2
Query: 4253 ESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNNNLSFLLIDSVKLEDSGTYICQGFTNKELISECKITLNVVDNIS---DTLQCQVKFEKDKYSIEINQDVTMRALIECT---STHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNS-------STARTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCS-NNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGMVD-GKLLELVHFTV----QVNP-----IQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMPFGDPCVL-----DNPFIDLYIESPQVNEHSGLYKCIVTNEKS-ETEFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLKIN------ESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAI-WFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDG-ETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRIIVKP 6406
            E V L   V G  K  + W      L  +K + ++ IT +    +  + I S +L   G Y C    N E  S+ +  L V D  S   DT +   +F +   S  + +    +A+++C         + W   G+ +EM + + ++ K++G +  L   N  ++  G Y C  EN+ G++        T      ++    D L  V   + +T G    LE     +     +W K+  +   ++ +     +     LT   A++ D   Y+ E   + G +   V  TV    QV P     + +I   +    K  C+     +S +KP              ++W ++  P  +   +     D+    L IE  + ++  G Y+  V+N+       V +TV      V S  L   +   + +VN  +  KI LSVE     K++    W K  + +  +     + +    Y L +   +M+D G Y + ++      ESS  + V          TK   K + +P  KK L D  +   P+      EVE  G  K + W+   +EI    +E +    +  + LTIP   EK  G+Y++  AN+ G + S  ++++  + EI   ++ +               +   E    N ++   P   + W K+G E  D+K  +      +   +++L I  A+VED+  Y  + +N  G   + A + V     K +D  +  VKP
Sbjct: 3009 EKVVLECKVIGEPKPKVSW------LHDNKTITQESITVESVEGVERVTITSSELSHQGKYTCIA-ENTEGTSKTEAFLTVQDTASSKTDTGRGAPEFVELLRSCTVTE--KQQAILKCKVKGEPRPKIKWTKEGKEVEMSARVRAEHKDDGTLT-LTFDNVTQADAGEYRCEAENEYGSAWTEGPIIVTLEGAPKIDGEAPDFLQPVKPAV-VTVGETAVLEGKISGKPKPSVKWYKNGEELKPSDRVKIENLDDGTQRLTVTNAKLDDMDEYRCEASNEFGDVWSDVTLTVKEPAQVAPGFFKELSAIQVKETETAKFECK-----VSGTKP-------------DVKWFKDGTPLKEDKRVHFESTDDGTQRLVIEDSKTDDQ-GNYRIEVSNDAGVANSKVPLTV------VPSETLK--IKKGLTDVNVTQGTKILLSVEVEGKPKTVK---WYKGTETVTSSQTTKIVQVTESEYKLEIESAEMSDTGAYRVVLSTDSFSVESSATVTV----------TKAAEK-ISLPSFKKGLADQSV---PKGTPLVLEVEIEGKPKDVKWYKNGDEIKDGKVEDL---GNGKYRLTIPDFQEKDVGEYSVTAANEAGEIESKAKVNVSAKPEIVSGLVPTT--------------VKQGETATFNVKVKG-PVKGVKWYKNGKEIPDAKTKD------NGDGSYSLEIPNAQVEDAADYKVVVSNDAGDADSSAALTV-----KLADDGKDKVKP 3680          

HSP 5 Score: 74.3294 bits (181), Expect = 2.540e-12
Identity = 62/273 (22.71%), Postives = 126/273 (46.15%), Query Frame = 2
Query: 9584 KKSVQINIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQ--IEFIGKFFEINNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVPKEDFGSRRHMGLTSPFSAPEL-LKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQLYNEDSNDAISNSACV-------FIRKCLLLKTG-------ERLTSSDSLSHEWF 10351
            K ++Q+   D   R+       KG +S  +  ++ +T+       K    ++  I  SE++ +++  H N+  +  A      +L L+ E+L     + ++    ++ E QV + + Q+  A+ +LH   + HLD+ P NI+   K + ++KL  F  A  ++  G+ + +   + +++PE  +   P+   SDMW +G++TF  L G      E D+   E+  + + N  C          ++CL   T         R+ + ++LSH++ 
Sbjct: 7051 KSNLQLQTDDPTGRFQIGGLKFKGRFSVIRDAVDSTTEGHAHCAVKIRHPSSEAI--SEYESLRDGQHENVQRLIAAFNN-SNFLYLLSERLYEDVFSRFVFN-DYYTEEQVALTMRQVTSALHFLHFKGIAHLDVNPHNIMFQSKRSWVVKLVDFGRA--QKVSGAVKPVDFDTKWASPEFHIPETPVTVQSDMWGMGVVTFCLLAGFHPFTSEYDR--EEEIKENVINVKCDPNLIPVNASQECLSFATWALKKSPVRRMRTDEALSHKFL 7315          

HSP 6 Score: 74.3294 bits (181), Expect = 2.929e-12
Identity = 169/795 (21.26%), Postives = 299/795 (37.61%), Query Frame = 2
Query: 4082 QLEIAHCQLSDSGQYKICFNPLEASKCGKVTGLFLVSIAP-IKKNLKPIDSNIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNNNLSFLLIDSVKLEDSGTY-ICQGFTNKELISECKIT------LNVVDNISDTLQCQVKFEKDKYSIEINQDVTMRALIECTSTHYSVSWFFNGEILEMKSD--ILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTA-----RTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCS-NNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGMVD-GKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMP--FGDPCVLDNPFIDLY-IESPQVNEHS-GLYKCIVTNEKSETEFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELS----VESRVPTKSIDSAVWLKDEK---------LLNETDPRLTIIMQPFCYNLILRDVKMTDAGMY-SLKINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNF--TLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIV 6355
            +L I    L D+G+Y +    +  S   K      V   P I + L+    NIE   G+     V+V    ++ +KW   + ++K +  L+ K+I  K       L I+  +L+D   Y +       +  S   +T      L +VD + D              +E  Q V ++  +E       + W+ NG+ L+  +D     +   +G+ + L I +  +S  G Y  ++ N  G   +      ++  + E        S  K+ E+ EG+ L L+     E   +  W KD +    ++ I           L    A+ +D G Y+     + G        TV     Q      + +  +  +    +  D K    +V+V    +  +QW  N +P  F D   LD+     Y +    V E   G  KCI  NE    E V    +F+          + L         + D +I +     +E  V         W KD K         + N  D    I + PF         + +D G+Y  + +NE             I +  +E  +    P+I  PL+D  + N  + ++   +V+       +W+ +   + A++   IQ+  D    L I  + E+  G Y     N  G + +    S  +  ++ +Q ++     P FTK L D+     ++  L C +  DP P+I W ++G+ L     N    +++  P+   +L + E+ + D G Y C   N  G   T+A   V
Sbjct: 4116 RLIIPSADLKDAGEYTVEV--INESGKAKSDAKGEVDEKPEIVRGLE----NIEIPEGDDDVFKVEVSAPVRQ-VKWYKNDQEIKPNSHLEAKKIGPKKYE----LAINRAQLDDGADYKVVLSNAAGDCDSSAALTVVKPNVLKIVDGLKDV------------DVEEPQPVELKVKVEGIPK--VIKWYKNGQELKPDADGFKFEEKPESGEFS-LTIPSSKKSDGGAYRVVLGNDKGEVYSGSVVHVKSAKSSEPTSGANFLSPLKDTEVEEGDMLTLQCTIAGEPFPEVIWEKDGVVLQKDDRITMRVALDGTATLRIRSAKKSDIGQYRVTAKNEAGSATSDCKVTVTEQGEQP----SKPKFVIPLKTGAALPGDKKEF--NVKVRGLPKPTLQWFLNGIPIKFDDRITLDDMADGNYCLTIRDVREEDFGTLKCIAKNENGTDETV---CEFQQGAGHDDGSRDDLRYPPRFNVPLWDRRIPVGDPMFIECHVDANPTAEVEWFKDGKKIEHTAHTEIRNTVDGACRIKIIPF---------EESDIGVYMCVAVNELGQAETQATYQVEILEHVEEEKRREYAPKINPPLEDKTV-NGGQPIRLSCKVDAIPRASVVWYKDGLPLRADSRTSIQYEEDGTATLAINDSTEEDIGAYRCVATNAHGTINT----SCSVNVKVPKQEVKKEGEEPFFTKGLVDLWADRGDSFTLKCAVTGDPFPEIKWYRNGQLL----RNGPRTVIETSPDGSCSLTVNESTMSDEGIYRCEAENAHGKAKTQATAHV 4857          

HSP 7 Score: 71.633 bits (174), Expect = 1.655e-11
Identity = 79/309 (25.57%), Postives = 132/309 (42.72%), Query Frame = 2
Query: 5534 WLKDEK---------LLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLKINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKI-LDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVT-DSEPKESDSSRIIVKPLCAPVLT 6427
            WLKD K         +   T P   I  +     L+L +V   DAG Y+  +  ++     +     I    K+  K  K P+    LQD   +   E V  E +V      K  W  +N+ I  E++     S +    +TI ++   H GKYT    N  G  +++  L++    + +    ++   AP F + L+   +  K+   L C++  +P+PKI WTK+G+ ++   ++ RV+    +    TL        D+G Y C   N  G   TE  IIVT +  PK    +   ++P+   V+T
Sbjct: 2920 WLKDGKEIELIARIRVQTRTGPEGHITQE-----LVLDNVTPEDAGKYTCIVENTAGKDTCEATLTVIESLEKKSEK--KAPEFIVALQDKTTKTS-EKVVLECKVIGEPKPKVSWLHDNKTITQESITV--ESVEGVERVTITSSELSHQGKYTCIAENTEGTSKTEAFLTVQ---DTASSKTDTGRGAPEFVELLRSCTVTEKQQAILKCKVKGEPRPKIKWTKEGKEVE---MSARVRAEHKDDGTLTLTFDNVTQADAGEYRCEAENEYGSAWTEGPIIVTLEGAPKIDGEAPDFLQPVKPAVVT 3212          

HSP 8 Score: 70.8626 bits (172), Expect = 3.428e-11
Identity = 116/503 (23.06%), Postives = 200/503 (39.76%), Query Frame = 2
Query: 4919 WSKDDIDCSNN--GIFNSTKNKNCFNLTKLKAEITDSGVY------KFEGMVDGKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMPFGDP----CVLDNPFIDLYIESPQVNEHSGLYKCIVTNEKSETEF-VEITVKFK-DEKVVSPILGELLSCTVEEVNTIEDEKIEL-SVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMY----SLKINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFE--NEEI--DAENMEFIQWSCDNYFALTIP-AAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIV 6355
            W KDD+    +    F S ++   F +T    ++TD+G Y      ++          ++    +  P   +    +      C++ ++I           EV  W +  + WL +D P           D     L I   Q ++ +G+Y   + NE    E   E+ V+   D+  V+P        T+E V   E E++   SV +  P   I   +W  + K L+E++    I     C  L ++DV     GM     S ++  +S D  +KVR  P              P   KPL+D  ++ +   V   FEV+ SG  +    F    +E+    E +E +    D ++ ++IP  + +KH G+   +  N+ G   S  RL++       EQ  E    AP F K ++D  + + E       +  +P P++ W  +G  +D       VKI     +  L I  A+   +G   C   N +G   T+A ++V
Sbjct:  581 WYKDDVQLHEDERHTFYSDED-GFFAMTIDPVQVTDTGRYTCMATNEYGQASTSAFFRVLKVEKEAAPPAFVTKLRDKE----CKEGDVI-------DFECEVEGWPEPELVWLVDDQPLRPSHDFRLQYDGQTAKLEIRDAQPDD-TGVYTVKIQNEFGSIESKAELFVQADPDKNHVAP----EFQATIEYVECDEGEEVRFKSVITGDPNPEI---IWFINGKPLSESEKVKFISEDGICI-LTIKDVTRHFDGMVTCQGSNRLGSASCDGRLKVRVPPA------------PPTFNKPLEDKTVQEKSTVV---FEVDVSGWPEPTLTFTLCGKELKNGEEGVEIV--GHDGFYRISIPNTSMDKHDGEIVAKAQNEHGTAESRARLTV-------EQEEEESRSAPTFLKDIEDQTVKTGEFAVFETTVRGNPNPEVTWFINGHKMDQGSPG--VKIEAHNHDHKLTIDSAQY--AGTVLCRAENAVGRFETKARLVV 1034          

HSP 9 Score: 70.0922 bits (170), Expect = 4.672e-11
Identity = 225/1066 (21.11%), Postives = 428/1066 (40.15%), Query Frame = 2
Query: 3260 FFTNLKQIETISGENLHVQFKAYNIVLDTLKKGSWFVNNELLDFKKWNGSVNVSESQVEINFPKSTNELSGIWQFRIDKPMKLFSPEISVNVLAKEVAPLSTGFLDCEIEEIDLKIGETLSLTLNAKDIPIMTLKNGGWFLNSEPIHAVKFRGNEVIEENKVKIVIPNVTKEFSGLLQYRIVKPVELYSPEIIIKIRGSLIKQTPKIEEEKFESNLILELHNVSLNISENERILLEAKIISGNINSYKTPPQWFWNDEAVKNINCKKDFTSNLAQLEIAHCQLSDSGQYKICFNPLEASKCGKVTGLFLVSIAPIKKNLKP--IDSNIETC--PGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNNNLSFLL-IDSVKLEDSGTY-ICQGFTNKELISECKITLNVVDNISDTLQCQVKFEKDKYSIEINQDVTMRALIECTSTHYSVSWFFNG-EILEMKSDILSDIKNNGKIA-ELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKD--DIDCSNNGIFNSTKNKNCFNLTKLKAEITDSGVYKFE-GMVDGKLLEL-VHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRN--DMPFGDPCVL------DNPFIDLYIESPQVNEHSGLYKCIVTNEK-SETEFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFC---YNLILRDVKMTDAGMYSLKIN------ESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIF---IRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGY-DTTEAVIIV 6355
            FF  L  I+    E    + K      D      WF +   L   K     +  +    +    S  +  G ++  +     + + ++ + V+  E   +  G  D  + +     G  + L++  +  P  T+K   W+  +E + + +      + E++ K+ I +   E S    YR+V   + +S E    +  ++ K   KI    F+  L         ++ +   ++LE +I  G     K    W+ N + +K+   + D  +   +L I   Q  D G+Y +      A++ G++      S A +  + KP  +   + T    GE+ T  V V+G   K +KW       K  K + + +   K N + S+ L I + ++ED+  Y +       +  S   +T+ + D+  D ++ ++       +++  +  T    ++       V W+ NG EI   K+      K+NG  +  L+I N        Y+ ++ N  G++ ++   L V+   I  +  + ++ E+ +G +  L+V +  +K  + +W K+  +I  S+     S  + N   L    A   D+  YK      DG   +     TV+       L   E ++    ED   ++S   P+ + +E     +  ++W +N  ++P      +      DN ++ L I S  V E +G YK  V NE  S     +ITV+ K    + P+  + ++         E E  E SVE+    + +    W K+ +   E  P    I++      Y L++++    DA  Y + +       ESS  + VK     + K    I K L+   + K  + +F   I+ EPE V+              W  +   I A     I+   D  + L IP+A  K  G+YT++V N+ G  +SD       + E+ E+        P   + L++IEI   ++      +   P  ++ W K+ + +         KI  +   + L I  A+++D   Y  + +N  G  D++ A+ +V
Sbjct: 3300 FFKELSAIQVKETETAKFECKVSGTKPDV----KWFKDGTPLKEDKRVHFESTDDGTQRLVIEDSKTDDQGNYRIEVSNDAGVANSKVPLTVVPSETLKIKKGLTDVNVTQ-----GTKILLSVEVEGKP-KTVK---WYKGTETVTSSQTTKIVQVTESEYKLEIESA--EMSDTGAYRVVLSTDSFSVESSATV--TVTKAAEKISLPSFKKGL------ADQSVPKGTPLVLEVEI-EGKPKDVK----WYKNGDEIKDGKVE-DLGNGKYRLTIPDFQEKDVGEYSVTA----ANEAGEIE-----SKAKVNVSAKPEIVSGLVPTTVKQGETATFNVKVKG-PVKGVKW------YKNGKEIPDAKT--KDNGDGSYSLEIPNAQVEDAADYKVVVSNDAGDADSSAALTVKLADDGKDKVKPEIVSGLIPTTVKQGETATFNVKVKGPVKQ--VKWYKNGKEIPNAKA------KDNGDGSYSLEIPNAQLDDTADYKVVVSNDAGDADSS-AALTVKLPGIAIVKGL-EDAEVPKGKKAVLQVETN-KKPKEIKWYKNGKEITPSDKAQPGSDGD-NKPQLVIPDAGDDDAAEYKVVLTDEDGNTADSSCALTVK-------LPAKEPKIIKGLEDQ--VVSIGSPIKLEIETSGSPK-TVKWYKNGKELPGAAAKTIKIQKIDDNKYV-LEIPS-SVVEDTGDYKVEVANEAGSANSSGKITVEPKI-TFLKPLKDQSIT---------EGENAEFSVETNTKPRIVK---WYKNGQ---EIKPNSRFIIEQKTDTKYQLVIKNAVRDDADTYKIVLENTAGEAESSAQLTVKKAKAGLCK----IVKGLEDQVVAKGAKMVFEVKIQGEPEDVR--------------WLRDANVISAGANAIIEKIDDTTYRLIIPSADLKDAGEYTVEVINESGKAKSDA------KGEVDEK--------PEIVRGLENIEIPEGDDDVFKVEVSA-PVRQVKWYKNDQEIKPNSHLEAKKIGPK--KYELAINRAQLDDGADYKVVLSNAAGDCDSSAALTVV 4243          

HSP 10 Score: 69.707 bits (169), Expect = 6.107e-11
Identity = 64/235 (27.23%), Postives = 105/235 (44.68%), Query Frame = 2
Query: 5792 EPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDG--------RLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFT--LIITEAEVEDSGRYCCLGTNFLGYDTT--EAVIIVTDSEPKESDSS-RIIVKPLCAPVLTAEYSKGADVI 6457
            E + +K E +V+ S   + +W+ +   +   +   I  S D    L IP+      G Y +   N  G  +  G        R S   RS  +++ +     AP   + L++I I  K++ RL C+   DPKP I W KDGE +       R++++ E P+    L++  A  +D+G Y C+  N  G   T  +  +I  D +P++ DSS R    P     LT   +K  D +
Sbjct: 4994 EGQPLKLECKVDASPLPEMVWYKDGAIVTPSDRIQISLSPDGVATLLIPSCVYDDDGIYRVIATNPSGTAQDKGTATVKKLPRDSGARRS--ADRDVFDANKAPKLMEPLENIRIPEKQSFRLRCKFSGDPKPTIKWFKDGERV---FPYGRLQLI-ESPDGVCELVVDSATRQDAGGYRCVAENTYGSARTSCDVNVIRGDRKPRDIDSSIREGKAPGFTTPLTIRRAKPGDSV 5222          

HSP 11 Score: 59.6918 bits (143), Expect = 6.445e-8
Identity = 94/384 (24.48%), Postives = 157/384 (40.89%), Query Frame = 2
Query: 5282 FIDLYIESPQVNEHSGLYKCIVTNEKSETEFVEITVKFKDEKVVSP--ILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNET-DPRLTIIMQPFCYNLILRDVKMTDAGMYSLKIN------ESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEI-DAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRIIVK 6403
            F  + I+  QV + +G Y C+ TNE  +          K EK  +P   + +L     +E + I+    E  VE   P   +   VWL D++ L  + D RL    Q     L +RD +  D G+Y++KI       ES  ++ V+  P           KN   P+ +  ++ +   +E E V+F+  +      + IWF   + + ++E ++FI  S D    LTI        G  T Q +N +G    DGRL + +               P F K L+D  +  K  +     +   P+P + +T  G+ L +      +   D F   ++  T  +  D G       N  G   + A + V + E +ES S+   +K
Sbjct:  603 FFAMTIDPVQVTD-TGRYTCMATNEYGQASTSAFFRVLKVEKEAAPPAFVTKLRDKECKEGDVID---FECEVEG-WPEPEL---VWLVDDQPLRPSHDFRLQYDGQ--TAKLEIRDAQPDDTGVYTVKIQNEFGSIESKAELFVQADPD----------KNHVAPEFQATIEYVEC-DEGEEVRFKSVITGDPNPEIIWFINGKPLSESEKVKFI--SEDGICILTIKDVTRHFDGMVTCQGSNRLGSASCDGRLKVRVPP-----------APPTFNKPLEDKTVQEKSTVVFEVDVSGWPEPTLTFTLCGKELKNGEEGVEIVGHDGFYRISIPNTSMDKHD-GEIVAKAQNEHGTAESRARLTV-EQEEEESRSAPTFLK 950          

HSP 12 Score: 56.225 bits (134), Expect = 7.480e-7
Identity = 206/1044 (19.73%), Postives = 399/1044 (38.22%), Query Frame = 2
Query: 3362 WFVNNELLDFKKWNGSVNVSESQVEINFPKSTNELSGIWQFRIDKPMKLFSPEISVNV-LAKEVAPLSTGFLDCEIEEIDLKIGETLSLTLNAKDIPIMTLKNGGWFLNSEPIHAVKFRGNEVIEENKVKIVIPNVTKEFSGLLQYRIVKPVELYSPEIIIKIRGSLIKQTPKIEEEKFESNLILELHNVSLNISENERILLEAKIISGNINSYKTPPQWFWNDEAVKNINCKKDFTSNLAQLEIAHCQLSDSGQYKICFNPLEASKCGKVTGLFLVSIAPIKKNLKP--IDSNIETC--PGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNNNLSFLL-IDSVKLEDSGTYICQGFTNKELISECKITLNVVDNISDTLQCQVKFE-----KDKYSIEINQDVTMRALIECTSTHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVTKNIE---ITEGNELNLEV-VSEIEKDLQFQWSKDDIDCSNNGIFNSTK-NKNCFNLTKLKAEITDSGVYKFEGMVDGKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMPFGDPCVLDNPFI---------DLYIESPQVNEHSGLYKCIVTNEKSETEF-VEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLK-INESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAI-WFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRIIVKPL 6409
            W+   E +   +    V V+ES+ ++     + E+S    +R+      FS E S  V + K    +S       + +  +  G  L L +  +  P    K+  W+ N + I   K    E +   K ++ IP+  ++  G  +Y +    E    E   K+    +   P+I      S L      V   + + E      K+  G +   K    W+ N + + +   K +   + + LEI + Q+ D+  YK+  +  +A        L +      K  +KP  +   I T    GE+ T  V V+G  K+ +KW       K  K +   +   K N + S+ L I + +L+D+  Y               +  N   +   +    VK       K     E+ +       +E       + W+ NG+ +   SD      +     +L I +  +     Y+ ++ ++DGN++ +   L V+    +    + K +E   ++ G+ + LE+  S   K +++  +  ++  +        K + N + L    + + D+G YK         +E+ +     N    I  T E ++  +    +  +++ +    SVE  N K  +++W +N    G     ++ FI          L I++  V + +  YK ++ N   E E   ++TVK     +   + G       +    + + KI+   E            WL+D  +++     +   +    Y LI+    + DAG Y+++ INES          K       E+ +    P+I + L++I I   PE     F+VE S   + + W+  ++EI   +    +      + L I  A       Y + ++N  G   S   L+++  + +                 LKD+++   + + L  ++   PK  I W K+G+ L       + +   E   F+L I  ++  D G Y  +  N  G   + +V+ V  ++  E  S    + PL
Sbjct: 3425 WYKGTETVTSSQTTKIVQVTESEYKLEI--ESAEMSDTGAYRVVLSTDSFSVESSATVTVTKAAEKISLPSFKKGLADQSVPKGTPLVLEVEIEGKP----KDVKWYKNGDEIKDGKV---EDLGNGKYRLTIPDFQEKDVG--EYSVTAANEAGEIESKAKVN---VSAKPEIV-----SGL------VPTTVKQGETATFNVKV-KGPVKGVK----WYKNGKEIPDAKTKDNGDGSYS-LEIPNAQVEDAADYKVVVS-NDAGDADSSAALTVKLADDGKDKVKPEIVSGLIPTTVKQGETATFNVKVKGPVKQ-VKW------YKNGKEIPNAKA--KDNGDGSYSLEIPNAQLDDTADYKV-------------VVSNDAGDADSSAALTVKLPGIAIVKGLEDAEVPKGKKAVLQVETNKKPKEIKWYKNGKEI-TPSDKAQPGSDGDNKPQLVIPDAGDDDAAEYKVVLTDEDGNTADSSCALTVKLPAKEP--KIIKGLEDQVVSIGSPIKLEIETSGSPKTVKWYKNGKELPGAAAKTIKIQKIDDNKYVLEIPSSVVEDTGDYK---------VEVANEAGSANSSGKI--TVEPKITFLKPLKDQSITEGENAEFSVET-NTKPRIVKWYKN----GQEIKPNSRFIIEQKTDTKYQLVIKN-AVRDDADTYKIVLENTAGEAESSAQLTVKKAKAGLCKIVKGLEDQVVAKGAKMVFEVKIQGEPED---------VRWLRDANVISAGANAIIEKIDDTTYRLIIPSADLKDAGEYTVEVINESG---------KAKSDAKGEVDEK---PEIVRGLENIEI---PEGDDDVFKVEVSAPVRQVKWYKNDQEIKPNSHLEAKKIGPKKYELAINRAQLDDGADYKVVLSNAAGDCDSSAALTVVKPNVLK------------IVDGLKDVDVEEPQPVELKVKVEGIPK-VIKWYKNGQELKPDADGFKFEEKPESGEFSLTIPSSKKSDGGAYRVVLGNDKGEVYSGSVVHVKSAKSSEPTSGANFLSPL 4357          

HSP 13 Score: 55.8398 bits (133), Expect = 1.054e-6
Identity = 84/362 (23.20%), Postives = 144/362 (39.78%), Query Frame = 2
Query: 5327 GLYKCIVTNEKSETEF-----VEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVE-SRVPTKSIDSAVWLKDEKLLNETDPRLTI-IMQPFCYNLILRDVKMTDAGMYSL-------KINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPN--FTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDS 6364
            G+Y C+  NE  + E      VEI    ++EK         ++  +E+      + I LS +   +P  S+   VW KD   L   D R +I   +     L + D    D G Y          IN +S  + VKV  + ++K+ +E F         K L D++  +  ++   +  V      +  W+   + +       I+ S D   +LT+  +     G Y  +  N  G  ++     + +    +E+        P F  +L D+ +     I L C++   P P + W+KDG  L     + R +  +E     + L I  A V D G Y C+ TN  G  TT++ + + D 
Sbjct: 4626 GVYMCVAVNELGQAETQATYQVEILEHVEEEKRRE--YAPKINPPLEDKTVNGGQPIRLSCKVDAIPRASV---VWYKDGLPLR-ADSRTSIQYEEDGTATLAINDSTEEDIGAYRCVATNAHGTIN-TSCSVNVKVPKQEVKKEGEEPF-------FTKGLVDLWA-DRGDSFTLKCAVTGDPFPEIKWYRNGQLLRNGPRTVIETSPDGSCSLTVNESTMSDEGIYRCEAENAHGKAKTQATAHVQMALGKTEKPKMDEGKPPKFILELSDMSVSLGNVIDLECKVTGLPNPSVKWSKDGGPL---IEDSRFEWSNEASKGVYQLRIKNATVHDEGTYRCVATNENGSATTKSFVRMDDG 4969          

HSP 14 Score: 53.9138 bits (128), Expect = 3.576e-6
Identity = 138/651 (21.20%), Postives = 257/651 (39.48%), Query Frame = 2
Query: 4472 ECKITLNVVDNISDTLQCQVKFEKDKYSIEINQ-DVTMRALIECTSTHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNS-STARTELNVEN---IQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCSNNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGM----VDGKLLEL-VHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGV-IQWLRNDMPFGDP---CVLDNPFIDLYIESPQVN-EHSGLYKCIVTNEKSETEF-VEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVW-LKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLKINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRM-MCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEP 6370
            E K  L V++   +T + +  F      +E+ + D     +I   S  Y   W+ NG +LE   + ++ IKN    + L I N  +S +   E    N+ G+S S+A+  +N  +   I +D   SVT  I+ TE  E    +       ++  W+ ++     +    + K ++ + L    A+I  +G  K         D K  +L V   V+    +S LT             + +  + +PL  ++E+     G  + WL N  P        V+D+     ++   +   E SG       N   E E   ++TV   ++K       E +        T+E E ++ S  + V  K + +  W L ++KL+   + ++  + +    ++ ++   M   G   ++    S  +    + K        + K  ++P+    + D  ++ E E VKF   VE        W    E + +++        D    + I A   +  G+ + +  N +G  + D +L++           +    AP F K L+D  I   E   ++ ++ +  PKPKI W KDG  + S    + V+  +E  +  L I + ++ED GR      +  G     A + V    P
Sbjct: 1965 ETKTELKVLETPKETKKPE--FTDKLRDMEVTKGDTVQMDVIALHSPLYK--WYQNGNLLEDGKNGVT-IKNEENKSSLIIPNAQDSGKITVEA--SNEVGSSESSAQLTVNPPSTTPIVVDGPKSVT--IKETETAEFKATISGFPAPTVK--WTINEKIVEESRTITTIKTEDVYTLKISNAKIEQTGTVKVTAQNSAGQDSKQADLKVEPNVKAPKFKSQLT-------------DKVADEGEPLRWNLELDGPSPGTEVSWLLNGQPLTKSDTVQVVDHGDGTYHVTIAEAKPEMSGTLTAKAKNAAGECETSAKVTVNGGNKKP------EFVQAPQNHETTLE-ESVKFS--AIVTGKPMPNVTWYLNNKKLIQSEEVKVKYVHETGKTSIRIQKPLMEHNGTIRVEAENVSGKVQATAQLK--------VDKKTEVPKFTTNMDDRQVK-EGEDVKFTANVEGYPEPSVAWTLNGEPV-SKHPNITVTDKDGEHTIEISAVTPEQAGELSCEATNPVGSKKRDVQLAV-----------KKVGDAPTFAKNLEDRLITEGELTLMDAKLNIVKPKPKITWLKDGVEITSDGHYKIVE--EEDGSLKLSILQTKLEDKGRITIKAESEFGVAECSASLGVVKGRP 2559          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: unc-89 (Muscle M-line assembly protein unc-89 [Source:UniProtKB/Swiss-Prot;Acc:O01761])

HSP 1 Score: 136.346 bits (342), Expect = 4.752e-31
Identity = 157/617 (25.45%), Postives = 269/617 (43.60%), Query Frame = 2
Query: 8714 ITLSWSPPRISPDLYIPFTVDVECRPVNYSYSDEEGWSVFKTNIKKNRVDIADLDPNINYQLRIVPVTDFGI-------------GKPSMVIKKIRRSDN---LNSPTTEKA--MMLQEKHCLAVPMFC--------CLSQKAELKFTKLMEYKLDKITWTFNNAKVDVND--ERYKIFSAETYGIYFIIKNLEEDDFGEY-C-ALDEVQDPIQSFILIKSDAPTILNCLPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIFSSYRTVITEDKEQGTY--SLLISKCILSDGGEYSIRAENAIGFAEVKFNLRVDAHPE-------KKSVQINIGDVNDRYYTMKK----LAKGSYSRCQIVIEKSTQIEFIGKFFEINNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIY-----EKLQGLS-LAEYITQLSHWC----ESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVPKEDFGSRRHM--GL------TSP-FSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQ--LYNEDS----NDAISN---SACVFIRKCLLLKTGERLTSSDSLSHEWF 10351
            +TLSW P + +P  Y   T  +E R +      E+ WS+ + NI +    + +L+   +YQ R+     +GI               P  V    RR++    L  P  EKA  M   E++  A P F         C           +  +    I W F    +D +    + K+++         I    +++ G+Y C A ++  D  Q+ ++  +  P  +  L N + +  +   + V++D +P PE+ W + W+ I  S R    +D   G Y  SL+I+  +  D G YS  A N  G A     + V+A  +       ++ V I    V + Y   +K     A+G+  R   V EK+T  EF+ +   I++  +   +     ++ H  IV++   +   D+ L L+        + GLS LA    +++       E+ VR+ + QL+ A+ ++H+ R+ HLD++PE I++    ++ LKL          DFG  R +  GL       SP F +PE+++  P+   +DMWS G+LT++ L G    + + D   L N DS    +  + N    A  F++K L      RLT  ++L H W 
Sbjct: 6270 LTLSWIPTKRAPPRYPQVTYVIEIREL-----PEKQWSLLEYNIPEPVCKVRNLELGKSYQFRVRAENIYGISDPSPASPPSRLMAPPQPVFD--RRTNKVIPLLDPYAEKALDMRYSEQYACA-PWFSPGVVEKRYCAENDTLTIVLNVSGFPDPDIKWKFRGWDIDTSSPTSKCKVYTYGGSETTLAITGFSKENVGQYQCFAKNDYGDAQQNIMVDLATRPNFIQPLVNKTFSSAQPMRMDVRVDGEPFPELKWMKEWRPIVESSRIKFVQD---GPYLCSLIINDPMWRDSGIYSCVAVNDAGQATTSCTVTVEAEGDYNDVELPRRRVTIESRRVRELYEISEKDEKLAAEGAPFR---VKEKATGREFLAQLRPIDDALMRHVDIH--NSLDHPGIVQMHRVLR--DEKLALVVFDNANSTIDGLSSLAHPGVEIAEPKGVNRETCVRVFVRQLLLALKHMHDLRIAHLDLRPETILL---QDDKLKLA---------DFGQARRLLRGLITGEIKGSPEFVSPEIVRSYPLTLATDMWSTGVLTYVLLTGLSPFHGDNDNETLANVDSCQFDSSPLGNFSYDAGDFVKKLLTEIPVSRLTVDEALDHPWI 6856          

HSP 2 Score: 98.5969 bits (244), Expect = 1.366e-19
Identity = 171/766 (22.32%), Postives = 303/766 (39.56%), Query Frame = 2
Query: 4283 GFSKKDIKWKVLEDDLKQDKILQE---KRITQKFNNNLSFLLIDSVKLEDSGTYICQGFTNKELISECKITLNVVDNISDTLQCQVKFEKDKYSIEINQDVTMRALIECTSTHYSVSWFFNGEILEM-KSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDD--IDCSNNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGMVD-GKLLELVHFTVQVNPIQSILTTDESRLK-LICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMPFGDPCVLDNPFI----------DLYIESPQVNEHSGLYKCIVTNEKSETEF-VEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDE-KLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLK-INESSVDILV---KVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSC--DNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCI-----------------------APLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKI-LDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVT-DSEPKESDSSRIIVKPLCAPVLT 6427
            G S  D++W       K DK + E     + +     +  L++      D+G Y  +  +N    +E      V  ++      +   E     ++IN+  T+   ++      SV W  +G+ ++   S +++ ++ +G  + + I++      G Y C   N  G + T      V+N+           +E+ E     L V      +   +W KDD  I   N  +         F+LT   A   D G+Y      + G+ L   +F +  + I    T    +L+ L   + E +  D K  +I   V N     ++W ++D P      +DN  I           L I+  +  E  G+Y C  TNE  E +    + V+   E++ +P+  + L     E    + +  EL V  RV  K      W KD   +  +    +    +   + L+++D    D G Y+ +  N++  D  V   K+      KQT E  K L I    +PL++ F   E +TV  E +V +  +   I FF+N++   E  + +Q     D    LTI  A ++  G Y  +  N  G   ++  L +   +++ E + +                           AP F + L+   +  K+   L C++  +P+PKI WTK+G+ ++   ++ RV+    +    TL        D+G Y C   N  G   TE  IIVT +  PK    +   ++P+   V+T
Sbjct: 3191 GGSAPDVEW------FKDDKPVSEDGNHEMKKNPETGVFTLVVKQAATTDAGKYTAKA-SNPAGTAESSAEAEVTQSLEKPTFVR---ELVTTEVKINETATLSVTVKGVPDP-SVEWLKDGQPVQTDSSHVIAKVEGSGSYS-ITIKDARLEDSGKYACRATNPAGEAKTEANFAVVKNLVPPEFVEKLSPLEVKEKESTTLSVKVVGTPEPSVEWFKDDTPISIDNVHVIQKQTAVGSFSLTINDARQGDVGIYSCRARNEAGEALTTANFGIIRDSIPPEFT---QKLRPLEVREQETL--DLKVTVIGTPVPN-----VEWFKDDKPIN----IDNSHIFAKDEGSGHHTLTIKQAR-GEDVGVYTCKATNEAGEAKTTANMAVQ---EEIEAPLFVQGLKPYEVE----QGKPAELVV--RVEGKPEPEVKWFKDGVPIAIDNQHVIEKKGENGSHTLVIKDTNNADFGKYTCQATNKAGKDETVGELKIPKYSFEKQTAEEVKPLFI----EPLKETFAV-EGDTVVLECKVNKE-SHPQIKFFKNDQ-PVEIGQHMQLEVLEDGNIKLTIQNAKKEDVGAYRCEAVNVAGKANTNADLKIQFAAKVEEHVTDESGQLEEIGQFETVGDTASSKTDTGRGAPEFVELLRSCTVTEKQQAILKCKVKGEPRPKIKWTKEGKEVE---MSARVRAEHKDDGTLTLTFDNVTQADAGEYRCEAENEYGSAWTEGPIIVTLEGAPKIDGEAPDFLQPVKPAVVT 3910          

HSP 3 Score: 92.0485 bits (227), Expect = 1.263e-17
Identity = 131/611 (21.44%), Postives = 246/611 (40.26%), Query Frame = 2
Query: 10622 PNDNSSEEVKSDRSETFPSADRLSVSNTTKELLFTVPLKDQTFKSDSTAGKITVTLTCQLSLLGSEPISISWYKNQELLTDDSRIKLEVIKGGFLSCTILN-ATETDVGIFRCIARCHSLRTETSARLVLGDVPPQPEQLSVYYTNQEEVLLKWSP-----YLSAIDDVIYRIDIRTIDSRNKIRNWKTIGYSVDNR-YLLENLDRTQQYIARIIAQNKYGYSPYSIATSVFQNKIRN-----IHSLKQALIFNRKWMLTSRQSNHFNDL--------------HDLIKDIS--SDDI-------------RMNVIREHYSTLSQKSSGFAVLKLKNTNVNFPEYIVQRTFKMEDICPAFDLCVRIKYYHFPILFGEICDSSLGNRITFEEFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFV-GTVKEQESLTTHKPSIFKAPEYRY-ESITRYESDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNT--NTLLLPVPHTHFRAPKLSMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWFKQDPQTIYEMEHQTISSTPL 12319
            P+  + E +K+D  +  P A + +  + T   +FT  L+D   + +  A        C +S   S    ++W    ++L  + R+ +E  +   ++  ILN A   D+G + C A       ++S RL+ G+ P +P +     ++  E+ ++W       YL  I    YR++ R     +    W T+   +D+   ++++L     Y  R+ AQN +G    S+++ + Q   +      I  LK  +  N   M   + +N    +               D+  ++   +DD              R +VIR+   + ++  +  AV     ++    EY   R  + E++     L       +F  L  E     + +R  F ++               Y+E  V   +RQ+   + FLH   + H ++ P  I+   ++ +S+ +KL+     Q V G VK  +  T      + +PE+   E+    +SD+W +G+++F LLA   P   +   + ++   V N   +  L+PV                S+    F   +LKKSP  R   D  L+H +   DP  +   E    S++ L
Sbjct: 7476 PSATAIERIKADIEKVTPCATKKN-DDGTFAPIFTARLRDVYLRKNQPA-----IFECAVS--ASPAPKVTWDFQGKILESNDRVTIE--QDNNVARLILNHAAPYDLGEYVCTAINEYGTDKSSCRLISGETPSRPGRPEAELSSDTEIFIQWEAPEGPTYLEGI---TYRLEYRVAGPNDHGDPWITVSEKIDDESVIVKHLSPLGIYQFRVTAQNGFGLGLPSLSSRIVQTHGKGAPKLQIDVLKSEIRLNVVSM-PQKSTNQLGGISEESEEDSEARTANEDMKSNLQLQTDDPTGRFQIGGLKFKGRFSVIRDAVDSTTEGHAHCAVKIRHPSSEAISEYESLRDGQHENVQ---RLIAAFNNSNFLYLLSERLYEDVFSRFVFNDY---------------YTEEQVALTMRQVTSALHFLHFKGIAHLDVNPHNIMF--QSKRSWVVKLVDFGRAQKVSGAVKPVDFDTK-----WASPEFHIPETPVTVQSDMWGMGVVTFCLLAGFHPFTSEYDREEEIKENVINVKCDPNLIPV--------------NASQECLSFATWALKKSPVRRMRTDEALSHKFLSSDPSMVRRRESIKYSASRL 8033          

HSP 4 Score: 83.9593 bits (206), Expect = 3.378e-15
Identity = 180/816 (22.06%), Postives = 331/816 (40.56%), Query Frame = 2
Query: 4013 QWFWNDEAVKNINCKKDFTSNLAQLEIAHCQLSDSGQYKICF--NPLEASKCGKVTGLFLVSIAPIKKNLKPIDSNIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNN--NLSFLLIDSVKLEDSGTY--ICQGFTNKELISECKITLNVV---DNISDTLQCQVKFEKDKYSIEINQDVTMRALIECTSTHYSVSWFFNGEIL---EMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCSNNGIFN-STKNKNCFNLTKLKAEITDSGVYKFEGMVDGKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLR--NDMPFGDPCVL---DNPFIDLYIESPQVNEHSGLYKCIVTNEKSETEFVEITVKFKDEKVVSPILGEL-----LSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLKINESSVD-----ILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAI-WFFENEEI--DAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETL--DSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTD 6361
            +W+ N + + N   K +   + + LEI + QL D+  YK+    +  +A     +T + L  IA I K L+    + E   G+   L V+      K+IKW       K  K +      Q  ++  N   L+I     +D+  Y  +          S C +T+ +      I   L+ QV        + I   + +   IE + +  +V W+ NG+ L     K+  +  I +N  + E+      ++  G Y+  + N+ G S+ +  ++ VE  +I  L  + K+  ITEG      V +  +  +  +W K+  +   N  F    K    + L    A   D+  YK        +LE      + +   ++        K++    + +++    ++  V++    + V +WLR  N +  G   ++   D+    L I S  + + +G Y   V NE                K  S   GE+     +   +E +   E +     VE   P + +    W K+++ +          + P  Y L +   ++ D   Y + ++ ++ D      L  V+P  ++              I   L+D+ +  EP+ V+ + +VE  G  K I W+   +E+  DA+  +F +      F+LTIP++ +   G Y + + ND G V S G +  +  ++ SE    +  ++PL     KD E+   + + L C +  +P P+++W KDG  L  D +   R    LD     TL I  A+  D G+Y     N  G  T++  + VT+
Sbjct: 4409 KWYKNGKEIPNAKAKDNGDGSYS-LEIPNAQLDDTADYKVVVSNDAGDADSSAALT-VKLPGIA-IVKGLE----DAEVPKGKKAVLQVETNK-KPKEIKW------YKNGKEITPSDKAQPGSDGDNKPQLVIPDAGDDDAAEYKVVLTDEDGNTADSSCALTVKLPAKEPKIIKGLEDQV--------VSIGSPIKLE--IETSGSPKTVKWYKNGKELPGAAAKTIKIQKIDDNKYVLEIPSSVVEDT--GDYKVEVANEAG-SANSSGKITVEP-KITFLKPL-KDQSITEGENAEFSVETNTKPRI-VKWYKNGQEIKPNSRFIIEQKTDTKYQLVIKNAVRDDADTYKI-------VLENTAGEAESSAQLTVKKAKAGLCKIVKGLEDQVVAKGAKMVFEVKIQGEPEDV-RWLRDANVISAGANAIIEKIDDTTYRLIIPSADLKD-AGEYTVEVINESG--------------KAKSDAKGEVDEKPEIVRGLENIEIPEGDDDVFKVEVSAPVRQVK---WYKNDQEIKPNSHLEAKKIGPKKYELAINRAQLDDGADYKVVLSNAAGDCDSSAALTVVKPNVLK--------------IVDGLKDVDVE-EPQPVELKVKVE--GIPKVIKWYKNGQELKPDADGFKFEEKPESGEFSLTIPSSKKSDGGAYRVVLGNDKGEVYS-GSVVHVKSAKSSEPTSGANFLSPL-----KDTEVEEGDMLTLQCTIAGEPFPEVIWEKDGVVLQKDDRITMRVA--LDG--TATLRIRSAKKSDIGQYRVTAKNEAGSATSDCKVTVTE 5141          

HSP 5 Score: 74.3294 bits (181), Expect = 2.796e-12
Identity = 62/273 (22.71%), Postives = 127/273 (46.52%), Query Frame = 2
Query: 9584 KKSVQINIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQ--IEFIGKFFEINNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVPKEDFGSRRHMGLTSPFSAPEL-LKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQLYNEDSNDAISNSAC-------VFIRKCLLLKTG-------ERLTSSDSLSHEWF 10351
            K ++Q+   D   R+       KG +S  +  ++ +T+       K    ++  I  SE++ +++  H N+  +  A    + +L L+ E+L     + ++    ++ E QV + + Q+  A+ +LH   + HLD+ P NI+   K + ++KL  F  A  ++  G+ + +   + +++PE  +   P+   SDMW +G++TF  L G      E D+   E+  + + N  C          ++CL   T         R+ + ++LSH++ 
Sbjct: 7749 KSNLQLQTDDPTGRFQIGGLKFKGRFSVIRDAVDSTTEGHAHCAVKIRHPSSEAI--SEYESLRDGQHENVQRLIAAFNNSN-FLYLLSERLYEDVFSRFVFN-DYYTEEQVALTMRQVTSALHFLHFKGIAHLDVNPHNIMFQSKRSWVVKLVDFGRA--QKVSGAVKPVDFDTKWASPEFHIPETPVTVQSDMWGMGVVTFCLLAGFHPFTSEYDR--EEEIKENVINVKCDPNLIPVNASQECLSFATWALKKSPVRRMRTDEALSHKFL 8013          

HSP 6 Score: 73.559 bits (179), Expect = 4.284e-12
Identity = 169/795 (21.26%), Postives = 299/795 (37.61%), Query Frame = 2
Query: 4082 QLEIAHCQLSDSGQYKICFNPLEASKCGKVTGLFLVSIAP-IKKNLKPIDSNIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNNNLSFLLIDSVKLEDSGTY-ICQGFTNKELISECKIT------LNVVDNISDTLQCQVKFEKDKYSIEINQDVTMRALIECTSTHYSVSWFFNGEILEMKSD--ILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTA-----RTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCS-NNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGMVD-GKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMP--FGDPCVLDNPFIDLY-IESPQVNEHS-GLYKCIVTNEKSETEFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELS----VESRVPTKSIDSAVWLKDEK---------LLNETDPRLTIIMQPFCYNLILRDVKMTDAGMY-SLKINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNF--TLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIV 6355
            +L I    L D+G+Y +    +  S   K      V   P I + L+    NIE   G+     V+V    ++ +KW   + ++K +  L+ K+I  K       L I+  +L+D   Y +       +  S   +T      L +VD + D              +E  Q V ++  +E       + W+ NG+ L+  +D     +   +G+ + L I +  +S  G Y  ++ N  G   +      ++  + E        S  K+ E+ EG+ L L+     E   +  W KD +    ++ I           L    A+ +D G Y+     + G        TV     Q      + +  +  +    +  D K    +V+V    +  +QW  N +P  F D   LD+     Y +    V E   G  KCI  NE    E V    +F+          + L         + D +I +     +E  V         W KD K         + N  D    I + PF         + +D G+Y  + +NE             I +  +E  +    P+I  PL+D  + N  + ++   +V+       +W+ +   + A++   IQ+  D    L I  + E+  G Y     N  G + +    S  +  ++ +Q ++     P FTK L D+     ++  L C +  DP P+I W ++G+ L     N    +++  P+   +L + E+ + D G Y C   N  G   T+A   V
Sbjct: 4814 RLIIPSADLKDAGEYTVEV--INESGKAKSDAKGEVDEKPEIVRGLE----NIEIPEGDDDVFKVEVSAPVRQ-VKWYKNDQEIKPNSHLEAKKIGPKKYE----LAINRAQLDDGADYKVVLSNAAGDCDSSAALTVVKPNVLKIVDGLKDV------------DVEEPQPVELKVKVEGIPK--VIKWYKNGQELKPDADGFKFEEKPESGEFS-LTIPSSKKSDGGAYRVVLGNDKGEVYSGSVVHVKSAKSSEPTSGANFLSPLKDTEVEEGDMLTLQCTIAGEPFPEVIWEKDGVVLQKDDRITMRVALDGTATLRIRSAKKSDIGQYRVTAKNEAGSATSDCKVTVTEQGEQP----SKPKFVIPLKTGAALPGDKKEF--NVKVRGLPKPTLQWFLNGIPIKFDDRITLDDMADGNYCLTIRDVREEDFGTLKCIAKNENGTDETV---CEFQQGAGHDDGSRDDLRYPPRFNVPLWDRRIPVGDPMFIECHVDANPTAEVEWFKDGKKIEHTAHTEIRNTVDGACRIKIIPF---------EESDIGVYMCVAVNELGQAETQATYQVEILEHVEEEKRREYAPKINPPLEDKTV-NGGQPIRLSCKVDAIPRASVVWYKDGLPLRADSRTSIQYEEDGTATLAINDSTEEDIGAYRCVATNAHGTINT----SCSVNVKVPKQEVKKEGEEPFFTKGLVDLWADRGDSFTLKCAVTGDPFPEIKWYRNGQLL----RNGPRTVIETSPDGSCSLTVNESTMSDEGIYRCEAENAHGKAKTQATAHV 5555          

HSP 7 Score: 73.1738 bits (178), Expect = 6.788e-12
Identity = 200/875 (22.86%), Postives = 340/875 (38.86%), Query Frame = 2
Query: 3932 LNISENERILLEAKIISGNINSYKTPPQWFWNDEAVKNINCK---KDFTSNLAQLEIAHCQLSDSGQYKICFNPLEASKCGKVTGLFLVSI---API-KKNLKPIDSNIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNNNLSFLLIDSVKLEDSGTYICQGFTNK----ELISECKITLNVVDNISDTLQCQVKFEKDKYSIEINQDVTMRALIEC---TSTHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSST---------ARTELNV--ENIQI----------DCLNSVT-------------KNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCSNNG-IFNSTKNKNCFNLTKLKAEITDSGVYKFEGMVDGKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISV---EVLNWK-----QGVIQWLRN--DMPFGDPCV---LDNPFIDLYIESPQVNEHSGLYKCIVTNEKSETEFVEITVKFKDEKVVSP-ILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTI-IMQPFCYNLILRDVKMTDAGMYSLKINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAI-WFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSE-ISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVT 6358
            L + E E + L+  +I   + +     +WF +D+ +   N     KD  S    L I   +  D G Y  C    EA +  K T    V     AP+  + LKP     E   G+   L V VEG  + ++KW   +D +    I  +  I +K  N    L+I      D G Y CQ  TNK    E + E KI     +  +      +  E  K +  +  D     ++EC     +H  + +F N + +E+   +  ++  +G I +L IQN  +   G Y C   N  G ++T         A+ E +V  E+ Q+          D  +S T             ++  +TE  +  L+   + E   + +W+K+  +   +  +    K+     LT       D+G Y+ E        E  + +        I+ T E   K+  E  +  L   KP +++V    VL  K     +  ++W +N  ++   D      LD+    L + + ++++    Y+C  +NE  +  + ++T+  K+   V+P    EL +  V+E  T    K E  V    P        W KD   L E D R+           L++ D K  D G Y +++   S D  V     P+     E  K      IKK L D+   N  +  K    VE  G  K + W+   E + +     I    ++ + L I +A     G Y + ++ D   V S   +++   +E IS          P F K L D  +     + L   +   PK  + W K+G+ +     + +V+ L     + L I + + +D G Y     N  G   ++A + V+
Sbjct: 3469 LEVREQETLDLKVTVIGTPVPNV----EWFKDDKPINIDNSHIFAKDEGSGHHTLTIKQARGEDVGVY-TCKATNEAGEA-KTTANMAVQEEIEAPLFVQGLKPY----EVEQGKPAELVVRVEGKPEPEVKW--FKDGVPI-AIDNQHVIEKKGENGSHTLVIKDTNNADFGKYTCQA-TNKAGKDETVGELKIPKYSFEKQTAEEVKPLFIEPLKETFAVEGDT---VVLECKVNKESHPQIKFFKNDQPVEIGQHMQLEVLEDGNI-KLTIQNAKKEDVGAYRCEAVNVAGKANTNADLKIQFAAKVEEHVTDESGQLEEIGQFETVGDTASSKTDTGRGAPEFVELLRSCTVTEKQQAILKCKVKGEPRPKIKWTKEGKEVEMSARVRAEHKDDGTLTLTFDNVTQADAGEYRCEA-------ENEYGSAWTE--GPIIVTLEGAPKIDGEAPD-FLQPVKPAVVTVGETAVLEGKISGKPKPSVKWYKNGEELKPSDRVKIENLDDGTQRLTVTNAKLDDMD-EYRCEASNEFGDV-WSDVTLTVKEPAQVAPGFFKELSAIQVKETETA---KFECKVSGTKP-----DVKWFKDGTPLKE-DKRVHFESTDDGTQRLVIEDSKTDDQGNYRIEV---SNDAGVANSKVPLTVVPSETLK------IKKGLTDV---NVTQGTKILLSVEVEGKPKTVKWYKGTETVTSSQTTKIVQVTESEYKLEIESAEMSDTGAYRVVLSTDSFSVESSATVTVTKAAEKIS---------LPSFKKGLADQSVPKGTPLVLEVEIEGKPK-DVKWYKNGDEIK----DGKVEDLGNG-KYRLTIPDFQEKDVGEYSVTAANEAGEIESKAKVNVS 4277          

HSP 8 Score: 70.4774 bits (171), Expect = 3.868e-11
Identity = 116/503 (23.06%), Postives = 200/503 (39.76%), Query Frame = 2
Query: 4919 WSKDDIDCSNN--GIFNSTKNKNCFNLTKLKAEITDSGVY------KFEGMVDGKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMPFGDP----CVLDNPFIDLYIESPQVNEHSGLYKCIVTNEKSETEF-VEITVKFK-DEKVVSPILGELLSCTVEEVNTIEDEKIEL-SVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMY----SLKINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFE--NEEI--DAENMEFIQWSCDNYFALTIP-AAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIV 6355
            W KDD+    +    F S ++   F +T    ++TD+G Y      ++          ++    +  P   +    +      C++ ++I           EV  W +  + WL +D P           D     L I   Q ++ +G+Y   + NE    E   E+ V+   D+  V+P        T+E V   E E++   SV +  P   I   +W  + K L+E++    I     C  L ++DV     GM     S ++  +S D  +KVR  P              P   KPL+D  ++ +   V   FEV+ SG  +    F    +E+    E +E +    D ++ ++IP  + +KH G+   +  N+ G   S  RL++       EQ  E    AP F K ++D  + + E       +  +P P++ W  +G  +D       VKI     +  L I  A+   +G   C   N +G   T+A ++V
Sbjct:  581 WYKDDVQLHEDERHTFYSDED-GFFAMTIDPVQVTDTGRYTCMATNEYGQASTSAFFRVLKVEKEAAPPAFVTKLRDKE----CKEGDVI-------DFECEVEGWPEPELVWLVDDQPLRPSHDFRLQYDGQTAKLEIRDAQPDD-TGVYTVKIQNEFGSIESKAELFVQADPDKNHVAP----EFQATIEYVECDEGEEVRFKSVITGDPNPEI---IWFINGKPLSESEKVKFISEDGICI-LTIKDVTRHFDGMVTCQGSNRLGSASCDGRLKVRVPPAP------------PTFNKPLEDKTVQEKSTVV---FEVDVSGWPEPTLTFTLCGKELKNGEEGVEIV--GHDGFYRISIPNTSMDKHDGEIVAKAQNEHGTAESRARLTV-------EQEEEESRSAPTFLKDIEDQTVKTGEFAVFETTVRGNPNPEVTWFINGHKMDQGSPG--VKIEAHNHDHKLTIDSAQY--AGTVLCRAENAVGRFETKARLVV 1034          

HSP 9 Score: 69.707 bits (169), Expect = 6.390e-11
Identity = 64/235 (27.23%), Postives = 105/235 (44.68%), Query Frame = 2
Query: 5792 EPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDG--------RLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFT--LIITEAEVEDSGRYCCLGTNFLGYDTT--EAVIIVTDSEPKESDSS-RIIVKPLCAPVLTAEYSKGADVI 6457
            E + +K E +V+ S   + +W+ +   +   +   I  S D    L IP+      G Y +   N  G  +  G        R S   RS  +++ +     AP   + L++I I  K++ RL C+   DPKP I W KDGE +       R++++ E P+    L++  A  +D+G Y C+  N  G   T  +  +I  D +P++ DSS R    P     LT   +K  D +
Sbjct: 5692 EGQPLKLECKVDASPLPEMVWYKDGAIVTPSDRIQISLSPDGVATLLIPSCVYDDDGIYRVIATNPSGTAQDKGTATVKKLPRDSGARRS--ADRDVFDANKAPKLMEPLENIRIPEKQSFRLRCKFSGDPKPTIKWFKDGERV---FPYGRLQLI-ESPDGVCELVVDSATRQDAGGYRCVAENTYGSARTSCDVNVIRGDRKPRDIDSSIREGKAPGFTTPLTIRRAKPGDSV 5920          

HSP 10 Score: 69.707 bits (169), Expect = 6.608e-11
Identity = 225/1066 (21.11%), Postives = 428/1066 (40.15%), Query Frame = 2
Query: 3260 FFTNLKQIETISGENLHVQFKAYNIVLDTLKKGSWFVNNELLDFKKWNGSVNVSESQVEINFPKSTNELSGIWQFRIDKPMKLFSPEISVNVLAKEVAPLSTGFLDCEIEEIDLKIGETLSLTLNAKDIPIMTLKNGGWFLNSEPIHAVKFRGNEVIEENKVKIVIPNVTKEFSGLLQYRIVKPVELYSPEIIIKIRGSLIKQTPKIEEEKFESNLILELHNVSLNISENERILLEAKIISGNINSYKTPPQWFWNDEAVKNINCKKDFTSNLAQLEIAHCQLSDSGQYKICFNPLEASKCGKVTGLFLVSIAPIKKNLKP--IDSNIETC--PGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNNNLSFLL-IDSVKLEDSGTY-ICQGFTNKELISECKITLNVVDNISDTLQCQVKFEKDKYSIEINQDVTMRALIECTSTHYSVSWFFNG-EILEMKSDILSDIKNNGKIA-ELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKD--DIDCSNNGIFNSTKNKNCFNLTKLKAEITDSGVYKFE-GMVDGKLLEL-VHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRN--DMPFGDPCVL------DNPFIDLYIESPQVNEHSGLYKCIVTNEK-SETEFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFC---YNLILRDVKMTDAGMYSLKIN------ESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIF---IRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGY-DTTEAVIIV 6355
            FF  L  I+    E    + K      D      WF +   L   K     +  +    +    S  +  G ++  +     + + ++ + V+  E   +  G  D  + +     G  + L++  +  P  T+K   W+  +E + + +      + E++ K+ I +   E S    YR+V   + +S E    +  ++ K   KI    F+  L         ++ +   ++LE +I  G     K    W+ N + +K+   + D  +   +L I   Q  D G+Y +      A++ G++      S A +  + KP  +   + T    GE+ T  V V+G   K +KW       K  K + + +   K N + S+ L I + ++ED+  Y +       +  S   +T+ + D+  D ++ ++       +++  +  T    ++       V W+ NG EI   K+      K+NG  +  L+I N        Y+ ++ N  G++ ++   L V+   I  +  + ++ E+ +G +  L+V +  +K  + +W K+  +I  S+     S  + N   L    A   D+  YK      DG   +     TV+       L   E ++    ED   ++S   P+ + +E     +  ++W +N  ++P      +      DN ++ L I S  V E +G YK  V NE  S     +ITV+ K    + P+  + ++         E E  E SVE+    + +    W K+ +   E  P    I++      Y L++++    DA  Y + +       ESS  + VK     + K    I K L+   + K  + +F   I+ EPE V+              W  +   I A     I+   D  + L IP+A  K  G+YT++V N+ G  +SD       + E+ E+        P   + L++IEI   ++      +   P  ++ W K+ + +         KI  +   + L I  A+++D   Y  + +N  G  D++ A+ +V
Sbjct: 3998 FFKELSAIQVKETETAKFECKVSGTKPDV----KWFKDGTPLKEDKRVHFESTDDGTQRLVIEDSKTDDQGNYRIEVSNDAGVANSKVPLTVVPSETLKIKKGLTDVNVTQ-----GTKILLSVEVEGKP-KTVK---WYKGTETVTSSQTTKIVQVTESEYKLEIESA--EMSDTGAYRVVLSTDSFSVESSATV--TVTKAAEKISLPSFKKGL------ADQSVPKGTPLVLEVEI-EGKPKDVK----WYKNGDEIKDGKVE-DLGNGKYRLTIPDFQEKDVGEYSVTA----ANEAGEIE-----SKAKVNVSAKPEIVSGLVPTTVKQGETATFNVKVKG-PVKGVKW------YKNGKEIPDAKT--KDNGDGSYSLEIPNAQVEDAADYKVVVSNDAGDADSSAALTVKLADDGKDKVKPEIVSGLIPTTVKQGETATFNVKVKGPVKQ--VKWYKNGKEIPNAKA------KDNGDGSYSLEIPNAQLDDTADYKVVVSNDAGDADSS-AALTVKLPGIAIVKGL-EDAEVPKGKKAVLQVETN-KKPKEIKWYKNGKEITPSDKAQPGSDGD-NKPQLVIPDAGDDDAAEYKVVLTDEDGNTADSSCALTVK-------LPAKEPKIIKGLEDQ--VVSIGSPIKLEIETSGSPK-TVKWYKNGKELPGAAAKTIKIQKIDDNKYV-LEIPS-SVVEDTGDYKVEVANEAGSANSSGKITVEPKI-TFLKPLKDQSIT---------EGENAEFSVETNTKPRIVK---WYKNGQ---EIKPNSRFIIEQKTDTKYQLVIKNAVRDDADTYKIVLENTAGEAESSAQLTVKKAKAGLCK----IVKGLEDQVVAKGAKMVFEVKIQGEPEDVR--------------WLRDANVISAGANAIIEKIDDTTYRLIIPSADLKDAGEYTVEVINESGKAKSDA------KGEVDEK--------PEIVRGLENIEIPEGDDDVFKVEVSA-PVRQVKWYKNDQEIKPNSHLEAKKIGPK--KYELAINRAQLDDGADYKVVLSNAAGDCDSSAALTVV 4941          

HSP 11 Score: 69.3218 bits (168), Expect = 9.234e-11
Identity = 157/732 (21.45%), Postives = 287/732 (39.21%), Query Frame = 2
Query: 4394 LLIDSVKLEDSGTYICQGF-------TNKELISE--CKITLNVVD------------NISDTLQCQVKFEKDKYS-IEINQDVTM----RALIECT---STHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNS-------STARTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCS-NNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGMVD-GKLLELVHFTV----QVNP-----IQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMPFGDPCVL-----DNPFIDLYIESPQVNEHSGLYKCIVTNEKS-ETEFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLKIN------ESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAI-WFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDG-ETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRIIVKP 6406
            L I + K ED G Y C+         TN +L  +   K+  +V D             + DT   +    +     +E+ +  T+    +A+++C         + W   G+ +EM + + ++ K++G +  L   N  ++  G Y C  EN+ G++        T      ++    D L  V   + +T G    LE     +     +W K+  +   ++ +     +     LT   A++ D   Y+ E   + G +   V  TV    QV P     + +I   +    K  C+     +S +KP +             +W ++  P  +   +     D+    L IE  + ++  G Y+  V+N+       V +TV      V S  L   +   + +VN  +  KI LSVE     K++    W K  + +  +     + +    Y L +   +M+D G Y + ++      ESS  + V          TK   K + +P  KK L D  +   P+      EVE  G  K + W+   +EI    +E +    +  + LTIP   EK  G+Y++  AN+ G + S  ++++  + EI   ++ +               +   E    N ++   P   + W K+G E  D+K  +      +   +++L I  A+VED+  Y  + +N  G   + A + V     K +D  +  VKP
Sbjct: 3722 LTIQNAKKEDVGAYRCEAVNVAGKANTNADLKIQFAAKVEEHVTDESGQLEEIGQFETVGDTASSKTDTGRGAPEFVELLRSCTVTEKQQAILKCKVKGEPRPKIKWTKEGKEVEMSARVRAEHKDDGTLT-LTFDNVTQADAGEYRCEAENEYGSAWTEGPIIVTLEGAPKIDGEAPDFLQPVKPAV-VTVGETAVLEGKISGKPKPSVKWYKNGEELKPSDRVKIENLDDGTQRLTVTNAKLDDMDEYRCEASNEFGDVWSDVTLTVKEPAQVAPGFFKELSAIQVKETETAKFECK-----VSGTKPDV-------------KWFKDGTPLKEDKRVHFESTDDGTQRLVIEDSKTDDQ-GNYRIEVSNDAGVANSKVPLTV------VPSETL--KIKKGLTDVNVTQGTKILLSVEVEGKPKTVK---WYKGTETVTSSQTTKIVQVTESEYKLEIESAEMSDTGAYRVVLSTDSFSVESSATVTV----------TKAAEK-ISLPSFKKGLADQSV---PKGTPLVLEVEIEGKPKDVKWYKNGDEIKDGKVEDL---GNGKYRLTIPDFQEKDVGEYSVTAANEAGEIESKAKVNVSAKPEIVSGLVPTT--------------VKQGETATFNVKVKG-PVKGVKWYKNGKEIPDAKTKD------NGDGSYSLEIPNAQVEDAADYKVVVSNDAGDADSSAALTV-----KLADDGKDKVKP 4378          

HSP 12 Score: 66.2402 bits (160), Expect = 6.821e-10
Identity = 85/362 (23.48%), Postives = 148/362 (40.88%), Query Frame = 2
Query: 5333 YKCIVTNE-KSETEFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQP--FCYNLILRDVKMTDAGMYSLKIN------ESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFI-QWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDE---FPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVI-IVTDSEPKE 6376
            YK I TN   + T   +IT K     V +P+  + L  T   V   E+ K+E+ V    P        W KD+K ++E D    +   P    + L+++    TDAG Y+ K +      ESS +               E+ ++L+ P   + L    ++   ET      V+        W  + + +  ++   I +      +++TI  A  +  GKY  +  N  G  +++   +++              + P F +KL  +E+  KE+  L+ +++  P+P + W KD    D+      V ++ +     +F+L I +A   D G Y C   N  G   T A   I+ DS P E
Sbjct: 3143 YKAIATNSIGTATSTSKITTK-----VEAPVFEQGLKKT--SVKEKEEIKMEVKVGGSAP-----DVEWFKDDKPVSE-DGNHEMKKNPETGVFTLVVKQAATTDAGKYTAKASNPAGTAESSAEA--------------EVTQSLEKPTFVRELVTTEVKIN-ETATLSVTVKGVPDPSVEWLKDGQPVQTDSSHVIAKVEGSGSYSITIKDARLEDSGKYACRATNPAGEAKTEANFAVV-----------KNLVPPEFVEKLSPLEVKEKESTTLSVKVVGTPEPSVEWFKD----DTPISIDNVHVIQKQTAVGSFSLTINDARQGDVGIYSCRARNEAGEALTTANFGIIRDSIPPE 3461          

HSP 13 Score: 64.6994 bits (156), Expect = 2.075e-9
Identity = 172/819 (21.00%), Postives = 296/819 (36.14%), Query Frame = 2
Query: 4085 LEIAHCQLSDSGQYKICFNPLEASKCGKVTGLFLVSIAPIKKNLKPID-----SNIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNNNLSF-LLIDSVKLEDSGTYICQGFTNKELISECKITLNVVDNISDTLQCQVKFEKDKYSIEINQDVTMRALIECTSTHY-SVSWFFNGEILEM-KSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCS--NNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGM-VDGKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMP--FGDPC---VLDNPFIDLYIESPQVNEHSGLYKCIVTN-------------------------------EKSETEFVEITVKFK-DEKVVSPILGELL-SCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLKI--------NESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILD-EFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSE 6367
            + I   +L DSG+Y  C     A +        +V      KNL P +     S +E    ES TL V V G  +  ++W   +  +  D +     + QK     SF L I+  +  D G Y C+    +    E   T N    I D++  +  F +    +E+ +  T+   +    T   +V WF + + + +  S I +  + +G    L I+       G+Y C   N+ G + T       E I+        K  E+ +G    L V  E + + + +W KD +  +  N  +           L        D G Y  +     GK   +    +     +   T +E +   I    E    +   +++  +V       I++ +ND P   G      VL++  I L I++ +  E  G Y+C   N                               E  + E V  T   K D    +P   ELL SCTV E       K +  ++ +V  +      W K+ K +  +              L   +V   DAG Y  +          E  + + ++  PK           + + P   +P++   +    ET   E ++         W+   EE+   +   I+   D    LT+  A      +Y  + +N+ G V SD  L++           E   +AP F K+L  I++   E  +  C+ +   KP + W KDG  L     ++RV     +     L+I +++ +D G Y    +N  G   ++  + V  SE
Sbjct: 3323 ITIKDARLEDSGKY-ACRATNPAGEAKTEANFAVV------KNLVPPEFVEKLSPLEVKEKESTTLSVKVVGTPEPSVEWFKDDTPISIDNV----HVIQKQTAVGSFSLTINDARQGDVGIYSCRA---RNEAGEALTTANF-GIIRDSIPPE--FTQKLRPLEVREQETLDLKVTVIGTPVPNVEWFKDDKPINIDNSHIFAKDEGSGHHT-LTIKQARGEDVGVYTCKATNEAGEAKTTANMAVQEEIEAPLFVQGLKPYEVEQGKPAELVVRVEGKPEPEVKWFKDGVPIAIDNQHVIEKKGENGSHTLVIKDTNNADFGKYTCQATNKAGKDETVGELKIPKYSFEK-QTAEEVKPLFIEPLKETFAVEGDTVVLECKVNKESHPQIKFFKNDQPVEIGQHMQLEVLEDGNIKLTIQNAK-KEDVGAYRCEAVNVAGKANTNADLKIQFAAKVEEHVTDESGQLEEIGQFETVGDTASSKTDTGRGAPEFVELLRSCTVTE-------KQQAILKCKVKGEPRPKIKWTKEGKEVEMSARVRAEHKDDGTLTLTFDNVTQADAGEYRCEAENEYGSAWTEGPIIVTLEGAPK----------IDGEAPDFLQPVKPAVV-TVGETAVLEGKISGKPKPSVKWYKNGEELKPSDRVKIENLDDGTQRLTVTNAKLDDMDEYRCEASNEFGDVWSDVTLTVK----------EPAQVAPGFFKELSAIQVKETETAKFECK-VSGTKPDVKWFKDGTPLKE---DKRVHFESTDDGTQRLVIEDSKTDDQGNYRIEVSNDAGVANSKVPLTVVPSE 4089          

HSP 14 Score: 59.6918 bits (143), Expect = 7.207e-8
Identity = 94/384 (24.48%), Postives = 157/384 (40.89%), Query Frame = 2
Query: 5282 FIDLYIESPQVNEHSGLYKCIVTNEKSETEFVEITVKFKDEKVVSP--ILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNET-DPRLTIIMQPFCYNLILRDVKMTDAGMYSLKIN------ESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEI-DAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRIIVK 6403
            F  + I+  QV + +G Y C+ TNE  +          K EK  +P   + +L     +E + I+    E  VE   P   +   VWL D++ L  + D RL    Q     L +RD +  D G+Y++KI       ES  ++ V+  P           KN   P+ +  ++ +   +E E V+F+  +      + IWF   + + ++E ++FI  S D    LTI        G  T Q +N +G    DGRL + +               P F K L+D  +  K  +     +   P+P + +T  G+ L +      +   D F   ++  T  +  D G       N  G   + A + V + E +ES S+   +K
Sbjct:  603 FFAMTIDPVQVTD-TGRYTCMATNEYGQASTSAFFRVLKVEKEAAPPAFVTKLRDKECKEGDVID---FECEVEG-WPEPEL---VWLVDDQPLRPSHDFRLQYDGQ--TAKLEIRDAQPDDTGVYTVKIQNEFGSIESKAELFVQADPD----------KNHVAPEFQATIEYVEC-DEGEEVRFKSVITGDPNPEIIWFINGKPLSESEKVKFI--SEDGICILTIKDVTRHFDGMVTCQGSNRLGSASCDGRLKVRVPP-----------APPTFNKPLEDKTVQEKSTVVFEVDVSGWPEPTLTFTLCGKELKNGEEGVEIVGHDGFYRISIPNTSMDKHD-GEIVAKAQNEHGTAESRARLTV-EQEEEESRSAPTFLK 950          

HSP 15 Score: 58.5362 bits (140), Expect = 1.824e-7
Identity = 40/181 (22.10%), Postives = 79/181 (43.65%), Query Frame = 2
Query: 9044 CCLSQKAELKFTKLMEYKLDKITWTFNNAKVDVNDERYKIFSAETYGIY-FIIKNLEEDDFGEYCA-----LDEVQDPIQSFILIKSDAPTILNCLPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIFSSYRTVITEDKEQGTYSLLISKCILSDGGEYSIRAENAIGFAEVKFNLRV 9568
              + +K E+K    +      + W F + K    D  +++      G++  ++K     D G+Y A         +   ++ +    + PT +  L    + ++E  ++SV +   P P V W ++ + + +    VI + +  G+YS+ I    L D G+Y+ RA N  G A+ + N  V
Sbjct: 3176 TSVKEKEEIKMEVKVGGSAPDVEW-FKDDKPVSEDGNHEMKKNPETGVFTLVVKQAATTDAGKYTAKASNPAGTAESSAEAEVTQSLEKPTFVRELVTTEVKINETATLSVTVKGVPDPSVEWLKDGQPVQTDSSHVIAKVEGSGSYSITIKDARLEDSGKYACRATNPAGEAKTEANFAV 3355          

HSP 16 Score: 56.9954 bits (136), Expect = 4.428e-7
Identity = 39/138 (28.26%), Postives = 64/138 (46.38%), Query Frame = 2
Query: 5957 CGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEP 6370
             GKYT  V N  G    +  L+++   E   +       AP F   L+D    + E + L C+++ +PKPK+ W  D +T+  + +   V+ ++     T  IT +E+   G+Y C+  N  G   TEA + V    P
Sbjct: 2937 AGKYTCIVENTAGKDTCEATLTVIESLEKKSEKK-----APEFIVALQDKTTKTSEKVVLECKVIGEPKPKVSWLHDNKTITQESIT--VESVEGVERVT--ITSSELSHQGKYTCIAENTEGTSKTEAFLTVQGEAP 3065          

HSP 17 Score: 55.8398 bits (133), Expect = 1.198e-6
Identity = 84/362 (23.20%), Postives = 144/362 (39.78%), Query Frame = 2
Query: 5327 GLYKCIVTNEKSETEF-----VEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVE-SRVPTKSIDSAVWLKDEKLLNETDPRLTI-IMQPFCYNLILRDVKMTDAGMYSL-------KINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPN--FTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDS 6364
            G+Y C+  NE  + E      VEI    ++EK         ++  +E+      + I LS +   +P  S+   VW KD   L   D R +I   +     L + D    D G Y          IN +S  + VKV  + ++K+ +E F         K L D++  +  ++   +  V      +  W+   + +       I+ S D   +LT+  +     G Y  +  N  G  ++     + +    +E+        P F  +L D+ +     I L C++   P P + W+KDG  L     + R +  +E     + L I  A V D G Y C+ TN  G  TT++ + + D 
Sbjct: 5324 GVYMCVAVNELGQAETQATYQVEILEHVEEEKRRE--YAPKINPPLEDKTVNGGQPIRLSCKVDAIPRASV---VWYKDGLPLR-ADSRTSIQYEEDGTATLAINDSTEEDIGAYRCVATNAHGTIN-TSCSVNVKVPKQEVKKEGEEPF-------FTKGLVDLWA-DRGDSFTLKCAVTGDPFPEIKWYRNGQLLRNGPRTVIETSPDGSCSLTVNESTMSDEGIYRCEAENAHGKAKTQATAHVQMALGKTEKPKMDEGKPPKFILELSDMSVSLGNVIDLECKVTGLPNPSVKWSKDGGPL---IEDSRFEWSNEASKGVYQLRIKNATVHDEGTYRCVATNENGSATTKSFVRMDDG 5667          

HSP 18 Score: 55.4546 bits (132), Expect = 1.229e-6
Identity = 206/1044 (19.73%), Postives = 399/1044 (38.22%), Query Frame = 2
Query: 3362 WFVNNELLDFKKWNGSVNVSESQVEINFPKSTNELSGIWQFRIDKPMKLFSPEISVNV-LAKEVAPLSTGFLDCEIEEIDLKIGETLSLTLNAKDIPIMTLKNGGWFLNSEPIHAVKFRGNEVIEENKVKIVIPNVTKEFSGLLQYRIVKPVELYSPEIIIKIRGSLIKQTPKIEEEKFESNLILELHNVSLNISENERILLEAKIISGNINSYKTPPQWFWNDEAVKNINCKKDFTSNLAQLEIAHCQLSDSGQYKICFNPLEASKCGKVTGLFLVSIAPIKKNLKP--IDSNIETC--PGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNNNLSFLL-IDSVKLEDSGTYICQGFTNKELISECKITLNVVDNISDTLQCQVKFE-----KDKYSIEINQDVTMRALIECTSTHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVTKNIE---ITEGNELNLEV-VSEIEKDLQFQWSKDDIDCSNNGIFNSTK-NKNCFNLTKLKAEITDSGVYKFEGMVDGKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMPFGDPCVLDNPFI---------DLYIESPQVNEHSGLYKCIVTNEKSETEF-VEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLK-INESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAI-WFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRIIVKPL 6409
            W+   E +   +    V V+ES+ ++     + E+S    +R+      FS E S  V + K    +S       + +  +  G  L L +  +  P    K+  W+ N + I   K    E +   K ++ IP+  ++  G  +Y +    E    E   K+    +   P+I      S L      V   + + E      K+  G +   K    W+ N + + +   K +   + + LEI + Q+ D+  YK+  +  +A        L +      K  +KP  +   I T    GE+ T  V V+G  K+ +KW       K  K +   +   K N + S+ L I + +L+D+  Y               +  N   +   +    VK       K     E+ +       +E       + W+ NG+ +   SD      +     +L I +  +     Y+ ++ ++DGN++ +   L V+    +    + K +E   ++ G+ + LE+  S   K +++  +  ++  +        K + N + L    + + D+G YK         +E+ +     N    I  T E ++  +    +  +++ +    SVE  N K  +++W +N    G     ++ FI          L I++  V + +  YK ++ N   E E   ++TVK     +   + G       +    + + KI+   E            WL+D  +++     +   +    Y LI+    + DAG Y+++ INES          K       E+ +    P+I + L++I I   PE     F+VE S   + + W+  ++EI   +    +      + L I  A       Y + ++N  G   S   L+++  + +                 LKD+++   + + L  ++   PK  I W K+G+ L       + +   E   F+L I  ++  D G Y  +  N  G   + +V+ V  ++  E  S    + PL
Sbjct: 4123 WYKGTETVTSSQTTKIVQVTESEYKLEI--ESAEMSDTGAYRVVLSTDSFSVESSATVTVTKAAEKISLPSFKKGLADQSVPKGTPLVLEVEIEGKP----KDVKWYKNGDEIKDGKV---EDLGNGKYRLTIPDFQEKDVG--EYSVTAANEAGEIESKAKVN---VSAKPEIV-----SGL------VPTTVKQGETATFNVKV-KGPVKGVK----WYKNGKEIPDAKTKDNGDGSYS-LEIPNAQVEDAADYKVVVS-NDAGDADSSAALTVKLADDGKDKVKPEIVSGLIPTTVKQGETATFNVKVKGPVKQ-VKW------YKNGKEIPNAKA--KDNGDGSYSLEIPNAQLDDTADYKV-------------VVSNDAGDADSSAALTVKLPGIAIVKGLEDAEVPKGKKAVLQVETNKKPKEIKWYKNGKEI-TPSDKAQPGSDGDNKPQLVIPDAGDDDAAEYKVVLTDEDGNTADSSCALTVKLPAKEP--KIIKGLEDQVVSIGSPIKLEIETSGSPKTVKWYKNGKELPGAAAKTIKIQKIDDNKYVLEIPSSVVEDTGDYK---------VEVANEAGSANSSGKI--TVEPKITFLKPLKDQSITEGENAEFSVET-NTKPRIVKWYKN----GQEIKPNSRFIIEQKTDTKYQLVIKN-AVRDDADTYKIVLENTAGEAESSAQLTVKKAKAGLCKIVKGLEDQVVAKGAKMVFEVKIQGEPED---------VRWLRDANVISAGANAIIEKIDDTTYRLIIPSADLKDAGEYTVEVINESG---------KAKSDAKGEVDEK---PEIVRGLENIEI---PEGDDDVFKVEVSAPVRQVKWYKNDQEIKPNSHLEAKKIGPKKYELAINRAQLDDGADYKVVLSNAAGDCDSSAALTVVKPNVLK------------IVDGLKDVDVEEPQPVELKVKVEGIPK-VIKWYKNGQELKPDADGFKFEEKPESGEFSLTIPSSKKSDGGAYRVVLGNDKGEVYSGSVVHVKSAKSSEPTSGANFLSPL 5055          

HSP 19 Score: 53.9138 bits (128), Expect = 4.274e-6
Identity = 138/651 (21.20%), Postives = 257/651 (39.48%), Query Frame = 2
Query: 4472 ECKITLNVVDNISDTLQCQVKFEKDKYSIEINQ-DVTMRALIECTSTHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNS-STARTELNVEN---IQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCSNNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGM----VDGKLLEL-VHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGV-IQWLRNDMPFGDP---CVLDNPFIDLYIESPQVN-EHSGLYKCIVTNEKSETEF-VEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVW-LKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLKINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRM-MCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEP 6370
            E K  L V++   +T + +  F      +E+ + D     +I   S  Y   W+ NG +LE   + ++ IKN    + L I N  +S +   E    N+ G+S S+A+  +N  +   I +D   SVT  I+ TE  E    +       ++  W+ ++     +    + K ++ + L    A+I  +G  K         D K  +L V   V+    +S LT             + +  + +PL  ++E+     G  + WL N  P        V+D+     ++   +   E SG       N   E E   ++TV   ++K       E +        T+E E ++ S  + V  K + +  W L ++KL+   + ++  + +    ++ ++   M   G   ++    S  +    + K        + K  ++P+    + D  ++ E E VKF   VE        W    E + +++        D    + I A   +  G+ + +  N +G  + D +L++           +    AP F K L+D  I   E   ++ ++ +  PKPKI W KDG  + S    + V+  +E  +  L I + ++ED GR      +  G     A + V    P
Sbjct: 1943 ETKTELKVLETPKETKKPE--FTDKLRDMEVTKGDTVQMDVIALHSPLYK--WYQNGNLLEDGKNGVT-IKNEENKSSLIIPNAQDSGKITVEA--SNEVGSSESSAQLTVNPPSTTPIVVDGPKSVT--IKETETAEFKATISGFPAPTVK--WTINEKIVEESRTITTIKTEDVYTLKISNAKIEQTGTVKVTAQNSAGQDSKQADLKVEPNVKAPKFKSQLT-------------DKVADEGEPLRWNLELDGPSPGTEVSWLLNGQPLTKSDTVQVVDHGDGTYHVTIAEAKPEMSGTLTAKAKNAAGECETSAKVTVNGGNKKP------EFVQAPQNHETTLE-ESVKFS--AIVTGKPMPNVTWYLNNKKLIQSEEVKVKYVHETGKTSIRIQKPLMEHNGTIRVEAENVSGKVQATAQLK--------VDKKTEVPKFTTNMDDRQVK-EGEDVKFTANVEGYPEPSVAWTLNGEPV-SKHPNITVTDKDGEHTIEISAVTPEQAGELSCEATNPVGSKKRDVQLAV-----------KKVGDAPTFAKNLEDRLITEGELTLMDAKLNIVKPKPKITWLKDGVEITSDGHYKIVE--EEDGSLKLSILQTKLEDKGRITIKAESEFGVAECSASLGVVKGRP 2537          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: unc-89 (Muscle M-line assembly protein unc-89 [Source:UniProtKB/Swiss-Prot;Acc:O01761])

HSP 1 Score: 136.346 bits (342), Expect = 5.082e-31
Identity = 157/617 (25.45%), Postives = 269/617 (43.60%), Query Frame = 2
Query: 8714 ITLSWSPPRISPDLYIPFTVDVECRPVNYSYSDEEGWSVFKTNIKKNRVDIADLDPNINYQLRIVPVTDFGI-------------GKPSMVIKKIRRSDN---LNSPTTEKA--MMLQEKHCLAVPMFC--------CLSQKAELKFTKLMEYKLDKITWTFNNAKVDVND--ERYKIFSAETYGIYFIIKNLEEDDFGEY-C-ALDEVQDPIQSFILIKSDAPTILNCLPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIFSSYRTVITEDKEQGTY--SLLISKCILSDGGEYSIRAENAIGFAEVKFNLRVDAHPE-------KKSVQINIGDVNDRYYTMKK----LAKGSYSRCQIVIEKSTQIEFIGKFFEINNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIY-----EKLQGLS-LAEYITQLSHWC----ESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVPKEDFGSRRHM--GL------TSP-FSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQ--LYNEDS----NDAISN---SACVFIRKCLLLKTGERLTSSDSLSHEWF 10351
            +TLSW P + +P  Y   T  +E R +      E+ WS+ + NI +    + +L+   +YQ R+     +GI               P  V    RR++    L  P  EKA  M   E++  A P F         C           +  +    I W F    +D +    + K+++         I    +++ G+Y C A ++  D  Q+ ++  +  P  +  L N + +  +   + V++D +P PE+ W + W+ I  S R    +D   G Y  SL+I+  +  D G YS  A N  G A     + V+A  +       ++ V I    V + Y   +K     A+G+  R   V EK+T  EF+ +   I++  +   +     ++ H  IV++   +   D+ L L+        + GLS LA    +++       E+ VR+ + QL+ A+ ++H+ R+ HLD++PE I++    ++ LKL          DFG  R +  GL       SP F +PE+++  P+   +DMWS G+LT++ L G    + + D   L N DS    +  + N    A  F++K L      RLT  ++L H W 
Sbjct: 6292 LTLSWIPTKRAPPRYPQVTYVIEIREL-----PEKQWSLLEYNIPEPVCKVRNLELGKSYQFRVRAENIYGISDPSPASPPSRLMAPPQPVFD--RRTNKVIPLLDPYAEKALDMRYSEQYACA-PWFSPGVVEKRYCAENDTLTIVLNVSGFPDPDIKWKFRGWDIDTSSPTSKCKVYTYGGSETTLAITGFSKENVGQYQCFAKNDYGDAQQNIMVDLATRPNFIQPLVNKTFSSAQPMRMDVRVDGEPFPELKWMKEWRPIVESSRIKFVQD---GPYLCSLIINDPMWRDSGIYSCVAVNDAGQATTSCTVTVEAEGDYNDVELPRRRVTIESRRVRELYEISEKDEKLAAEGAPFR---VKEKATGREFLAQLRPIDDALMRHVDIH--NSLDHPGIVQMHRVLR--DEKLALVVFDNANSTIDGLSSLAHPGVEIAEPKGVNRETCVRVFVRQLLLALKHMHDLRIAHLDLRPETILL---QDDKLKLA---------DFGQARRLLRGLITGEIKGSPEFVSPEIVRSYPLTLATDMWSTGVLTYVLLTGLSPFHGDNDNETLANVDSCQFDSSPLGNFSYDAGDFVKKLLTEIPVSRLTVDEALDHPWI 6878          

HSP 2 Score: 98.2117 bits (243), Expect = 1.656e-19
Identity = 171/766 (22.32%), Postives = 303/766 (39.56%), Query Frame = 2
Query: 4283 GFSKKDIKWKVLEDDLKQDKILQE---KRITQKFNNNLSFLLIDSVKLEDSGTYICQGFTNKELISECKITLNVVDNISDTLQCQVKFEKDKYSIEINQDVTMRALIECTSTHYSVSWFFNGEILEM-KSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDD--IDCSNNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGMVD-GKLLELVHFTVQVNPIQSILTTDESRLK-LICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMPFGDPCVLDNPFI----------DLYIESPQVNEHSGLYKCIVTNEKSETEF-VEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDE-KLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLK-INESSVDILV---KVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSC--DNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCI-----------------------APLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKI-LDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVT-DSEPKESDSSRIIVKPLCAPVLT 6427
            G S  D++W       K DK + E     + +     +  L++      D+G Y  +  +N    +E      V  ++      +   E     ++IN+  T+   ++      SV W  +G+ ++   S +++ ++ +G  + + I++      G Y C   N  G + T      V+N+           +E+ E     L V      +   +W KDD  I   N  +         F+LT   A   D G+Y      + G+ L   +F +  + I    T    +L+ L   + E +  D K  +I   V N     ++W ++D P      +DN  I           L I+  +  E  G+Y C  TNE  E +    + V+   E++ +P+  + L     E    + +  EL V  RV  K      W KD   +  +    +    +   + L+++D    D G Y+ +  N++  D  V   K+      KQT E  K L I    +PL++ F   E +TV  E +V +  +   I FF+N++   E  + +Q     D    LTI  A ++  G Y  +  N  G   ++  L +   +++ E + +                           AP F + L+   +  K+   L C++  +P+PKI WTK+G+ ++   ++ RV+    +    TL        D+G Y C   N  G   TE  IIVT +  PK    +   ++P+   V+T
Sbjct: 3213 GGSAPDVEW------FKDDKPVSEDGNHEMKKNPETGVFTLVVKQAATTDAGKYTAKA-SNPAGTAESSAEAEVTQSLEKPTFVR---ELVTTEVKINETATLSVTVKGVPDP-SVEWLKDGQPVQTDSSHVIAKVEGSGSYS-ITIKDARLEDSGKYACRATNPAGEAKTEANFAVVKNLVPPEFVEKLSPLEVKEKESTTLSVKVVGTPEPSVEWFKDDTPISIDNVHVIQKQTAVGSFSLTINDARQGDVGIYSCRARNEAGEALTTANFGIIRDSIPPEFT---QKLRPLEVREQETL--DLKVTVIGTPVPN-----VEWFKDDKPIN----IDNSHIFAKDEGSGHHTLTIKQAR-GEDVGVYTCKATNEAGEAKTTANMAVQ---EEIEAPLFVQGLKPYEVE----QGKPAELVV--RVEGKPEPEVKWFKDGVPIAIDNQHVIEKKGENGSHTLVIKDTNNADFGKYTCQATNKAGKDETVGELKIPKYSFEKQTAEEVKPLFI----EPLKETFAV-EGDTVVLECKVNKE-SHPQIKFFKNDQ-PVEIGQHMQLEVLEDGNIKLTIQNAKKEDVGAYRCEAVNVAGKANTNADLKIQFAAKVEEHVTDESGQLEEIGQFETVGDTASSKTDTGRGAPEFVELLRSCTVTEKQQAILKCKVKGEPRPKIKWTKEGKEVE---MSARVRAEHKDDGTLTLTFDNVTQADAGEYRCEAENEYGSAWTEGPIIVTLEGAPKIDGEAPDFLQPVKPAVVT 3932          

HSP 3 Score: 92.0485 bits (227), Expect = 1.252e-17
Identity = 131/611 (21.44%), Postives = 246/611 (40.26%), Query Frame = 2
Query: 10622 PNDNSSEEVKSDRSETFPSADRLSVSNTTKELLFTVPLKDQTFKSDSTAGKITVTLTCQLSLLGSEPISISWYKNQELLTDDSRIKLEVIKGGFLSCTILN-ATETDVGIFRCIARCHSLRTETSARLVLGDVPPQPEQLSVYYTNQEEVLLKWSP-----YLSAIDDVIYRIDIRTIDSRNKIRNWKTIGYSVDNR-YLLENLDRTQQYIARIIAQNKYGYSPYSIATSVFQNKIRN-----IHSLKQALIFNRKWMLTSRQSNHFNDL--------------HDLIKDIS--SDDI-------------RMNVIREHYSTLSQKSSGFAVLKLKNTNVNFPEYIVQRTFKMEDICPAFDLCVRIKYYHFPILFGEICDSSLGNRITFEEFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFV-GTVKEQESLTTHKPSIFKAPEYRY-ESITRYESDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNT--NTLLLPVPHTHFRAPKLSMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWFKQDPQTIYEMEHQTISSTPL 12319
            P+  + E +K+D  +  P A + +  + T   +FT  L+D   + +  A        C +S   S    ++W    ++L  + R+ +E  +   ++  ILN A   D+G + C A       ++S RL+ G+ P +P +     ++  E+ ++W       YL  I    YR++ R     +    W T+   +D+   ++++L     Y  R+ AQN +G    S+++ + Q   +      I  LK  +  N   M   + +N    +               D+  ++   +DD              R +VIR+   + ++  +  AV     ++    EY   R  + E++     L       +F  L  E     + +R  F ++               Y+E  V   +RQ+   + FLH   + H ++ P  I+   ++ +S+ +KL+     Q V G VK  +  T      + +PE+   E+    +SD+W +G+++F LLA   P   +   + ++   V N   +  L+PV                S+    F   +LKKSP  R   D  L+H +   DP  +   E    S++ L
Sbjct: 7498 PSATAIERIKADIEKVTPCATKKN-DDGTFAPIFTARLRDVYLRKNQPA-----IFECAVS--ASPAPKVTWDFQGKILESNDRVTIE--QDNNVARLILNHAAPYDLGEYVCTAINEYGTDKSSCRLISGETPSRPGRPEAELSSDTEIFIQWEAPEGPTYLEGI---TYRLEYRVAGPNDHGDPWITVSEKIDDESVIVKHLSPLGIYQFRVTAQNGFGLGLPSLSSRIVQTHGKGAPKLQIDVLKSEIRLNVVSM-PQKSTNQLGGISEESEEDSEARTANEDMKSNLQLQTDDPTGRFQIGGLKFKGRFSVIRDAVDSTTEGHAHCAVKIRHPSSEAISEYESLRDGQHENVQ---RLIAAFNNSNFLYLLSERLYEDVFSRFVFNDY---------------YTEEQVALTMRQVTSALHFLHFKGIAHLDVNPHNIMF--QSKRSWVVKLVDFGRAQKVSGAVKPVDFDTK-----WASPEFHIPETPVTVQSDMWGMGVVTFCLLAGFHPFTSEYDREEEIKENVINVKCDPNLIPV--------------NASQECLSFATWALKKSPVRRMRTDEALSHKFLSSDPSMVRRRESIKYSASRL 8055          

HSP 4 Score: 83.5741 bits (205), Expect = 4.096e-15
Identity = 180/816 (22.06%), Postives = 331/816 (40.56%), Query Frame = 2
Query: 4013 QWFWNDEAVKNINCKKDFTSNLAQLEIAHCQLSDSGQYKICF--NPLEASKCGKVTGLFLVSIAPIKKNLKPIDSNIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNN--NLSFLLIDSVKLEDSGTY--ICQGFTNKELISECKITLNVV---DNISDTLQCQVKFEKDKYSIEINQDVTMRALIECTSTHYSVSWFFNGEIL---EMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCSNNGIFN-STKNKNCFNLTKLKAEITDSGVYKFEGMVDGKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLR--NDMPFGDPCVL---DNPFIDLYIESPQVNEHSGLYKCIVTNEKSETEFVEITVKFKDEKVVSPILGEL-----LSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLKINESSVD-----ILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAI-WFFENEEI--DAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETL--DSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTD 6361
            +W+ N + + N   K +   + + LEI + QL D+  YK+    +  +A     +T + L  IA I K L+    + E   G+   L V+      K+IKW       K  K +      Q  ++  N   L+I     +D+  Y  +          S C +T+ +      I   L+ QV        + I   + +   IE + +  +V W+ NG+ L     K+  +  I +N  + E+      ++  G Y+  + N+ G S+ +  ++ VE  +I  L  + K+  ITEG      V +  +  +  +W K+  +   N  F    K    + L    A   D+  YK        +LE      + +   ++        K++    + +++    ++  V++    + V +WLR  N +  G   ++   D+    L I S  + + +G Y   V NE                K  S   GE+     +   +E +   E +     VE   P + +    W K+++ +          + P  Y L +   ++ D   Y + ++ ++ D      L  V+P  ++              I   L+D+ +  EP+ V+ + +VE  G  K I W+   +E+  DA+  +F +      F+LTIP++ +   G Y + + ND G V S G +  +  ++ SE    +  ++PL     KD E+   + + L C +  +P P+++W KDG  L  D +   R    LD     TL I  A+  D G+Y     N  G  T++  + VT+
Sbjct: 4431 KWYKNGKEIPNAKAKDNGDGSYS-LEIPNAQLDDTADYKVVVSNDAGDADSSAALT-VKLPGIA-IVKGLE----DAEVPKGKKAVLQVETNK-KPKEIKW------YKNGKEITPSDKAQPGSDGDNKPQLVIPDAGDDDAAEYKVVLTDEDGNTADSSCALTVKLPAKEPKIIKGLEDQV--------VSIGSPIKLE--IETSGSPKTVKWYKNGKELPGAAAKTIKIQKIDDNKYVLEIPSSVVEDT--GDYKVEVANEAG-SANSSGKITVEP-KITFLKPL-KDQSITEGENAEFSVETNTKPRI-VKWYKNGQEIKPNSRFIIEQKTDTKYQLVIKNAVRDDADTYKI-------VLENTAGEAESSAQLTVKKAKAGLCKIVKGLEDQVVAKGAKMVFEVKIQGEPEDV-RWLRDANVISAGANAIIEKIDDTTYRLIIPSADLKD-AGEYTVEVINESG--------------KAKSDAKGEVDEKPEIVRGLENIEIPEGDDDVFKVEVSAPVRQVK---WYKNDQEIKPNSHLEAKKIGPKKYELAINRAQLDDGADYKVVLSNAAGDCDSSAALTVVKPNVLK--------------IVDGLKDVDVE-EPQPVELKVKVE--GIPKVIKWYKNGQELKPDADGFKFEEKPESGEFSLTIPSSKKSDGGAYRVVLGNDKGEVYS-GSVVHVKSAKSSEPTSGANFLSPL-----KDTEVEEGDMLTLQCTIAGEPFPEVIWEKDGVVLQKDDRITMRVA--LDG--TATLRIRSAKKSDIGQYRVTAKNEAGSATSDCKVTVTE 5163          

HSP 5 Score: 74.3294 bits (181), Expect = 2.916e-12
Identity = 62/273 (22.71%), Postives = 127/273 (46.52%), Query Frame = 2
Query: 9584 KKSVQINIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQ--IEFIGKFFEINNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVPKEDFGSRRHMGLTSPFSAPEL-LKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQLYNEDSNDAISNSAC-------VFIRKCLLLKTG-------ERLTSSDSLSHEWF 10351
            K ++Q+   D   R+       KG +S  +  ++ +T+       K    ++  I  SE++ +++  H N+  +  A    + +L L+ E+L     + ++    ++ E QV + + Q+  A+ +LH   + HLD+ P NI+   K + ++KL  F  A  ++  G+ + +   + +++PE  +   P+   SDMW +G++TF  L G      E D+   E+  + + N  C          ++CL   T         R+ + ++LSH++ 
Sbjct: 7771 KSNLQLQTDDPTGRFQIGGLKFKGRFSVIRDAVDSTTEGHAHCAVKIRHPSSEAI--SEYESLRDGQHENVQRLIAAFNNSN-FLYLLSERLYEDVFSRFVFN-DYYTEEQVALTMRQVTSALHFLHFKGIAHLDVNPHNIMFQSKRSWVVKLVDFGRA--QKVSGAVKPVDFDTKWASPEFHIPETPVTVQSDMWGMGVVTFCLLAGFHPFTSEYDR--EEEIKENVINVKCDPNLIPVNASQECLSFATWALKKSPVRRMRTDEALSHKFL 8035          

HSP 6 Score: 73.559 bits (179), Expect = 4.543e-12
Identity = 169/795 (21.26%), Postives = 299/795 (37.61%), Query Frame = 2
Query: 4082 QLEIAHCQLSDSGQYKICFNPLEASKCGKVTGLFLVSIAP-IKKNLKPIDSNIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNNNLSFLLIDSVKLEDSGTY-ICQGFTNKELISECKIT------LNVVDNISDTLQCQVKFEKDKYSIEINQDVTMRALIECTSTHYSVSWFFNGEILEMKSD--ILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTA-----RTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCS-NNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGMVD-GKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMP--FGDPCVLDNPFIDLY-IESPQVNEHS-GLYKCIVTNEKSETEFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELS----VESRVPTKSIDSAVWLKDEK---------LLNETDPRLTIIMQPFCYNLILRDVKMTDAGMY-SLKINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNF--TLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIV 6355
            +L I    L D+G+Y +    +  S   K      V   P I + L+    NIE   G+     V+V    ++ +KW   + ++K +  L+ K+I  K       L I+  +L+D   Y +       +  S   +T      L +VD + D              +E  Q V ++  +E       + W+ NG+ L+  +D     +   +G+ + L I +  +S  G Y  ++ N  G   +      ++  + E        S  K+ E+ EG+ L L+     E   +  W KD +    ++ I           L    A+ +D G Y+     + G        TV     Q      + +  +  +    +  D K    +V+V    +  +QW  N +P  F D   LD+     Y +    V E   G  KCI  NE    E V    +F+          + L         + D +I +     +E  V         W KD K         + N  D    I + PF         + +D G+Y  + +NE             I +  +E  +    P+I  PL+D  + N  + ++   +V+       +W+ +   + A++   IQ+  D    L I  + E+  G Y     N  G + +    S  +  ++ +Q ++     P FTK L D+     ++  L C +  DP P+I W ++G+ L     N    +++  P+   +L + E+ + D G Y C   N  G   T+A   V
Sbjct: 4836 RLIIPSADLKDAGEYTVEV--INESGKAKSDAKGEVDEKPEIVRGLE----NIEIPEGDDDVFKVEVSAPVRQ-VKWYKNDQEIKPNSHLEAKKIGPKKYE----LAINRAQLDDGADYKVVLSNAAGDCDSSAALTVVKPNVLKIVDGLKDV------------DVEEPQPVELKVKVEGIPK--VIKWYKNGQELKPDADGFKFEEKPESGEFS-LTIPSSKKSDGGAYRVVLGNDKGEVYSGSVVHVKSAKSSEPTSGANFLSPLKDTEVEEGDMLTLQCTIAGEPFPEVIWEKDGVVLQKDDRITMRVALDGTATLRIRSAKKSDIGQYRVTAKNEAGSATSDCKVTVTEQGEQP----SKPKFVIPLKTGAALPGDKKEF--NVKVRGLPKPTLQWFLNGIPIKFDDRITLDDMADGNYCLTIRDVREEDFGTLKCIAKNENGTDETV---CEFQQGAGHDDGSRDDLRYPPRFNVPLWDRRIPVGDPMFIECHVDANPTAEVEWFKDGKKIEHTAHTEIRNTVDGACRIKIIPF---------EESDIGVYMCVAVNELGQAETQATYQVEILEHVEEEKRREYAPKINPPLEDKTV-NGGQPIRLSCKVDAIPRASVVWYKDGLPLRADSRTSIQYEEDGTATLAINDSTEEDIGAYRCVATNAHGTINT----SCSVNVKVPKQEVKKEGEEPFFTKGLVDLWADRGDSFTLKCAVTGDPFPEIKWYRNGQLL----RNGPRTVIETSPDGSCSLTVNESTMSDEGIYRCEAENAHGKAKTQATAHV 5577          

HSP 7 Score: 72.7886 bits (177), Expect = 8.092e-12
Identity = 200/875 (22.86%), Postives = 340/875 (38.86%), Query Frame = 2
Query: 3932 LNISENERILLEAKIISGNINSYKTPPQWFWNDEAVKNINCK---KDFTSNLAQLEIAHCQLSDSGQYKICFNPLEASKCGKVTGLFLVSI---API-KKNLKPIDSNIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNNNLSFLLIDSVKLEDSGTYICQGFTNK----ELISECKITLNVVDNISDTLQCQVKFEKDKYSIEINQDVTMRALIEC---TSTHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSST---------ARTELNV--ENIQI----------DCLNSVT-------------KNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCSNNG-IFNSTKNKNCFNLTKLKAEITDSGVYKFEGMVDGKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISV---EVLNWK-----QGVIQWLRN--DMPFGDPCV---LDNPFIDLYIESPQVNEHSGLYKCIVTNEKSETEFVEITVKFKDEKVVSP-ILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTI-IMQPFCYNLILRDVKMTDAGMYSLKINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAI-WFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSE-ISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVT 6358
            L + E E + L+  +I   + +     +WF +D+ +   N     KD  S    L I   +  D G Y  C    EA +  K T    V     AP+  + LKP     E   G+   L V VEG  + ++KW   +D +    I  +  I +K  N    L+I      D G Y CQ  TNK    E + E KI     +  +      +  E  K +  +  D     ++EC     +H  + +F N + +E+   +  ++  +G I +L IQN  +   G Y C   N  G ++T         A+ E +V  E+ Q+          D  +S T             ++  +TE  +  L+   + E   + +W+K+  +   +  +    K+     LT       D+G Y+ E        E  + +        I+ T E   K+  E  +  L   KP +++V    VL  K     +  ++W +N  ++   D      LD+    L + + ++++    Y+C  +NE  +  + ++T+  K+   V+P    EL +  V+E  T    K E  V    P        W KD   L E D R+           L++ D K  D G Y +++   S D  V     P+     E  K      IKK L D+   N  +  K    VE  G  K + W+   E + +     I    ++ + L I +A     G Y + ++ D   V S   +++   +E IS          P F K L D  +     + L   +   PK  + W K+G+ +     + +V+ L     + L I + + +D G Y     N  G   ++A + V+
Sbjct: 3491 LEVREQETLDLKVTVIGTPVPNV----EWFKDDKPINIDNSHIFAKDEGSGHHTLTIKQARGEDVGVY-TCKATNEAGEA-KTTANMAVQEEIEAPLFVQGLKPY----EVEQGKPAELVVRVEGKPEPEVKW--FKDGVPI-AIDNQHVIEKKGENGSHTLVIKDTNNADFGKYTCQA-TNKAGKDETVGELKIPKYSFEKQTAEEVKPLFIEPLKETFAVEGDT---VVLECKVNKESHPQIKFFKNDQPVEIGQHMQLEVLEDGNI-KLTIQNAKKEDVGAYRCEAVNVAGKANTNADLKIQFAAKVEEHVTDESGQLEEIGQFETVGDTASSKTDTGRGAPEFVELLRSCTVTEKQQAILKCKVKGEPRPKIKWTKEGKEVEMSARVRAEHKDDGTLTLTFDNVTQADAGEYRCEA-------ENEYGSAWTE--GPIIVTLEGAPKIDGEAPD-FLQPVKPAVVTVGETAVLEGKISGKPKPSVKWYKNGEELKPSDRVKIENLDDGTQRLTVTNAKLDDMD-EYRCEASNEFGDV-WSDVTLTVKEPAQVAPGFFKELSAIQVKETETA---KFECKVSGTKP-----DVKWFKDGTPLKE-DKRVHFESTDDGTQRLVIEDSKTDDQGNYRIEV---SNDAGVANSKVPLTVVPSETLK------IKKGLTDV---NVTQGTKILLSVEVEGKPKTVKWYKGTETVTSSQTTKIVQVTESEYKLEIESAEMSDTGAYRVVLSTDSFSVESSATVTVTKAAEKIS---------LPSFKKGLADQSVPKGTPLVLEVEIEGKPK-DVKWYKNGDEIK----DGKVEDLGNG-KYRLTIPDFQEKDVGEYSVTAANEAGEIESKAKVNVS 4299          

HSP 8 Score: 70.4774 bits (171), Expect = 4.171e-11
Identity = 116/503 (23.06%), Postives = 200/503 (39.76%), Query Frame = 2
Query: 4919 WSKDDIDCSNN--GIFNSTKNKNCFNLTKLKAEITDSGVY------KFEGMVDGKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMPFGDP----CVLDNPFIDLYIESPQVNEHSGLYKCIVTNEKSETEF-VEITVKFK-DEKVVSPILGELLSCTVEEVNTIEDEKIEL-SVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMY----SLKINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFE--NEEI--DAENMEFIQWSCDNYFALTIP-AAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIV 6355
            W KDD+    +    F S ++   F +T    ++TD+G Y      ++          ++    +  P   +    +      C++ ++I           EV  W +  + WL +D P           D     L I   Q ++ +G+Y   + NE    E   E+ V+   D+  V+P        T+E V   E E++   SV +  P   I   +W  + K L+E++    I     C  L ++DV     GM     S ++  +S D  +KVR  P              P   KPL+D  ++ +   V   FEV+ SG  +    F    +E+    E +E +    D ++ ++IP  + +KH G+   +  N+ G   S  RL++       EQ  E    AP F K ++D  + + E       +  +P P++ W  +G  +D       VKI     +  L I  A+   +G   C   N +G   T+A ++V
Sbjct:  581 WYKDDVQLHEDERHTFYSDED-GFFAMTIDPVQVTDTGRYTCMATNEYGQASTSAFFRVLKVEKEAAPPAFVTKLRDKE----CKEGDVI-------DFECEVEGWPEPELVWLVDDQPLRPSHDFRLQYDGQTAKLEIRDAQPDD-TGVYTVKIQNEFGSIESKAELFVQADPDKNHVAP----EFQATIEYVECDEGEEVRFKSVITGDPNPEI---IWFINGKPLSESEKVKFISEDGICI-LTIKDVTRHFDGMVTCQGSNRLGSASCDGRLKVRVPPAP------------PTFNKPLEDKTVQEKSTVV---FEVDVSGWPEPTLTFTLCGKELKNGEEGVEIV--GHDGFYRISIPNTSMDKHDGEIVAKAQNEHGTAESRARLTV-------EQEEEESRSAPTFLKDIEDQTVKTGEFAVFETTVRGNPNPEVTWFINGHKMDQGSPG--VKIEAHNHDHKLTIDSAQY--AGTVLCRAENAVGRFETKARLVV 1034          

HSP 9 Score: 69.707 bits (169), Expect = 6.664e-11
Identity = 64/235 (27.23%), Postives = 105/235 (44.68%), Query Frame = 2
Query: 5792 EPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDG--------RLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFT--LIITEAEVEDSGRYCCLGTNFLGYDTT--EAVIIVTDSEPKESDSS-RIIVKPLCAPVLTAEYSKGADVI 6457
            E + +K E +V+ S   + +W+ +   +   +   I  S D    L IP+      G Y +   N  G  +  G        R S   RS  +++ +     AP   + L++I I  K++ RL C+   DPKP I W KDGE +       R++++ E P+    L++  A  +D+G Y C+  N  G   T  +  +I  D +P++ DSS R    P     LT   +K  D +
Sbjct: 5714 EGQPLKLECKVDASPLPEMVWYKDGAIVTPSDRIQISLSPDGVATLLIPSCVYDDDGIYRVIATNPSGTAQDKGTATVKKLPRDSGARRS--ADRDVFDANKAPKLMEPLENIRIPEKQSFRLRCKFSGDPKPTIKWFKDGERV---FPYGRLQLI-ESPDGVCELVVDSATRQDAGGYRCVAENTYGSARTSCDVNVIRGDRKPRDIDSSIREGKAPGFTTPLTIRRAKPGDSV 5942          

HSP 10 Score: 69.3218 bits (168), Expect = 7.878e-11
Identity = 225/1066 (21.11%), Postives = 428/1066 (40.15%), Query Frame = 2
Query: 3260 FFTNLKQIETISGENLHVQFKAYNIVLDTLKKGSWFVNNELLDFKKWNGSVNVSESQVEINFPKSTNELSGIWQFRIDKPMKLFSPEISVNVLAKEVAPLSTGFLDCEIEEIDLKIGETLSLTLNAKDIPIMTLKNGGWFLNSEPIHAVKFRGNEVIEENKVKIVIPNVTKEFSGLLQYRIVKPVELYSPEIIIKIRGSLIKQTPKIEEEKFESNLILELHNVSLNISENERILLEAKIISGNINSYKTPPQWFWNDEAVKNINCKKDFTSNLAQLEIAHCQLSDSGQYKICFNPLEASKCGKVTGLFLVSIAPIKKNLKP--IDSNIETC--PGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNNNLSFLL-IDSVKLEDSGTY-ICQGFTNKELISECKITLNVVDNISDTLQCQVKFEKDKYSIEINQDVTMRALIECTSTHYSVSWFFNG-EILEMKSDILSDIKNNGKIA-ELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKD--DIDCSNNGIFNSTKNKNCFNLTKLKAEITDSGVYKFE-GMVDGKLLEL-VHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRN--DMPFGDPCVL------DNPFIDLYIESPQVNEHSGLYKCIVTNEK-SETEFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFC---YNLILRDVKMTDAGMYSLKIN------ESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIF---IRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGY-DTTEAVIIV 6355
            FF  L  I+    E    + K      D      WF +   L   K     +  +    +    S  +  G ++  +     + + ++ + V+  E   +  G  D  + +     G  + L++  +  P  T+K   W+  +E + + +      + E++ K+ I +   E S    YR+V   + +S E    +  ++ K   KI    F+  L         ++ +   ++LE +I  G     K    W+ N + +K+   + D  +   +L I   Q  D G+Y +      A++ G++      S A +  + KP  +   + T    GE+ T  V V+G   K +KW       K  K + + +   K N + S+ L I + ++ED+  Y +       +  S   +T+ + D+  D ++ ++       +++  +  T    ++       V W+ NG EI   K+      K+NG  +  L+I N        Y+ ++ N  G++ ++   L V+   I  +  + ++ E+ +G +  L+V +  +K  + +W K+  +I  S+     S  + N   L    A   D+  YK      DG   +     TV+       L   E ++    ED   ++S   P+ + +E     +  ++W +N  ++P      +      DN ++ L I S  V E +G YK  V NE  S     +ITV+ K    + P+  + ++         E E  E SVE+    + +    W K+ +   E  P    I++      Y L++++    DA  Y + +       ESS  + VK     + K    I K L+   + K  + +F   I+ EPE V+              W  +   I A     I+   D  + L IP+A  K  G+YT++V N+ G  +SD       + E+ E+        P   + L++IEI   ++      +   P  ++ W K+ + +         KI  +   + L I  A+++D   Y  + +N  G  D++ A+ +V
Sbjct: 4020 FFKELSAIQVKETETAKFECKVSGTKPDV----KWFKDGTPLKEDKRVHFESTDDGTQRLVIEDSKTDDQGNYRIEVSNDAGVANSKVPLTVVPSETLKIKKGLTDVNVTQ-----GTKILLSVEVEGKP-KTVK---WYKGTETVTSSQTTKIVQVTESEYKLEIESA--EMSDTGAYRVVLSTDSFSVESSATV--TVTKAAEKISLPSFKKGL------ADQSVPKGTPLVLEVEI-EGKPKDVK----WYKNGDEIKDGKVE-DLGNGKYRLTIPDFQEKDVGEYSVTA----ANEAGEIE-----SKAKVNVSAKPEIVSGLVPTTVKQGETATFNVKVKG-PVKGVKW------YKNGKEIPDAKT--KDNGDGSYSLEIPNAQVEDAADYKVVVSNDAGDADSSAALTVKLADDGKDKVKPEIVSGLIPTTVKQGETATFNVKVKGPVKQ--VKWYKNGKEIPNAKA------KDNGDGSYSLEIPNAQLDDTADYKVVVSNDAGDADSS-AALTVKLPGIAIVKGL-EDAEVPKGKKAVLQVETN-KKPKEIKWYKNGKEITPSDKAQPGSDGD-NKPQLVIPDAGDDDAAEYKVVLTDEDGNTADSSCALTVK-------LPAKEPKIIKGLEDQ--VVSIGSPIKLEIETSGSPK-TVKWYKNGKELPGAAAKTIKIQKIDDNKYV-LEIPS-SVVEDTGDYKVEVANEAGSANSSGKITVEPKI-TFLKPLKDQSIT---------EGENAEFSVETNTKPRIVK---WYKNGQ---EIKPNSRFIIEQKTDTKYQLVIKNAVRDDADTYKIVLENTAGEAESSAQLTVKKAKAGLCK----IVKGLEDQVVAKGAKMVFEVKIQGEPEDVR--------------WLRDANVISAGANAIIEKIDDTTYRLIIPSADLKDAGEYTVEVINESGKAKSDA------KGEVDEK--------PEIVRGLENIEIPEGDDDVFKVEVSA-PVRQVKWYKNDQEIKPNSHLEAKKIGPK--KYELAINRAQLDDGADYKVVLSNAAGDCDSSAALTVV 4963          

HSP 11 Score: 68.9366 bits (167), Expect = 1.101e-10
Identity = 157/732 (21.45%), Postives = 287/732 (39.21%), Query Frame = 2
Query: 4394 LLIDSVKLEDSGTYICQGF-------TNKELISE--CKITLNVVD------------NISDTLQCQVKFEKDKYS-IEINQDVTM----RALIECT---STHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNS-------STARTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCS-NNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGMVD-GKLLELVHFTV----QVNP-----IQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMPFGDPCVL-----DNPFIDLYIESPQVNEHSGLYKCIVTNEKS-ETEFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLKIN------ESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAI-WFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDG-ETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRIIVKP 6406
            L I + K ED G Y C+         TN +L  +   K+  +V D             + DT   +    +     +E+ +  T+    +A+++C         + W   G+ +EM + + ++ K++G +  L   N  ++  G Y C  EN+ G++        T      ++    D L  V   + +T G    LE     +     +W K+  +   ++ +     +     LT   A++ D   Y+ E   + G +   V  TV    QV P     + +I   +    K  C+     +S +KP +             +W ++  P  +   +     D+    L IE  + ++  G Y+  V+N+       V +TV      V S  L   +   + +VN  +  KI LSVE     K++    W K  + +  +     + +    Y L +   +M+D G Y + ++      ESS  + V          TK   K + +P  KK L D  +   P+      EVE  G  K + W+   +EI    +E +    +  + LTIP   EK  G+Y++  AN+ G + S  ++++  + EI   ++ +               +   E    N ++   P   + W K+G E  D+K  +      +   +++L I  A+VED+  Y  + +N  G   + A + V     K +D  +  VKP
Sbjct: 3744 LTIQNAKKEDVGAYRCEAVNVAGKANTNADLKIQFAAKVEEHVTDESGQLEEIGQFETVGDTASSKTDTGRGAPEFVELLRSCTVTEKQQAILKCKVKGEPRPKIKWTKEGKEVEMSARVRAEHKDDGTLT-LTFDNVTQADAGEYRCEAENEYGSAWTEGPIIVTLEGAPKIDGEAPDFLQPVKPAV-VTVGETAVLEGKISGKPKPSVKWYKNGEELKPSDRVKIENLDDGTQRLTVTNAKLDDMDEYRCEASNEFGDVWSDVTLTVKEPAQVAPGFFKELSAIQVKETETAKFECK-----VSGTKPDV-------------KWFKDGTPLKEDKRVHFESTDDGTQRLVIEDSKTDDQ-GNYRIEVSNDAGVANSKVPLTV------VPSETL--KIKKGLTDVNVTQGTKILLSVEVEGKPKTVK---WYKGTETVTSSQTTKIVQVTESEYKLEIESAEMSDTGAYRVVLSTDSFSVESSATVTV----------TKAAEK-ISLPSFKKGLADQSV---PKGTPLVLEVEIEGKPKDVKWYKNGDEIKDGKVEDL---GNGKYRLTIPDFQEKDVGEYSVTAANEAGEIESKAKVNVSAKPEIVSGLVPTT--------------VKQGETATFNVKVKG-PVKGVKWYKNGKEIPDAKTKD------NGDGSYSLEIPNAQVEDAADYKVVVSNDAGDADSSAALTV-----KLADDGKDKVKP 4400          

HSP 12 Score: 66.2402 bits (160), Expect = 6.995e-10
Identity = 85/362 (23.48%), Postives = 148/362 (40.88%), Query Frame = 2
Query: 5333 YKCIVTNE-KSETEFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQP--FCYNLILRDVKMTDAGMYSLKIN------ESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFI-QWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDE---FPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVI-IVTDSEPKE 6376
            YK I TN   + T   +IT K     V +P+  + L  T   V   E+ K+E+ V    P        W KD+K ++E D    +   P    + L+++    TDAG Y+ K +      ESS +               E+ ++L+ P   + L    ++   ET      V+        W  + + +  ++   I +      +++TI  A  +  GKY  +  N  G  +++   +++              + P F +KL  +E+  KE+  L+ +++  P+P + W KD    D+      V ++ +     +F+L I +A   D G Y C   N  G   T A   I+ DS P E
Sbjct: 3165 YKAIATNSIGTATSTSKITTK-----VEAPVFEQGLKKT--SVKEKEEIKMEVKVGGSAP-----DVEWFKDDKPVSE-DGNHEMKKNPETGVFTLVVKQAATTDAGKYTAKASNPAGTAESSAEA--------------EVTQSLEKPTFVRELVTTEVKIN-ETATLSVTVKGVPDPSVEWLKDGQPVQTDSSHVIAKVEGSGSYSITIKDARLEDSGKYACRATNPAGEAKTEANFAVV-----------KNLVPPEFVEKLSPLEVKEKESTTLSVKVVGTPEPSVEWFKD----DTPISIDNVHVIQKQTAVGSFSLTINDARQGDVGIYSCRARNEAGEALTTANFGIIRDSIPPE 3483          

HSP 13 Score: 64.6994 bits (156), Expect = 2.516e-9
Identity = 172/819 (21.00%), Postives = 296/819 (36.14%), Query Frame = 2
Query: 4085 LEIAHCQLSDSGQYKICFNPLEASKCGKVTGLFLVSIAPIKKNLKPID-----SNIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNNNLSF-LLIDSVKLEDSGTYICQGFTNKELISECKITLNVVDNISDTLQCQVKFEKDKYSIEINQDVTMRALIECTSTHY-SVSWFFNGEILEM-KSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCS--NNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGM-VDGKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMP--FGDPC---VLDNPFIDLYIESPQVNEHSGLYKCIVTN-------------------------------EKSETEFVEITVKFK-DEKVVSPILGELL-SCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLKI--------NESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILD-EFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSE 6367
            + I   +L DSG+Y  C     A +        +V      KNL P +     S +E    ES TL V V G  +  ++W   +  +  D +     + QK     SF L I+  +  D G Y C+    +    E   T N    I D++  +  F +    +E+ +  T+   +    T   +V WF + + + +  S I +  + +G    L I+       G+Y C   N+ G + T       E I+        K  E+ +G    L V  E + + + +W KD +  +  N  +           L        D G Y  +     GK   +    +     +   T +E +   I    E    +   +++  +V       I++ +ND P   G      VL++  I L I++ +  E  G Y+C   N                               E  + E V  T   K D    +P   ELL SCTV E       K +  ++ +V  +      W K+ K +  +              L   +V   DAG Y  +          E  + + ++  PK           + + P   +P++   +    ET   E ++         W+   EE+   +   I+   D    LT+  A      +Y  + +N+ G V SD  L++           E   +AP F K+L  I++   E  +  C+ +   KP + W KDG  L     ++RV     +     L+I +++ +D G Y    +N  G   ++  + V  SE
Sbjct: 3345 ITIKDARLEDSGKY-ACRATNPAGEAKTEANFAVV------KNLVPPEFVEKLSPLEVKEKESTTLSVKVVGTPEPSVEWFKDDTPISIDNV----HVIQKQTAVGSFSLTINDARQGDVGIYSCRA---RNEAGEALTTANF-GIIRDSIPPE--FTQKLRPLEVREQETLDLKVTVIGTPVPNVEWFKDDKPINIDNSHIFAKDEGSGHHT-LTIKQARGEDVGVYTCKATNEAGEAKTTANMAVQEEIEAPLFVQGLKPYEVEQGKPAELVVRVEGKPEPEVKWFKDGVPIAIDNQHVIEKKGENGSHTLVIKDTNNADFGKYTCQATNKAGKDETVGELKIPKYSFEK-QTAEEVKPLFIEPLKETFAVEGDTVVLECKVNKESHPQIKFFKNDQPVEIGQHMQLEVLEDGNIKLTIQNAK-KEDVGAYRCEAVNVAGKANTNADLKIQFAAKVEEHVTDESGQLEEIGQFETVGDTASSKTDTGRGAPEFVELLRSCTVTE-------KQQAILKCKVKGEPRPKIKWTKEGKEVEMSARVRAEHKDDGTLTLTFDNVTQADAGEYRCEAENEYGSAWTEGPIIVTLEGAPK----------IDGEAPDFLQPVKPAVV-TVGETAVLEGKISGKPKPSVKWYKNGEELKPSDRVKIENLDDGTQRLTVTNAKLDDMDEYRCEASNEFGDVWSDVTLTVK----------EPAQVAPGFFKELSAIQVKETETAKFECK-VSGTKPDVKWFKDGTPLKE---DKRVHFESTDDGTQRLVIEDSKTDDQGNYRIEVSNDAGVANSKVPLTVVPSE 4111          

HSP 14 Score: 59.6918 bits (143), Expect = 7.452e-8
Identity = 94/384 (24.48%), Postives = 157/384 (40.89%), Query Frame = 2
Query: 5282 FIDLYIESPQVNEHSGLYKCIVTNEKSETEFVEITVKFKDEKVVSP--ILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNET-DPRLTIIMQPFCYNLILRDVKMTDAGMYSLKIN------ESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEI-DAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRIIVK 6403
            F  + I+  QV + +G Y C+ TNE  +          K EK  +P   + +L     +E + I+    E  VE   P   +   VWL D++ L  + D RL    Q     L +RD +  D G+Y++KI       ES  ++ V+  P           KN   P+ +  ++ +   +E E V+F+  +      + IWF   + + ++E ++FI  S D    LTI        G  T Q +N +G    DGRL + +               P F K L+D  +  K  +     +   P+P + +T  G+ L +      +   D F   ++  T  +  D G       N  G   + A + V + E +ES S+   +K
Sbjct:  603 FFAMTIDPVQVTD-TGRYTCMATNEYGQASTSAFFRVLKVEKEAAPPAFVTKLRDKECKEGDVID---FECEVEG-WPEPEL---VWLVDDQPLRPSHDFRLQYDGQ--TAKLEIRDAQPDDTGVYTVKIQNEFGSIESKAELFVQADPD----------KNHVAPEFQATIEYVEC-DEGEEVRFKSVITGDPNPEIIWFINGKPLSESEKVKFI--SEDGICILTIKDVTRHFDGMVTCQGSNRLGSASCDGRLKVRVPP-----------APPTFNKPLEDKTVQEKSTVVFEVDVSGWPEPTLTFTLCGKELKNGEEGVEIVGHDGFYRISIPNTSMDKHD-GEIVAKAQNEHGTAESRARLTV-EQEEEESRSAPTFLK 950          

HSP 15 Score: 58.5362 bits (140), Expect = 1.779e-7
Identity = 40/181 (22.10%), Postives = 79/181 (43.65%), Query Frame = 2
Query: 9044 CCLSQKAELKFTKLMEYKLDKITWTFNNAKVDVNDERYKIFSAETYGIY-FIIKNLEEDDFGEYCA-----LDEVQDPIQSFILIKSDAPTILNCLPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIFSSYRTVITEDKEQGTYSLLISKCILSDGGEYSIRAENAIGFAEVKFNLRV 9568
              + +K E+K    +      + W F + K    D  +++      G++  ++K     D G+Y A         +   ++ +    + PT +  L    + ++E  ++SV +   P P V W ++ + + +    VI + +  G+YS+ I    L D G+Y+ RA N  G A+ + N  V
Sbjct: 3198 TSVKEKEEIKMEVKVGGSAPDVEW-FKDDKPVSEDGNHEMKKNPETGVFTLVVKQAATTDAGKYTAKASNPAGTAESSAEAEVTQSLEKPTFVRELVTTEVKINETATLSVTVKGVPDPSVEWLKDGQPVQTDSSHVIAKVEGSGSYSITIKDARLEDSGKYACRATNPAGEAKTEANFAV 3377          

HSP 16 Score: 56.9954 bits (136), Expect = 4.318e-7
Identity = 39/138 (28.26%), Postives = 64/138 (46.38%), Query Frame = 2
Query: 5957 CGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEP 6370
             GKYT  V N  G    +  L+++   E   +       AP F   L+D    + E + L C+++ +PKPK+ W  D +T+  + +   V+ ++     T  IT +E+   G+Y C+  N  G   TEA + V    P
Sbjct: 2959 AGKYTCIVENTAGKDTCEATLTVIESLEKKSEKK-----APEFIVALQDKTTKTSEKVVLECKVIGEPKPKVSWLHDNKTITQESIT--VESVEGVERVT--ITSSELSHQGKYTCIAENTEGTSKTEAFLTVQGEAP 3087          

HSP 17 Score: 55.4546 bits (132), Expect = 1.239e-6
Identity = 84/362 (23.20%), Postives = 144/362 (39.78%), Query Frame = 2
Query: 5327 GLYKCIVTNEKSETEF-----VEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVE-SRVPTKSIDSAVWLKDEKLLNETDPRLTI-IMQPFCYNLILRDVKMTDAGMYSL-------KINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPN--FTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDS 6364
            G+Y C+  NE  + E      VEI    ++EK         ++  +E+      + I LS +   +P  S+   VW KD   L   D R +I   +     L + D    D G Y          IN +S  + VKV  + ++K+ +E F         K L D++  +  ++   +  V      +  W+   + +       I+ S D   +LT+  +     G Y  +  N  G  ++     + +    +E+        P F  +L D+ +     I L C++   P P + W+KDG  L     + R +  +E     + L I  A V D G Y C+ TN  G  TT++ + + D 
Sbjct: 5346 GVYMCVAVNELGQAETQATYQVEILEHVEEEKRRE--YAPKINPPLEDKTVNGGQPIRLSCKVDAIPRASV---VWYKDGLPLR-ADSRTSIQYEEDGTATLAINDSTEEDIGAYRCVATNAHGTIN-TSCSVNVKVPKQEVKKEGEEPF-------FTKGLVDLWA-DRGDSFTLKCAVTGDPFPEIKWYRNGQLLRNGPRTVIETSPDGSCSLTVNESTMSDEGIYRCEAENAHGKAKTQATAHVQMALGKTEKPKMDEGKPPKFILELSDMSVSLGNVIDLECKVTGLPNPSVKWSKDGGPL---IEDSRFEWSNEASKGVYQLRIKNATVHDEGTYRCVATNENGSATTKSFVRMDDG 5689          

HSP 18 Score: 55.4546 bits (132), Expect = 1.477e-6
Identity = 206/1044 (19.73%), Postives = 399/1044 (38.22%), Query Frame = 2
Query: 3362 WFVNNELLDFKKWNGSVNVSESQVEINFPKSTNELSGIWQFRIDKPMKLFSPEISVNV-LAKEVAPLSTGFLDCEIEEIDLKIGETLSLTLNAKDIPIMTLKNGGWFLNSEPIHAVKFRGNEVIEENKVKIVIPNVTKEFSGLLQYRIVKPVELYSPEIIIKIRGSLIKQTPKIEEEKFESNLILELHNVSLNISENERILLEAKIISGNINSYKTPPQWFWNDEAVKNINCKKDFTSNLAQLEIAHCQLSDSGQYKICFNPLEASKCGKVTGLFLVSIAPIKKNLKP--IDSNIETC--PGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNNNLSFLL-IDSVKLEDSGTYICQGFTNKELISECKITLNVVDNISDTLQCQVKFE-----KDKYSIEINQDVTMRALIECTSTHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVTKNIE---ITEGNELNLEV-VSEIEKDLQFQWSKDDIDCSNNGIFNSTK-NKNCFNLTKLKAEITDSGVYKFEGMVDGKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMPFGDPCVLDNPFI---------DLYIESPQVNEHSGLYKCIVTNEKSETEF-VEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLK-INESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAI-WFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRIIVKPL 6409
            W+   E +   +    V V+ES+ ++     + E+S    +R+      FS E S  V + K    +S       + +  +  G  L L +  +  P    K+  W+ N + I   K    E +   K ++ IP+  ++  G  +Y +    E    E   K+    +   P+I      S L      V   + + E      K+  G +   K    W+ N + + +   K +   + + LEI + Q+ D+  YK+  +  +A        L +      K  +KP  +   I T    GE+ T  V V+G  K+ +KW       K  K +   +   K N + S+ L I + +L+D+  Y               +  N   +   +    VK       K     E+ +       +E       + W+ NG+ +   SD      +     +L I +  +     Y+ ++ ++DGN++ +   L V+    +    + K +E   ++ G+ + LE+  S   K +++  +  ++  +        K + N + L    + + D+G YK         +E+ +     N    I  T E ++  +    +  +++ +    SVE  N K  +++W +N    G     ++ FI          L I++  V + +  YK ++ N   E E   ++TVK     +   + G       +    + + KI+   E            WL+D  +++     +   +    Y LI+    + DAG Y+++ INES          K       E+ +    P+I + L++I I   PE     F+VE S   + + W+  ++EI   +    +      + L I  A       Y + ++N  G   S   L+++  + +                 LKD+++   + + L  ++   PK  I W K+G+ L       + +   E   F+L I  ++  D G Y  +  N  G   + +V+ V  ++  E  S    + PL
Sbjct: 4145 WYKGTETVTSSQTTKIVQVTESEYKLEI--ESAEMSDTGAYRVVLSTDSFSVESSATVTVTKAAEKISLPSFKKGLADQSVPKGTPLVLEVEIEGKP----KDVKWYKNGDEIKDGKV---EDLGNGKYRLTIPDFQEKDVG--EYSVTAANEAGEIESKAKVN---VSAKPEIV-----SGL------VPTTVKQGETATFNVKV-KGPVKGVK----WYKNGKEIPDAKTKDNGDGSYS-LEIPNAQVEDAADYKVVVS-NDAGDADSSAALTVKLADDGKDKVKPEIVSGLIPTTVKQGETATFNVKVKGPVKQ-VKW------YKNGKEIPNAKA--KDNGDGSYSLEIPNAQLDDTADYKV-------------VVSNDAGDADSSAALTVKLPGIAIVKGLEDAEVPKGKKAVLQVETNKKPKEIKWYKNGKEI-TPSDKAQPGSDGDNKPQLVIPDAGDDDAAEYKVVLTDEDGNTADSSCALTVKLPAKEP--KIIKGLEDQVVSIGSPIKLEIETSGSPKTVKWYKNGKELPGAAAKTIKIQKIDDNKYVLEIPSSVVEDTGDYK---------VEVANEAGSANSSGKI--TVEPKITFLKPLKDQSITEGENAEFSVET-NTKPRIVKWYKN----GQEIKPNSRFIIEQKTDTKYQLVIKN-AVRDDADTYKIVLENTAGEAESSAQLTVKKAKAGLCKIVKGLEDQVVAKGAKMVFEVKIQGEPED---------VRWLRDANVISAGANAIIEKIDDTTYRLIIPSADLKDAGEYTVEVINESG---------KAKSDAKGEVDEK---PEIVRGLENIEI---PEGDDDVFKVEVSAPVRQVKWYKNDQEIKPNSHLEAKKIGPKKYELAINRAQLDDGADYKVVLSNAAGDCDSSAALTVVKPNVLK------------IVDGLKDVDVEEPQPVELKVKVEGIPK-VIKWYKNGQELKPDADGFKFEEKPESGEFSLTIPSSKKSDGGAYRVVLGNDKGEVYSGSVVHVKSAKSSEPTSGANFLSPL 5077          

HSP 19 Score: 53.9138 bits (128), Expect = 4.532e-6
Identity = 138/651 (21.20%), Postives = 257/651 (39.48%), Query Frame = 2
Query: 4472 ECKITLNVVDNISDTLQCQVKFEKDKYSIEINQ-DVTMRALIECTSTHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNS-STARTELNVEN---IQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCSNNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGM----VDGKLLEL-VHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGV-IQWLRNDMPFGDP---CVLDNPFIDLYIESPQVN-EHSGLYKCIVTNEKSETEF-VEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVW-LKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLKINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRM-MCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEP 6370
            E K  L V++   +T + +  F      +E+ + D     +I   S  Y   W+ NG +LE   + ++ IKN    + L I N  +S +   E    N+ G+S S+A+  +N  +   I +D   SVT  I+ TE  E    +       ++  W+ ++     +    + K ++ + L    A+I  +G  K         D K  +L V   V+    +S LT             + +  + +PL  ++E+     G  + WL N  P        V+D+     ++   +   E SG       N   E E   ++TV   ++K       E +        T+E E ++ S  + V  K + +  W L ++KL+   + ++  + +    ++ ++   M   G   ++    S  +    + K        + K  ++P+    + D  ++ E E VKF   VE        W    E + +++        D    + I A   +  G+ + +  N +G  + D +L++           +    AP F K L+D  I   E   ++ ++ +  PKPKI W KDG  + S    + V+  +E  +  L I + ++ED GR      +  G     A + V    P
Sbjct: 1965 ETKTELKVLETPKETKKPE--FTDKLRDMEVTKGDTVQMDVIALHSPLYK--WYQNGNLLEDGKNGVT-IKNEENKSSLIIPNAQDSGKITVEA--SNEVGSSESSAQLTVNPPSTTPIVVDGPKSVT--IKETETAEFKATISGFPAPTVK--WTINEKIVEESRTITTIKTEDVYTLKISNAKIEQTGTVKVTAQNSAGQDSKQADLKVEPNVKAPKFKSQLT-------------DKVADEGEPLRWNLELDGPSPGTEVSWLLNGQPLTKSDTVQVVDHGDGTYHVTIAEAKPEMSGTLTAKAKNAAGECETSAKVTVNGGNKKP------EFVQAPQNHETTLE-ESVKFS--AIVTGKPMPNVTWYLNNKKLIQSEEVKVKYVHETGKTSIRIQKPLMEHNGTIRVEAENVSGKVQATAQLK--------VDKKTEVPKFTTNMDDRQVK-EGEDVKFTANVEGYPEPSVAWTLNGEPV-SKHPNITVTDKDGEHTIEISAVTPEQAGELSCEATNPVGSKKRDVQLAV-----------KKVGDAPTFAKNLEDRLITEGELTLMDAKLNIVKPKPKITWLKDGVEITSDGHYKIVE--EEDGSLKLSILQTKLEDKGRITIKAESEFGVAECSASLGVVKGRP 2559          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: Unc-89 (gene:FBgn0053519 transcript:FBtr0343286)

HSP 1 Score: 135.576 bits (340), Expect = 9.079e-31
Identity = 137/614 (22.31%), Postives = 256/614 (41.69%), Query Frame = 2
Query: 8705 EREITLSWSPP-RISPDLYIPFTVDVECRPVNYSYSDEEGWSVFKTNIKKNRVDIADLDPNINYQLRIVPVTDFGIGKPSMVIKKIRRSDNLNSPTT------------EKAMMLQEKHCLAVPMFCCLSQKAELKF-------------TKLM----EYKLDKITWTFNNAKVDVNDERYKIFSAETYGIYFIIKNLEED-DFGEYCALDEVQDPIQSFILIKSDAPTILNCLPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIFSSYRTVITEDKEQGTYSLLISKCILSDGGEYSIRAENAIGFAEVKFNLRVDA------------HPEKKSVQINIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEINNMGIGR--------SEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLA-EYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLC--GFSNAVPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGH-----------LKVNFEGDQLYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWF 10351
            +R + LSW+P   ++P   I + +++   P       E  W   +T ++    DI +L+P  +Y+ R+     FG+  PS   +  R+    + P T            E +    +   +  P    L+Q  +                T+LM     Y   K+T+ F++  ++      + ++       FI K L+ D  + E  A +E  +  Q   L  ++ P  L       +   +N  I  ++   P PEV W ++WK I  S R  I+   +   Y L I   I+ DGG YSI A N  G       + ++             HP  +S Q+      D+Y    +L +G+       +E+S+   +  K         GR        +E + +   +H+N++  +DA    D+ + LI E   G  L  + + +  ++ E  +   I Q +  + ++HE  V H+ +  ++++++    +I+K+   G S  + + +  +  + G+   F +PE++  E + F+ DMW++G++T++ L GH           L    EG   + ++    IS+    FI + LL    ER+    +L H WF
Sbjct: 1939 DRGLLLSWNPSVPLTPRYPITYQIEMMDLP-------EGDWRTLRTGVRSCACDIRNLEPFRDYRFRVRVENKFGVSDPSPYTQTYRQKLVPDPPKTYTYLPPGTDFRPETSPYFPKDFDIERPPHDGLAQAPQFLLREQDISYGVKDHNTELMWFVYGYPKPKMTYYFDDMLIESGGRFDQSYTRNGQATLFINKMLDRDVGWYEAVATNEHGEARQRVRLEIAEHPRFLKRPDETFIMARKNGRIEAKLVGIPLPEVHWFKDWKPIVDSSRIKISS-YDPDIYVLSIHDSIIKDGGLYSISARNIAGSISTSVTVHIEENEDQYIYKTYGRHPYVRSKQLRY---QDKYDIGDELGRGTQGITYHAVERSSGDNYAAKIM------YGRPELRPFMLNELEMMNTFNHKNLIRPYDAYDT-DRSVTLIMELAAGGELVRDNLLRRDYYTERDIAHYIRQTLWGLEHMHEMGVGHMGLTIKDLLISVVGGDIIKVSDFGLSRKINRHNLSTLDY-GMPE-FVSPEVVNKEGVNFSHDMWTVGLITYVLLGGHNPFLGIDDRETLTKIREGRWDFKDEIWTHISDDGRDFISRLLLYSPEERMDVKTALKHPWF 2532          

HSP 2 Score: 116.316 bits (290), Expect = 5.858e-25
Identity = 103/426 (24.18%), Postives = 192/426 (45.07%), Query Frame = 2
Query: 10808 LGSEPISISWYKNQELLTDDSRIKLEVIKGGFLSCTILNATETDVGIFRCIARCHSLRTETSARLVLGDVPPQPEQLSVYYTNQEEVLLKWSPYLSAIDDVIYRIDIRTIDSR-NKIRNWKTIGYSVDNR-YLLENLDRTQQYIARIIAQNKYGYSPYSI--ATSVFQNKIRNIHSLK-----QALIFNRKWMLTSRQSNHFNDLHDLIKDISSDDIRMNVIREHYSTLSQKSSGFAVLKLKNTNVNFPEYIVQRTFKMED-----ICPAFDLCVRIKYYHFPILFGEICDSSLGNRITFEEFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRYESDIWSLGILSFLLLATQLP 12043
            +G     + W+KN  +LT+  RIK+ V + G        A   DVG+++ +AR    +T    R+V+  +P  P+   +   +  E+LL+W       DD    +   ++  + +    W T+  ++D+  YLL +L     Y  R+ ++N+ G+S   I  + S        IH  K     Q L  N   ++   +  H  D H   +    + +  + + + YS +S+ + G     +K    +    +V +  ++ D     +   FD    +++   P LF      ++   I   E + G ++L+   +R  YSE  V T++ QLL  +Q+LH     H NI+P  ++++  + +S  +KL+   + + V  +  +  +T      F+ PE   +     +SDIWSLG L++LLL+   P
Sbjct: 2770 VGDPKPCVQWFKNDMVLTESKRIKISVDEDGRSILRFEPALHFDVGVYKVVARNKVGQTVARCRIVVATLPDAPDSPEISANSGTEILLRWK---QPRDDGHSTVLCYSLQYKLSNCDAWTTVADNIDHEFYLLHDLQPNTNYQFRLASKNRIGWSEMGIPVSASTVGGDAPKIHITKAMKHLQQLTENGHQVVPEEERVH-TDYH--CEREPPNWVTDSSVSDKYSFISEIARGEFSTIVKGIQKSTDTVVVAKILEVTDENEDNVVAEFDNFKTLRHERIPALFSAYKPLNVPIAIFVMEKLQGADVLTYFSSRHEYSEQMVATVVTQLLDALQYLHWRGYCHLNIQPDNVVMA--SVRSIQVKLVDFGSAKKVNKLGMK--VTPCGSLDFQPPEMINDEPIFPQSDIWSLGALTYLLLSGCSP 3185          

HSP 3 Score: 109.383 bits (272), Expect = 7.566e-23
Identity = 73/264 (27.65%), Postives = 119/264 (45.08%), Query Frame = 2
Query: 9614 VNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEINNMGIGR--SEFQCIQNISHRNIVEIFDA---IAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQLYNEDSN------------DAISNSACVFIRKCLLLKTGERLTSSDSLSHEWFI 10354
            V+D+Y  + ++A+G +S     I+KST    + K  E+ +       +EF   + + H  I  +F A   + +P    + + EKLQG  +  Y +    + E  V  ++ QL+ A+ YLH    CHL+I+P+N++M    +  +KL  F +A      G +     +  F  PE++  EPI   SD+WS+G LT+L L G     F G   Y    N              ++  A  FI         +R  + D L H W +
Sbjct: 2985 VSDKYSFISEIARGEFSTIVKGIQKSTDTVVVAKILEVTDENEDNVVAEFDNFKTLRHERIPALFSAYKPLNVP--IAIFVMEKLQGADVLTYFSSRHEYSEQMVATVVTQLLDALQYLHWRGYCHLNIQPDNVVMASVRSIQVKLVDFGSAKKVNKLGMKVTPCGSLDFQPPEMINDEPIFPQSDIWSLGALTYLLLSGCSP--FRGADEYETKQNISFVRYRFENLFKEVTPEATRFIMLLFKRHPTKRPYTEDCLEHRWLM 3244          

HSP 4 Score: 95.9005 bits (237), Expect = 1.131e-18
Identity = 180/814 (22.11%), Postives = 305/814 (37.47%), Query Frame = 2
Query: 4073 NLAQLEIAHCQLSDSGQYKICFNPLEASKCGKVTGLFLVSIAP----IKKNLKPID----SNIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQD----KILQEKRITQKFNNNLSF--LLIDSVKLEDSGTYICQGFTNKELISECKITLNVVD--NISDTLQCQVKFEKDKYSIEINQDVTMRALIECTSTHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNS-VTKNIEITEGNELNLEVVSEIEKDLQ--------FQWSKD----DIDCSNNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGMVD-GKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRN--DMPFGDPCVLDNPFIDLYIESPQVN------EHSGLYKCIVTNEKSET-EFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLK-INE-----SSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIA----PLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSE 6367
            N  +L+I +C  +D+G Y I      AS+   V+    V  AP     K N +P       + E          V + G  K  +K+   E ++ +     +I+++K       + L F  L+I  V+  D+GTY C+  TNK   + C+     V+  N    L  Q+    +K   +                     W  NGE  + +         +     L  Q+      GIY C+ +   GN S +  EL+V+   I  LN    K   + E  E N  +      +LQ         QW  D     +D  +  ++   +++   +L     +  D+GVY  E + + G+    ++  V+  P          ++K I +   I  S  + + + +EV  + Q  +Q   N  D+       + +  I   +E   V         +G Y    TN+ S+T E+   TVK K      P++ +       E   I  EK  + +  R+         W  DE  +  TD + T+      Y L +      DAG Y++K  NE     SS  +L+K  P+   K                 L++I +      V+    V+      A W+ +  EID +  +F      N F L +        G YT ++ ND G                  ++ ++C +     P   + LK++E+   ++  L   +  +P+ KI W KDG  +      +  +      N+ L +  A  ED+G Y    TNF+G  T+   + V  SE
Sbjct:  164 NSYRLDIKNCSETDAGTYTI--RAQSASETTTVSAQLAVGQAPGHDETKTNTEPAFLVSLKDAEMIENTLFRFMVKIIGDPKPRVKFYKDEKEILETNDRIQIIRDK-------DYLGFYELVIADVQKTDAGTYSCKA-TNKHGEANCEAIATTVEDKNPFGALSGQILPAGEKPVFQ---------------------WKRNGEEFDPEERFKVLFGEDEDSLALVFQHVKPEDAGIYTCVAQTSTGNISCS-AELSVQG-AIQTLNREPEKPTLVIEHREANASIGGSAILELQCKGFPKPAVQWKHDGEVIQVDDRHKFMY---EDEESMSLVIKNVDTVDAGVYTIEAINELGQDESSINLVVKAPP----------KIKKITD---ITCSAGETIKMEIEVEGFPQPTVQVTNNGKDVTAESNVKISSSSIGKSLEKVVVEVKEIKLSQAGNYSIKATNDLSQTSEYWSCTVKSK------PVIVKNF-----ESEYIHGEKENVQMTVRIDAYPEAKLTWYHDETEIKITDSKYTVSSDGNAYTLKITGATRVDAGKYTVKATNEHGSATSSTQLLIKCAPEFTHK-----------------LKNITVAEGDSNVELVVGVDAYPRPHAKWYIDGIEIDEKRNDFRHVEEGNDFKLIMNQVATNMQGNYTCKIMNDYG------------------KLEDNCVVTVNCKPKVKRGLKNVEVQEGKSFTLEVEVYSEPEAKIKWFKDGHEIYEDARIKISRDTQRIENYYLTLNLARTEDAGTYEMKATNFIGETTSTCKVAVLTSE 882          

HSP 5 Score: 92.0485 bits (227), Expect = 1.307e-17
Identity = 110/405 (27.16%), Postives = 176/405 (43.46%), Query Frame = 2
Query: 5150 DNEIILSDSKPLIISVEVLNWKQGVIQWLRND---MPFGDPCVLDNP--FIDLYIESPQVNEHSGLYKCIVTNEKSETEFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCY-NLILRDVKMTDAGMYSLKINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIF-IRNEPETVKFEFEVEESGAKKAIWFFENEEI--DAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTT 6337
            DN + +   +PL++   V       +QWL++     P     +  NP   + L I S Q N+ SG YK I++N   E +     V  K E++    L  + S TV     +  E ++L  E++V         W KD  LL  + P +  I  P     LI+   +  DAG+Y   I     +I    + + + K++K +F           LQD   I   P  VK + +V  +   K  WF    EI  DA ++  ++ + DN  +L I        G Y +   N  G   S  +L +  +++  E   E    AP F   L+D+     + + L+   + +P P+++W+KDG TL     N R+ +  +  +  L I  AE  DSG Y CL  N LG D++
Sbjct: 1319 DNALDVLQGEPLVLECCVDGSPLPTVQWLKDGDEVKPSESIKISTNPDGLVKLEINSCQPND-SGAYKLIISNPHGE-KVALCAVAVKPEEMQPKFLKPITSQTV-----VVGEPLKL--EAQVTGFPAPEVKWYKDGMLLRPS-PEINFINSPNGQIGLIIDAAQPLDAGVYKCLIANKGGEIEGVSKVEIVPKESKPVFV--------AELQDASSIEGFP--VKMDIKVVGNPKPKLQWFHNGHEIKPDASHIAIVE-NPDNSSSLIIEKTAPGDSGLYEVIAQNPEGSTASKAKLYVAPKAD--ETATEE---APQFVSALRDVNADEGQELVLSAPFISNPMPEVIWSKDGVTLTP---NERLLMTCDGKHIGLTIKPAEAADSGNYTCLLANPLGEDSS 1694          

HSP 6 Score: 68.1662 bits (165), Expect = 2.542e-10
Identity = 99/386 (25.65%), Postives = 160/386 (41.45%), Query Frame = 2
Query: 3929 SLNISENERILLEAKIISGNINSYKTPPQWFWNDEAVKNINCKKDFTS--NLAQLEIAHCQLSDSGQYK-ICFNPLEASKCGKVTGLFLVSIAPIK---KNLKPIDSNIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFN--NNLSFLLIDSVKLEDSGTYICQGFTNKELISECKITLNVVDNISDTLQCQVKFEKDKYSIE---INQDVTMRALIECTSTHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLN-------SVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCSNNGIFNSTKNKNCFNLTKLKAEITDSGVY 5032
            +L++ + E ++LE  +    + +     QW  + + VK     K  T+   L +LEI  CQ +DSG YK I  NP      G+   L  V++ P +   K LKPI S      GE + L   V GF   ++KW       K   +L+        N  N    L+ID+ +  D+G Y C    NK    E    + +V   S  +   V   +D  SIE   +  D+ +       +    + WF NG  ++  +  ++ ++N    + L I+       G+YE + +N +G S+ ++ +L V     +          S  +++   EG EL L          +  WSKD +  + N     T +     LT   AE  DSG Y
Sbjct: 1321 ALDVLQGEPLVLECCVDGSPLPTV----QWLKDGDEVKPSESIKISTNPDGLVKLEINSCQPNDSGAYKLIISNP-----HGEKVALCAVAVKPEEMQPKFLKPITSQTVVV-GEPLKLEAQVTGFPAPEVKW------YKDGMLLRPSPEINFINSPNGQIGLIIDAAQPLDAGVYKCL-IANKGGEIEGVSKVEIVPKESKPVF--VAELQDASSIEGFPVKMDIKV-----VGNPKPKLQWFHNGHEIKPDASHIAIVENPDNSSSLIIEKTAPGDSGLYEVIAQNPEG-STASKAKLYVAPKADETATEEAPQFVSALRDVNADEGQELVLSAPFISNPMPEVIWSKDGVTLTPNERLLMTCDGKHIGLTIKPAEAADSGNY 1681          

HSP 7 Score: 64.6994 bits (156), Expect = 2.567e-9
Identity = 201/958 (20.98%), Postives = 369/958 (38.52%), Query Frame = 2
Query: 3629 LNAKDIPIMTLKNGGWFLNSEPIHAVKFRGNEVIEENKVKIVIPNVTKEFSGLLQYRIVKPVELYSPEIIIKIRGSLIKQTPKIEEEKFESNLILELHNVSLNISENERILLEAKIISGNINSYKTPPQWFWNDEAVKNINCKKDFT---SNLAQLEIAHCQLSDSGQYKI-CFNPLEASKCGKVTGLFLVSIAPIKKNLKPIDSNIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNNNLSFLLIDSVKLEDSGTYICQGFTNKELISECKITLNVVDNISDTLQCQVK--------FEKDKYSIEINQDVTMRALIECTSTHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVT---KNIEITEGNELNLEVVSEIEK--DLQFQWSKDDIDCS-NNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGMVD-GKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMPF---------GDPCVLDNPFIDLYIESPQVNEHSGLYKCIVTNEKSETEFV-EITVKFKDEKVVSPILGELLSCTVEE-----------VNTIED---EKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLKI----------NESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPET----VKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEF--PNFTLIITEAEVEDSGRYCCLGTNFLG 6325
            L A + P+   K  G   + E    V F  +E    + + +V  +V  E +G+            S    + ++G++  QT   E EK    L++E    + +I  +  + L+ K        +  P   + +D  V  ++ +  F         L I +    D+G Y I   N L   +    + + LV  AP K  +K I ++I    GE++ + ++VEGF +  ++      D+  +  ++    +   +     + +  +KL  +G Y  +               N +   S+   C VK        FE +    E  ++V M   I+       ++W+ +   +++ +D    + ++G    LKI        G Y     N+ G S+T+ T+L      I C    T   KNI + EG+  N+E+V  ++       +W  D I+       F   +  N F L   +      G Y  + M D GKL +    TV   P          ++K   ++ E+   + K   + VEV +  +  I+W ++              D   ++N ++ L +      E +G Y+   TN   ET    ++ V   +   +   + + L  T EE           V+  +    E + L  E          A+W  D K +   D    I +    Y L ++ + + DAG Y + +           E S+  + + R KPI  Q   + K++K+ +  K  + +    +P      +K    V E+   K     + ++ DAEN   +Q++C     L I  A  K  G+Y ++V N  G + + G + ++ + EIS                L D + L  + I     +  +PKPK+ WT+  E L   C +   +++ +     + L+       + G+Y    TN  G
Sbjct:  323 LPAGEKPVFQWKRNGEEFDPEERFKVLFGEDE----DSLALVFQHVKPEDAGIYTCVAQTSTGNISCSAELSVQGAI--QTLNREPEK--PTLVIEHREANASIGGSAILELQCK-------GFPKPAVQWKHDGEVIQVDDRHKFMYEDEESMSLVIKNVDTVDAGVYTIEAINELGQDE----SSINLVVKAPPK--IKKI-TDITCSAGETIKMEIEVEGFPQPTVQVTNNGKDVTAESNVKISSSSIGKSLEKVVVEVKEIKLSQAGNYSIKA-------------TNDLSQTSEYWSCTVKSKPVIVKNFESEYIHGE-KENVQMTVRIDAYP-EAKLTWYHDETEIKI-TDSKYTVSSDGNAYTLKITGATRVDAGKYTVKATNEHG-SATSSTQL-----LIKCAPEFTHKLKNITVAEGDS-NVELVVGVDAYPRPHAKWYIDGIEIDEKRNDFRHVEEGNDFKLIMNQVATNMQGNYTCKIMNDYGKLEDNCVVTVNCKP----------KVKRGLKNVEV--QEGKSFTLEVEVYSEPEAKIKWFKDGHEIYEDARIKISRDTQRIENYYLTLNLAR---TEDAGTYEMKATNFIGETTSTCKVAVLTSEALSLEQTVTKTLIATTEEPEEGAVPEIVHVDVFQQHSYESVPLKYEVIATGIPKPEAIWYHDGKPIT-PDKHTAITVDGDHYKLEVQSLDLVDAGEYKVVVQNKVGEKSHQGELSLSGIAEYR-KPILTQGPGL-KDIKVNKGDKVCEPVVFTADPAPEIVLLKDGQPVVETNNVK----LKVDKKDAENG-LVQYTC----TLNILEAEIKDSGRYELKVKNKYGELVTSGWIDVLAKPEIS---------------GLNDTKCLPGDTICFEALVQANPKPKVSWTRGNENL---CNHENCEVIADVDADKYRLVFQSVSPCEDGKYTITATNSEG 1190          

HSP 8 Score: 63.1586 bits (152), Expect = 7.889e-9
Identity = 122/575 (21.22%), Postives = 230/575 (40.00%), Query Frame = 2
Query: 4703 LKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCS-NNGIFNSTKNKNCFNLTKLKAEITDSGVYKFE-GMVDGKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDM---PFGDPCVLDNP--FIDLYIESPQVNEHSGLYKCIVTNEKSETEFV-EITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQP-FCYNLILRDVKMTDAGMYSLKIN--ESSVDILVK--VRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDN-YFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDS 6385
            L I++  E+  G Y C+  N+ G  + A  +L + ++    +  +   +++ +G  L LE   +       QW KD  +   +  I  ST       L     +  DSG YK       G+ + L    V+   +Q         LK I     ++    +PL +  +V  +    ++W ++ M   P  +   +++P   I L I++ Q  + +G+YKC++ N+  E E V ++ +  K+ K V   + EL     ++ ++IE   +++ +  +V         W  +   +      + I+  P    +LI+      D+G+Y +     E S     K  V PK     T+E       PQ    L+D+   +E + +        +   + IW    + +     E +  +CD  +  LTI  A     G YT  +AN +G             S      +      P+FT+K+ D + +   N ++   +   P P + W    + +     + +  I ++  +  LI+   E  D G Y C+ +N  G D T+  + + +   K S S
Sbjct: 1275 LDIKSFRENDVGAYTCVATNEIG-VTKAPFKLAMLSLAPSFVKKLDNALDVLQGEPLVLECCVDGSPLPTVQWLKDGDEVKPSESIKISTNPDGLVKLEINSCQPNDSGAYKLIISNPHGEKVALCAVAVKPEEMQPKF------LKPITSQTVVV---GEPLKLEAQVTGFPAPEVKWYKDGMLLRPSPEINFINSPNGQIGLIIDAAQPLD-AGVYKCLIANKGGEIEGVSKVEIVPKESKPV--FVAEL-----QDASSIEGFPVKMDI--KVVGNPKPKLQWFHNGHEIKPDASHIAIVENPDNSSSLIIEKTAPGDSGLYEVIAQNPEGSTASKAKLYVAPKADETATEEA------PQFVSALRDVNA-DEGQELVLSAPFISNPMPEVIW--SKDGVTLTPNERLLMTCDGKHIGLTIKPAEAADSGNYTCLLANPLG-----------EDSSACNANVRKVYKPPVFTQKISDQQQVFGNNAKIPVTVSGVPYPDLEWYFQDKPIPK---SEKYSIKNDGDHHMLIVNNCEKGDQGVYKCIASNREGKDITQGRLDIVNEIKKHSRS 1806          

HSP 9 Score: 57.3806 bits (137), Expect = 3.849e-7
Identity = 59/237 (24.89%), Postives = 104/237 (43.88%), Query Frame = 2
Query: 5711 RKQTKEIFKNLKIPQIKKPLQDIFIRNEP-ETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCD--NYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKD-GETLDSKCLNRRVKIL---DEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAV-IIVTDSEPKESDSSRII 6397
            R Q     +++  P + K L+ + +  EP ET  FE + ++       W  +N+ ++    + I  +    N + L I    E   G YTI+  +         +L++       E    +    P F   LKD E++     R   +++ DPKP++ + KD  E L++   N R++I+   D    + L+I + +  D+G Y C  TN  G    EA+   V D  P  + S +I+
Sbjct:   96 RLQEDRPLRSVDKPVVVKMLKSVQV--EPGETAHFEIQFKDQPGL-VTWLKDNKPLEDRLADRITQTAAPMNSYRLDIKNCSETDAGTYTIRAQSASETTTVSAQLAVGQAPGHDETKTNT---EPAFLVSLKDAEMIENTLFRFMVKIIGDPKPRVKFYKDEKEILET---NDRIQIIRDKDYLGFYELVIADVQKTDAGTYSCKATNKHGEANCEAIATTVEDKNPFGALSGQIL 323          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: Unc-89 (gene:FBgn0053519 transcript:FBtr0113464)

HSP 1 Score: 135.191 bits (339), Expect = 1.343e-30
Identity = 136/610 (22.30%), Postives = 257/610 (42.13%), Query Frame = 2
Query: 8705 EREITLSWSPP-RISPDLYIPFTVDVECRPVNYSYSDEEGWSVFKTNIKKNRVDIADLDPNINYQLRIVPVTDFGIGKPSMVIKKIRRSDNLNSPTT------------EKAMMLQEKHCLAVPMFCCLSQKAELKF-------------TKLM----EYKLDKITWTFNNAKVDVNDERYKIFSAETYGIYFIIKNLEED-DFGEYCALDEVQDPIQSFILIKSDAPTILNCLPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIFSSYRTVITEDKEQGTYSLLISKCILSDGGEYSIRAENAIGFAEVKFNLRVDA------------HPEKKSVQINIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFF----EINNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLA-EYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLC--GFSNAVPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGH-----------LKVNFEGDQLYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWF 10351
            +R + LSW+P   ++P   I + +++   P       E  W   +T ++    DI +L+P  +Y+ R+     FG+  PS   +  R+    + P T            E +    +   +  P    L+Q  +                T+LM     Y   K+T+ F++  ++      + ++       FI K L+ D  + E  A +E  +  Q   L  ++ P  L       +   +N  I  ++   P PEV W ++WK I  S R  I+   +   Y L I   I+ DGG YSI A N  G       + ++             HP  +S Q+      D+Y    +L +G+       +E+S+   +  K      E+    +  +E + +   +H+N++  +DA    D+ + LI E   G  L  + + +  ++ E  +   I Q +  + ++HE  V H+ +  ++++++    +I+K+   G S  + + +  +  + G+   F +PE++  E + F+ DMW++G++T++ L GH           L    EG   + ++    IS+    FI + LL    ER+    +L H WF
Sbjct: 2847 DRGLLLSWNPSVPLTPRYPITYQIEMMDLP-------EGDWRTLRTGVRSCACDIRNLEPFRDYRFRVRVENKFGVSDPSPYTQTYRQKLVPDPPKTYTYLPPGTDFRPETSPYFPKDFDIERPPHDGLAQAPQFLLREQDISYGVKDHNTELMWFVYGYPKPKMTYYFDDMLIESGGRFDQSYTRNGQATLFINKMLDRDVGWYEAVATNEHGEARQRVRLEIAEHPRFLKRPDETFIMARKNGRIEAKLVGIPLPEVHWFKDWKPIVDSSRIKIS-SYDPDIYVLSIHDSIIKDGGLYSISARNIAGSISTSVTVHIEENEDQYIYKTYGRHPYVRSKQLRY---QDKYDIGDELGRGTQGITYHAVERSSGDNYAAKIMYGRPELRPFML--NELEMMNTFNHKNLIRPYDAYDT-DRSVTLIMELAAGGELVRDNLLRRDYYTERDIAHYIRQTLWGLEHMHEMGVGHMGLTIKDLLISVVGGDIIKVSDFGLSRKINRHNLSTLDY-GMPE-FVSPEVVNKEGVNFSHDMWTVGLITYVLLGGHNPFLGIDDRETLTKIREGRWDFKDEIWTHISDDGRDFISRLLLYSPEERMDVKTALKHPWF 3440          

HSP 2 Score: 116.316 bits (290), Expect = 6.852e-25
Identity = 103/426 (24.18%), Postives = 192/426 (45.07%), Query Frame = 2
Query: 10808 LGSEPISISWYKNQELLTDDSRIKLEVIKGGFLSCTILNATETDVGIFRCIARCHSLRTETSARLVLGDVPPQPEQLSVYYTNQEEVLLKWSPYLSAIDDVIYRIDIRTIDSR-NKIRNWKTIGYSVDNR-YLLENLDRTQQYIARIIAQNKYGYSPYSI--ATSVFQNKIRNIHSLK-----QALIFNRKWMLTSRQSNHFNDLHDLIKDISSDDIRMNVIREHYSTLSQKSSGFAVLKLKNTNVNFPEYIVQRTFKMED-----ICPAFDLCVRIKYYHFPILFGEICDSSLGNRITFEEFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRYESDIWSLGILSFLLLATQLP 12043
            +G     + W+KN  +LT+  RIK+ V + G        A   DVG+++ +AR    +T    R+V+  +P  P+   +   +  E+LL+W       DD    +   ++  + +    W T+  ++D+  YLL +L     Y  R+ ++N+ G+S   I  + S        IH  K     Q L  N   ++   +  H  D H   +    + +  + + + YS +S+ + G     +K    +    +V +  ++ D     +   FD    +++   P LF      ++   I   E + G ++L+   +R  YSE  V T++ QLL  +Q+LH     H NI+P  ++++  + +S  +KL+   + + V  +  +  +T      F+ PE   +     +SDIWSLG L++LLL+   P
Sbjct: 3678 VGDPKPCVQWFKNDMVLTESKRIKISVDEDGRSILRFEPALHFDVGVYKVVARNKVGQTVARCRIVVATLPDAPDSPEISANSGTEILLRWK---QPRDDGHSTVLCYSLQYKLSNCDAWTTVADNIDHEFYLLHDLQPNTNYQFRLASKNRIGWSEMGIPVSASTVGGDAPKIHITKAMKHLQQLTENGHQVVPEEERVH-TDYH--CEREPPNWVTDSSVSDKYSFISEIARGEFSTIVKGIQKSTDTVVVAKILEVTDENEDNVVAEFDNFKTLRHERIPALFSAYKPLNVPIAIFVMEKLQGADVLTYFSSRHEYSEQMVATVVTQLLDALQYLHWRGYCHLNIQPDNVVMA--SVRSIQVKLVDFGSAKKVNKLGMK--VTPCGSLDFQPPEMINDEPIFPQSDIWSLGALTYLLLSGCSP 4093          

HSP 3 Score: 109.768 bits (273), Expect = 6.365e-23
Identity = 73/264 (27.65%), Postives = 119/264 (45.08%), Query Frame = 2
Query: 9614 VNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEINNMGIGR--SEFQCIQNISHRNIVEIFDA---IAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQLYNEDSN------------DAISNSACVFIRKCLLLKTGERLTSSDSLSHEWFI 10354
            V+D+Y  + ++A+G +S     I+KST    + K  E+ +       +EF   + + H  I  +F A   + +P    + + EKLQG  +  Y +    + E  V  ++ QL+ A+ YLH    CHL+I+P+N++M    +  +KL  F +A      G +     +  F  PE++  EPI   SD+WS+G LT+L L G     F G   Y    N              ++  A  FI         +R  + D L H W +
Sbjct: 3893 VSDKYSFISEIARGEFSTIVKGIQKSTDTVVVAKILEVTDENEDNVVAEFDNFKTLRHERIPALFSAYKPLNVP--IAIFVMEKLQGADVLTYFSSRHEYSEQMVATVVTQLLDALQYLHWRGYCHLNIQPDNVVMASVRSIQVKLVDFGSAKKVNKLGMKVTPCGSLDFQPPEMINDEPIFPQSDIWSLGALTYLLLSGCSP--FRGADEYETKQNISFVRYRFENLFKEVTPEATRFIMLLFKRHPTKRPYTEDCLEHRWLM 4152          

HSP 4 Score: 95.9005 bits (237), Expect = 1.020e-18
Identity = 180/814 (22.11%), Postives = 305/814 (37.47%), Query Frame = 2
Query: 4073 NLAQLEIAHCQLSDSGQYKICFNPLEASKCGKVTGLFLVSIAP----IKKNLKPID----SNIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQD----KILQEKRITQKFNNNLSF--LLIDSVKLEDSGTYICQGFTNKELISECKITLNVVD--NISDTLQCQVKFEKDKYSIEINQDVTMRALIECTSTHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNS-VTKNIEITEGNELNLEVVSEIEKDLQ--------FQWSKD----DIDCSNNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGMVD-GKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRN--DMPFGDPCVLDNPFIDLYIESPQVN------EHSGLYKCIVTNEKSET-EFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLK-INE-----SSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIA----PLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSE 6367
            N  +L+I +C  +D+G Y I      AS+   V+    V  AP     K N +P       + E          V + G  K  +K+   E ++ +     +I+++K       + L F  L+I  V+  D+GTY C+  TNK   + C+     V+  N    L  Q+    +K   +                     W  NGE  + +         +     L  Q+      GIY C+ +   GN S +  EL+V+   I  LN    K   + E  E N  +      +LQ         QW  D     +D  +  ++   +++   +L     +  D+GVY  E + + G+    ++  V+  P          ++K I +   I  S  + + + +EV  + Q  +Q   N  D+       + +  I   +E   V         +G Y    TN+ S+T E+   TVK K      P++ +       E   I  EK  + +  R+         W  DE  +  TD + T+      Y L +      DAG Y++K  NE     SS  +L+K  P+   K                 L++I +      V+    V+      A W+ +  EID +  +F      N F L +        G YT ++ ND G                  ++ ++C +     P   + LK++E+   ++  L   +  +P+ KI W KDG  +      +  +      N+ L +  A  ED+G Y    TNF+G  T+   + V  SE
Sbjct: 1072 NSYRLDIKNCSETDAGTYTI--RAQSASETTTVSAQLAVGQAPGHDETKTNTEPAFLVSLKDAEMIENTLFRFMVKIIGDPKPRVKFYKDEKEILETNDRIQIIRDK-------DYLGFYELVIADVQKTDAGTYSCKA-TNKHGEANCEAIATTVEDKNPFGALSGQILPAGEKPVFQ---------------------WKRNGEEFDPEERFKVLFGEDEDSLALVFQHVKPEDAGIYTCVAQTSTGNISCS-AELSVQGA-IQTLNREPEKPTLVIEHREANASIGGSAILELQCKGFPKPAVQWKHDGEVIQVDDRHKFMY---EDEESMSLVIKNVDTVDAGVYTIEAINELGQDESSINLVVKAPP----------KIKKITD---ITCSAGETIKMEIEVEGFPQPTVQVTNNGKDVTAESNVKISSSSIGKSLEKVVVEVKEIKLSQAGNYSIKATNDLSQTSEYWSCTVKSK------PVIVKNF-----ESEYIHGEKENVQMTVRIDAYPEAKLTWYHDETEIKITDSKYTVSSDGNAYTLKITGATRVDAGKYTVKATNEHGSATSSTQLLIKCAPEFTHK-----------------LKNITVAEGDSNVELVVGVDAYPRPHAKWYIDGIEIDEKRNDFRHVEEGNDFKLIMNQVATNMQGNYTCKIMNDYG------------------KLEDNCVVTVNCKPKVKRGLKNVEVQEGKSFTLEVEVYSEPEAKIKWFKDGHEIYEDARIKISRDTQRIENYYLTLNLARTEDAGTYEMKATNFIGETTSTCKVAVLTSE 1790          

HSP 5 Score: 92.4337 bits (228), Expect = 1.129e-17
Identity = 110/405 (27.16%), Postives = 176/405 (43.46%), Query Frame = 2
Query: 5150 DNEIILSDSKPLIISVEVLNWKQGVIQWLRND---MPFGDPCVLDNP--FIDLYIESPQVNEHSGLYKCIVTNEKSETEFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCY-NLILRDVKMTDAGMYSLKINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIF-IRNEPETVKFEFEVEESGAKKAIWFFENEEI--DAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTT 6337
            DN + +   +PL++   V       +QWL++     P     +  NP   + L I S Q N+ SG YK I++N   E +     V  K E++    L  + S TV     +  E ++L  E++V         W KD  LL  + P +  I  P     LI+   +  DAG+Y   I     +I    + + + K++K +F           LQD   I   P  VK + +V  +   K  WF    EI  DA ++  ++ + DN  +L I        G Y +   N  G   S  +L +  +++  E   E    AP F   L+D+     + + L+   + +P P+++W+KDG TL     N R+ +  +  +  L I  AE  DSG Y CL  N LG D++
Sbjct: 2227 DNALDVLQGEPLVLECCVDGSPLPTVQWLKDGDEVKPSESIKISTNPDGLVKLEINSCQPND-SGAYKLIISNPHGE-KVALCAVAVKPEEMQPKFLKPITSQTV-----VVGEPLKL--EAQVTGFPAPEVKWYKDGMLLRPS-PEINFINSPNGQIGLIIDAAQPLDAGVYKCLIANKGGEIEGVSKVEIVPKESKPVFV--------AELQDASSIEGFP--VKMDIKVVGNPKPKLQWFHNGHEIKPDASHIAIVE-NPDNSSSLIIEKTAPGDSGLYEVIAQNPEGSTASKAKLYVAPKAD--ETATEE---APQFVSALRDVNADEGQELVLSAPFISNPMPEVIWSKDGVTLTP---NERLLMTCDGKHIGLTIKPAEAADSGNYTCLLANPLGEDSS 2602          

HSP 6 Score: 68.9366 bits (167), Expect = 1.556e-10
Identity = 99/386 (25.65%), Postives = 160/386 (41.45%), Query Frame = 2
Query: 3929 SLNISENERILLEAKIISGNINSYKTPPQWFWNDEAVKNINCKKDFTS--NLAQLEIAHCQLSDSGQYK-ICFNPLEASKCGKVTGLFLVSIAPIK---KNLKPIDSNIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFN--NNLSFLLIDSVKLEDSGTYICQGFTNKELISECKITLNVVDNISDTLQCQVKFEKDKYSIE---INQDVTMRALIECTSTHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLN-------SVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCSNNGIFNSTKNKNCFNLTKLKAEITDSGVY 5032
            +L++ + E ++LE  +    + +     QW  + + VK     K  T+   L +LEI  CQ +DSG YK I  NP      G+   L  V++ P +   K LKPI S      GE + L   V GF   ++KW       K   +L+        N  N    L+ID+ +  D+G Y C    NK    E    + +V   S  +   V   +D  SIE   +  D+ +       +    + WF NG  ++  +  ++ ++N    + L I+       G+YE + +N +G S+ ++ +L V     +          S  +++   EG EL L          +  WSKD +  + N     T +     LT   AE  DSG Y
Sbjct: 2229 ALDVLQGEPLVLECCVDGSPLPTV----QWLKDGDEVKPSESIKISTNPDGLVKLEINSCQPNDSGAYKLIISNP-----HGEKVALCAVAVKPEEMQPKFLKPITSQTVVV-GEPLKLEAQVTGFPAPEVKW------YKDGMLLRPSPEINFINSPNGQIGLIIDAAQPLDAGVYKCL-IANKGGEIEGVSKVEIVPKESKPVF--VAELQDASSIEGFPVKMDIKV-----VGNPKPKLQWFHNGHEIKPDASHIAIVENPDNSSSLIIEKTAPGDSGLYEVIAQNPEG-STASKAKLYVAPKADETATEEAPQFVSALRDVNADEGQELVLSAPFISNPMPEVIWSKDGVTLTPNERLLMTCDGKHIGLTIKPAEAADSGNY 2589          

HSP 7 Score: 64.3142 bits (155), Expect = 3.420e-9
Identity = 201/958 (20.98%), Postives = 369/958 (38.52%), Query Frame = 2
Query: 3629 LNAKDIPIMTLKNGGWFLNSEPIHAVKFRGNEVIEENKVKIVIPNVTKEFSGLLQYRIVKPVELYSPEIIIKIRGSLIKQTPKIEEEKFESNLILELHNVSLNISENERILLEAKIISGNINSYKTPPQWFWNDEAVKNINCKKDFT---SNLAQLEIAHCQLSDSGQYKI-CFNPLEASKCGKVTGLFLVSIAPIKKNLKPIDSNIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNNNLSFLLIDSVKLEDSGTYICQGFTNKELISECKITLNVVDNISDTLQCQVK--------FEKDKYSIEINQDVTMRALIECTSTHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVT---KNIEITEGNELNLEVVSEIEK--DLQFQWSKDDIDCS-NNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGMVD-GKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMPF---------GDPCVLDNPFIDLYIESPQVNEHSGLYKCIVTNEKSETEFV-EITVKFKDEKVVSPILGELLSCTVEE-----------VNTIED---EKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLKI----------NESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPET----VKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEF--PNFTLIITEAEVEDSGRYCCLGTNFLG 6325
            L A + P+   K  G   + E    V F  +E    + + +V  +V  E +G+            S    + ++G++  QT   E EK    L++E    + +I  +  + L+ K        +  P   + +D  V  ++ +  F         L I +    D+G Y I   N L   +    + + LV  AP K  +K I ++I    GE++ + ++VEGF +  ++      D+  +  ++    +   +     + +  +KL  +G Y  +               N +   S+   C VK        FE +    E  ++V M   I+       ++W+ +   +++ +D    + ++G    LKI        G Y     N+ G S+T+ T+L      I C    T   KNI + EG+  N+E+V  ++       +W  D I+       F   +  N F L   +      G Y  + M D GKL +    TV   P          ++K   ++ E+   + K   + VEV +  +  I+W ++              D   ++N ++ L +      E +G Y+   TN   ET    ++ V   +   +   + + L  T EE           V+  +    E + L  E          A+W  D K +   D    I +    Y L ++ + + DAG Y + +           E S+  + + R KPI  Q   + K++K+ +  K  + +    +P      +K    V E+   K     + ++ DAEN   +Q++C     L I  A  K  G+Y ++V N  G + + G + ++ + EIS                L D + L  + I     +  +PKPK+ WT+  E L   C +   +++ +     + L+       + G+Y    TN  G
Sbjct: 1231 LPAGEKPVFQWKRNGEEFDPEERFKVLFGEDE----DSLALVFQHVKPEDAGIYTCVAQTSTGNISCSAELSVQGAI--QTLNREPEK--PTLVIEHREANASIGGSAILELQCK-------GFPKPAVQWKHDGEVIQVDDRHKFMYEDEESMSLVIKNVDTVDAGVYTIEAINELGQDE----SSINLVVKAPPK--IKKI-TDITCSAGETIKMEIEVEGFPQPTVQVTNNGKDVTAESNVKISSSSIGKSLEKVVVEVKEIKLSQAGNYSIKA-------------TNDLSQTSEYWSCTVKSKPVIVKNFESEYIHGE-KENVQMTVRIDAYP-EAKLTWYHDETEIKI-TDSKYTVSSDGNAYTLKITGATRVDAGKYTVKATNEHG-SATSSTQL-----LIKCAPEFTHKLKNITVAEGDS-NVELVVGVDAYPRPHAKWYIDGIEIDEKRNDFRHVEEGNDFKLIMNQVATNMQGNYTCKIMNDYGKLEDNCVVTVNCKP----------KVKRGLKNVEV--QEGKSFTLEVEVYSEPEAKIKWFKDGHEIYEDARIKISRDTQRIENYYLTLNLAR---TEDAGTYEMKATNFIGETTSTCKVAVLTSEALSLEQTVTKTLIATTEEPEEGAVPEIVHVDVFQQHSYESVPLKYEVIATGIPKPEAIWYHDGKPIT-PDKHTAITVDGDHYKLEVQSLDLVDAGEYKVVVQNKVGEKSHQGELSLSGIAEYR-KPILTQGPGL-KDIKVNKGDKVCEPVVFTADPAPEIVLLKDGQPVVETNNVK----LKVDKKDAENG-LVQYTC----TLNILEAEIKDSGRYELKVKNKYGELVTSGWIDVLAKPEIS---------------GLNDTKCLPGDTICFEALVQANPKPKVSWTRGNENL---CNHENCEVIADVDADKYRLVFQSVSPCEDGKYTITATNSEG 2098          

HSP 8 Score: 63.1586 bits (152), Expect = 8.238e-9
Identity = 122/575 (21.22%), Postives = 230/575 (40.00%), Query Frame = 2
Query: 4703 LKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCS-NNGIFNSTKNKNCFNLTKLKAEITDSGVYKFE-GMVDGKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDM---PFGDPCVLDNP--FIDLYIESPQVNEHSGLYKCIVTNEKSETEFV-EITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQP-FCYNLILRDVKMTDAGMYSLKIN--ESSVDILVK--VRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDN-YFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDS 6385
            L I++  E+  G Y C+  N+ G  + A  +L + ++    +  +   +++ +G  L LE   +       QW KD  +   +  I  ST       L     +  DSG YK       G+ + L    V+   +Q         LK I     ++    +PL +  +V  +    ++W ++ M   P  +   +++P   I L I++ Q  + +G+YKC++ N+  E E V ++ +  K+ K V   + EL     ++ ++IE   +++ +  +V         W  +   +      + I+  P    +LI+      D+G+Y +     E S     K  V PK     T+E       PQ    L+D+   +E + +        +   + IW    + +     E +  +CD  +  LTI  A     G YT  +AN +G             S      +      P+FT+K+ D + +   N ++   +   P P + W    + +     + +  I ++  +  LI+   E  D G Y C+ +N  G D T+  + + +   K S S
Sbjct: 2183 LDIKSFRENDVGAYTCVATNEIG-VTKAPFKLAMLSLAPSFVKKLDNALDVLQGEPLVLECCVDGSPLPTVQWLKDGDEVKPSESIKISTNPDGLVKLEINSCQPNDSGAYKLIISNPHGEKVALCAVAVKPEEMQPKF------LKPITSQTVVV---GEPLKLEAQVTGFPAPEVKWYKDGMLLRPSPEINFINSPNGQIGLIIDAAQPLD-AGVYKCLIANKGGEIEGVSKVEIVPKESKPV--FVAEL-----QDASSIEGFPVKMDI--KVVGNPKPKLQWFHNGHEIKPDASHIAIVENPDNSSSLIIEKTAPGDSGLYEVIAQNPEGSTASKAKLYVAPKADETATEEA------PQFVSALRDVNA-DEGQELVLSAPFISNPMPEVIW--SKDGVTLTPNERLLMTCDGKHIGLTIKPAEAADSGNYTCLLANPLG-----------EDSSACNANVRKVYKPPVFTQKISDQQQVFGNNAKIPVTVSGVPYPDLEWYFQDKPIPK---SEKYSIKNDGDHHMLIVNNCEKGDQGVYKCIASNREGKDITQGRLDIVNEIKKHSRS 2714          

HSP 9 Score: 57.7658 bits (138), Expect = 3.628e-7
Identity = 59/237 (24.89%), Postives = 104/237 (43.88%), Query Frame = 2
Query: 5711 RKQTKEIFKNLKIPQIKKPLQDIFIRNEP-ETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCD--NYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKD-GETLDSKCLNRRVKIL---DEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAV-IIVTDSEPKESDSSRII 6397
            R Q     +++  P + K L+ + +  EP ET  FE + ++       W  +N+ ++    + I  +    N + L I    E   G YTI+  +         +L++       E    +    P F   LKD E++     R   +++ DPKP++ + KD  E L++   N R++I+   D    + L+I + +  D+G Y C  TN  G    EA+   V D  P  + S +I+
Sbjct: 1004 RLQEDRPLRSVDKPVVVKMLKSVQV--EPGETAHFEIQFKDQPGL-VTWLKDNKPLEDRLADRITQTAAPMNSYRLDIKNCSETDAGTYTIRAQSASETTTVSAQLAVGQAPGHDETKTNT---EPAFLVSLKDAEMIENTLFRFMVKIIGDPKPRVKFYKDEKEILET---NDRIQIIRDKDYLGFYELVIADVQKTDAGTYSCKATNKHGEANCEAIATTVEDKNPFGALSGQIL 1231          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: Unc-89 (gene:FBgn0053519 transcript:FBtr0343284)

HSP 1 Score: 135.191 bits (339), Expect = 1.376e-30
Identity = 136/610 (22.30%), Postives = 257/610 (42.13%), Query Frame = 2
Query: 8705 EREITLSWSPP-RISPDLYIPFTVDVECRPVNYSYSDEEGWSVFKTNIKKNRVDIADLDPNINYQLRIVPVTDFGIGKPSMVIKKIRRSDNLNSPTT------------EKAMMLQEKHCLAVPMFCCLSQKAELKF-------------TKLM----EYKLDKITWTFNNAKVDVNDERYKIFSAETYGIYFIIKNLEED-DFGEYCALDEVQDPIQSFILIKSDAPTILNCLPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIFSSYRTVITEDKEQGTYSLLISKCILSDGGEYSIRAENAIGFAEVKFNLRVDA------------HPEKKSVQINIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFF----EINNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLA-EYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLC--GFSNAVPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGH-----------LKVNFEGDQLYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWF 10351
            +R + LSW+P   ++P   I + +++   P       E  W   +T ++    DI +L+P  +Y+ R+     FG+  PS   +  R+    + P T            E +    +   +  P    L+Q  +                T+LM     Y   K+T+ F++  ++      + ++       FI K L+ D  + E  A +E  +  Q   L  ++ P  L       +   +N  I  ++   P PEV W ++WK I  S R  I+   +   Y L I   I+ DGG YSI A N  G       + ++             HP  +S Q+      D+Y    +L +G+       +E+S+   +  K      E+    +  +E + +   +H+N++  +DA    D+ + LI E   G  L  + + +  ++ E  +   I Q +  + ++HE  V H+ +  ++++++    +I+K+   G S  + + +  +  + G+   F +PE++  E + F+ DMW++G++T++ L GH           L    EG   + ++    IS+    FI + LL    ER+    +L H WF
Sbjct: 2822 DRGLLLSWNPSVPLTPRYPITYQIEMMDLP-------EGDWRTLRTGVRSCACDIRNLEPFRDYRFRVRVENKFGVSDPSPYTQTYRQKLVPDPPKTYTYLPPGTDFRPETSPYFPKDFDIERPPHDGLAQAPQFLLREQDISYGVKDHNTELMWFVYGYPKPKMTYYFDDMLIESGGRFDQSYTRNGQATLFINKMLDRDVGWYEAVATNEHGEARQRVRLEIAEHPRFLKRPDETFIMARKNGRIEAKLVGIPLPEVHWFKDWKPIVDSSRIKISS-YDPDIYVLSIHDSIIKDGGLYSISARNIAGSISTSVTVHIEENEDQYIYKTYGRHPYVRSKQLRY---QDKYDIGDELGRGTQGITYHAVERSSGDNYAAKIMYGRPELRPFML--NELEMMNTFNHKNLIRPYDAYDT-DRSVTLIMELAAGGELVRDNLLRRDYYTERDIAHYIRQTLWGLEHMHEMGVGHMGLTIKDLLISVVGGDIIKVSDFGLSRKINRHNLSTLDY-GMPE-FVSPEVVNKEGVNFSHDMWTVGLITYVLLGGHNPFLGIDDRETLTKIREGRWDFKDEIWTHISDDGRDFISRLLLYSPEERMDVKTALKHPWF 3415          

HSP 2 Score: 116.316 bits (290), Expect = 6.403e-25
Identity = 103/426 (24.18%), Postives = 192/426 (45.07%), Query Frame = 2
Query: 10808 LGSEPISISWYKNQELLTDDSRIKLEVIKGGFLSCTILNATETDVGIFRCIARCHSLRTETSARLVLGDVPPQPEQLSVYYTNQEEVLLKWSPYLSAIDDVIYRIDIRTIDSR-NKIRNWKTIGYSVDNR-YLLENLDRTQQYIARIIAQNKYGYSPYSI--ATSVFQNKIRNIHSLK-----QALIFNRKWMLTSRQSNHFNDLHDLIKDISSDDIRMNVIREHYSTLSQKSSGFAVLKLKNTNVNFPEYIVQRTFKMED-----ICPAFDLCVRIKYYHFPILFGEICDSSLGNRITFEEFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRYESDIWSLGILSFLLLATQLP 12043
            +G     + W+KN  +LT+  RIK+ V + G        A   DVG+++ +AR    +T    R+V+  +P  P+   +   +  E+LL+W       DD    +   ++  + +    W T+  ++D+  YLL +L     Y  R+ ++N+ G+S   I  + S        IH  K     Q L  N   ++   +  H  D H   +    + +  + + + YS +S+ + G     +K    +    +V +  ++ D     +   FD    +++   P LF      ++   I   E + G ++L+   +R  YSE  V T++ QLL  +Q+LH     H NI+P  ++++  + +S  +KL+   + + V  +  +  +T      F+ PE   +     +SDIWSLG L++LLL+   P
Sbjct: 3653 VGDPKPCVQWFKNDMVLTESKRIKISVDEDGRSILRFEPALHFDVGVYKVVARNKVGQTVARCRIVVATLPDAPDSPEISANSGTEILLRWK---QPRDDGHSTVLCYSLQYKLSNCDAWTTVADNIDHEFYLLHDLQPNTNYQFRLASKNRIGWSEMGIPVSASTVGGDAPKIHITKAMKHLQQLTENGHQVVPEEERVH-TDYH--CEREPPNWVTDSSVSDKYSFISEIARGEFSTIVKGIQKSTDTVVVAKILEVTDENEDNVVAEFDNFKTLRHERIPALFSAYKPLNVPIAIFVMEKLQGADVLTYFSSRHEYSEQMVATVVTQLLDALQYLHWRGYCHLNIQPDNVVMA--SVRSIQVKLVDFGSAKKVNKLGMK--VTPCGSLDFQPPEMINDEPIFPQSDIWSLGALTYLLLSGCSP 4068          

HSP 3 Score: 109.768 bits (273), Expect = 6.413e-23
Identity = 73/264 (27.65%), Postives = 119/264 (45.08%), Query Frame = 2
Query: 9614 VNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEINNMGIGR--SEFQCIQNISHRNIVEIFDA---IAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQLYNEDSN------------DAISNSACVFIRKCLLLKTGERLTSSDSLSHEWFI 10354
            V+D+Y  + ++A+G +S     I+KST    + K  E+ +       +EF   + + H  I  +F A   + +P    + + EKLQG  +  Y +    + E  V  ++ QL+ A+ YLH    CHL+I+P+N++M    +  +KL  F +A      G +     +  F  PE++  EPI   SD+WS+G LT+L L G     F G   Y    N              ++  A  FI         +R  + D L H W +
Sbjct: 3868 VSDKYSFISEIARGEFSTIVKGIQKSTDTVVVAKILEVTDENEDNVVAEFDNFKTLRHERIPALFSAYKPLNVP--IAIFVMEKLQGADVLTYFSSRHEYSEQMVATVVTQLLDALQYLHWRGYCHLNIQPDNVVMASVRSIQVKLVDFGSAKKVNKLGMKVTPCGSLDFQPPEMINDEPIFPQSDIWSLGALTYLLLSGCSP--FRGADEYETKQNISFVRYRFENLFKEVTPEATRFIMLLFKRHPTKRPYTEDCLEHRWLM 4127          

HSP 4 Score: 93.2041 bits (230), Expect = 6.544e-18
Identity = 178/810 (21.98%), Postives = 303/810 (37.41%), Query Frame = 2
Query: 4073 NLAQLEIAHCQLSDSGQYKICFNPLEASKCGKVTGLFLVSIAP----IKKNLKPID----SNIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQD----KILQEKRITQKFNNNLSF--LLIDSVKLEDSGTYICQGFTNKELISECKITLNVVD--NISDTLQCQVKFEKDKYSIEINQDVTMRALIECTSTHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNS-VTKNIEITEGNELNLEVVSEIEKDLQ--------FQWSKD----DIDCSNNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGMVD-GKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRN--DMPFGDPCVLDNPFIDLYIESPQVN------EHSGLYKCIVTNEKSET-EFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLK-INE-----SSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIA----PLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIV 6355
            N  +L+I +C  +D+G Y I      AS+   V+    V  AP     K N +P       + E          V + G  K  +K+   E ++ +     +I+++K       + L F  L+I  V+  D+GTY C+  TNK   + C+     V+  N    L  Q+    +K   +                     W  NGE  + +         +     L  Q+      GIY C+ +   GN S +  EL+V+   I  LN    K   + E  E N  +      +LQ         QW  D     +D  +  ++   +++   +L     +  D+GVY  E + + G+    ++  V+  P          ++K I +   I  S  + + + +EV  + Q  +Q   N  D+       + +  I   +E   V         +G Y    TN+ S+T E+   TVK K      P++ +       E   I  EK  + +  R+         W  DE  +  TD + T+      Y L +      DAG Y++K  NE     SS  +L+K  P+   K                 L++I +      V+    V+      A W+ +  EID +  +F      N F L +        G YT ++ ND G                  ++ ++C +     P   + LK++E+   ++  L   +  +P+ KI W KDG  +      +  +      N+ L +  A  ED+G Y    TNF+G  T+   + V
Sbjct: 1072 NSYRLDIKNCSETDAGTYTI--RAQSASETTTVSAQLAVGQAPGHDETKTNTEPAFLVSLKDAEMIENTLFRFMVKIIGDPKPRVKFYKDEKEILETNDRIQIIRDK-------DYLGFYELVIADVQKTDAGTYSCKA-TNKHGEANCEAIATTVEDKNPFGALSGQILPAGEKPVFQ---------------------WKRNGEEFDPEERFKVLFGEDEDSLALVFQHVKPEDAGIYTCVAQTSTGNISCS-AELSVQGA-IQTLNREPEKPTLVIEHREANASIGGSAILELQCKGFPKPAVQWKHDGEVIQVDDRHKFMY---EDEESMSLVIKNVDTVDAGVYTIEAINELGQDESSINLVVKAPP----------KIKKITD---ITCSAGETIKMEIEVEGFPQPTVQVTNNGKDVTAESNVKISSSSIGKSLEKVVVEVKEIKLSQAGNYSIKATNDLSQTSEYWSCTVKSK------PVIVKNF-----ESEYIHGEKENVQMTVRIDAYPEAKLTWYHDETEIKITDSKYTVSSDGNAYTLKITGATRVDAGKYTVKATNEHGSATSSTQLLIKCAPEFTHK-----------------LKNITVAEGDSNVELVVGVDAYPRPHAKWYIDGIEIDEKRNDFRHVEEGNDFKLIMNQVATNMQGNYTCKIMNDYG------------------KLEDNCVVTVNCKPKVKRGLKNVEVQEGKSFTLEVEVYSEPEAKIKWFKDGHEIYEDARIKISRDTQRIENYYLTLNLARTEDAGTYEMKATNFIGETTSTCKVAV 1786          

HSP 5 Score: 92.8189 bits (229), Expect = 9.225e-18
Identity = 110/405 (27.16%), Postives = 176/405 (43.46%), Query Frame = 2
Query: 5150 DNEIILSDSKPLIISVEVLNWKQGVIQWLRND---MPFGDPCVLDNP--FIDLYIESPQVNEHSGLYKCIVTNEKSETEFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCY-NLILRDVKMTDAGMYSLKINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIF-IRNEPETVKFEFEVEESGAKKAIWFFENEEI--DAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTT 6337
            DN + +   +PL++   V       +QWL++     P     +  NP   + L I S Q N+ SG YK I++N   E +     V  K E++    L  + S TV     +  E ++L  E++V         W KD  LL  + P +  I  P     LI+   +  DAG+Y   I     +I    + + + K++K +F           LQD   I   P  VK + +V  +   K  WF    EI  DA ++  ++ + DN  +L I        G Y +   N  G   S  +L +  +++  E   E    AP F   L+D+     + + L+   + +P P+++W+KDG TL     N R+ +  +  +  L I  AE  DSG Y CL  N LG D++
Sbjct: 2202 DNALDVLQGEPLVLECCVDGSPLPTVQWLKDGDEVKPSESIKISTNPDGLVKLEINSCQPND-SGAYKLIISNPHGE-KVALCAVAVKPEEMQPKFLKPITSQTV-----VVGEPLKL--EAQVTGFPAPEVKWYKDGMLLRPS-PEINFINSPNGQIGLIIDAAQPLDAGVYKCLIANKGGEIEGVSKVEIVPKESKPVFV--------AELQDASSIEGFP--VKMDIKVVGNPKPKLQWFHNGHEIKPDASHIAIVE-NPDNSSSLIIEKTAPGDSGLYEVIAQNPEGSTASKAKLYVAPKAD--ETATEE---APQFVSALRDVNADEGQELVLSAPFISNPMPEVIWSKDGVTLTP---NERLLMTCDGKHIGLTIKPAEAADSGNYTCLLANPLGEDSS 2577          

HSP 6 Score: 69.3218 bits (168), Expect = 1.103e-10
Identity = 99/386 (25.65%), Postives = 160/386 (41.45%), Query Frame = 2
Query: 3929 SLNISENERILLEAKIISGNINSYKTPPQWFWNDEAVKNINCKKDFTS--NLAQLEIAHCQLSDSGQYK-ICFNPLEASKCGKVTGLFLVSIAPIK---KNLKPIDSNIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFN--NNLSFLLIDSVKLEDSGTYICQGFTNKELISECKITLNVVDNISDTLQCQVKFEKDKYSIE---INQDVTMRALIECTSTHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLN-------SVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCSNNGIFNSTKNKNCFNLTKLKAEITDSGVY 5032
            +L++ + E ++LE  +    + +     QW  + + VK     K  T+   L +LEI  CQ +DSG YK I  NP      G+   L  V++ P +   K LKPI S      GE + L   V GF   ++KW       K   +L+        N  N    L+ID+ +  D+G Y C    NK    E    + +V   S  +   V   +D  SIE   +  D+ +       +    + WF NG  ++  +  ++ ++N    + L I+       G+YE + +N +G S+ ++ +L V     +          S  +++   EG EL L          +  WSKD +  + N     T +     LT   AE  DSG Y
Sbjct: 2204 ALDVLQGEPLVLECCVDGSPLPTV----QWLKDGDEVKPSESIKISTNPDGLVKLEINSCQPNDSGAYKLIISNP-----HGEKVALCAVAVKPEEMQPKFLKPITSQTVVV-GEPLKLEAQVTGFPAPEVKW------YKDGMLLRPSPEINFINSPNGQIGLIIDAAQPLDAGVYKCL-IANKGGEIEGVSKVEIVPKESKPVF--VAELQDASSIEGFPVKMDIKV-----VGNPKPKLQWFHNGHEIKPDASHIAIVENPDNSSSLIIEKTAPGDSGLYEVIAQNPEG-STASKAKLYVAPKADETATEEAPQFVSALRDVNADEGQELVLSAPFISNPMPEVIWSKDGVTLTPNERLLMTCDGKHIGLTIKPAEAADSGNY 2564          

HSP 7 Score: 66.6254 bits (161), Expect = 7.830e-10
Identity = 199/944 (21.08%), Postives = 368/944 (38.98%), Query Frame = 2
Query: 3629 LNAKDIPIMTLKNGGWFLNSEPIHAVKFRGNEVIEENKVKIVIPNVTKEFSGLLQYRIVKPVELYSPEIIIKIRGSLIKQTPKIEEEKFESNLILELHNVSLNISENERILLEAKIISGNINSYKTPPQWFWNDEAVKNINCKKDFT---SNLAQLEIAHCQLSDSGQYKI-CFNPLEASKCGKVTGLFLVSIAPIKKNLKPIDSNIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNNNLSFLLIDSVKLEDSGTYICQGFTNKELISECKITLNVVDNISDTLQCQVK--------FEKDKYSIEINQDVTMRALIECTSTHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVT---KNIEITEGNELNLEVVSEIEK--DLQFQWSKDDIDCS-NNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGMVD-GKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMPF---------GDPCVLDNPFIDLYIESPQVNEHSGLYKCIVTNEKSETEFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSV-ESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLKI----------NESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPET----VKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEF--PNFTLIITEAEVEDSGRYCCLGTNFLG 6325
            L A + P+   K  G   + E    V F  +E    + + +V  +V  E +G+            S    + ++G++  QT   E EK    L++E    + +I  +  + L+ K        +  P   + +D  V  ++ +  F         L I +    D+G Y I   N L   +    + + LV  AP K  +K I ++I    GE++ + ++VEGF +  ++      D+  +  ++    +   +     + +  +KL  +G Y  +               N +   S+   C VK        FE +    E  ++V M   I+       ++W+ +   +++ +D    + ++G    LKI        G Y     N+ G S+T+ T+L      I C    T   KNI + EG+  N+E+V  ++       +W  D I+       F   +  N F L   +      G Y  + M D GKL +    TV   P          ++K   ++ E+   + K   + VEV +  +  I+W ++              D   ++N ++ L +      E +G Y+   TN   ET            KV    + E++   V + ++ E   ++  V  + +P      A+W  D K +   D    I +    Y L ++ + + DAG Y + +           E S+  + + R KPI  Q   + K++K+ +  K  + +    +P      +K    V E+   K     + ++ DAEN   +Q++C     L I  A  K  G+Y ++V N  G + + G + ++ + EIS                L D + L  + I     +  +PKPK+ WT+  E L   C +   +++ +     + L+       + G+Y    TN  G
Sbjct: 1231 LPAGEKPVFQWKRNGEEFDPEERFKVLFGEDE----DSLALVFQHVKPEDAGIYTCVAQTSTGNISCSAELSVQGAI--QTLNREPEK--PTLVIEHREANASIGGSAILELQCK-------GFPKPAVQWKHDGEVIQVDDRHKFMYEDEESMSLVIKNVDTVDAGVYTIEAINELGQDE----SSINLVVKAPPK--IKKI-TDITCSAGETIKMEIEVEGFPQPTVQVTNNGKDVTAESNVKISSSSIGKSLEKVVVEVKEIKLSQAGNYSIKA-------------TNDLSQTSEYWSCTVKSKPVIVKNFESEYIHGE-KENVQMTVRIDAYP-EAKLTWYHDETEIKI-TDSKYTVSSDGNAYTLKITGATRVDAGKYTVKATNEHG-SATSSTQL-----LIKCAPEFTHKLKNITVAEGDS-NVELVVGVDAYPRPHAKWYIDGIEIDEKRNDFRHVEEGNDFKLIMNQVATNMQGNYTCKIMNDYGKLEDNCVVTVNCKP----------KVKRGLKNVEV--QEGKSFTLEVEVYSEPEAKIKWFKDGHEIYEDARIKISRDTQRIENYYLTLNLAR---TEDAGTYEMKATNFIGETT--------STCKVAVLTVPEIVHVDVFQQHSYESVPLKYEVIATGIPKPE---AIWYHDGKPIT-PDKHTAITVDGDHYKLEVQSLDLVDAGEYKVVVQNKVGEKSHQGELSLSGIAEYR-KPILTQGPGL-KDIKVNKGDKVCEPVVFTADPAPEIVLLKDGQPVVETNNVK----LKVDKKDAENG-LVQYTC----TLNILEAEIKDSGRYELKVKNKYGELVTSGWIDVLAKPEIS---------------GLNDTKCLPGDTICFEALVQANPKPKVSWTRGNENL---CNHENCEVIADVDADKYRLVFQSVSPCEDGKYTITATNSEG 2073          

HSP 8 Score: 63.5438 bits (153), Expect = 6.965e-9
Identity = 122/575 (21.22%), Postives = 230/575 (40.00%), Query Frame = 2
Query: 4703 LKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCS-NNGIFNSTKNKNCFNLTKLKAEITDSGVYKFE-GMVDGKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDM---PFGDPCVLDNP--FIDLYIESPQVNEHSGLYKCIVTNEKSETEFV-EITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQP-FCYNLILRDVKMTDAGMYSLKIN--ESSVDILVK--VRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDN-YFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDS 6385
            L I++  E+  G Y C+  N+ G  + A  +L + ++    +  +   +++ +G  L LE   +       QW KD  +   +  I  ST       L     +  DSG YK       G+ + L    V+   +Q         LK I     ++    +PL +  +V  +    ++W ++ M   P  +   +++P   I L I++ Q  + +G+YKC++ N+  E E V ++ +  K+ K V   + EL     ++ ++IE   +++ +  +V         W  +   +      + I+  P    +LI+      D+G+Y +     E S     K  V PK     T+E       PQ    L+D+   +E + +        +   + IW    + +     E +  +CD  +  LTI  A     G YT  +AN +G             S      +      P+FT+K+ D + +   N ++   +   P P + W    + +     + +  I ++  +  LI+   E  D G Y C+ +N  G D T+  + + +   K S S
Sbjct: 2158 LDIKSFRENDVGAYTCVATNEIG-VTKAPFKLAMLSLAPSFVKKLDNALDVLQGEPLVLECCVDGSPLPTVQWLKDGDEVKPSESIKISTNPDGLVKLEINSCQPNDSGAYKLIISNPHGEKVALCAVAVKPEEMQPKF------LKPITSQTVVV---GEPLKLEAQVTGFPAPEVKWYKDGMLLRPSPEINFINSPNGQIGLIIDAAQPLD-AGVYKCLIANKGGEIEGVSKVEIVPKESKPV--FVAEL-----QDASSIEGFPVKMDI--KVVGNPKPKLQWFHNGHEIKPDASHIAIVENPDNSSSLIIEKTAPGDSGLYEVIAQNPEGSTASKAKLYVAPKADETATEEA------PQFVSALRDVNA-DEGQELVLSAPFISNPMPEVIW--SKDGVTLTPNERLLMTCDGKHIGLTIKPAEAADSGNYTCLLANPLG-----------EDSSACNANVRKVYKPPVFTQKISDQQQVFGNNAKIPVTVSGVPYPDLEWYFQDKPIPK---SEKYSIKNDGDHHMLIVNNCEKGDQGVYKCIASNREGKDITQGRLDIVNEIKKHSRS 2689          

HSP 9 Score: 57.7658 bits (138), Expect = 3.507e-7
Identity = 59/237 (24.89%), Postives = 104/237 (43.88%), Query Frame = 2
Query: 5711 RKQTKEIFKNLKIPQIKKPLQDIFIRNEP-ETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCD--NYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKD-GETLDSKCLNRRVKIL---DEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAV-IIVTDSEPKESDSSRII 6397
            R Q     +++  P + K L+ + +  EP ET  FE + ++       W  +N+ ++    + I  +    N + L I    E   G YTI+  +         +L++       E    +    P F   LKD E++     R   +++ DPKP++ + KD  E L++   N R++I+   D    + L+I + +  D+G Y C  TN  G    EA+   V D  P  + S +I+
Sbjct: 1004 RLQEDRPLRSVDKPVVVKMLKSVQV--EPGETAHFEIQFKDQPGL-VTWLKDNKPLEDRLADRITQTAAPMNSYRLDIKNCSETDAGTYTIRAQSASETTTVSAQLAVGQAPGHDETKTNT---EPAFLVSLKDAEMIENTLFRFMVKIIGDPKPRVKFYKDEKEILET---NDRIQIIRDKDYLGFYELVIADVQKTDAGTYSCKATNKHGEANCEAIATTVEDKNPFGALSGQIL 1231          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: Unc-89 (gene:FBgn0053519 transcript:FBtr0343285)

HSP 1 Score: 135.191 bits (339), Expect = 1.385e-30
Identity = 136/610 (22.30%), Postives = 257/610 (42.13%), Query Frame = 2
Query: 8705 EREITLSWSPP-RISPDLYIPFTVDVECRPVNYSYSDEEGWSVFKTNIKKNRVDIADLDPNINYQLRIVPVTDFGIGKPSMVIKKIRRSDNLNSPTT------------EKAMMLQEKHCLAVPMFCCLSQKAELKF-------------TKLM----EYKLDKITWTFNNAKVDVNDERYKIFSAETYGIYFIIKNLEED-DFGEYCALDEVQDPIQSFILIKSDAPTILNCLPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIFSSYRTVITEDKEQGTYSLLISKCILSDGGEYSIRAENAIGFAEVKFNLRVDA------------HPEKKSVQINIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFF----EINNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLA-EYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLC--GFSNAVPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGH-----------LKVNFEGDQLYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWF 10351
            +R + LSW+P   ++P   I + +++   P       E  W   +T ++    DI +L+P  +Y+ R+     FG+  PS   +  R+    + P T            E +    +   +  P    L+Q  +                T+LM     Y   K+T+ F++  ++      + ++       FI K L+ D  + E  A +E  +  Q   L  ++ P  L       +   +N  I  ++   P PEV W ++WK I  S R  I+   +   Y L I   I+ DGG YSI A N  G       + ++             HP  +S Q+      D+Y    +L +G+       +E+S+   +  K      E+    +  +E + +   +H+N++  +DA    D+ + LI E   G  L  + + +  ++ E  +   I Q +  + ++HE  V H+ +  ++++++    +I+K+   G S  + + +  +  + G+   F +PE++  E + F+ DMW++G++T++ L GH           L    EG   + ++    IS+    FI + LL    ER+    +L H WF
Sbjct: 2594 DRGLLLSWNPSVPLTPRYPITYQIEMMDLP-------EGDWRTLRTGVRSCACDIRNLEPFRDYRFRVRVENKFGVSDPSPYTQTYRQKLVPDPPKTYTYLPPGTDFRPETSPYFPKDFDIERPPHDGLAQAPQFLLREQDISYGVKDHNTELMWFVYGYPKPKMTYYFDDMLIESGGRFDQSYTRNGQATLFINKMLDRDVGWYEAVATNEHGEARQRVRLEIAEHPRFLKRPDETFIMARKNGRIEAKLVGIPLPEVHWFKDWKPIVDSSRIKIS-SYDPDIYVLSIHDSIIKDGGLYSISARNIAGSISTSVTVHIEENEDQYIYKTYGRHPYVRSKQLRY---QDKYDIGDELGRGTQGITYHAVERSSGDNYAAKIMYGRPELRPFML--NELEMMNTFNHKNLIRPYDAYDT-DRSVTLIMELAAGGELVRDNLLRRDYYTERDIAHYIRQTLWGLEHMHEMGVGHMGLTIKDLLISVVGGDIIKVSDFGLSRKINRHNLSTLDY-GMPE-FVSPEVVNKEGVNFSHDMWTVGLITYVLLGGHNPFLGIDDRETLTKIREGRWDFKDEIWTHISDDGRDFISRLLLYSPEERMDVKTALKHPWF 3187          

HSP 2 Score: 116.316 bits (290), Expect = 6.351e-25
Identity = 103/426 (24.18%), Postives = 192/426 (45.07%), Query Frame = 2
Query: 10808 LGSEPISISWYKNQELLTDDSRIKLEVIKGGFLSCTILNATETDVGIFRCIARCHSLRTETSARLVLGDVPPQPEQLSVYYTNQEEVLLKWSPYLSAIDDVIYRIDIRTIDSR-NKIRNWKTIGYSVDNR-YLLENLDRTQQYIARIIAQNKYGYSPYSI--ATSVFQNKIRNIHSLK-----QALIFNRKWMLTSRQSNHFNDLHDLIKDISSDDIRMNVIREHYSTLSQKSSGFAVLKLKNTNVNFPEYIVQRTFKMED-----ICPAFDLCVRIKYYHFPILFGEICDSSLGNRITFEEFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRYESDIWSLGILSFLLLATQLP 12043
            +G     + W+KN  +LT+  RIK+ V + G        A   DVG+++ +AR    +T    R+V+  +P  P+   +   +  E+LL+W       DD    +   ++  + +    W T+  ++D+  YLL +L     Y  R+ ++N+ G+S   I  + S        IH  K     Q L  N   ++   +  H  D H   +    + +  + + + YS +S+ + G     +K    +    +V +  ++ D     +   FD    +++   P LF      ++   I   E + G ++L+   +R  YSE  V T++ QLL  +Q+LH     H NI+P  ++++  + +S  +KL+   + + V  +  +  +T      F+ PE   +     +SDIWSLG L++LLL+   P
Sbjct: 3425 VGDPKPCVQWFKNDMVLTESKRIKISVDEDGRSILRFEPALHFDVGVYKVVARNKVGQTVARCRIVVATLPDAPDSPEISANSGTEILLRWK---QPRDDGHSTVLCYSLQYKLSNCDAWTTVADNIDHEFYLLHDLQPNTNYQFRLASKNRIGWSEMGIPVSASTVGGDAPKIHITKAMKHLQQLTENGHQVVPEEERVH-TDYH--CEREPPNWVTDSSVSDKYSFISEIARGEFSTIVKGIQKSTDTVVVAKILEVTDENEDNVVAEFDNFKTLRHERIPALFSAYKPLNVPIAIFVMEKLQGADVLTYFSSRHEYSEQMVATVVTQLLDALQYLHWRGYCHLNIQPDNVVMA--SVRSIQVKLVDFGSAKKVNKLGMK--VTPCGSLDFQPPEMINDEPIFPQSDIWSLGALTYLLLSGCSP 3840          

HSP 3 Score: 109.768 bits (273), Expect = 6.155e-23
Identity = 73/264 (27.65%), Postives = 119/264 (45.08%), Query Frame = 2
Query: 9614 VNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEINNMGIGR--SEFQCIQNISHRNIVEIFDA---IAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQLYNEDSN------------DAISNSACVFIRKCLLLKTGERLTSSDSLSHEWFI 10354
            V+D+Y  + ++A+G +S     I+KST    + K  E+ +       +EF   + + H  I  +F A   + +P    + + EKLQG  +  Y +    + E  V  ++ QL+ A+ YLH    CHL+I+P+N++M    +  +KL  F +A      G +     +  F  PE++  EPI   SD+WS+G LT+L L G     F G   Y    N              ++  A  FI         +R  + D L H W +
Sbjct: 3640 VSDKYSFISEIARGEFSTIVKGIQKSTDTVVVAKILEVTDENEDNVVAEFDNFKTLRHERIPALFSAYKPLNVP--IAIFVMEKLQGADVLTYFSSRHEYSEQMVATVVTQLLDALQYLHWRGYCHLNIQPDNVVMASVRSIQVKLVDFGSAKKVNKLGMKVTPCGSLDFQPPEMINDEPIFPQSDIWSLGALTYLLLSGCSP--FRGADEYETKQNISFVRYRFENLFKEVTPEATRFIMLLFKRHPTKRPYTEDCLEHRWLM 3899          

HSP 4 Score: 96.6709 bits (239), Expect = 5.827e-19
Identity = 180/814 (22.11%), Postives = 305/814 (37.47%), Query Frame = 2
Query: 4073 NLAQLEIAHCQLSDSGQYKICFNPLEASKCGKVTGLFLVSIAP----IKKNLKPID----SNIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQD----KILQEKRITQKFNNNLSF--LLIDSVKLEDSGTYICQGFTNKELISECKITLNVVD--NISDTLQCQVKFEKDKYSIEINQDVTMRALIECTSTHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNS-VTKNIEITEGNELNLEVVSEIEKDLQ--------FQWSKD----DIDCSNNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGMVD-GKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRN--DMPFGDPCVLDNPFIDLYIESPQVN------EHSGLYKCIVTNEKSET-EFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLK-INE-----SSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIA----PLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSE 6367
            N  +L+I +C  +D+G Y I      AS+   V+    V  AP     K N +P       + E          V + G  K  +K+   E ++ +     +I+++K       + L F  L+I  V+  D+GTY C+  TNK   + C+     V+  N    L  Q+    +K   +                     W  NGE  + +         +     L  Q+      GIY C+ +   GN S +  EL+V+   I  LN    K   + E  E N  +      +LQ         QW  D     +D  +  ++   +++   +L     +  D+GVY  E + + G+    ++  V+  P          ++K I +   I  S  + + + +EV  + Q  +Q   N  D+       + +  I   +E   V         +G Y    TN+ S+T E+   TVK K      P++ +       E   I  EK  + +  R+         W  DE  +  TD + T+      Y L +      DAG Y++K  NE     SS  +L+K  P+   K                 L++I +      V+    V+      A W+ +  EID +  +F      N F L +        G YT ++ ND G                  ++ ++C +     P   + LK++E+   ++  L   +  +P+ KI W KDG  +      +  +      N+ L +  A  ED+G Y    TNF+G  T+   + V  SE
Sbjct:  819 NSYRLDIKNCSETDAGTYTI--RAQSASETTTVSAQLAVGQAPGHDETKTNTEPAFLVSLKDAEMIENTLFRFMVKIIGDPKPRVKFYKDEKEILETNDRIQIIRDK-------DYLGFYELVIADVQKTDAGTYSCKA-TNKHGEANCEAIATTVEDKNPFGALSGQILPAGEKPVFQ---------------------WKRNGEEFDPEERFKVLFGEDEDSLALVFQHVKPEDAGIYTCVAQTSTGNISCS-AELSVQGA-IQTLNREPEKPTLVIEHREANASIGGSAILELQCKGFPKPAVQWKHDGEVIQVDDRHKFMY---EDEESMSLVIKNVDTVDAGVYTIEAINELGQDESSINLVVKAPP----------KIKKITD---ITCSAGETIKMEIEVEGFPQPTVQVTNNGKDVTAESNVKISSSSIGKSLEKVVVEVKEIKLSQAGNYSIKATNDLSQTSEYWSCTVKSK------PVIVKNF-----ESEYIHGEKENVQMTVRIDAYPEAKLTWYHDETEIKITDSKYTVSSDGNAYTLKITGATRVDAGKYTVKATNEHGSATSSTQLLIKCAPEFTHK-----------------LKNITVAEGDSNVELVVGVDAYPRPHAKWYIDGIEIDEKRNDFRHVEEGNDFKLIMNQVATNMQGNYTCKIMNDYG------------------KLEDNCVVTVNCKPKVKRGLKNVEVQEGKSFTLEVEVYSEPEAKIKWFKDGHEIYEDARIKISRDTQRIENYYLTLNLARTEDAGTYEMKATNFIGETTSTCKVAVLTSE 1537          

HSP 5 Score: 93.2041 bits (230), Expect = 6.781e-18
Identity = 110/405 (27.16%), Postives = 176/405 (43.46%), Query Frame = 2
Query: 5150 DNEIILSDSKPLIISVEVLNWKQGVIQWLRND---MPFGDPCVLDNP--FIDLYIESPQVNEHSGLYKCIVTNEKSETEFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCY-NLILRDVKMTDAGMYSLKINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIF-IRNEPETVKFEFEVEESGAKKAIWFFENEEI--DAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTT 6337
            DN + +   +PL++   V       +QWL++     P     +  NP   + L I S Q N+ SG YK I++N   E +     V  K E++    L  + S TV     +  E ++L  E++V         W KD  LL  + P +  I  P     LI+   +  DAG+Y   I     +I    + + + K++K +F           LQD   I   P  VK + +V  +   K  WF    EI  DA ++  ++ + DN  +L I        G Y +   N  G   S  +L +  +++  E   E    AP F   L+D+     + + L+   + +P P+++W+KDG TL     N R+ +  +  +  L I  AE  DSG Y CL  N LG D++
Sbjct: 1974 DNALDVLQGEPLVLECCVDGSPLPTVQWLKDGDEVKPSESIKISTNPDGLVKLEINSCQPND-SGAYKLIISNPHGE-KVALCAVAVKPEEMQPKFLKPITSQTV-----VVGEPLKL--EAQVTGFPAPEVKWYKDGMLLRPS-PEINFINSPNGQIGLIIDAAQPLDAGVYKCLIANKGGEIEGVSKVEIVPKESKPVFV--------AELQDASSIEGFP--VKMDIKVVGNPKPKLQWFHNGHEIKPDASHIAIVE-NPDNSSSLIIEKTAPGDSGLYEVIAQNPEGSTASKAKLYVAPKAD--ETATEE---APQFVSALRDVNADEGQELVLSAPFISNPMPEVIWSKDGVTLTP---NERLLMTCDGKHIGLTIKPAEAADSGNYTCLLANPLGEDSS 2349          

HSP 6 Score: 69.707 bits (169), Expect = 8.617e-11
Identity = 99/386 (25.65%), Postives = 160/386 (41.45%), Query Frame = 2
Query: 3929 SLNISENERILLEAKIISGNINSYKTPPQWFWNDEAVKNINCKKDFTS--NLAQLEIAHCQLSDSGQYK-ICFNPLEASKCGKVTGLFLVSIAPIK---KNLKPIDSNIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFN--NNLSFLLIDSVKLEDSGTYICQGFTNKELISECKITLNVVDNISDTLQCQVKFEKDKYSIE---INQDVTMRALIECTSTHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLN-------SVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCSNNGIFNSTKNKNCFNLTKLKAEITDSGVY 5032
            +L++ + E ++LE  +    + +     QW  + + VK     K  T+   L +LEI  CQ +DSG YK I  NP      G+   L  V++ P +   K LKPI S      GE + L   V GF   ++KW       K   +L+        N  N    L+ID+ +  D+G Y C    NK    E    + +V   S  +   V   +D  SIE   +  D+ +       +    + WF NG  ++  +  ++ ++N    + L I+       G+YE + +N +G S+ ++ +L V     +          S  +++   EG EL L          +  WSKD +  + N     T +     LT   AE  DSG Y
Sbjct: 1976 ALDVLQGEPLVLECCVDGSPLPTV----QWLKDGDEVKPSESIKISTNPDGLVKLEINSCQPNDSGAYKLIISNP-----HGEKVALCAVAVKPEEMQPKFLKPITSQTVVV-GEPLKLEAQVTGFPAPEVKW------YKDGMLLRPSPEINFINSPNGQIGLIIDAAQPLDAGVYKCL-IANKGGEIEGVSKVEIVPKESKPVF--VAELQDASSIEGFPVKMDIKV-----VGNPKPKLQWFHNGHEIKPDASHIAIVENPDNSSSLIIEKTAPGDSGLYEVIAQNPEG-STASKAKLYVAPKADETATEEAPQFVSALRDVNADEGQELVLSAPFISNPMPEVIWSKDGVTLTPNERLLMTCDGKHIGLTIKPAEAADSGNY 2336          

HSP 7 Score: 65.0846 bits (157), Expect = 1.911e-9
Identity = 201/958 (20.98%), Postives = 369/958 (38.52%), Query Frame = 2
Query: 3629 LNAKDIPIMTLKNGGWFLNSEPIHAVKFRGNEVIEENKVKIVIPNVTKEFSGLLQYRIVKPVELYSPEIIIKIRGSLIKQTPKIEEEKFESNLILELHNVSLNISENERILLEAKIISGNINSYKTPPQWFWNDEAVKNINCKKDFT---SNLAQLEIAHCQLSDSGQYKI-CFNPLEASKCGKVTGLFLVSIAPIKKNLKPIDSNIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNNNLSFLLIDSVKLEDSGTYICQGFTNKELISECKITLNVVDNISDTLQCQVK--------FEKDKYSIEINQDVTMRALIECTSTHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVT---KNIEITEGNELNLEVVSEIEK--DLQFQWSKDDIDCS-NNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGMVD-GKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMPF---------GDPCVLDNPFIDLYIESPQVNEHSGLYKCIVTNEKSETEFV-EITVKFKDEKVVSPILGELLSCTVEE-----------VNTIED---EKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLKI----------NESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPET----VKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEF--PNFTLIITEAEVEDSGRYCCLGTNFLG 6325
            L A + P+   K  G   + E    V F  +E    + + +V  +V  E +G+            S    + ++G++  QT   E EK    L++E    + +I  +  + L+ K        +  P   + +D  V  ++ +  F         L I +    D+G Y I   N L   +    + + LV  AP K  +K I ++I    GE++ + ++VEGF +  ++      D+  +  ++    +   +     + +  +KL  +G Y  +               N +   S+   C VK        FE +    E  ++V M   I+       ++W+ +   +++ +D    + ++G    LKI        G Y     N+ G S+T+ T+L      I C    T   KNI + EG+  N+E+V  ++       +W  D I+       F   +  N F L   +      G Y  + M D GKL +    TV   P          ++K   ++ E+   + K   + VEV +  +  I+W ++              D   ++N ++ L +      E +G Y+   TN   ET    ++ V   +   +   + + L  T EE           V+  +    E + L  E          A+W  D K +   D    I +    Y L ++ + + DAG Y + +           E S+  + + R KPI  Q   + K++K+ +  K  + +    +P      +K    V E+   K     + ++ DAEN   +Q++C     L I  A  K  G+Y ++V N  G + + G + ++ + EIS                L D + L  + I     +  +PKPK+ WT+  E L   C +   +++ +     + L+       + G+Y    TN  G
Sbjct:  978 LPAGEKPVFQWKRNGEEFDPEERFKVLFGEDE----DSLALVFQHVKPEDAGIYTCVAQTSTGNISCSAELSVQGAI--QTLNREPEK--PTLVIEHREANASIGGSAILELQCK-------GFPKPAVQWKHDGEVIQVDDRHKFMYEDEESMSLVIKNVDTVDAGVYTIEAINELGQDE----SSINLVVKAPPK--IKKI-TDITCSAGETIKMEIEVEGFPQPTVQVTNNGKDVTAESNVKISSSSIGKSLEKVVVEVKEIKLSQAGNYSIKA-------------TNDLSQTSEYWSCTVKSKPVIVKNFESEYIHGE-KENVQMTVRIDAYP-EAKLTWYHDETEIKI-TDSKYTVSSDGNAYTLKITGATRVDAGKYTVKATNEHG-SATSSTQL-----LIKCAPEFTHKLKNITVAEGDS-NVELVVGVDAYPRPHAKWYIDGIEIDEKRNDFRHVEEGNDFKLIMNQVATNMQGNYTCKIMNDYGKLEDNCVVTVNCKP----------KVKRGLKNVEV--QEGKSFTLEVEVYSEPEAKIKWFKDGHEIYEDARIKISRDTQRIENYYLTLNLAR---TEDAGTYEMKATNFIGETTSTCKVAVLTSEALSLEQTVTKTLIATTEEPEEGAVPEIVHVDVFQQHSYESVPLKYEVIATGIPKPEAIWYHDGKPIT-PDKHTAITVDGDHYKLEVQSLDLVDAGEYKVVVQNKVGEKSHQGELSLSGIAEYR-KPILTQGPGL-KDIKVNKGDKVCEPVVFTADPAPEIVLLKDGQPVVETNNVK----LKVDKKDAENG-LVQYTC----TLNILEAEIKDSGRYELKVKNKYGELVTSGWIDVLAKPEIS---------------GLNDTKCLPGDTICFEALVQANPKPKVSWTRGNENL---CNHENCEVIADVDADKYRLVFQSVSPCEDGKYTITATNSEG 1845          

HSP 8 Score: 63.929 bits (154), Expect = 5.047e-9
Identity = 122/575 (21.22%), Postives = 230/575 (40.00%), Query Frame = 2
Query: 4703 LKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCS-NNGIFNSTKNKNCFNLTKLKAEITDSGVYKFE-GMVDGKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDM---PFGDPCVLDNP--FIDLYIESPQVNEHSGLYKCIVTNEKSETEFV-EITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQP-FCYNLILRDVKMTDAGMYSLKIN--ESSVDILVK--VRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDN-YFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDS 6385
            L I++  E+  G Y C+  N+ G  + A  +L + ++    +  +   +++ +G  L LE   +       QW KD  +   +  I  ST       L     +  DSG YK       G+ + L    V+   +Q         LK I     ++    +PL +  +V  +    ++W ++ M   P  +   +++P   I L I++ Q  + +G+YKC++ N+  E E V ++ +  K+ K V   + EL     ++ ++IE   +++ +  +V         W  +   +      + I+  P    +LI+      D+G+Y +     E S     K  V PK     T+E       PQ    L+D+   +E + +        +   + IW    + +     E +  +CD  +  LTI  A     G YT  +AN +G             S      +      P+FT+K+ D + +   N ++   +   P P + W    + +     + +  I ++  +  LI+   E  D G Y C+ +N  G D T+  + + +   K S S
Sbjct: 1930 LDIKSFRENDVGAYTCVATNEIG-VTKAPFKLAMLSLAPSFVKKLDNALDVLQGEPLVLECCVDGSPLPTVQWLKDGDEVKPSESIKISTNPDGLVKLEINSCQPNDSGAYKLIISNPHGEKVALCAVAVKPEEMQPKF------LKPITSQTVVV---GEPLKLEAQVTGFPAPEVKWYKDGMLLRPSPEINFINSPNGQIGLIIDAAQPLD-AGVYKCLIANKGGEIEGVSKVEIVPKESKPV--FVAEL-----QDASSIEGFPVKMDI--KVVGNPKPKLQWFHNGHEIKPDASHIAIVENPDNSSSLIIEKTAPGDSGLYEVIAQNPEGSTASKAKLYVAPKADETATEEA------PQFVSALRDVNA-DEGQELVLSAPFISNPMPEVIW--SKDGVTLTPNERLLMTCDGKHIGLTIKPAEAADSGNYTCLLANPLG-----------EDSSACNANVRKVYKPPVFTQKISDQQQVFGNNAKIPVTVSGVPYPDLEWYFQDKPIPK---SEKYSIKNDGDHHMLIVNNCEKGDQGVYKCIASNREGKDITQGRLDIVNEIKKHSRS 2461          

HSP 9 Score: 57.7658 bits (138), Expect = 3.082e-7
Identity = 59/237 (24.89%), Postives = 104/237 (43.88%), Query Frame = 2
Query: 5711 RKQTKEIFKNLKIPQIKKPLQDIFIRNEP-ETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCD--NYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKD-GETLDSKCLNRRVKIL---DEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAV-IIVTDSEPKESDSSRII 6397
            R Q     +++  P + K L+ + +  EP ET  FE + ++       W  +N+ ++    + I  +    N + L I    E   G YTI+  +         +L++       E    +    P F   LKD E++     R   +++ DPKP++ + KD  E L++   N R++I+   D    + L+I + +  D+G Y C  TN  G    EA+   V D  P  + S +I+
Sbjct:  751 RLQEDRPLRSVDKPVVVKMLKSVQV--EPGETAHFEIQFKDQPGL-VTWLKDNKPLEDRLADRITQTAAPMNSYRLDIKNCSETDAGTYTIRAQSASETTTVSAQLAVGQAPGHDETKTNT---EPAFLVSLKDAEMIENTLFRFMVKIIGDPKPRVKFYKDEKEILET---NDRIQIIRDKDYLGFYELVIADVQKTDAGTYSCKATNKHGEANCEAIATTVEDKNPFGALSGQIL 978          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: Unc-89 (gene:FBgn0053519 transcript:FBtr0343283)

HSP 1 Score: 135.191 bits (339), Expect = 1.435e-30
Identity = 136/610 (22.30%), Postives = 257/610 (42.13%), Query Frame = 2
Query: 8705 EREITLSWSPP-RISPDLYIPFTVDVECRPVNYSYSDEEGWSVFKTNIKKNRVDIADLDPNINYQLRIVPVTDFGIGKPSMVIKKIRRSDNLNSPTT------------EKAMMLQEKHCLAVPMFCCLSQKAELKF-------------TKLM----EYKLDKITWTFNNAKVDVNDERYKIFSAETYGIYFIIKNLEED-DFGEYCALDEVQDPIQSFILIKSDAPTILNCLPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIFSSYRTVITEDKEQGTYSLLISKCILSDGGEYSIRAENAIGFAEVKFNLRVDA------------HPEKKSVQINIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFF----EINNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLA-EYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLC--GFSNAVPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGH-----------LKVNFEGDQLYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWF 10351
            +R + LSW+P   ++P   I + +++   P       E  W   +T ++    DI +L+P  +Y+ R+     FG+  PS   +  R+    + P T            E +    +   +  P    L+Q  +                T+LM     Y   K+T+ F++  ++      + ++       FI K L+ D  + E  A +E  +  Q   L  ++ P  L       +   +N  I  ++   P PEV W ++WK I  S R  I+   +   Y L I   I+ DGG YSI A N  G       + ++             HP  +S Q+      D+Y    +L +G+       +E+S+   +  K      E+    +  +E + +   +H+N++  +DA    D+ + LI E   G  L  + + +  ++ E  +   I Q +  + ++HE  V H+ +  ++++++    +I+K+   G S  + + +  +  + G+   F +PE++  E + F+ DMW++G++T++ L GH           L    EG   + ++    IS+    FI + LL    ER+    +L H WF
Sbjct: 2823 DRGLLLSWNPSVPLTPRYPITYQIEMMDLP-------EGDWRTLRTGVRSCACDIRNLEPFRDYRFRVRVENKFGVSDPSPYTQTYRQKLVPDPPKTYTYLPPGTDFRPETSPYFPKDFDIERPPHDGLAQAPQFLLREQDISYGVKDHNTELMWFVYGYPKPKMTYYFDDMLIESGGRFDQSYTRNGQATLFINKMLDRDVGWYEAVATNEHGEARQRVRLEIAEHPRFLKRPDETFIMARKNGRIEAKLVGIPLPEVHWFKDWKPIVDSSRIKISS-YDPDIYVLSIHDSIIKDGGLYSISARNIAGSISTSVTVHIEENEDQYIYKTYGRHPYVRSKQLRY---QDKYDIGDELGRGTQGITYHAVERSSGDNYAAKIMYGRPELRPFML--NELEMMNTFNHKNLIRPYDAYDT-DRSVTLIMELAAGGELVRDNLLRRDYYTERDIAHYIRQTLWGLEHMHEMGVGHMGLTIKDLLISVVGGDIIKVSDFGLSRKINRHNLSTLDY-GMPE-FVSPEVVNKEGVNFSHDMWTVGLITYVLLGGHNPFLGIDDRETLTKIREGRWDFKDEIWTHISDDGRDFISRLLLYSPEERMDVKTALKHPWF 3416          

HSP 2 Score: 116.316 bits (290), Expect = 6.733e-25
Identity = 103/426 (24.18%), Postives = 192/426 (45.07%), Query Frame = 2
Query: 10808 LGSEPISISWYKNQELLTDDSRIKLEVIKGGFLSCTILNATETDVGIFRCIARCHSLRTETSARLVLGDVPPQPEQLSVYYTNQEEVLLKWSPYLSAIDDVIYRIDIRTIDSR-NKIRNWKTIGYSVDNR-YLLENLDRTQQYIARIIAQNKYGYSPYSI--ATSVFQNKIRNIHSLK-----QALIFNRKWMLTSRQSNHFNDLHDLIKDISSDDIRMNVIREHYSTLSQKSSGFAVLKLKNTNVNFPEYIVQRTFKMED-----ICPAFDLCVRIKYYHFPILFGEICDSSLGNRITFEEFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRYESDIWSLGILSFLLLATQLP 12043
            +G     + W+KN  +LT+  RIK+ V + G        A   DVG+++ +AR    +T    R+V+  +P  P+   +   +  E+LL+W       DD    +   ++  + +    W T+  ++D+  YLL +L     Y  R+ ++N+ G+S   I  + S        IH  K     Q L  N   ++   +  H  D H   +    + +  + + + YS +S+ + G     +K    +    +V +  ++ D     +   FD    +++   P LF      ++   I   E + G ++L+   +R  YSE  V T++ QLL  +Q+LH     H NI+P  ++++  + +S  +KL+   + + V  +  +  +T      F+ PE   +     +SDIWSLG L++LLL+   P
Sbjct: 3654 VGDPKPCVQWFKNDMVLTESKRIKISVDEDGRSILRFEPALHFDVGVYKVVARNKVGQTVARCRIVVATLPDAPDSPEISANSGTEILLRWK---QPRDDGHSTVLCYSLQYKLSNCDAWTTVADNIDHEFYLLHDLQPNTNYQFRLASKNRIGWSEMGIPVSASTVGGDAPKIHITKAMKHLQQLTENGHQVVPEEERVH-TDYH--CEREPPNWVTDSSVSDKYSFISEIARGEFSTIVKGIQKSTDTVVVAKILEVTDENEDNVVAEFDNFKTLRHERIPALFSAYKPLNVPIAIFVMEKLQGADVLTYFSSRHEYSEQMVATVVTQLLDALQYLHWRGYCHLNIQPDNVVMA--SVRSIQVKLVDFGSAKKVNKLGMK--VTPCGSLDFQPPEMINDEPIFPQSDIWSLGALTYLLLSGCSP 4069          

HSP 3 Score: 109.768 bits (273), Expect = 6.577e-23
Identity = 73/264 (27.65%), Postives = 119/264 (45.08%), Query Frame = 2
Query: 9614 VNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEINNMGIGR--SEFQCIQNISHRNIVEIFDA---IAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQLYNEDSN------------DAISNSACVFIRKCLLLKTGERLTSSDSLSHEWFI 10354
            V+D+Y  + ++A+G +S     I+KST    + K  E+ +       +EF   + + H  I  +F A   + +P    + + EKLQG  +  Y +    + E  V  ++ QL+ A+ YLH    CHL+I+P+N++M    +  +KL  F +A      G +     +  F  PE++  EPI   SD+WS+G LT+L L G     F G   Y    N              ++  A  FI         +R  + D L H W +
Sbjct: 3869 VSDKYSFISEIARGEFSTIVKGIQKSTDTVVVAKILEVTDENEDNVVAEFDNFKTLRHERIPALFSAYKPLNVP--IAIFVMEKLQGADVLTYFSSRHEYSEQMVATVVTQLLDALQYLHWRGYCHLNIQPDNVVMASVRSIQVKLVDFGSAKKVNKLGMKVTPCGSLDFQPPEMINDEPIFPQSDIWSLGALTYLLLSGCSP--FRGADEYETKQNISFVRYRFENLFKEVTPEATRFIMLLFKRHPTKRPYTEDCLEHRWLM 4128          

HSP 4 Score: 93.2041 bits (230), Expect = 6.328e-18
Identity = 178/810 (21.98%), Postives = 303/810 (37.41%), Query Frame = 2
Query: 4073 NLAQLEIAHCQLSDSGQYKICFNPLEASKCGKVTGLFLVSIAP----IKKNLKPID----SNIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQD----KILQEKRITQKFNNNLSF--LLIDSVKLEDSGTYICQGFTNKELISECKITLNVVD--NISDTLQCQVKFEKDKYSIEINQDVTMRALIECTSTHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNS-VTKNIEITEGNELNLEVVSEIEKDLQ--------FQWSKD----DIDCSNNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGMVD-GKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRN--DMPFGDPCVLDNPFIDLYIESPQVN------EHSGLYKCIVTNEKSET-EFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLK-INE-----SSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIA----PLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIV 6355
            N  +L+I +C  +D+G Y I      AS+   V+    V  AP     K N +P       + E          V + G  K  +K+   E ++ +     +I+++K       + L F  L+I  V+  D+GTY C+  TNK   + C+     V+  N    L  Q+    +K   +                     W  NGE  + +         +     L  Q+      GIY C+ +   GN S +  EL+V+   I  LN    K   + E  E N  +      +LQ         QW  D     +D  +  ++   +++   +L     +  D+GVY  E + + G+    ++  V+  P          ++K I +   I  S  + + + +EV  + Q  +Q   N  D+       + +  I   +E   V         +G Y    TN+ S+T E+   TVK K      P++ +       E   I  EK  + +  R+         W  DE  +  TD + T+      Y L +      DAG Y++K  NE     SS  +L+K  P+   K                 L++I +      V+    V+      A W+ +  EID +  +F      N F L +        G YT ++ ND G                  ++ ++C +     P   + LK++E+   ++  L   +  +P+ KI W KDG  +      +  +      N+ L +  A  ED+G Y    TNF+G  T+   + V
Sbjct: 1073 NSYRLDIKNCSETDAGTYTI--RAQSASETTTVSAQLAVGQAPGHDETKTNTEPAFLVSLKDAEMIENTLFRFMVKIIGDPKPRVKFYKDEKEILETNDRIQIIRDK-------DYLGFYELVIADVQKTDAGTYSCKA-TNKHGEANCEAIATTVEDKNPFGALSGQILPAGEKPVFQ---------------------WKRNGEEFDPEERFKVLFGEDEDSLALVFQHVKPEDAGIYTCVAQTSTGNISCS-AELSVQGA-IQTLNREPEKPTLVIEHREANASIGGSAILELQCKGFPKPAVQWKHDGEVIQVDDRHKFMY---EDEESMSLVIKNVDTVDAGVYTIEAINELGQDESSINLVVKAPP----------KIKKITD---ITCSAGETIKMEIEVEGFPQPTVQVTNNGKDVTAESNVKISSSSIGKSLEKVVVEVKEIKLSQAGNYSIKATNDLSQTSEYWSCTVKSK------PVIVKNF-----ESEYIHGEKENVQMTVRIDAYPEAKLTWYHDETEIKITDSKYTVSSDGNAYTLKITGATRVDAGKYTVKATNEHGSATSSTQLLIKCAPEFTHK-----------------LKNITVAEGDSNVELVVGVDAYPRPHAKWYIDGIEIDEKRNDFRHVEEGNDFKLIMNQVATNMQGNYTCKIMNDYG------------------KLEDNCVVTVNCKPKVKRGLKNVEVQEGKSFTLEVEVYSEPEAKIKWFKDGHEIYEDARIKISRDTQRIENYYLTLNLARTEDAGTYEMKATNFIGETTSTCKVAV 1787          

HSP 5 Score: 92.8189 bits (229), Expect = 8.996e-18
Identity = 110/405 (27.16%), Postives = 176/405 (43.46%), Query Frame = 2
Query: 5150 DNEIILSDSKPLIISVEVLNWKQGVIQWLRND---MPFGDPCVLDNP--FIDLYIESPQVNEHSGLYKCIVTNEKSETEFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCY-NLILRDVKMTDAGMYSLKINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIF-IRNEPETVKFEFEVEESGAKKAIWFFENEEI--DAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTT 6337
            DN + +   +PL++   V       +QWL++     P     +  NP   + L I S Q N+ SG YK I++N   E +     V  K E++    L  + S TV     +  E ++L  E++V         W KD  LL  + P +  I  P     LI+   +  DAG+Y   I     +I    + + + K++K +F           LQD   I   P  VK + +V  +   K  WF    EI  DA ++  ++ + DN  +L I        G Y +   N  G   S  +L +  +++  E   E    AP F   L+D+     + + L+   + +P P+++W+KDG TL     N R+ +  +  +  L I  AE  DSG Y CL  N LG D++
Sbjct: 2203 DNALDVLQGEPLVLECCVDGSPLPTVQWLKDGDEVKPSESIKISTNPDGLVKLEINSCQPND-SGAYKLIISNPHGE-KVALCAVAVKPEEMQPKFLKPITSQTV-----VVGEPLKL--EAQVTGFPAPEVKWYKDGMLLRPS-PEINFINSPNGQIGLIIDAAQPLDAGVYKCLIANKGGEIEGVSKVEIVPKESKPVFV--------AELQDASSIEGFP--VKMDIKVVGNPKPKLQWFHNGHEIKPDASHIAIVE-NPDNSSSLIIEKTAPGDSGLYEVIAQNPEGSTASKAKLYVAPKAD--ETATEE---APQFVSALRDVNADEGQELVLSAPFISNPMPEVIWSKDGVTLTP---NERLLMTCDGKHIGLTIKPAEAADSGNYTCLLANPLGEDSS 2578          

HSP 6 Score: 69.3218 bits (168), Expect = 1.094e-10
Identity = 99/386 (25.65%), Postives = 160/386 (41.45%), Query Frame = 2
Query: 3929 SLNISENERILLEAKIISGNINSYKTPPQWFWNDEAVKNINCKKDFTS--NLAQLEIAHCQLSDSGQYK-ICFNPLEASKCGKVTGLFLVSIAPIK---KNLKPIDSNIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFN--NNLSFLLIDSVKLEDSGTYICQGFTNKELISECKITLNVVDNISDTLQCQVKFEKDKYSIE---INQDVTMRALIECTSTHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLN-------SVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCSNNGIFNSTKNKNCFNLTKLKAEITDSGVY 5032
            +L++ + E ++LE  +    + +     QW  + + VK     K  T+   L +LEI  CQ +DSG YK I  NP      G+   L  V++ P +   K LKPI S      GE + L   V GF   ++KW       K   +L+        N  N    L+ID+ +  D+G Y C    NK    E    + +V   S  +   V   +D  SIE   +  D+ +       +    + WF NG  ++  +  ++ ++N    + L I+       G+YE + +N +G S+ ++ +L V     +          S  +++   EG EL L          +  WSKD +  + N     T +     LT   AE  DSG Y
Sbjct: 2205 ALDVLQGEPLVLECCVDGSPLPTV----QWLKDGDEVKPSESIKISTNPDGLVKLEINSCQPNDSGAYKLIISNP-----HGEKVALCAVAVKPEEMQPKFLKPITSQTVVV-GEPLKLEAQVTGFPAPEVKW------YKDGMLLRPSPEINFINSPNGQIGLIIDAAQPLDAGVYKCL-IANKGGEIEGVSKVEIVPKESKPVF--VAELQDASSIEGFPVKMDIKV-----VGNPKPKLQWFHNGHEIKPDASHIAIVENPDNSSSLIIEKTAPGDSGLYEVIAQNPEG-STASKAKLYVAPKADETATEEAPQFVSALRDVNADEGQELVLSAPFISNPMPEVIWSKDGVTLTPNERLLMTCDGKHIGLTIKPAEAADSGNY 2565          

HSP 7 Score: 66.6254 bits (161), Expect = 7.830e-10
Identity = 199/944 (21.08%), Postives = 368/944 (38.98%), Query Frame = 2
Query: 3629 LNAKDIPIMTLKNGGWFLNSEPIHAVKFRGNEVIEENKVKIVIPNVTKEFSGLLQYRIVKPVELYSPEIIIKIRGSLIKQTPKIEEEKFESNLILELHNVSLNISENERILLEAKIISGNINSYKTPPQWFWNDEAVKNINCKKDFT---SNLAQLEIAHCQLSDSGQYKI-CFNPLEASKCGKVTGLFLVSIAPIKKNLKPIDSNIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNNNLSFLLIDSVKLEDSGTYICQGFTNKELISECKITLNVVDNISDTLQCQVK--------FEKDKYSIEINQDVTMRALIECTSTHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVT---KNIEITEGNELNLEVVSEIEK--DLQFQWSKDDIDCS-NNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGMVD-GKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMPF---------GDPCVLDNPFIDLYIESPQVNEHSGLYKCIVTNEKSETEFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSV-ESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLKI----------NESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPET----VKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEF--PNFTLIITEAEVEDSGRYCCLGTNFLG 6325
            L A + P+   K  G   + E    V F  +E    + + +V  +V  E +G+            S    + ++G++  QT   E EK    L++E    + +I  +  + L+ K        +  P   + +D  V  ++ +  F         L I +    D+G Y I   N L   +    + + LV  AP K  +K I ++I    GE++ + ++VEGF +  ++      D+  +  ++    +   +     + +  +KL  +G Y  +               N +   S+   C VK        FE +    E  ++V M   I+       ++W+ +   +++ +D    + ++G    LKI        G Y     N+ G S+T+ T+L      I C    T   KNI + EG+  N+E+V  ++       +W  D I+       F   +  N F L   +      G Y  + M D GKL +    TV   P          ++K   ++ E+   + K   + VEV +  +  I+W ++              D   ++N ++ L +      E +G Y+   TN   ET            KV    + E++   V + ++ E   ++  V  + +P      A+W  D K +   D    I +    Y L ++ + + DAG Y + +           E S+  + + R KPI  Q   + K++K+ +  K  + +    +P      +K    V E+   K     + ++ DAEN   +Q++C     L I  A  K  G+Y ++V N  G + + G + ++ + EIS                L D + L  + I     +  +PKPK+ WT+  E L   C +   +++ +     + L+       + G+Y    TN  G
Sbjct: 1232 LPAGEKPVFQWKRNGEEFDPEERFKVLFGEDE----DSLALVFQHVKPEDAGIYTCVAQTSTGNISCSAELSVQGAI--QTLNREPEK--PTLVIEHREANASIGGSAILELQCK-------GFPKPAVQWKHDGEVIQVDDRHKFMYEDEESMSLVIKNVDTVDAGVYTIEAINELGQDE----SSINLVVKAPPK--IKKI-TDITCSAGETIKMEIEVEGFPQPTVQVTNNGKDVTAESNVKISSSSIGKSLEKVVVEVKEIKLSQAGNYSIKA-------------TNDLSQTSEYWSCTVKSKPVIVKNFESEYIHGE-KENVQMTVRIDAYP-EAKLTWYHDETEIKI-TDSKYTVSSDGNAYTLKITGATRVDAGKYTVKATNEHG-SATSSTQL-----LIKCAPEFTHKLKNITVAEGDS-NVELVVGVDAYPRPHAKWYIDGIEIDEKRNDFRHVEEGNDFKLIMNQVATNMQGNYTCKIMNDYGKLEDNCVVTVNCKP----------KVKRGLKNVEV--QEGKSFTLEVEVYSEPEAKIKWFKDGHEIYEDARIKISRDTQRIENYYLTLNLAR---TEDAGTYEMKATNFIGETT--------STCKVAVLTVPEIVHVDVFQQHSYESVPLKYEVIATGIPKPE---AIWYHDGKPIT-PDKHTAITVDGDHYKLEVQSLDLVDAGEYKVVVQNKVGEKSHQGELSLSGIAEYR-KPILTQGPGL-KDIKVNKGDKVCEPVVFTADPAPEIVLLKDGQPVVETNNVK----LKVDKKDAENG-LVQYTC----TLNILEAEIKDSGRYELKVKNKYGELVTSGWIDVLAKPEIS---------------GLNDTKCLPGDTICFEALVQANPKPKVSWTRGNENL---CNHENCEVIADVDADKYRLVFQSVSPCEDGKYTITATNSEG 2074          

HSP 8 Score: 63.5438 bits (153), Expect = 6.736e-9
Identity = 122/575 (21.22%), Postives = 230/575 (40.00%), Query Frame = 2
Query: 4703 LKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCS-NNGIFNSTKNKNCFNLTKLKAEITDSGVYKFE-GMVDGKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDM---PFGDPCVLDNP--FIDLYIESPQVNEHSGLYKCIVTNEKSETEFV-EITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQP-FCYNLILRDVKMTDAGMYSLKIN--ESSVDILVK--VRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDN-YFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDS 6385
            L I++  E+  G Y C+  N+ G  + A  +L + ++    +  +   +++ +G  L LE   +       QW KD  +   +  I  ST       L     +  DSG YK       G+ + L    V+   +Q         LK I     ++    +PL +  +V  +    ++W ++ M   P  +   +++P   I L I++ Q  + +G+YKC++ N+  E E V ++ +  K+ K V   + EL     ++ ++IE   +++ +  +V         W  +   +      + I+  P    +LI+      D+G+Y +     E S     K  V PK     T+E       PQ    L+D+   +E + +        +   + IW    + +     E +  +CD  +  LTI  A     G YT  +AN +G             S      +      P+FT+K+ D + +   N ++   +   P P + W    + +     + +  I ++  +  LI+   E  D G Y C+ +N  G D T+  + + +   K S S
Sbjct: 2159 LDIKSFRENDVGAYTCVATNEIG-VTKAPFKLAMLSLAPSFVKKLDNALDVLQGEPLVLECCVDGSPLPTVQWLKDGDEVKPSESIKISTNPDGLVKLEINSCQPNDSGAYKLIISNPHGEKVALCAVAVKPEEMQPKF------LKPITSQTVVV---GEPLKLEAQVTGFPAPEVKWYKDGMLLRPSPEINFINSPNGQIGLIIDAAQPLD-AGVYKCLIANKGGEIEGVSKVEIVPKESKPV--FVAEL-----QDASSIEGFPVKMDI--KVVGNPKPKLQWFHNGHEIKPDASHIAIVENPDNSSSLIIEKTAPGDSGLYEVIAQNPEGSTASKAKLYVAPKADETATEEA------PQFVSALRDVNA-DEGQELVLSAPFISNPMPEVIW--SKDGVTLTPNERLLMTCDGKHIGLTIKPAEAADSGNYTCLLANPLG-----------EDSSACNANVRKVYKPPVFTQKISDQQQVFGNNAKIPVTVSGVPYPDLEWYFQDKPIPK---SEKYSIKNDGDHHMLIVNNCEKGDQGVYKCIASNREGKDITQGRLDIVNEIKKHSRS 2690          

HSP 9 Score: 57.7658 bits (138), Expect = 3.449e-7
Identity = 59/237 (24.89%), Postives = 104/237 (43.88%), Query Frame = 2
Query: 5711 RKQTKEIFKNLKIPQIKKPLQDIFIRNEP-ETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCD--NYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKD-GETLDSKCLNRRVKIL---DEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAV-IIVTDSEPKESDSSRII 6397
            R Q     +++  P + K L+ + +  EP ET  FE + ++       W  +N+ ++    + I  +    N + L I    E   G YTI+  +         +L++       E    +    P F   LKD E++     R   +++ DPKP++ + KD  E L++   N R++I+   D    + L+I + +  D+G Y C  TN  G    EA+   V D  P  + S +I+
Sbjct: 1005 RLQEDRPLRSVDKPVVVKMLKSVQV--EPGETAHFEIQFKDQPGL-VTWLKDNKPLEDRLADRITQTAAPMNSYRLDIKNCSETDAGTYTIRAQSASETTTVSAQLAVGQAPGHDETKTNT---EPAFLVSLKDAEMIENTLFRFMVKIIGDPKPRVKFYKDEKEILET---NDRIQIIRDKDYLGFYELVIADVQKTDAGTYSCKATNKHGEANCEAIATTVEDKNPFGALSGQIL 1232          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: spegb (striated muscle enriched protein kinase b [Source:ZFIN;Acc:ZDB-GENE-081104-517])

HSP 1 Score: 131.339 bits (329), Expect = 2.839e-29
Identity = 129/576 (22.40%), Postives = 252/576 (43.75%), Query Frame = 2
Query: 8708 REITLSWSPPRISPDLYIPFTVDVECRPVNYSYSDEEG------WSVFKTNIKKNRVDIADLDPNINYQLRIVPVTDFGIGKPSMVIKKIRRSDNLNSPTTEKAMMLQEKHCLAVPMFCCLSQKAELKFTKLMEYKLDKITWTFNNAKVDVNDERYKIFSAETYGIYFIIKNLEEDDFGEYCALDEVQDPIQSFILI--KSDAPTILNCLPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIF-SSYRTVITEDKEQGTYSLLISKCILSDGGEYSIRAENAIGFAEVKFNLRV--------DAHPEKKSVQINIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFF--EINNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAV---PKE----DFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKV-NFEGDQLYNEDSN-DAISNSACVFIRKCLLLKTGERLTSSDSLSHEWF 10351
            + ITLSW  P+          +D    P +  Y+ ++       W++  + +K+    I++L   + Y  R++ +T     KPS   + ++  D    P  ++A ++ +K     P    + +K  L  T  + +    +TW      +      +++   +       +  ++  D G+   +   +    S +L    + APT    + +  + + E    +V ++ +P P+++W +    +  SS+ T + +D E    SL++      D G Y+  A+N  G    K  L V        D   ++ S+   +  + D Y   K++ +G++S  + VI+K+ ++E+  KF             E   + ++ H  I+   DA     +  V+I  +L    L + +T+ S   ES++R  + QL++ ++YLH+  + HLDIKP+NI+M    ++ +++C F NAV   P E     +G       T  F APE++   P+   +D+   G+  F   +    V N     +  E+S    + + A  F+ K LL+    R  +++ L H WF
Sbjct: 1027 KTITLSWKKPK---------RLDPSIDPSSLMYAIQQQALGSIQWTIIASCLKQTTYTISNLSKGVRYAFRVLSITSKAFSKPSPATEPMQLLDR--GPYVQEAPVIIDK-----PDIVYMVEKQPLSITVTLNHVNASVTWKRGGVTLSNRPGLFELSMPDDDQHTLKLCKVKSSDVGQLTCIANNKYGSDSCVLTLEMAVAPTFETIMEDLDVNVGETPRFAVVVEGKPVPDILWYKGDTLLSESSHFTFVYDDNE---CSLVVLNTQADDSGVYTCTAKNLAGSVSCKAELTVHTTKQYKDDPMEDEASILRKMRRLTDYYDVHKEIGRGAFSYVKRVIQKAGKLEYAAKFISARAKRKASALRELNILSHLDHERILYFHDAFE--KKNAVIIITELCHEELLDRLTKKSTILESEIRSSVRQLLEGINYLHQLDILHLDIKPDNILMADHSSDQIRICDFGNAVKFMPDEAQYCKYG-------TPEFVAPEIVNQTPVSKATDICLTGVSPFAGENDRSSVLNIRNYNVAFEESMFTDLCHEAKGFVIK-LLVADRLRPDANECLRHPWF 1573          

HSP 2 Score: 105.145 bits (261), Expect = 1.926e-21
Identity = 77/264 (29.17%), Postives = 124/264 (46.97%), Query Frame = 2
Query: 9626 YYTMKKLAKGSYSRCQIVIEKSTQIEFIGKF--FEINNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVPKEDFGSRRHMGLTSP-----FSAPELLKGEPIQFNSDMWSIGILTFLCLHGHL---------------KVNFEGDQLYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWF 10351
            Y  M + A+G +   +   E +T   ++ K   +E  +      E+  ++++ H  I+ + +A   P +YLVLI E   G  L   +     + E  V   I Q++Q + YLH  R+ HLDIKPENII+T  Y  ++K+  F +A   + F        + P     + +PE+LKG+ +   +D+WSIGILT++ L G L                  F+  +LY       +S SA +FI+K L      R T  D  ++ W 
Sbjct: 2753 YTFMDEKARGRFGVIRECRENATGNLYMAKIVPYEPESKQTVLQEYDILKSLHHEKIMALHEAYVTP-RYLVLISECCSGKELLHSLIDRFRYSEDDVVAYIVQILQGLDYLHSRRILHLDIKPENIIVT--YMNVVKIIDFGSA---QTFNPLFLKQFSPPIGTLDYMSPEMLKGDVVGPPADIWSIGILTYIMLSGRLPFTENDPAETEARIQAAKFDLSKLYQN-----VSQSASLFIKKILCSYPWARPTIKDCFTNSWL 3005          

HSP 3 Score: 93.2041 bits (230), Expect = 7.545e-18
Identity = 116/515 (22.52%), Postives = 202/515 (39.22%), Query Frame = 2
Query: 5534 WLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLKI-NESSVD-----ILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAE----NMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDS---------------------SRIIVKPLCAPVLTAEYSKGADVILSWTSVATTDTLNIIYNIEKQKSLTSTNWKKIMKNLTETTYSLSSSCLPPQESHLLRCVAISEYGFETVSNIIEIPIRANSPIL--PPD-KPTIIFKDATCVKISWMRGKCKNLTPEESIGKIMYSLEMKDNPKSSWQIVSNDLVDNEYSLS-LEPGVSYMFRVIAFNDFGISEPS 6973
            WL+D   +      +    +   + +I++  + +D G+Y+ KI NE         + VK RP         +   L    I +P++D+ ++   ET  FE  V         W  + + I        M F    C     L + +  E   G YT +++     + S  +L ++              I PLFT+KL  +E++   N R +C++   P P+++W+     L+    N  ++IL E    +LII+    ED G Y     N  G D   A + V +  P  S                        R  +     P+   +  +G + +L    VA      I +     K + ST  +K+ +      +SL   C+      + +CV  ++ G  T  + + +     + IL  PPD  P +       + +SW   K K L P      +MY+++ +      W I+++ L    Y++S L  GV Y FRV++      S+PS
Sbjct:  630 WLRDRVTIKTGTRHIVQETEEGNFEMIIKSAQRSDTGVYTCKIINEYGTKQCEGKLEVKARP---------VEPGL---AIIRPVRDVMVKAG-ETALFECHVIGPQDTDVDWLSDGKLIQPALLNCKMHFDGKRC----RLLLNSVHEDDSGTYTCKLSTAKEELTSSAKLKVI------------ASIEPLFTRKLDVLEVIEGRNARFDCKVSGTPPPQVIWSHFDRPLEE---NEDIRILKEGGRHSLIISHVSNEDEGLYTVAARNSHGEDECAAELYVQEPRPAISSQIAKLEKMPSIPEEPEVPENEIERFTMPDFVKPLYDMDVVEGREAVLR-CKVAGLPYPTITW-FHNGKRIDSTEDRKMTQ--FRDVHSLVVRCVCHAHGGVYKCVISNKVGKATCYSHLYV-----TDILPDPPDGAPVVESITGKTITLSWK--KPKRLDPSIDPSSLMYAIQQQALGSIQWTIIASCLKQTTYTISNLSKGVRYAFRVLSITSKAFSKPS 1101          

HSP 4 Score: 89.7373 bits (221), Expect = 1.006e-16
Identity = 113/470 (24.04%), Postives = 192/470 (40.85%), Query Frame = 2
Query: 10781 VTLTCQLSLLGSEPISISWYKNQELLTDDSRIKLEVIKGGFLSCTILNATETDVGIFRCIARCHSLRTETSARLV-LGDVPPQPEQLSVYYTNQEEVLLKWSPYLSAIDDVIYRIDIRTIDSRNKIRNWKTIGYSV-DNRYLLENLDRTQQYIARIIAQNKYGYSPYSIATSV--FQNKIRNIHSL----KQALIFNRKWMLTSRQSNHFNDL-----HDLIKDISSDDIRMNVIREHYSTLSQKSSG-FAVLKLKNTNVN-------------------FPEYIVQRTFKMEDICPAFDLCVRIKYYHFPILFGEICDSSLGNRITFEEFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSI----FKAPEYRYESITRYESDIWSLGILSFLLLATQLPAIEDACSDSDVH 12079
            VTL+C  +  GS    ISW K+++ L  D R+ +     G     I+  T+ D G++ C+A  + L T TS+ +V L  +P  P    V    +   L+ W P         Y ++ R  +  N   NW  +   V D  Y + +L     Y  R+   NK G  PYS  + V    + +  + SL    +     NR  M  S ++     +        I       +R  V ++ Y+ + +K+ G F V++    N                       EY + ++   E I    +  V  +Y    +L  E C               G  LL  L+ R  YSE  VV  I Q+L  + +LHS  ++H +I+P  I+++        +K+I   + Q    +     L    P I    + +PE     +    +DIWS+GIL++++L+ +LP  E+  ++++  
Sbjct: 2525 VTLSCLPA--GSPHPHISWMKDKKPLEIDPRMNMISCPDGRQLLMIMKTTKKDAGLYECVA-ANPLATVTSSCVVSLARLPNSPGTPEVPQKYKNTALVVWRPS-DTTAPCTYSLE-RKTEGEN---NWLIVATGVADCYYNVLDLPAGASYRFRVACVNKAGQGPYSSLSEVVVLDSTVVLVTSLSPVGEGTGTPNR--MTPSGRATPSGRITPSGRRTPIGKPGDSTLRQGVPQKPYTFMDEKARGRFGVIRECRENATGNLYMAKIVPYEPESKQTVLQEYDILKSLHHEKIMALHEAYVTPRYL---VLISECCS--------------GKELLHSLIDRFRYSEDDVVAYIVQILQGLDYLHSRRILHLDIKPENIIVTYMNV----VKIIDFGSAQTFNPL----FLKQFSPPIGTLDYMSPEMLKGDVVGPPADIWSIGILTYIMLSGRLPFTENDPAETEAR 2959          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: spega (striated muscle enriched protein kinase a [Source:NCBI gene;Acc:570504])

HSP 1 Score: 128.642 bits (322), Expect = 1.523e-28
Identity = 136/607 (22.41%), Postives = 258/607 (42.50%), Query Frame = 2
Query: 8708 REITLSWSPPRISPDLYIPFTVDVECRPVNYSYSDEEG------WSVFKTNIKKNRVDIADLDPNINYQLRIVPVTDFGIGKPSMVIKKIRRSDNLNSPTTEKAMMLQEKHCLAVPMFCCLSQKAELKFTKLMEYKLDKITWTFNNAKVDVNDERYKIFSAETYGIYFI-----------IKNLEEDDFGE--YCALDEVQDPIQSFILIKSDAPTILNCLPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIF-SSYRTVITEDKEQGTYSLLISKCILSDGGEYSIRAENAIGFAEVKFNLRVDAHPE----------KKSVQINIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEI--NNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAV---PKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQ-----------LYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWF--IKPGNNLNAAL 10384
            R I LSW  P+          +D    P +  Y  ++       W+   +++      +  L   + Y  R++  T   + KPS              PT    ++ + ++    P+      K ++ +   +E +   IT T N+ +     +R  +      G   +           I  ++  D G+  + A ++    + +  L+ +  P     + +  + + E    +V +D +P P+++W ++   +  SS+ T + +D+E    SL++      D G Y+  A+N  G    K  L V               + ++   +  + D Y   K++ +G++S  + V  K+ Q  F  KF  +          E   +  + H++IV   DA     + +V+I  +L    L E IT+ +   ES+V+ II QL++ + YLH++ + HLD+KPENI+M  +  + +++C F NA+   P E+   +     T  F APE++   PI  ++D+W +G++T+LCL G      E D+            + E     +   A  FI K +L+    R  +++ L H WF  +  G ++N  L
Sbjct:  949 RMILLSWKKPK---------NLDPSIDPASLMYVVQQQVLGSTQWTTIASSLTDTSYTVTSLSKGVCYSFRVLSTTGKTLSKPSQ-------------PTDLVQLVDRGEYFRKAPVII---DKPDIVYA--VENQPVTITITINHVQATCTWKRRGVVLVNKLGALEMTTPDDDQHALHIAKVKSTDVGQLIFMANNQYGSDLCTLQLVIAVPPIFETIMEDLDVCVGETCHFAVVVDGKPDPDILWYKDGVLLAESSHLTFVYDDRE---CSLVVLNAQPEDVGVYTCTAKNLAGSVSCKAELTVHTAQNVEEEEEQMEDEATILRRMRMLTDYYDIHKEIGRGAFSYVKRVKHKNDQ-SFAAKFISVRAKKKTCALRELALLAELDHKSIVRFHDAFE--KRRVVIILTELCHEELLERITKRTTILESEVQSIIRQLLEGIEYLHQNDIIHLDLKPENILMADQKTDQIRICDFGNALKVKPNEELYCKYG---TPEFIAPEIVNQSPISKSTDIWPVGVITYLCLTGVSPFAGENDRDTLLNIRNYNVAFEESMFKDLCREAKGFIIK-VLVSNKLRPDATECLLHPWFKSLTKGKSINTTL 1518          

HSP 2 Score: 92.8189 bits (229), Expect = 1.115e-17
Identity = 71/257 (27.63%), Postives = 124/257 (48.25%), Query Frame = 2
Query: 9626 YYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEINNMGIGR--SEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAV---PKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQLYNEDSNDA----------ISNSACVFIRKCLLLKTGERLTSSDSLSHEWF 10351
            Y  + + A+G +   +   E +T   FI K    +         E++ ++++    I+ + +A   P +YLVLI E   G  + + +     + E  V   I Q++Q + YLH  ++ HLDIKP+NI++T     ++K+  F +A    P       R++G T  + APE+LKG+ +   +D+WS+G+L+++ L G      +  QL     ++A          +S SA  F++K L      R T  D L+H W 
Sbjct: 2682 YSFLDEKARGRFGVIRDCRENATGKMFIAKIIPYDQQTKQTIIKEYEILKSLRCERIMALHEAYITP-RYLVLITEYCSGKEILQNLIDRFCYSEDDVVGFIVQILQGLEYLHNCKILHLDIKPDNIMVTNL--NVIKIIDFGSAQRFNPLSLQQCSRYLG-TLEYMAPEMLKGDLVGPPADIWSLGVLSYIMLSGRHPFEDKDPQLTEAKIHEAKFDSTKLYPKVSQSASTFLKKILNSYPWCRPTIKDCLNHSWL 2934          

HSP 3 Score: 80.1073 bits (196), Expect = 7.918e-14
Identity = 100/444 (22.52%), Postives = 176/444 (39.64%), Query Frame = 2
Query: 5756 IKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAE----NMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPK-ESDSSRIIVKP--------------------LCAPVLTAEYSKGADVILSWTSVATTDTLNIIYNIEKQKSLTSTNWKKIMKNLTETTYSLSSSCLPPQESHLLRCVAISEYGFETVSNIIEIPIRANSPILPPDKPTIIFK-DATCVKISWMRGKCKNLTPEESIGKIMYSLEMKDNPKSSWQIVSNDLVDNEYSL-SLEPGVSYMFRVIAFNDFGISEPSQ--SLISRIDR 7000
            I +P+QD+ ++   ET   E  +  S A    W    + I        M+F    C   F     +A E   G YT +++     +     L ++   E            PLFT+KL+ +E +   + + +C++   P P++ WT   + L     +  + IL+   + +L+IT    E  G Y  +  N  G   + A + V +  P   +  SR+   P                       P+   E  +G + +L              Y+    K + STN +K+ +     +  + S C     S + +CV  ++ G       + + +    P   PD P +I       + +SW   K KNL P      +MY ++ +    + W  +++ L D  Y++ SL  GV Y FRV++     +S+PSQ   L+  +DR
Sbjct:  620 ITRPMQDVKVKAG-ETALLECFIAGSQAVDVDWLANGKLIQPALFDCKMQFDGHRCRLLFK----SAHENDSGCYTCKLSTAKEELICTANLLVIPSKE------------PLFTRKLEVLEAIEGRSAQFDCKVSGCPPPEVTWTHCEKPL---VESDNIHILNVNGHHSLLITHVNKESEGLYTAIAQNVHGKAASSAELYVQEPRPAISTHMSRLEKMPSIPEEPEVPEGEVERRTMPDFIKPLSDLEVIEGKEAVLKCRVTGLPYPKITWYH--NGKKIESTNDRKMTQYRDVHSLVIQSVCH--DHSGVYKCVISNKVGKAACYAHLYVAVSLPEP---PDGPPVIESVTGRMILLSWK--KPKNLDPSIDPASLMYVVQQQVLGSTQWTTIASSLTDTSYTVTSLSKGVCYSFRVLSTTGKTLSKPSQPTDLVQLVDR 1034          

HSP 4 Score: 69.707 bits (169), Expect = 1.008e-10
Identity = 82/359 (22.84%), Postives = 147/359 (40.95%), Query Frame = 2
Query: 5609 LILRDVKMTDAGMYSLKINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRN-------EPETVKFEFEVEESGAKKAIWFF-ENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLM-LRSEISEQM-----MESCC-------------IAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRIIVKPLCAPVLTAEYSKGADVILSWTSV----ATTDTLNIIYNIEKQKSLTSTNWKKIMKNLTETTYSLSS 6592
            L+ +     D+G Y+ K++ +  +++                 NL +   K+PL   F R        E  + +F+ +V      +  W   E   ++++N+  +  + + + +L I    ++  G YT    N  G   S   L +   R  IS  M     M S                 P F K L D+E++  +   L CR+   P PKI W  +G+ ++S    +  +  D     +L+I     + SG Y C+ +N +G     A + V  S P+  D   +I           E   G  ++LSW        + D  +++Y ++ Q+ L ST W  I  +LT+T+Y+++S
Sbjct:  676 LLFKSAHENDSGCYTCKLSTAKEELICTA--------------NLLVIPSKEPL---FTRKLEVLEAIEGRSAQFDCKVSGCPPPEVTWTHCEKPLVESDNIHIL--NVNGHHSLLITHVNKESEGLYTAIAQNVHGKAASSAELYVQEPRPAISTHMSRLEKMPSIPEEPEVPEGEVERRTMPDFIKPLSDLEVIEGKEAVLKCRVTGLPYPKITWYHNGKKIESTNDRKMTQYRDV---HSLVIQSVCHDHSGVYKCVISNKVGKAACYAHLYVAVSLPEPPDGPPVI-----------ESVTGRMILLSWKKPKNLDPSIDPASLMYVVQ-QQVLGSTQWTTIASSLTDTSYTVTS 1000          

HSP 5 Score: 64.3142 bits (155), Expect = 4.416e-9
Identity = 78/317 (24.61%), Postives = 130/317 (41.01%), Query Frame = 2
Query: 11417 SSDDIRMNVIREHYSTLSQKSSG-FAVLKLKNTNVNFPEYIV----------QRTFKMEDICPAFDLCVRIKYYHFPILFGEICDSSLGNRITFEEFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRYESDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNTNTLLLPVPHTHFRAPKLSMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWFKQDPQTIYEMEHQTISSTPLVDFVN 12334
            S   +R  V ++ YS L +K+ G F V++    N     +I           Q   K  +I  +   C RI   H   +            +   E+  G  +L  L+ R  YSE  VV  I Q+L  +++LH+  ++H +I+P  I++   TN +  IK+I   + Q    +  Q+         + APE     +    +DIWSLG+LS+++L+ + P  ED           K+       +    F + KL    + S+S+  F+   L   P  R      L HSW           +  T ++T L +F+ 
Sbjct: 2669 SETTLRQGVPQKPYSFLDEKARGRFGVIRDCRENATGKMFIAKIIPYDQQTKQTIIKEYEILKSLR-CERIMALHEAYITPRYL-------VLITEYCSGKEILQNLIDRFCYSEDDVVGFIVQILQGLEYLHNCKILHLDIKPDNIMV---TNLNV-IKIIDFGSAQRFNPLSLQQCSRYLGTLEYMAPEMLKGDLVGPPADIWSLGVLSYIMLSGRHP-FED-----------KDPQLTEAKIHEAKFDSTKL--YPKVSQSASTFLKKILNSYPWCRPTIKDCLNHSWLHDSYLKKLRRQTLTFTTTRLKEFMG 2959          

HSP 6 Score: 63.929 bits (154), Expect = 6.771e-9
Identity = 58/219 (26.48%), Postives = 93/219 (42.47%), Query Frame = 2
Query: 11615 ILFGEICDSSLGNRITFEEFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVK---EQESLTTHKPSIFKAPEYRYESITRYESDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNTNTLLLPVPHTHFRAPKLSMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWFK 12262
            I+  E+C   L  RIT                R+   E  V +IIRQLL  I++LH N+++H +++P  IL++       D K   +  C F   +K    +E    +    F APE   +S     +DIW +G++++L L    P   +  +D D    ++N N              + SM     + ++ F+   L  S   R +A   L H WFK
Sbjct: 1324 IILTELCHEELLERIT---------------KRTTILESEVQSIIRQLLEGIEYLHQNDIIHLDLKPENILMA-------DQKTDQIRICDFGNALKVKPNEELYCKYGTPEFIAPEIVNQSPISKSTDIWPVGVITYLCLTGVSPFAGE--NDRDTLLNIRNYNVAF-----------EESMFKDLCREAKGFIIKVL-VSNKLRPDATECLLHPWFK 1506          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: spega (striated muscle enriched protein kinase a [Source:NCBI gene;Acc:570504])

HSP 1 Score: 128.642 bits (322), Expect = 1.536e-28
Identity = 136/607 (22.41%), Postives = 258/607 (42.50%), Query Frame = 2
Query: 8708 REITLSWSPPRISPDLYIPFTVDVECRPVNYSYSDEEG------WSVFKTNIKKNRVDIADLDPNINYQLRIVPVTDFGIGKPSMVIKKIRRSDNLNSPTTEKAMMLQEKHCLAVPMFCCLSQKAELKFTKLMEYKLDKITWTFNNAKVDVNDERYKIFSAETYGIYFI-----------IKNLEEDDFGE--YCALDEVQDPIQSFILIKSDAPTILNCLPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIF-SSYRTVITEDKEQGTYSLLISKCILSDGGEYSIRAENAIGFAEVKFNLRVDAHPE----------KKSVQINIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEI--NNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAV---PKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQ-----------LYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWF--IKPGNNLNAAL 10384
            R I LSW  P+          +D    P +  Y  ++       W+   +++      +  L   + Y  R++  T   + KPS              PT    ++ + ++    P+      K ++ +   +E +   IT T N+ +     +R  +      G   +           I  ++  D G+  + A ++    + +  L+ +  P     + +  + + E    +V +D +P P+++W ++   +  SS+ T + +D+E    SL++      D G Y+  A+N  G    K  L V               + ++   +  + D Y   K++ +G++S  + V  K+ Q  F  KF  +          E   +  + H++IV   DA     + +V+I  +L    L E IT+ +   ES+V+ II QL++ + YLH++ + HLD+KPENI+M  +  + +++C F NA+   P E+   +     T  F APE++   PI  ++D+W +G++T+LCL G      E D+            + E     +   A  FI K +L+    R  +++ L H WF  +  G ++N  L
Sbjct:  949 RMILLSWKKPK---------NLDPSIDPASLMYVVQQQVLGSTQWTTIASSLTDTSYTVTSLSKGVCYSFRVLSTTGKTLSKPSQ-------------PTDLVQLVDRGEYFRKAPVII---DKPDIVYA--VENQPVTITITINHVQATCTWKRRGVVLVNKLGALEMTTPDDDQHALHIAKVKSTDVGQLIFMANNQYGSDLCTLQLVIAVPPIFETIMEDLDVCVGETCHFAVVVDGKPDPDILWYKDGVLLAESSHLTFVYDDRE---CSLVVLNAQPEDVGVYTCTAKNLAGSVSCKAELTVHTAQNVEEEEEQMEDEATILRRMRMLTDYYDIHKEIGRGAFSYVKRVKHKNDQ-SFAAKFISVRAKKKTCALRELALLAELDHKSIVRFHDAFE--KRRVVIILTELCHEELLERITKRTTILESEVQSIIRQLLEGIEYLHQNYIIHLDLKPENILMADQKTDQIRICDFGNALKVKPNEELYCKYG---TPEFIAPEIVNQSPISKSTDIWPVGVITYLCLTGVSPFAGENDRDTLLNIRNYNVAFEESMFKDLCREAKGFIIK-VLVSNKLRPDATECLLHPWFKSLTKGKSINTTL 1518          

HSP 2 Score: 91.2781 bits (225), Expect = 3.516e-17
Identity = 71/257 (27.63%), Postives = 124/257 (48.25%), Query Frame = 2
Query: 9626 YYTMKKLAKGSYSRCQIVIEKSTQIEFIGKF--FEINNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAV---PKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQLYNEDSNDA----------ISNSACVFIRKCLLLKTGERLTSSDSLSHEWF 10351
            Y  + + A+G +   +   E +T   FI K   ++         E++ ++++    I+ + +A   P +YLVLI E   G  + + +     + E  V   I Q++Q + YLH  ++ HLDIKP+NI++T     ++K+  F +A    P       R++G T  + APE+LKG+ +   +D+WS+G+L+++ L G      +  QL     ++A          +S SA  F++K L      R T  D L H W 
Sbjct: 2682 YSFLDEKARGRFGVIRDCRENATGKMFIAKIIPYDQKTKQTIIKEYEILKSLRCERIMALHEAYITP-RYLVLITEYCSGKEILQNLIDRFCYSEDDVVGFIVQILQGLEYLHNCKILHLDIKPDNIMVTNL--NVIKIIDFGSAQRFNPLSLQQCSRYLG-TLEYMAPEMLKGDLVGPPADIWSLGVLSYIMLSGRHPFEDKDPQLTEAKIHEAKFDSTKLYPKVSQSASTFLKKILNSYPWCRPTIKDCLIHSWL 2934          

HSP 3 Score: 80.1073 bits (196), Expect = 8.467e-14
Identity = 100/444 (22.52%), Postives = 176/444 (39.64%), Query Frame = 2
Query: 5756 IKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAE----NMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPK-ESDSSRIIVKP--------------------LCAPVLTAEYSKGADVILSWTSVATTDTLNIIYNIEKQKSLTSTNWKKIMKNLTETTYSLSSSCLPPQESHLLRCVAISEYGFETVSNIIEIPIRANSPILPPDKPTIIFK-DATCVKISWMRGKCKNLTPEESIGKIMYSLEMKDNPKSSWQIVSNDLVDNEYSL-SLEPGVSYMFRVIAFNDFGISEPSQ--SLISRIDR 7000
            I +P+QD+ ++   ET   E  +  S A    W    + I        M+F    C   F     +A E   G YT +++     +     L ++   E            PLFT+KL+ +E +   + + +C++   P P++ WT   + L     +  + IL+   + +L+IT    E  G Y  +  N  G   + A + V +  P   +  SR+   P                       P+   E  +G + +L              Y+    K + STN +K+ +     +  + S C     S + +CV  ++ G       + + +    P   PD P +I       + +SW   K KNL P      +MY ++ +    + W  +++ L D  Y++ SL  GV Y FRV++     +S+PSQ   L+  +DR
Sbjct:  620 ITRPMQDVKVKAG-ETALLECFIAGSQAVDVDWLANGKLIQPALFDCKMQFDGHRCRLLFK----SAHENDSGCYTCKLSTAKEELICTANLLVIPSKE------------PLFTRKLEVLEAIEGRSAQFDCKVSGCPPPEVTWTHCEKPL---VESDNIHILNVNGHHSLLITHVNKESEGLYTAIAQNVHGKAASSAELYVQEPRPAISTHMSRLEKMPSIPEEPEVPEGEVERRTMPDFIKPLSDLEVIEGKEAVLKCRVTGLPYPKITWYH--NGKKIESTNDRKMTQYRDVHSLVIQSVCH--DHSGVYKCVISNKVGKAACYAHLYVAVSLPEP---PDGPPVIESVTGRMILLSWK--KPKNLDPSIDPASLMYVVQQQVLGSTQWTTIASSLTDTSYTVTSLSKGVCYSFRVLSTTGKTLSKPSQPTDLVQLVDR 1034          

HSP 4 Score: 69.707 bits (169), Expect = 1.025e-10
Identity = 86/384 (22.40%), Postives = 154/384 (40.10%), Query Frame = 2
Query: 5534 WLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLKINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRN-------EPETVKFEFEVEESGAKKAIWFF-ENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLM-LRSEISEQM-----MESCC-------------IAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRIIVKPLCAPVLTAEYSKGADVILSWTSV----ATTDTLNIIYNIEKQKSLTSTNWKKIMKNLTETTYSLSS 6592
            WL + KL+        +        L+ +     D+G Y+ K++ +  +++                 NL +   K+PL   F R        E  + +F+ +V      +  W   E   ++++N+  +  + + + +L I    ++  G YT    N  G   S   L +   R  IS  M     M S                 P F K L D+E++  +   L CR+   P PKI W  +G+ ++S    +  +  D     +L+I     + SG Y C+ +N +G     A + V  S P+  D   +I           E   G  ++LSW        + D  +++Y ++ Q+ L ST W  I  +LT+T+Y+++S
Sbjct:  651 WLANGKLIQPALFDCKMQFDGHRCRLLFKSAHENDSGCYTCKLSTAKEELICTA--------------NLLVIPSKEPL---FTRKLEVLEAIEGRSAQFDCKVSGCPPPEVTWTHCEKPLVESDNIHIL--NVNGHHSLLITHVNKESEGLYTAIAQNVHGKAASSAELYVQEPRPAISTHMSRLEKMPSIPEEPEVPEGEVERRTMPDFIKPLSDLEVIEGKEAVLKCRVTGLPYPKITWYHNGKKIESTNDRKMTQYRDV---HSLVIQSVCHDHSGVYKCVISNKVGKAACYAHLYVAVSLPEPPDGPPVI-----------ESVTGRMILLSWKKPKNLDPSIDPASLMYVVQ-QQVLGSTQWTTIASSLTDTSYTVTS 1000          

HSP 5 Score: 64.6994 bits (156), Expect = 4.027e-9
Identity = 78/317 (24.61%), Postives = 130/317 (41.01%), Query Frame = 2
Query: 11417 SSDDIRMNVIREHYSTLSQKSSG-FAVLKLKNTNVNFPEYIV----------QRTFKMEDICPAFDLCVRIKYYHFPILFGEICDSSLGNRITFEEFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRYESDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNTNTLLLPVPHTHFRAPKLSMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWFKQDPQTIYEMEHQTISSTPLVDFVN 12334
            S   +R  V ++ YS L +K+ G F V++    N     +I           Q   K  +I  +   C RI   H   +            +   E+  G  +L  L+ R  YSE  VV  I Q+L  +++LH+  ++H +I+P  I++   TN +  IK+I   + Q    +  Q+         + APE     +    +DIWSLG+LS+++L+ + P  ED           K+       +    F + KL    + S+S+  F+   L   P  R      L HSW           +  T ++T L +F+ 
Sbjct: 2669 SETTLRQGVPQKPYSFLDEKARGRFGVIRDCRENATGKMFIAKIIPYDQKTKQTIIKEYEILKSLR-CERIMALHEAYITPRYL-------VLITEYCSGKEILQNLIDRFCYSEDDVVGFIVQILQGLEYLHNCKILHLDIKPDNIMV---TNLNV-IKIIDFGSAQRFNPLSLQQCSRYLGTLEYMAPEMLKGDLVGPPADIWSLGVLSYIMLSGRHP-FED-----------KDPQLTEAKIHEAKFDSTKL--YPKVSQSASTFLKKILNSYPWCRPTIKDCLIHSWLHDSYLKKLRRQTLTFTTTRLKEFMG 2959          

HSP 6 Score: 62.3882 bits (150), Expect = 2.013e-8
Identity = 58/219 (26.48%), Postives = 92/219 (42.01%), Query Frame = 2
Query: 11615 ILFGEICDSSLGNRITFEEFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVK---EQESLTTHKPSIFKAPEYRYESITRYESDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNTNTLLLPVPHTHFRAPKLSMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWFK 12262
            I+  E+C   L  RIT                R+   E  V +IIRQLL  I++LH N ++H +++P  IL++       D K   +  C F   +K    +E    +    F APE   +S     +DIW +G++++L L    P   +  +D D    ++N N              + SM     + ++ F+   L  S   R +A   L H WFK
Sbjct: 1324 IILTELCHEELLERIT---------------KRTTILESEVQSIIRQLLEGIEYLHQNYIIHLDLKPENILMA-------DQKTDQIRICDFGNALKVKPNEELYCKYGTPEFIAPEIVNQSPISKSTDIWPVGVITYLCLTGVSPFAGE--NDRDTLLNIRNYNVAF-----------EESMFKDLCREAKGFIIKVL-VSNKLRPDATECLLHPWFK 1506          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: si:dkey-240h12.4 (si:dkey-240h12.4 [Source:ZFIN;Acc:ZDB-GENE-070705-406])

HSP 1 Score: 119.398 bits (298), Expect = 7.498e-28
Identity = 84/284 (29.58%), Postives = 150/284 (52.82%), Query Frame = 2
Query: 9605 IGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEI-----NNMGIGRS----EFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEI--LKLCGFSNA---VPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQ--LYNEDSND---------AISNSACVFIRKCLLLKTGERLTSSDSLSHEWFIKPGNNLNAA 10381
            + +V D Y     L  G + + + V E++T + + GKF ++     + +G+ R     E + +Q++ H+NI+ I D      + +VLI E ++G  L ++I +  +  E++    + Q+++ V+Y+H+  V H D+KPENI+++ K++    +K+  F  A   +  E++ S   +G T  + APE++  EP+   +DMWSIG++T++ L G      E D+  L N  S +           +N A  FI+K L+    ER+T+ + L H W IKP N    A
Sbjct:    6 VDNVEDLYEIGNVLGSGHFGQVREVRERATGVLWAGKFLKLKKGAGSRLGLERKSVEKEVEILQSLQHQNIMAIRDVFESRAE-IVLIVELIKGGELFDFIAEKENLTETEAIEFMKQILEGVNYMHQKNVAHFDLKPENIMLSDKHDPHPDIKIIDFGMAHHFIQGEEYKS---LGGTPQYIAPEIINYEPLGTAADMWSIGVITYILLSGLSPFQGETDEETLRNIVSMNYEFEPHFFSQTTNMAKDFIQKLLVKDQSERMTAEECLIHPW-IKPLNRTQIA 284          

HSP 2 Score: 67.3958 bits (163), Expect = 1.530e-10
Identity = 48/203 (23.65%), Postives = 91/203 (44.83%), Query Frame = 2
Query: 11669 EFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRYE-----SDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNTNTLLLPVPHTHFRAPKLSMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWFK 12262
            E + GG L   +  +   +E   +  ++Q+L  + ++H  NV H +++P  I++S + +   DIK+I           +E +SL          P+Y    I  YE     +D+WS+G+++++LL+   P      +D +    + + N    P    HF +   +M       ++ F+   L K  ++R  A+  L H W K
Sbjct:   94 ELIKGGELFDFIAEKENLTETEAIEFMKQILEGVNYMHQKNVAHFDLKPENIMLSDKHDPHPDIKIIDFGMAHHFIQGEEYKSLGG-------TPQYIAPEIINYEPLGTAADMWSIGVITYILLSGLSPF--QGETDEETLRNIVSMNYEFEP----HFFSQTTNM-------AKDFIQKLLVKDQSERMTAEECLIHPWIK 276          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: obscna (obscurin, cytoskeletal calmodulin and titin-interacting RhoGEF a [Source:ZFIN;Acc:ZDB-GENE-040812-4])

HSP 1 Score: 123.25 bits (308), Expect = 6.223e-27
Identity = 96/352 (27.27%), Postives = 169/352 (48.01%), Query Frame = 2
Query: 9362 IDAQPPPEVVWRRNWKKIFSSYRTVITEDKEQGTYSLLISKCILSDGGEYSIRAENAIGFAEVKFNLRVDAHPEKKSVQINIG-----DVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEINNMGIGRS--EFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVPKEDFGSRRHMGL---TSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQ----------LYNEDSNDAISNS--ACVFIRKCLLLKTGERLTSSDSLSHEWF 10351
            I   P PE+ W ++  +I SS  TVI ++  + + +LL ++    D G Y+  A N+ G       L VD  PE+      +       ++  Y   +++ +G++   + V  K++   F  KF  + +    R+  E   +  ++HR +  + D  +   + LVL+ E     SL +++       E +V++ I Q+++ + Y+H   + HLDIK +NI+M     E +K+C F      ++  S RH      T  F APE++  EP+   +D+WS+G++ +LCL  H     E D+          LY  D+ +  S S  A  F+ + L     +R ++S+ LSHEWF
Sbjct:  593 ITGHPRPEIQWFKDDVEISSSEYTVIVQNGARCSLTLLDTQT--EDCGTYTCIASNSAGQVFCHAQLNVDTGPEEIEESREVEFGKRRKLHSVYDVYEEIGRGTFGVVKKVTHKASGECFAAKFLPLRSSTRTRAFQERDLLSRLAHRRLACLLDFFST-RRTLVLVVELCSSQSLLDHLFLKGSVTEREVQLYIQQVLEGIGYIHGMNILHLDIKTDNILMVSPTREDIKICDFGFC---QEVDSSRHQYSKFGTPEFIAPEIVHQEPVTAATDIWSLGVVAYLCLTCHCPFFGENDRATLMKVAEGVLY-WDTPEITSRSVEAQDFLHRVLQPDPEKRPSASECLSHEWF 937          

HSP 2 Score: 88.1965 bits (217), Expect = 2.928e-16
Identity = 61/221 (27.60%), Postives = 113/221 (51.13%), Query Frame = 2
Query: 9752 EFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVP------------KEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHG----HLKVNFEGDQLYNEDS------NDAISNSACVFIRKCLLLKTGERLTSSDSLSHEW 10348
            E+Q ++ +SH  IV++  AI +    L+LI E   G  L   + + + + E+ V  ++ Q++ AV YLH  R+ HLD+K +N+++TGK   ++K+    +A P            +E   ++ ++ L     APE+L+G+ +   +D+W+IG+L F+ L      H  +N+E D+   +           +S  A  F++  L  K   R T+++ L + W
Sbjct: 1733 EYQVLRRLSHPRIVQLHSAI-LTSTCLLLIEELCSGRELLYNLAERNLYSEAHVTDLLEQILSAVDYLHSRRIVHLDLKSDNMLVTGK--NLVKIVDLGSAQPFNPGQALNIEHIREMTDNKGYIVLP---KAPEILEGQGVGPETDIWAIGVLAFIMLSADSPFHADLNWERDRNIKKGKIQFSRCYPGLSEGAINFMKNTLSNKAWARPTAAECLQNPW 1947          

HSP 3 Score: 68.1662 bits (165), Expect = 3.009e-10
Identity = 57/208 (27.40%), Postives = 95/208 (45.67%), Query Frame = 2
Query: 11669 EFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRYESDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNTNTLLLPVPHTHFRAPKLSMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWFKQDPQTIYEME 12292
            E     +LL  L  +   +E  V   I+Q+L  I ++H  N++H +I+   IL+   T +  DIK+     CQ V + + Q S        F APE  ++      +DIWSLG++++L L    P       ++D    +K    +L      ++  P+++     S  ++ F+H  L+  P  R +A   L+H WF    Q  YE E
Sbjct:  758 ELCSSQSLLDHLFLKGSVTEREVQLYIQQVLEGIGYIHGMNILHLDIKTDNILMVSPTRE--DIKICDFGFCQEVDSSRHQYS--KFGTPEFIAPEIVHQEPVTAATDIWSLGVVAYLCLTCHCPFF----GENDRATLMKVAEGVL------YWDTPEITSR---SVEAQDFLHRVLQPDPEKRPSASECLSHEWF----QGYYEDE 944          

HSP 4 Score: 60.8474 bits (146), Expect = 5.340e-8
Identity = 38/136 (27.94%), Postives = 70/136 (51.47%), Query Frame = 2
Query: 11657 ITFEEFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVG-----TVKEQESLTTHKPSIF--KAPEYRYESITRYESDIWSLGILSFLLLATQLP 12043
            +  EE   G  LL  L  R++YSE  V  ++ Q+L  + +LHS  +VH +++   +L++ +      +K++ L + Q         ++    +T +K  I   KAPE         E+DIW++G+L+F++L+   P
Sbjct: 1759 LLIEELCSGRELLYNLAERNLYSEAHVTDLLEQILSAVDYLHSRRIVHLDLKSDNMLVTGKNL----VKIVDLGSAQPFNPGQALNIEHIREMTDNKGYIVLPKAPEILEGQGVGPETDIWAIGVLAFIMLSADSP 1890          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: phyh (phytanoyl-CoA 2-hydroxylase [Source:Xenbase;Acc:XB-GENE-943669])

HSP 1 Score: 131.724 bits (330), Expect = 2.598e-29
Identity = 141/591 (23.86%), Postives = 240/591 (40.61%), Query Frame = 2
Query: 8708 REITLSWSPP-RISPDLYIP-FTVDVECRPVNYSYSDEEGWSVFKTNIKKNRVDIADLDPNINYQLRIVPVTDFGIGKPSMVIKKIRRSDNLNSPTTEKAMMLQEKHCLAVPMFCCLSQKAELKFTKLMEYKLDKITWTFNNAKVDVNDERYKIFSAETYGIY-----------FIIKNLEEDDFGE--YCALDEVQDPIQSFILIKSDAPTILNCLPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIF-SSYRTVITEDKEQGTYSLLISKCILSDGGEYSIRAENAIGFAEVKFNLRVDAHPEKKSVQI-NIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKF--FEINNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVPKEDFGSRRHMGLTSP-FSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQLYNEDSNDAISNSACVFIRKCLLLKTGE--------------RLTSSDSLSHEWFIKPGNNLNA 10378
            R + L W PP R+ P + +   T  V+ + V         W+V  TN+K     +  L     Y  R+   T     KPS              P +E   +      L       +  + E+ +  ++E +   IT T N+    V  +R     +   G+Y               +  + D G+  + A +       +  +  ++AP   + + +  + + E     V ++ +P P+++W ++   +  S + + + +D E    SL+I    L D G Y+  A N  G    K  L+V    E   + I  +  + D Y   K++ +G++S  + V+EKS   +   KF  F        R E   +  + H  I+  +DA       L+++ E         Y  + +   E  +R  I Q+++ + YLH   + HLDIKPENI+M    +E +++C F NA  +   G  ++    +P F APE++   PI   +D+W +G+L +LCL G     F G+  Y    N  I      F  K  +  T E              R  + +SL H WF    NNLN 
Sbjct:  516 RIVKLQWKPPKRLDPAIDLAQITYSVQQQAVGSPQ-----WTVIATNLKDTCYCVRSLTKEHQYLFRVTTNTPTSHSKPS--------------PPSESVCLFNRGPYLE--EMPSILDRPEILY--MVENQPLCITVTLNHVHAKVTWQRIDTVLSNVEGVYELSMPDDDQHSLTFFSPRKSDLGQLTFEAKNRYGSDSCTISIELAEAPRFESIMEDIEIGVGETARFVVVVEGKPIPDIMWYKDGVLLAESGHFSFVYDDTE---CSLVILNTALGDSGVYTCTARNLSGEISCKAELQVCPGKEPNEIDILKVRRLTDFYNIHKEIGRGAFSYVRHVVEKSNGRDLAAKFIPFRGATRESARRERDILSKLRHDRIIFFYDAFEK-RSALIIVMEL--------YPQKRAEVLEPHIRSFIRQILEGLDYLHHKNILHLDIKPENILMADTTSEQIRICDFGNAQ-ELTPGDPQYCKYGTPEFVAPEIVNQMPISTVTDIWPVGVLAYLCLTG--VSPFVGENDYTTLMN--IRGYTVAFEEKMFVGLTREARGFLIKVLGNEKLRPNAEESLEHPWFKVSVNNLNG 1066          

HSP 2 Score: 100.908 bits (250), Expect = 6.079e-20
Identity = 75/270 (27.78%), Postives = 128/270 (47.41%), Query Frame = 2
Query: 9584 KKSVQINIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKF--FEINNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYN-EILKLCGFSNAVPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQLYNEDS-----------NDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWF 10351
            ++S  +  G     Y  + + A+G +   +   E +T   F+ K   +E  N      E++ ++ + H+ I+ + +A   P +YLVLI E   G  L   + +   + E  V   + Q++Q + YLHE +V HLDIKPEN+I++     +I+ L    N  P       + +G T  + +PE+LKG+ +   +D+W +G+LT++ L G     FE D +  E                 S SA +FIRK L +    R +  +  S+ W 
Sbjct: 2104 RESTTLRQGVPQKPYTFLDEKARGRFGVIRECKENATGKHFMAKIIQYEPENKQNVLQEYEILKGLHHQRILSLHEAYITP-RYLVLISENCTGRELLYCLVERFRYSEDDVVNYLLQILQGLEYLHEQKVLHLDIKPENVIVSYMNTVKIIDLGSAQNFTPLVLRPLGKRIG-TLEYMSPEMLKGDAVGPAADIWGVGVLTYIMLSGRSPF-FELDPVETEHKILSGRFDIFKLYSNASQSASLFIRKILTIYPWSRPSLKECFSNPWL 2370          

HSP 3 Score: 63.5438 bits (153), Expect = 1.025e-8
Identity = 56/218 (25.69%), Postives = 90/218 (41.28%), Query Frame = 2
Query: 5753 QIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAE----NMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRI 6394
            ++  PLQD+ +    E   FE  V         W F  + +        M F    C     L + +  E   G YT +++      R +   S ML    S        +APLFT+KL D +++     RL+C++   P P + WT  G+ ++    +  + +L E  + TL+I     ED G+Y     N  G     A + V   EP+ + +S I
Sbjct:  186 EVLAPLQDVSV-CAGEAAVFECVVSGPADMDVDWMFRGKLLQPALLDCKMRFNGKQC----VLLLNSVHEDDSGVYTCKLST----ARDELTCSAMLTVHPS--------LAPLFTRKLSDRDVIEGRTARLDCKISGTPPPVVTWTHFGQPIEE---SENIHVLREGGHHTLLIPHVANEDEGQYTATAHNKHGEAECSAELYV--EEPRSATASHI 381          

HSP 4 Score: 59.3066 bits (142), Expect = 2.361e-7
Identity = 81/368 (22.01%), Postives = 141/368 (38.32%), Query Frame = 2
Query: 5609 LILRDVKMTDAGMYSLKI----NESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEID-AENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSL-----MLRSEIS----------EQMMESC----CIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRIIVKPLCAPVLTAEYSKGADVILSWTSV----ATTDTLNIIYNIEKQKSLTSTNWKKIMKNLTETTYSLSSSCLPPQESHLLR 6628
            L+L  V   D+G+Y+ K+    +E +   ++ V P                P   + L D  +  E  T + + ++  +      W    + I+ +EN+  ++     +  L IP    +  G+YT    N  G       L +        S IS          E  M+ C     + P F + L+DI+++    ++L C++   P P I W  +G+ + S    R  +  D      L+        +G Y  + +N +G     A + VTD  P   D           P++T+    G  V L W          D   I Y+++ Q+++ S  W  I  NL +T Y + S  L  +  +L R
Sbjct:  243 LLLNSVHEDDSGVYTCKLSTARDELTCSAMLTVHPS-------------LAPLFTRKLSDRDV-IEGRTARLDCKISGTPPPVVTWTHFGQPIEESENIHVLREG--GHHTLLIPHVANEDEGQYTATAHNKHGEAECSAELYVEEPRSATASHISKLEKMPSIPEEPEMQECEVEGVMMPDFLRPLQDIDVVEFREVQLECQVTGLPYPTITWYHNGQKIQSSDDRRMTQYKD---IHRLVFPSVTHSHAGVYKSVISNKVGKAACYAHLYVTDLVPTPPDG---------PPIITS--VTGRIVKLQWKPPKRLDPAIDLAQITYSVQ-QQAVGSPQWTVIATNLKDTCYCVRS--LTKEHQYLFR 577          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: c7orf26 (chromosome 7 open reading frame 26 [Source:Xenbase;Acc:XB-GENE-5734232])

HSP 1 Score: 116.316 bits (290), Expect = 1.377e-26
Identity = 82/287 (28.57%), Postives = 137/287 (47.74%), Query Frame = 2
Query: 9587 KSVQINIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFE-----INNMGIGRSEFQ----CIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEI--LKLCGFSNAVPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGH---------------LKVNFEGDQLYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWFIKPGNN 10369
            K V+     V D Y    +L  G ++  +   E+ T +E+  KF +      +  G+ R E +     +++I H+NI+ + D        +VLI E + G  L +++ Q     E +    I Q+++ V+YLH  ++ H D+KPENI++  K   +  +KL  F  A   ED    +++  T  F APE++  EP+   +DMWSIG++T++ L G                  VN+E    ++E+     S  A  FIRK L+  T +RL+  ++L H W      N
Sbjct:    5 KMVEFKQQKVEDFYDIADELGSGQFAIVKRCRERKTGVEYAAKFIKKRQSPASRRGVIRGEIEREVDILKDIQHQNIITLQDVYENKTD-VVLILELVSGGELFDFLAQKESLSEEEATRFIKQILEGVNYLHTRKIAHFDLKPENIMLLDKTIPMPHIKLIDFGLAHTIEDGVEFKNIFGTPEFVAPEIVNYEPLGLAADMWSIGVITYILLSGASPFLGENKQETLSNITAVNYE----FDEEFFSHTSELAKDFIRKLLVKDTRKRLSIQEALRHPWITPRDKN 286          

HSP 2 Score: 60.8474 bits (146), Expect = 2.252e-8
Identity = 38/130 (29.23%), Postives = 62/130 (47.69%), Query Frame = 2
Query: 11669 EFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRYE-----SDIWSLGILSFLLLATQLP 12043
            E V GG L   L  +   SE      I+Q+L  + +LH+  + H +++P  I++  +T     IKLI        G     E     K +IF  PE+    I  YE     +D+WS+G+++++LL+   P
Sbjct:   99 ELVSGGELFDFLAQKESLSEEEATRFIKQILEGVNYLHTRKIAHFDLKPENIMLLDKTIPMPHIKLIDF------GLAHTIEDGVEFK-NIFGTPEFVAPEIVNYEPLGLAADMWSIGVITYILLSGASP 221          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: nek2 (NIMA-related kinase 2 [Source:NCBI gene;Acc:407849])

HSP 1 Score: 115.546 bits (288), Expect = 3.612e-26
Identity = 81/279 (29.03%), Postives = 136/279 (48.75%), Query Frame = 2
Query: 9611 DVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEI-----NNMGIGRSEFQ----CIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGK--YNEILKLCGFSNAVPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQ-----------LYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWFIKPGNNLNAA 10381
            +V D Y  ++KL  G +   +   EKST   + GKF +      + +G+ R + +     +Q + H NI+ + D  A   + +VLI E ++G  L ++I +     E      + Q+++ V+Y+H   + H D+KPENI++  K   +  +K+  F  A   ED    + +  T  + APE++  EP+   +DMWSIG++T++ L G      E DQ            +++      S  A  FIR+ LL    +R+T+ + L H W IKP N   A 
Sbjct:    8 NVEDLYELLEKLGSGHFGEVKKCKEKSTGTYYAGKFIKTRKCKGSRLGLDRDQVEREVFILQQLEHPNIMRLHDVFASKAE-MVLILELIRGGELFDFIAEKEALSEEDAIEFLEQILKGVAYMHTRSIAHFDLKPENIMLLQKDVPHPKIKIIDFGLAQKIEDGTVFKSLCGTPQYIAPEVINYEPLGPPTDMWSIGVITYILLSGLSPFQGETDQETLTNVVAGSYEFDDRIFKQTSELAKDFIRQLLLKDPRDRMTAVECLIHPW-IKPLNRKQAV 284          

HSP 2 Score: 62.003 bits (149), Expect = 1.126e-8
Identity = 46/203 (22.66%), Postives = 91/203 (44.83%), Query Frame = 2
Query: 11669 EFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRYE-----SDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNTNTLLLPVPHTHFRAPKLSMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWFK 12262
            E + GG L   +  +   SE   +  + Q+L  + ++H+ ++ H +++P  I++ ++      IK+I        G  ++ E  T  K S+   P+Y    +  YE     +D+WS+G+++++LL+   P   +            +  TL   V  ++    ++    + S+ ++ F+   L K P DR  A   L H W K
Sbjct:   94 ELIRGGELFDFIAEKEALSEEDAIEFLEQILKGVAYMHTRSIAHFDLKPENIMLLQKDVPHPKIKIIDF------GLAQKIEDGTVFK-SLCGTPQYIAPEVINYEPLGPPTDMWSIGVITYILLSGLSPFQGET-----------DQETLTNVVAGSYEFDDRI--FKQTSELAKDFIRQLLLKDPRDRMTAVECLIHPWIK 276          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: nek2 (NIMA-related kinase 2 [Source:NCBI gene;Acc:407849])

HSP 1 Score: 115.546 bits (288), Expect = 6.874e-26
Identity = 81/278 (29.14%), Postives = 136/278 (48.92%), Query Frame = 2
Query: 9611 DVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEI-----NNMGIGRSEFQ----CIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGK--YNEILKLCGFSNAVPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQ-----------LYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWFIKPGNNLNA 10378
            +V D Y  ++KL  G +   +   EKST   + GKF +      + +G+ R + +     +Q + H NI+ + D  A   + +VLI E ++G  L ++I +     E      + Q+++ V+Y+H   + H D+KPENI++  K   +  +K+  F  A   ED    + +  T  + APE++  EP+   +DMWSIG++T++ L G      E DQ            +++      S  A  FIR+ LL    +R+T+ + L H W IKP N   A
Sbjct:   52 NVEDLYELLEKLGSGHFGEVKKCKEKSTGTYYAGKFIKTRKCKGSRLGLDRDQVEREVFILQQLEHPNIMRLHDVFASKAE-MVLILELIRGGELFDFIAEKEALSEEDAIEFLEQILKGVAYMHTRSIAHFDLKPENIMLLQKDVPHPKIKIIDFGLAQKIEDGTVFKSLCGTPQYIAPEVINYEPLGPPTDMWSIGVITYILLSGLSPFQGETDQETLTNVVAGSYEFDDRIFKQTSELAKDFIRQLLLKDPRDRMTAVECLIHPW-IKPLNRKQA 327          

HSP 2 Score: 61.6178 bits (148), Expect = 1.816e-8
Identity = 46/203 (22.66%), Postives = 91/203 (44.83%), Query Frame = 2
Query: 11669 EFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRYE-----SDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNTNTLLLPVPHTHFRAPKLSMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWFK 12262
            E + GG L   +  +   SE   +  + Q+L  + ++H+ ++ H +++P  I++ ++      IK+I        G  ++ E  T  K S+   P+Y    +  YE     +D+WS+G+++++LL+   P   +            +  TL   V  ++    ++    + S+ ++ F+   L K P DR  A   L H W K
Sbjct:  138 ELIRGGELFDFIAEKEALSEEDAIEFLEQILKGVAYMHTRSIAHFDLKPENIMLLQKDVPHPKIKIIDF------GLAQKIEDGTVFK-SLCGTPQYIAPEVINYEPLGPPTDMWSIGVITYILLSGLSPFQGET-----------DQETLTNVVAGSYEFDDRI--FKQTSELAKDFIRQLLLKDPRDRMTAVECLIHPWIK 320          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: nek2 (NIMA-related kinase 2 [Source:NCBI gene;Acc:407849])

HSP 1 Score: 115.161 bits (287), Expect = 7.298e-26
Identity = 81/278 (29.14%), Postives = 136/278 (48.92%), Query Frame = 2
Query: 9611 DVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEI-----NNMGIGRSEFQ----CIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGK--YNEILKLCGFSNAVPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQ-----------LYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWFIKPGNNLNA 10378
            +V D Y  ++KL  G +   +   EKST   + GKF +      + +G+ R + +     +Q + H NI+ + D  A   + +VLI E ++G  L ++I +     E      + Q+++ V+Y+H   + H D+KPENI++  K   +  +K+  F  A   ED    + +  T  + APE++  EP+   +DMWSIG++T++ L G      E DQ            +++      S  A  FIR+ LL    +R+T+ + L H W IKP N   A
Sbjct:   52 NVEDLYELLEKLGSGHFGEVKKCKEKSTGTYYAGKFIKTRKCKGSRLGLDRDQVEREVFILQQLEHPNIMRLHDVFASKAE-MVLILELIRGGELFDFIAEKEALSEEDAIEFLEQILKGVAYMHTRSIAHFDLKPENIMLLQKDVPHPKIKIIDFGLAQKIEDGTVFKSLCGTPQYIAPEVINYEPLGPPTDMWSIGVITYILLSGLSPFQGETDQETLTNVVAGSYEFDDRIFKQTSELAKDFIRQLLLKDPRDRMTAVECLIHPW-IKPLNRKQA 327          

HSP 2 Score: 62.003 bits (149), Expect = 1.486e-8
Identity = 46/203 (22.66%), Postives = 91/203 (44.83%), Query Frame = 2
Query: 11669 EFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRYE-----SDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNTNTLLLPVPHTHFRAPKLSMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWFK 12262
            E + GG L   +  +   SE   +  + Q+L  + ++H+ ++ H +++P  I++ ++      IK+I        G  ++ E  T  K S+   P+Y    +  YE     +D+WS+G+++++LL+   P   +            +  TL   V  ++    ++    + S+ ++ F+   L K P DR  A   L H W K
Sbjct:  138 ELIRGGELFDFIAEKEALSEEDAIEFLEQILKGVAYMHTRSIAHFDLKPENIMLLQKDVPHPKIKIIDF------GLAQKIEDGTVFK-SLCGTPQYIAPEVINYEPLGPPTDMWSIGVITYILLSGLSPFQGET-----------DQETLTNVVAGSYEFDDRI--FKQTSELAKDFIRQLLLKDPRDRMTAVECLIHPWIK 320          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Speg (SPEG complex locus [Source:MGI Symbol;Acc:MGI:109282])

HSP 1 Score: 124.02 bits (310), Expect = 4.712e-27
Identity = 139/623 (22.31%), Postives = 263/623 (42.22%), Query Frame = 2
Query: 8708 REITLSWSPPRISPDLYIPFTVDVECRPVNYSYS------DEEGWSVFKTNIKKNRVDIADLDPNINYQLRIVPVTDFGIGKPSMVIKKIRRSDNLNSPTTEKAMMLQEKHCLAVPMFCCLSQKAELKFTKLMEYKLDKITWTFNNAKVDV--NDERYKIFSAETYGIYFIIKNLEEDDFGEYC-----------------ALDEVQDPIQSFILIKSDAPTILNCLPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIF-SSYRTVITEDKEQGTYSLLISKCILSDGGEYSIRAENAIGFAEVKFNLRVDAHPEKKSVQINIGD-------------VNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFF--EINNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIM--TGKYNEILKLCGFSNA---VPKE----DFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQ-----------LYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWFIKPGNNLNAALDYI 10393
            R +TLSW+PPR         ++D+   P + +Y+        + W+   T +++       L   I +  R++  +     KPS   + ++  ++   P  E+A  + +K                     ++E +   +T TFN+ +  V     R  +  A T G+Y     L + D  +YC                 A +       S  L  ++AP   + + +  +   E    +V ++ +P P+++W ++   +  S++ + + E+ E    SL++      DGG Y+  A N  G    K  L V       S Q  +               ++D Y   +++ +G++S  + V+E+S+ +EF  KF   +       R E + +  + H  ++   +A     + LV++ E L    L E + +    CES+ R  + Q+++ + YLH+  V HLD+KPEN+++       E +++C F NA    P E     +G       T  F APE++   P+   +D+W +G++ FLCL G      E D+            + E +  ++S  A  F+ K +L++   R T+ ++L H WF         + D++
Sbjct: 1302 RMVTLSWNPPR---------SLDMAIDPDSLTYTVQHQVLGSDQWTALVTGLREPAWAATGLKKGIQHIFRVLSSSGKSSSKPSAPSEPVQLLEH--GPPLEEAPAVLDKQ----------------DIVYVVEGQPACVTVTFNHVEAQVVWRSCRGALLEART-GVY----ELSQPDDDQYCLRICRVSRRDLGPLTCSARNRHGTKACSVTLELAEAPRFESIMEDVEVGPGETARFAVVVEGKPLPDIMWYKDEVLLAESNHVSFVYEENE---CSLVLLSAGSQDGGVYTCTARNLAGEVSCKAELSV------LSAQTAMEVEGVGEDEEHRGRRLSDYYDIHQEIGRGAFSYLRRVVERSSGLEFAAKFIPSQAKPKASARREARLLARLQHGCVLYFHEAFER-RRGLVIVTE-LCTEELLERMARKPTVCESETRTYMRQVLEGICYLHQSHVLHLDVKPENLLVWDGAGGEEQVRICDFGNAQELTPGEPQYCQYG-------TPEFVAPEIVNQSPVSGVTDIWPVGVVAFLCLTGISPFVGENDRTTLMNIRNYNVAFEETTFLSLSREARGFLIK-VLVQDRLRPTAEETLEHPWFKTEAKGAEVSTDHL 1873          

HSP 2 Score: 117.857 bits (294), Expect = 3.501e-25
Identity = 79/281 (28.11%), Postives = 130/281 (46.26%), Query Frame = 2
Query: 9566 VDAHPEKKSVQINIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEINNMGIGR--SEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVP--KEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGH---------------LKVNFEGDQLYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWF 10351
            V + P  +S  +  G     Y  +++ A+G +   +   E +T   F+ K       G  R   E++ ++ + H  ++ + +A   P +YLVLI E      L   ++    + E  V   + QL+Q + YLH H V HLDIKP+N+++    +  LK+  F +A P   +      H   T  F APE++KG+PI   +D+W  G+LT++ L G+               +   F+  QLY        S SA +F+RK L +    R +  D L+H W 
Sbjct: 2941 VVSSPTPESTTLRQGPPQKPYTFLEEKARGRFGVVRSCRENATGRTFVAKIVPYAAEGKRRVLQEYEVLRTLHHERLMSLHEAYITP-RYLVLIAESCGNRELLCGLSDRFRYSEDDVATYVVQLLQGLDYLHGHHVLHLDIKPDNLLLAA--DNALKIVDFGSAQPYNPQALKPLGHRTGTLEFMAPEMVKGDPIGSATDIWGAGVLTYIMLSGYSPFYEPDPQETEARIVGGRFDAFQLYPN-----TSQSATLFLRKVLSVHPWSRPSLQDCLAHPWL 3213          

HSP 3 Score: 55.0694 bits (131), Expect = 3.509e-6
Identity = 36/120 (30.00%), Postives = 58/120 (48.33%), Query Frame = 2
Query: 6074 APLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRIIVKPLCAPVLTAE 6433
            AP+F   L+++ +    ++ L C +  +P P++ W KDG  L S+    R+ I  E    TL++ EA+  D+G Y    TN LG  T  + + V    P  S S      P  +P+ + E
Sbjct:  726 APVFEIPLQNMVVAPGADVLLKCIITANPPPQVSWKKDGSMLHSE---GRLLIRAEGERHTLLLREAQAADAGSYTATATNELGQATCASSLAV---RPGGSTS------PFSSPITSDE 833          

HSP 4 Score: 53.9138 bits (128), Expect = 7.214e-6
Identity = 66/265 (24.91%), Postives = 108/265 (40.75%), Query Frame = 2
Query: 11528 EYIVQRTFKMEDICPAFDLCVRIKYYHFPILFGEICDSSLGNRITFEEFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLE---NCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRYESDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNTNTLLLPVPHTHFRAPKLSMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWFKQDPQTIYEMEHQTISST 12313
            EY V RT   E +    +  +  +Y    +L  E C    GNR           LL  L  R  YSE  V T + QLL  + +LH ++V+H +I+P  +L++   + +  I   G     N Q +  +  +          F APE          +DIW  G+L++++L+   P  E    +++        +   L  P+T             S+S+  F+   L   P  R +    LAH W  QD   + ++  QT++ T
Sbjct: 3005 EYEVLRTLHHERLMSLHEAYITPRYL---VLIAESC----GNR----------ELLCGLSDRFRYSEDDVATYVVQLLQGLDYLHGHHVLHLDIKPDNLLLA--ADNALKIVDFGSAQPYNPQALKPLGHRTGTLE-----FMAPEMVKGDPIGSATDIWGAGVLTYIMLSGYSPFYEPDPQETEARIVGGRFDAFQL-YPNT-------------SQSATLFLRKVLSVHPWSRPSLQDCLAHPWL-QD-AYLMKLRRQTLTFT 3229          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Speg (SPEG complex locus [Source:MGI Symbol;Acc:MGI:109282])

HSP 1 Score: 123.635 bits (309), Expect = 5.339e-27
Identity = 139/623 (22.31%), Postives = 263/623 (42.22%), Query Frame = 2
Query: 8708 REITLSWSPPRISPDLYIPFTVDVECRPVNYSYS------DEEGWSVFKTNIKKNRVDIADLDPNINYQLRIVPVTDFGIGKPSMVIKKIRRSDNLNSPTTEKAMMLQEKHCLAVPMFCCLSQKAELKFTKLMEYKLDKITWTFNNAKVDV--NDERYKIFSAETYGIYFIIKNLEEDDFGEYC-----------------ALDEVQDPIQSFILIKSDAPTILNCLPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIF-SSYRTVITEDKEQGTYSLLISKCILSDGGEYSIRAENAIGFAEVKFNLRVDAHPEKKSVQINIGD-------------VNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFF--EINNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIM--TGKYNEILKLCGFSNA---VPKE----DFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQ-----------LYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWFIKPGNNLNAALDYI 10393
            R +TLSW+PPR         ++D+   P + +Y+        + W+   T +++       L   I +  R++  +     KPS   + ++  ++   P  E+A  + +K                     ++E +   +T TFN+ +  V     R  +  A T G+Y     L + D  +YC                 A +       S  L  ++AP   + + +  +   E    +V ++ +P P+++W ++   +  S++ + + E+ E    SL++      DGG Y+  A N  G    K  L V       S Q  +               ++D Y   +++ +G++S  + V+E+S+ +EF  KF   +       R E + +  + H  ++   +A     + LV++ E L    L E + +    CES+ R  + Q+++ + YLH+  V HLD+KPEN+++       E +++C F NA    P E     +G       T  F APE++   P+   +D+W +G++ FLCL G      E D+            + E +  ++S  A  F+ K +L++   R T+ ++L H WF         + D++
Sbjct: 1050 RMVTLSWNPPR---------SLDMAIDPDSLTYTVQHQVLGSDQWTALVTGLREPAWAATGLKKGIQHIFRVLSSSGKSSSKPSAPSEPVQLLEH--GPPLEEAPAVLDKQ----------------DIVYVVEGQPACVTVTFNHVEAQVVWRSCRGALLEART-GVY----ELSQPDDDQYCLRICRVSRRDLGPLTCSARNRHGTKACSVTLELAEAPRFESIMEDVEVGPGETARFAVVVEGKPLPDIMWYKDEVLLAESNHVSFVYEENE---CSLVLLSAGSQDGGVYTCTARNLAGEVSCKAELSV------LSAQTAMEVEGVGEDEEHRGRRLSDYYDIHQEIGRGAFSYLRRVVERSSGLEFAAKFIPSQAKPKASARREARLLARLQHGCVLYFHEAFER-RRGLVIVTE-LCTEELLERMARKPTVCESETRTYMRQVLEGICYLHQSHVLHLDVKPENLLVWDGAGGEEQVRICDFGNAQELTPGEPQYCQYG-------TPEFVAPEIVNQSPVSGVTDIWPVGVVAFLCLTGISPFVGENDRTTLMNIRNYNVAFEETTFLSLSREARGFLIK-VLVQDRLRPTAEETLEHPWFKTEAKGAEVSTDHL 1621          

HSP 2 Score: 117.472 bits (293), Expect = 3.809e-25
Identity = 79/281 (28.11%), Postives = 130/281 (46.26%), Query Frame = 2
Query: 9566 VDAHPEKKSVQINIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEINNMGIGR--SEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVP--KEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGH---------------LKVNFEGDQLYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWF 10351
            V + P  +S  +  G     Y  +++ A+G +   +   E +T   F+ K       G  R   E++ ++ + H  ++ + +A   P +YLVLI E      L   ++    + E  V   + QL+Q + YLH H V HLDIKP+N+++    +  LK+  F +A P   +      H   T  F APE++KG+PI   +D+W  G+LT++ L G+               +   F+  QLY        S SA +F+RK L +    R +  D L+H W 
Sbjct: 2689 VVSSPTPESTTLRQGPPQKPYTFLEEKARGRFGVVRSCRENATGRTFVAKIVPYAAEGKRRVLQEYEVLRTLHHERLMSLHEAYITP-RYLVLIAESCGNRELLCGLSDRFRYSEDDVATYVVQLLQGLDYLHGHHVLHLDIKPDNLLLAA--DNALKIVDFGSAQPYNPQALKPLGHRTGTLEFMAPEMVKGDPIGSATDIWGAGVLTYIMLSGYSPFYEPDPQETEARIVGGRFDAFQLYPN-----TSQSATLFLRKVLSVHPWSRPSLQDCLAHPWL 2961          

HSP 3 Score: 54.6842 bits (130), Expect = 3.637e-6
Identity = 36/120 (30.00%), Postives = 58/120 (48.33%), Query Frame = 2
Query: 6074 APLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRIIVKPLCAPVLTAE 6433
            AP+F   L+++ +    ++ L C +  +P P++ W KDG  L S+    R+ I  E    TL++ EA+  D+G Y    TN LG  T  + + V    P  S S      P  +P+ + E
Sbjct:  474 APVFEIPLQNMVVAPGADVLLKCIITANPPPQVSWKKDGSMLHSE---GRLLIRAEGERHTLLLREAQAADAGSYTATATNELGQATCASSLAV---RPGGSTS------PFSSPITSDE 581          

HSP 4 Score: 53.9138 bits (128), Expect = 7.541e-6
Identity = 66/265 (24.91%), Postives = 108/265 (40.75%), Query Frame = 2
Query: 11528 EYIVQRTFKMEDICPAFDLCVRIKYYHFPILFGEICDSSLGNRITFEEFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLE---NCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRYESDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNTNTLLLPVPHTHFRAPKLSMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWFKQDPQTIYEMEHQTISST 12313
            EY V RT   E +    +  +  +Y    +L  E C    GNR           LL  L  R  YSE  V T + QLL  + +LH ++V+H +I+P  +L++   + +  I   G     N Q +  +  +          F APE          +DIW  G+L++++L+   P  E    +++        +   L  P+T             S+S+  F+   L   P  R +    LAH W  QD   + ++  QT++ T
Sbjct: 2753 EYEVLRTLHHERLMSLHEAYITPRYL---VLIAESC----GNR----------ELLCGLSDRFRYSEDDVATYVVQLLQGLDYLHGHHVLHLDIKPDNLLLA--ADNALKIVDFGSAQPYNPQALKPLGHRTGTLE-----FMAPEMVKGDPIGSATDIWGAGVLTYIMLSGYSPFYEPDPQETEARIVGGRFDAFQL-YPNT-------------SQSATLFLRKVLSVHPWSRPSLQDCLAHPWL-QD-AYLMKLRRQTLTFT 2977          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Dapk2 (death-associated protein kinase 2 [Source:MGI Symbol;Acc:MGI:1341297])

HSP 1 Score: 115.161 bits (287), Expect = 3.158e-26
Identity = 88/299 (29.43%), Postives = 145/299 (48.49%), Query Frame = 2
Query: 9614 VNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFE-----INNMGIGRSEFQ----CIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEI--LKLCGFSNAVPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQL-------------YNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWFIKPGNNLNAALDYIIDQIVKLMTYPEEMV 10438
            V D Y   ++L  G ++  +   EKST +E+  KF +      +  G+ R E +     ++ + H NI+ + D        +VLI E + G  L +++ Q     E +    I Q++  V+YLH  ++ H D+KPENI++  K   I  +KL  F  A   ED    +++  T  F APE++  EP+   +DMWSIG++T++ L G     F GD               ++E+     S  A  FIRK L+ +T +RLT  ++L H W I P +   A +    + +V L  + ++ V
Sbjct:   19 VEDFYDIGEELGSGQFAIVKKCREKSTGLEYAAKFIKKRQSRASRRGVCREEIEREVSILRQVLHPNIITLHDVYENRTD-VVLILELVSGGELFDFLAQKESLSEEEATSFIKQILDGVNYLHTKKIAHFDLKPENIMLLDKNIPIPHIKLIDFGLAHEIEDGVEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSG--ASPFLGDTKQETLANITAVSYDFDEEFFSQTSELAKDFIRKLLVKETRKRLTIQEALRHPW-ITPVDTQQAMVRR--ESVVNLENFKKQYV 311          

HSP 2 Score: 63.1586 bits (152), Expect = 3.672e-9
Identity = 39/139 (28.06%), Postives = 67/139 (48.20%), Query Frame = 2
Query: 11669 EFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRY-----ESDIWSLGILSFLLLATQLPAIEDACSDS 12070
            E V GG L   L  +   SE    + I+Q+L  + +LH+  + H +++P  I++  +      IKLI        G   E E     K +IF  PE+    I  Y     E+D+WS+G+++++LL+   P + D   ++
Sbjct:  104 ELVSGGELFDFLAQKESLSEEEATSFIKQILDGVNYLHTKKIAHFDLKPENIMLLDKNIPIPHIKLIDF------GLAHEIEDGVEFK-NIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQET 235          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Dapk2 (death-associated protein kinase 2 [Source:MGI Symbol;Acc:MGI:1341297])

HSP 1 Score: 115.546 bits (288), Expect = 1.106e-25
Identity = 83/274 (30.29%), Postives = 133/274 (48.54%), Query Frame = 2
Query: 9614 VNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFE-----INNMGIGRSEFQ----CIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEI--LKLCGFSNAVPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQL-------------YNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWFIKPG 10363
            V D Y   ++L  G ++  +   EKST +E+  KF +      +  G+ R E +     ++ + H NI+ + D        +VLI E + G  L +++ Q     E +    I Q++  V+YLH  ++ H D+KPENI++  K   I  +KL  F  A   ED    +++  T  F APE++  EP+   +DMWSIG++T++ L G     F GD               ++E+     S  A  FIRK L+ +T +RLT  ++L H W    G
Sbjct:   19 VEDFYDIGEELGSGQFAIVKKCREKSTGLEYAAKFIKKRQSRASRRGVCREEIEREVSILRQVLHPNIITLHDVYENRTD-VVLILELVSGGELFDFLAQKESLSEEEATSFIKQILDGVNYLHTKKIAHFDLKPENIMLLDKNIPIPHIKLIDFGLAHEIEDGVEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSG--ASPFLGDTKQETLANITAVSYDFDEEFFSQTSELAKDFIRKLLVKETRKRLTIQEALRHPWITSKG 289          

HSP 2 Score: 63.1586 bits (152), Expect = 5.224e-9
Identity = 39/139 (28.06%), Postives = 67/139 (48.20%), Query Frame = 2
Query: 11669 EFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRY-----ESDIWSLGILSFLLLATQLPAIEDACSDS 12070
            E V GG L   L  +   SE    + I+Q+L  + +LH+  + H +++P  I++  +      IKLI        G   E E     K +IF  PE+    I  Y     E+D+WS+G+++++LL+   P + D   ++
Sbjct:  104 ELVSGGELFDFLAQKESLSEEEATSFIKQILDGVNYLHTKKIAHFDLKPENIMLLDKNIPIPHIKLIDF------GLAHEIEDGVEFK-NIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQET 235          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Obscn (obscurin, cytoskeletal calmodulin and titin-interacting RhoGEF [Source:MGI Symbol;Acc:MGI:2681862])

HSP 1 Score: 118.627 bits (296), Expect = 2.101e-25
Identity = 106/459 (23.09%), Postives = 200/459 (43.57%), Query Frame = 2
Query: 9104 KITWTFNNAKVDVNDERYKIFSAETYGIY-FIIKNLEEDDFGEY-CALDE------------VQDPI---------QSFILIKSDAPTILNCLPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIFSSYRTVITEDKEQGTYSLLISKCILSDGGEYSIRAENAIGFAEVKFNLRVDAHPEKKSV-QINIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEINNMGIGRS--EFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNA---VPKEDFGSRRHMGLTSP-FSAPELLKGEPIQFNSDMWSIGILTFLCL-----------HGHLKVNFEGDQLYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWFIK 10357
            +I W + +  +     RY++ +    G+   +I+   ++D G Y C L              +Q P          +  +     AP++   + +  + + +       I+  PPP V W +   ++ SS R  +++ ++  TYSL+++     D G Y+  A NA G    K  L V    +  +  Q+    ++  Y   +++ +G +   + V  K  ++    KF  + +    ++  E   +  + H  +  + D      + L+LI E      L + + +     E++V++ I QL++ + YLH H + HLDIKP NI+M     E +K+C F  A    P E   S+      SP F +PE+++  P+   SD+W++G++++L L              L    EG   ++  +   +S  A  FI+  L      R ++S  L+H WF+K
Sbjct: 6367 QIRW-YKDGTLLAPGNRYRMLNEPRSGVLVLVIQAASKEDLGHYECELVNRLGSTRGGGELYMQSPALRARDQHHREQIVAAVEGAPSMQVTIEDVQVQVGDMAQFDAVIEGHPPPIVTWYKGSTQLTSSAR--LSQRQDGTTYSLVLTDVAPHDAGVYTCVANNAGGQVLCKAELLVHGGDKLDAENQVYRRKLHSFYDVQEEIGRGVFGFVKRVQHKGNKMFCAAKFIPLRSKTRAQAYQERDILATLGHPLVTGLLDQFET-RKTLILILELCSSEELLDRLFKKGVVTEAEVKVYIQQLVEGLHYLHSHGILHLDIKPPNILMVHPAREDIKICDFGFAQKITPSEPQYSK----YGSPEFVSPEIIEQNPVSEGSDIWAMGVISYLSLTCSSPFAGESDRATLLNVLEGRVSWSSPTAAHLSEDAKDFIKATLQRTPRARPSTSQCLAHPWFLK 6817          

HSP 2 Score: 78.1814 bits (191), Expect = 3.675e-13
Identity = 56/216 (25.93%), Postives = 103/216 (47.69%), Query Frame = 2
Query: 9752 EFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNA--VPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQLYNEDSND----------AISNSACVFIRKCLLLKTGERLTSSDSLSHEWFIKPG 10363
            E++ ++ + H ++ ++  A   P ++LVLI E   G  L   + +   + ES V+  + Q++ A  YLH   + HLD++ EN+++T +YN +LK+    NA  + +E   +  +        APELL+G+     +D+W+IG+  F+ L G    + EG +   +               +S  A  F++  L  +   R  +S  L   W  + G
Sbjct: 7780 EYEALKRLHHPHLAQLHAAYLSP-RHLVLILELCSGPELLPSLAERESYSESDVKDYLWQMLSATQYLHAQHILHLDLRSENMMVT-EYN-LLKVIDLGNAQSLDQEKVPAPENFKDYLETMAPELLEGQGAVPQTDIWAIGVTAFIMLSGEYPESSEGTRDLQKGLRKGLIRLSRCYAGLSGGAVAFLQSSLCAQPWGRPCASTCLQCGWLTEEG 7992          

HSP 3 Score: 65.855 bits (159), Expect = 1.621e-9
Identity = 52/197 (26.40%), Postives = 88/197 (44.67%), Query Frame = 2
Query: 11669 EFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRYESDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNTNTLLLPVPHTHFRAPKLSMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWF 12259
            E      LL  L  + V +E  V   I+QL+  + +LHS+ ++H +I+P  IL+     +  DIK+      Q +   + Q S   +    F +PE   ++     SDIW++G++S+L L    P       +SD           LL V          +  H  S+ ++ F+  +L+++P  R +    LAH WF
Sbjct: 6636 ELCSSEELLDRLFKKGVVTEAEVKVYIQQLVEGLHYLHSHGILHLDIKPPNILMVHPARE--DIKICDFGFAQKITPSEPQYS--KYGSPEFVSPEIIEQNPVSEGSDIWAMGVISYLSLTCSSP----FAGESD--------RATLLNVLEGRVSWSSPTAAH-LSEDAKDFIKATLQRTPRARPSTSQCLAHPWF 6815          

HSP 4 Score: 65.855 bits (159), Expect = 2.032e-9
Identity = 169/871 (19.40%), Postives = 321/871 (36.85%), Query Frame = 2
Query: 3962 LEAKIISGNINSYKTPPQWFWNDEAVK-NINCKKDFTSNLAQLEIAHCQLSDSGQYKICFNPLEASKCGKVTGLFLVSIAPIKKNLKPIDSNIETCPGESVTLCVDVEGFSK-KDIKWKVLEDDLKQDKILQEKRITQKFNNNLSFLLIDSVKLEDSGTYIC----QGFTNKELISECK--ITLNVVDNISD------TLQCQVKFEKDKYSIEINQDVTMRALIECTSTHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVTKNIEITEGNELNLE-VVSEIEKDLQFQWSKDDIDCSNNGIFNSTKNKNCFNLTKLKAEITDSG--VYKFEGMVDGKLLELVHFTVQVN-PIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMPFGDPCVLDNPFIDLYIESPQVNEHSGLYKCIVTNEKSETEFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESR------VPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLKINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIV-----------TDSEPKESDSS--RIIVKPLCAPVLTAEYSKGADVILS 6463
            L++ ++S +        QW+ +D  +  +   K      +A+L I     +D+G Y+      ++S    V    +  I P++          +    E   +C   E   K +DI+W +    L  D       I+ +    L  L++ SV+  D+GT +C    +   +  L+ + K  + L  +D++S       TLQC+V                       +     V W  +G  +E+      D  +      L + + +    G+Y C + +K+  S  +  +L+V       +    K +E+ EG   + E V+S         W+        +G F++ +    + LT   A ++D+G  V+   G+     L +    V +  P++   TT    + L CE                  L+     ++WL++        +  +   DL  E        G    +V  + S  +  E T + +  K  + +      C  E+ N   +E  +L VE +        T+   S V  +   L      +     +     L +  ++ TD+  Y+  I ++             R Q + +    K+ ++ + L+D  ++ E  + KF   +  +      WF +   + +  +  I      Y  LT+     K  G    +          D R S  LR  ++E+         +F++ L D+ +   E++ L C         + WTKDG+TL       R ++  E     L+IT    +D GRY C     +G  ++ +++ V            D E  E  ++  R ++  + APV   E+  G DV+ S
Sbjct: 2639 LQSVVLSCDFRPAPKAVQWYKDDTPLSPSEKFKMALEGQMAELRILRLTPADAGVYRCQAGSAQSSAEVTVEAREVTVIQPLQ----------DAEAMEEGRVCFSCELSHKDEDIEWSLNGTPLYNDSF---HEISHE--GCLHTLVLKSVRQADTGT-VCATSPKVSVSARLVVKGKPVVFLKALDDVSAEERGTLTLQCEV-----------------------SDPEARVVWRKDG--VELGPSDKYDFLHKAGARGLTVHDLSHEDAGLYTCQVGSKETQSKVSVHDLHVG------ITKRLKTVEVLEGESCSFECVLSHESPSDPAVWTVGGKTVGGSGHFHAVRQGRKYTLTVKDAALSDAGEVVFSVLGLTSKASLIIRERPVDITKPLEDQRTTLGEDVMLSCE------------------LSRAGTSVRWLKDG-----KAIRKSQKYDLLSE--------GTRAVLVVRKASLKDSGEYTCETEASKSTAKL------CVEEKANRFTEELADLQVEEKGRAVFTCKTEHPASVVTWRKGLLELRASGKHVPSQEGLTLKLTINALERTDSDTYTCDIGQA-------------RTQARLLVHGQKV-RVIEDLEDTAVQ-EGSSAKFCCRIAPADYGPVHWFLDKTPLHSNELNEITVQPGGYHVLTLRQLALKDSGTVYFEAG--------DQRTSAALR--VTEK-------PSIFSRPLTDVTVTEGEDLTLVCETTT-VDSSVRWTKDGKTLRPSA---RCQLSHEGCQAQLLITATTPQDGGRYKCE----IGGASSSSIVRVHALPVRFRESLKDVEVPEGKAATLRCVLSSVAAPV---EWRHGDDVLKS 3382          

HSP 5 Score: 61.2326 bits (147), Expect = 4.801e-8
Identity = 74/315 (23.49%), Postives = 127/315 (40.32%), Query Frame = 2
Query: 11159 NWKTIGYSV-DNRYLLENLDRTQQYIARIIAQNKYGYSPYSIATSVFQNKIRNIHSLKQALIFNRKWMLTSRQSNHFNDLHDLIKDISSDDIRMNVIREHYSTLSQ---KSSGFAVLKLKNTNVNFPEYIVQRTFKMEDICPAFDLCVRIKYYHFPILFGEICDSSLGNR--ITFEEFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFK------APEYRYESITRYESDIWSLGILSFLLLATQLPAIEDACSD 12067
            +W T+   + D  YL   L R   YI R    +K G  PYS              S  + ++      L S + +       L+    +   +M + R  +S + Q   K+SG A+             IV   ++ ED          +K  H P L  ++  + L  R  +   E   G  LL  L  R  YSE  V   + Q+L   Q+LH+ +++H ++    ++++        +K+I L N Q +    +QE +    P  FK      APE         ++DIW++G+ +F++L+ + P   +   D
Sbjct: 7661 SWTTLASDISDCCYLTGKLSRGGMYIFRTACVSKAGMGPYS--------------SPSEQVLLGGPNHLASEEESSRGRPAQLLPSTKTFAFQMQIRRGRFSVVRQCREKASGRAL----------AAKIV--PYQPEDKTAVLREYEALKRLHHPHL-AQLHAAYLSPRHLVLILELCSGPELLPSLAERESYSESDVKDYLWQMLSATQYLHAQHILHLDLRSENMMVTEYNL----LKVIDLGNAQSL----DQEKVPA--PENFKDYLETMAPELLEGQGAVPQTDIWAIGVTAFIMLSGEYPESSEGTRD 7938          

HSP 6 Score: 58.5362 bits (140), Expect = 2.691e-7
Identity = 134/657 (20.40%), Postives = 234/657 (35.62%), Query Frame = 2
Query: 4394 LLIDSVKLEDSGTYICQGFTNKE----LISECKITLNVVDNISDTLQCQVKFEKDKYSIEINQDVTMRALIECTSTHYSV---SWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDL--QFQWSKDDIDCSNNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGMVDGKLLELVHFTVQ------VNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMPFGDPCVLDNPFIDLYIESPQVNEHSGLYKCIVTNEKSETEFVEITVKFKDEKVVSPILGE----LLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLKINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEV-EESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCC 6304
            L+I+ V+ ED  TY C     K      + E  IT+             V+  KD   +E        A  EC ++  SV    W     +L+   ++   ++ +G +  L +     +  G     I       S +  +L V +I +     +T+ +E   G EL   V+S   +      QW KDD   S +  F          L  L+    D+GVY+ +    G        TV+      + P+Q     +E R+   CE                  L+ K   I+W  N  P             LY +S     H G    +V     + +   +        V + ++ +    +    +++V+  E   + L  E   P   +   VW KD   L  +D +   + +     L + D+   DAG+Y+ ++        V V    +      I K LK  ++           E E+  FE  +  ES +  A+W    + +      F        + LT+  A     G+    V   +G      + SL++R    +            TK L+D      E++ L+C  +      + W KDG+ +     +++  +L E     L++ +A ++DSG Y C
Sbjct: 2502 LVINDVQPEDEDTYTCDAGNVKTSAQFFVEEQSITI-------------VRGLKDMTVME-----PAPAWFECETSIPSVRPPKWLLGKTVLQAGGNV--GLEQDGTVHRLTLHKTCSTMTGPVHFTI-----GKSRSSAQLVVSDIPV----VLTRPLEPKAGRELQSVVLSCDFRPAPKAVQWYKDDTPLSPSEKFKMALEGQMAELRILRLTPADAGVYRCQA---GSAQSSAEVTVEAREVTVIQPLQDAEAMEEGRVCFSCE------------------LSHKDEDIEWSLNGTP-------------LYNDSFHEISHEGCLHTLVLKSVRQADTGTVCATSPKVSVSARLVVKGKPVVFLKALDDVSAEERGTLTLQCEVSDPEARV---VWRKDGVELGPSD-KYDFLHKAGARGLTVHDLSHEDAGLYTCQVGSKETQSKVSVHDLHV-----GITKRLKTVEVL----------EGESCSFECVLSHESPSDPAVWTVGGKTVGGSG-HFHAVRQGRKYTLTVKDAALSDAGEVVFSV---LGLT---SKASLIIRERPVD-----------ITKPLEDQRTTLGEDVMLSCE-LSRAGTSVRWLKDGKAIRK---SQKYDLLSEGTRAVLVVRKASLKDSGEYTC 3054          

HSP 7 Score: 57.7658 bits (138), Expect = 5.125e-7
Identity = 172/793 (21.69%), Postives = 288/793 (36.32%), Query Frame = 2
Query: 3995 SYKTPPQWFWNDEAVKN---INCKKDFTSNLAQLEIAHCQLSDSGQYKICFNPLEASKCGKVTGLFLVSIAPIKKNLKPIDSNIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNNNLSFLLIDSVKLEDSGTYICQGFTNKELISECKITLNVVDNISDTLQCQVKFEKDKYSIEINQDVTMRALIECTSTHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCSNNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGMVDGKLLELVHFTVQVNP------IQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMPFGDPCVL--DNPFIDLYIESPQVNEHSGLYKCIVTNEKSETEFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLKINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNY--------FALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMM-CDPKPKILWTKDGETLD--SKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCL 6307
            S   P +W    E +++    + ++D    + +L+I    + DSG+Y           CG+      +S+  +         + E   G   TL   +       ++W+   + L         R + + N  +  L I  + +ED+G Y C     +E  S    TLNV            +F +D  S E  +  TM  L    S    V W    E L  +      ++ +G + EL+I + +    G Y C+     G   T+   L V+ +       + K  E TEG  + L    ++ K+   +W K     S+ G ++  ++     L      + D+G Y     V G+       +V+  P      ++S   T+ +   L C+     +S + P+        W++G  + LR+    GD   L  D    +L I    V E +G Y C+   EK+       T+  K  +VV           ++ +   E     L  E  VP  ++   VW K    L + D R     Q     L+LRD++  DAG YS      +    + V   P+R       + L+        QD+   +E  T +   E+            E   ++        + C  Y          L +    ++  G+YT     D G  +S  RLS+                 P F   L+  E  +    RL C++   +P   + W K+G  L   SK   RR   + E     L+I   E +D+G Y CL
Sbjct: 3791 SKAAPVEWRKGSETLRDGDRYSLRQD--GAMCELQIRGLTIEDSGEYTCV--------CGQEKTSATLSVKALPPRFIEDLRSQEATEGTMATLRCQMS--KAAPVEWRKGSETLGDGG-----RYSLRQNGAVCELQIHDLAVEDTGEYSC--VCGQEKTSA---TLNVK-------ALPPRFIEDLRSQEATEG-TMATLRCQMSKAAPVEWRKGSETL--RDGGRYSLRQDGAVCELQIHDLDVEDAGQYSCVC----GQEKTSAV-LTVDALPPKFTEGLKKE-EATEGTMVTLRC--QMSKEATVEWRKGAKTLSDGGRYSLRQDGAMCELQICGLAVEDAGEYS---CVCGQEKTSATLSVKALPPRFIEDLRSQEATEGTMATLRCQ-----MSKAAPV-------EWRKGS-KTLRD----GDRYSLRQDGAMCELQICDLAV-EDTGDYSCVCGQEKTSA-----TLSVKAPQVV-------FQQPLQNLQAEEGSMASLRCELSVPNAAM---VWSKGGLEL-QGDTRREARQQGCVAELLLRDLRREDAGEYSCTCGSQTTSATLMVTAAPVR-----FLRELQA-------QDV---DEGATARLRCELSR----------EAVSVEWRKGSLQLFPCAKYQMVQEGTTAELLVHGVEQEDAGEYTC----DAGHTQSIARLSVRAPK-------------PKFKTDLQSTEQEAGGTARLCCQLSEAEPGTPVQWLKEGVELHVGSKYEMRRQGAVCE-----LLIHGLEAKDTGEYACL 4459          

HSP 8 Score: 57.3806 bits (137), Expect = 6.370e-7
Identity = 78/324 (24.07%), Postives = 129/324 (39.81%), Query Frame = 2
Query: 5429 ELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQP--FCYNLILRDVKMTDAGMY-----SLKINESSV-DILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAEN-MEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRL---SLMLRSEIS---EQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIV 6355
            EL  CT E       E ++L+       K I S  W KD K + E DP   +I  P   C  LIL ++   D+G Y     S   N S++  ILV+V P+ + K     F                   E E  +    VE +   +  W+ +   +   N    +         L I AA ++  G Y  ++ N +G  R  G L   S  LR+      EQ++ +   AP     ++D+++   +  + +  +   P P + W K    L S     R+    +   ++L++T+    D+G Y C+  N  G    +A ++V
Sbjct: 6248 ELADCTAEL-----GETVKLACRVTGTPKPIVS--WYKDGKPV-EVDPHHILIEDPDGSC-TLILDNLTGIDSGQYMCFAASAAGNASTLGKILVQVPPRFVNKVRATPFV------------------EGEDAQITCTVEGAPYPQIRWYKDGTLLAPGNRYRMLNEPRSGVLVLVIQAASKEDLGHYECELVNRLGSTRGGGELYMQSPALRARDQHHREQIVAAVEGAPSMQVTIEDVQVQVGDMAQFDAVIEGHPPPIVTWYKGSTQLTSSA---RLSQRQDGTTYSLVLTDVAPHDAGVYTCVANNAGGQVLCKAELLV 6541          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|O01761|UNC89_CAEEL (Muscle M-line assembly protein unc-89 OS=Caenorhabditis elegans OX=6239 GN=unc-89 PE=1 SV=3)

HSP 1 Score: 136.346 bits (342), Expect = 6.465e-30
Identity = 157/617 (25.45%), Postives = 269/617 (43.60%), Query Frame = 2
Query: 8714 ITLSWSPPRISPDLYIPFTVDVECRPVNYSYSDEEGWSVFKTNIKKNRVDIADLDPNINYQLRIVPVTDFGI-------------GKPSMVIKKIRRSDN---LNSPTTEKA--MMLQEKHCLAVPMFC--------CLSQKAELKFTKLMEYKLDKITWTFNNAKVDVND--ERYKIFSAETYGIYFIIKNLEEDDFGEY-C-ALDEVQDPIQSFILIKSDAPTILNCLPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIFSSYRTVITEDKEQGTY--SLLISKCILSDGGEYSIRAENAIGFAEVKFNLRVDAHPE-------KKSVQINIGDVNDRYYTMKK----LAKGSYSRCQIVIEKSTQIEFIGKFFEINNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIY-----EKLQGLS-LAEYITQLSHWC----ESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVPKEDFGSRRHM--GL------TSP-FSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQ--LYNEDS----NDAISN---SACVFIRKCLLLKTGERLTSSDSLSHEWF 10351
            +TLSW P + +P  Y   T  +E R +      E+ WS+ + NI +    + +L+   +YQ R+     +GI               P  V    RR++    L  P  EKA  M   E++  A P F         C           +  +    I W F    +D +    + K+++         I    +++ G+Y C A ++  D  Q+ ++  +  P  +  L N + +  +   + V++D +P PE+ W + W+ I  S R    +D   G Y  SL+I+  +  D G YS  A N  G A     + V+A  +       ++ V I    V + Y   +K     A+G+  R   V EK+T  EF+ +   I++  +   +     ++ H  IV++   +   D+ L L+        + GLS LA    +++       E+ VR+ + QL+ A+ ++H+ R+ HLD++PE I++    ++ LKL          DFG  R +  GL       SP F +PE+++  P+   +DMWS G+LT++ L G    + + D   L N DS    +  + N    A  F++K L      RLT  ++L H W 
Sbjct: 6292 LTLSWIPTKRAPPRYPQVTYVIEIREL-----PEKQWSLLEYNIPEPVCKVRNLELGKSYQFRVRAENIYGISDPSPASPPSRLMAPPQPVFD--RRTNKVIPLLDPYAEKALDMRYSEQYACA-PWFSPGVVEKRYCAENDTLTIVLNVSGFPDPDIKWKFRGWDIDTSSPTSKCKVYTYGGSETTLAITGFSKENVGQYQCFAKNDYGDAQQNIMVDLATRPNFIQPLVNKTFSSAQPMRMDVRVDGEPFPELKWMKEWRPIVESSRIKFVQD---GPYLCSLIINDPMWRDSGIYSCVAVNDAGQATTSCTVTVEAEGDYNDVELPRRRVTIESRRVRELYEISEKDEKLAAEGAPFR---VKEKATGREFLAQLRPIDDALMRHVDIH--NSLDHPGIVQMHRVLR--DEKLALVVFDNANSTIDGLSSLAHPGVEIAEPKGVNRETCVRVFVRQLLLALKHMHDLRIAHLDLRPETILL---QDDKLKLA---------DFGQARRLLRGLITGEIKGSPEFVSPEIVRSYPLTLATDMWSTGVLTYVLLTGLSPFHGDNDNETLANVDSCQFDSSPLGNFSYDAGDFVKKLLTEIPVSRLTVDEALDHPWI 6878          

HSP 2 Score: 98.2117 bits (243), Expect = 2.106e-18
Identity = 171/766 (22.32%), Postives = 303/766 (39.56%), Query Frame = 2
Query: 4283 GFSKKDIKWKVLEDDLKQDKILQE---KRITQKFNNNLSFLLIDSVKLEDSGTYICQGFTNKELISECKITLNVVDNISDTLQCQVKFEKDKYSIEINQDVTMRALIECTSTHYSVSWFFNGEILEM-KSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDD--IDCSNNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGMVD-GKLLELVHFTVQVNPIQSILTTDESRLK-LICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMPFGDPCVLDNPFI----------DLYIESPQVNEHSGLYKCIVTNEKSETEF-VEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDE-KLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLK-INESSVDILV---KVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSC--DNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCI-----------------------APLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKI-LDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVT-DSEPKESDSSRIIVKPLCAPVLT 6427
            G S  D++W       K DK + E     + +     +  L++      D+G Y  +  +N    +E      V  ++      +   E     ++IN+  T+   ++      SV W  +G+ ++   S +++ ++ +G  + + I++      G Y C   N  G + T      V+N+           +E+ E     L V      +   +W KDD  I   N  +         F+LT   A   D G+Y      + G+ L   +F +  + I    T    +L+ L   + E +  D K  +I   V N     ++W ++D P      +DN  I           L I+  +  E  G+Y C  TNE  E +    + V+   E++ +P+  + L     E    + +  EL V  RV  K      W KD   +  +    +    +   + L+++D    D G Y+ +  N++  D  V   K+      KQT E  K L I    +PL++ F   E +TV  E +V +  +   I FF+N++   E  + +Q     D    LTI  A ++  G Y  +  N  G   ++  L +   +++ E + +                           AP F + L+   +  K+   L C++  +P+PKI WTK+G+ ++   ++ RV+    +    TL        D+G Y C   N  G   TE  IIVT +  PK    +   ++P+   V+T
Sbjct: 3213 GGSAPDVEW------FKDDKPVSEDGNHEMKKNPETGVFTLVVKQAATTDAGKYTAKA-SNPAGTAESSAEAEVTQSLEKPTFVR---ELVTTEVKINETATLSVTVKGVPDP-SVEWLKDGQPVQTDSSHVIAKVEGSGSYS-ITIKDARLEDSGKYACRATNPAGEAKTEANFAVVKNLVPPEFVEKLSPLEVKEKESTTLSVKVVGTPEPSVEWFKDDTPISIDNVHVIQKQTAVGSFSLTINDARQGDVGIYSCRARNEAGEALTTANFGIIRDSIPPEFT---QKLRPLEVREQETL--DLKVTVIGTPVPN-----VEWFKDDKPIN----IDNSHIFAKDEGSGHHTLTIKQAR-GEDVGVYTCKATNEAGEAKTTANMAVQ---EEIEAPLFVQGLKPYEVE----QGKPAELVV--RVEGKPEPEVKWFKDGVPIAIDNQHVIEKKGENGSHTLVIKDTNNADFGKYTCQATNKAGKDETVGELKIPKYSFEKQTAEEVKPLFI----EPLKETFAV-EGDTVVLECKVNKE-SHPQIKFFKNDQ-PVEIGQHMQLEVLEDGNIKLTIQNAKKEDVGAYRCEAVNVAGKANTNADLKIQFAAKVEEHVTDESGQLEEIGQFETVGDTASSKTDTGRGAPEFVELLRSCTVTEKQQAILKCKVKGEPRPKIKWTKEGKEVE---MSARVRAEHKDDGTLTLTFDNVTQADAGEYRCEAENEYGSAWTEGPIIVTLEGAPKIDGEAPDFLQPVKPAVVT 3932          

HSP 3 Score: 92.0485 bits (227), Expect = 1.593e-16
Identity = 131/611 (21.44%), Postives = 246/611 (40.26%), Query Frame = 2
Query: 10622 PNDNSSEEVKSDRSETFPSADRLSVSNTTKELLFTVPLKDQTFKSDSTAGKITVTLTCQLSLLGSEPISISWYKNQELLTDDSRIKLEVIKGGFLSCTILN-ATETDVGIFRCIARCHSLRTETSARLVLGDVPPQPEQLSVYYTNQEEVLLKWSP-----YLSAIDDVIYRIDIRTIDSRNKIRNWKTIGYSVDNR-YLLENLDRTQQYIARIIAQNKYGYSPYSIATSVFQNKIRN-----IHSLKQALIFNRKWMLTSRQSNHFNDL--------------HDLIKDIS--SDDI-------------RMNVIREHYSTLSQKSSGFAVLKLKNTNVNFPEYIVQRTFKMEDICPAFDLCVRIKYYHFPILFGEICDSSLGNRITFEEFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFV-GTVKEQESLTTHKPSIFKAPEYRY-ESITRYESDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNT--NTLLLPVPHTHFRAPKLSMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWFKQDPQTIYEMEHQTISSTPL 12319
            P+  + E +K+D  +  P A + +  + T   +FT  L+D   + +  A        C +S   S    ++W    ++L  + R+ +E  +   ++  ILN A   D+G + C A       ++S RL+ G+ P +P +     ++  E+ ++W       YL  I    YR++ R     +    W T+   +D+   ++++L     Y  R+ AQN +G    S+++ + Q   +      I  LK  +  N   M   + +N    +               D+  ++   +DD              R +VIR+   + ++  +  AV     ++    EY   R  + E++     L       +F  L  E     + +R  F ++               Y+E  V   +RQ+   + FLH   + H ++ P  I+   ++ +S+ +KL+     Q V G VK  +  T      + +PE+   E+    +SD+W +G+++F LLA   P   +   + ++   V N   +  L+PV                S+    F   +LKKSP  R   D  L+H +   DP  +   E    S++ L
Sbjct: 7498 PSATAIERIKADIEKVTPCATKKN-DDGTFAPIFTARLRDVYLRKNQPA-----IFECAVS--ASPAPKVTWDFQGKILESNDRVTIE--QDNNVARLILNHAAPYDLGEYVCTAINEYGTDKSSCRLISGETPSRPGRPEAELSSDTEIFIQWEAPEGPTYLEGI---TYRLEYRVAGPNDHGDPWITVSEKIDDESVIVKHLSPLGIYQFRVTAQNGFGLGLPSLSSRIVQTHGKGAPKLQIDVLKSEIRLNVVSM-PQKSTNQLGGISEESEEDSEARTANEDMKSNLQLQTDDPTGRFQIGGLKFKGRFSVIRDAVDSTTEGHAHCAVKIRHPSSEAISEYESLRDGQHENVQ---RLIAAFNNSNFLYLLSERLYEDVFSRFVFNDY---------------YTEEQVALTMRQVTSALHFLHFKGIAHLDVNPHNIMF--QSKRSWVVKLVDFGRAQKVSGAVKPVDFDTK-----WASPEFHIPETPVTVQSDMWGMGVVTFCLLAGFHPFTSEYDREEEIKENVINVKCDPNLIPV--------------NASQECLSFATWALKKSPVRRMRTDEALSHKFLSSDPSMVRRRESIKYSASRL 8055          

HSP 4 Score: 83.5741 bits (205), Expect = 5.210e-14
Identity = 180/816 (22.06%), Postives = 331/816 (40.56%), Query Frame = 2
Query: 4013 QWFWNDEAVKNINCKKDFTSNLAQLEIAHCQLSDSGQYKICF--NPLEASKCGKVTGLFLVSIAPIKKNLKPIDSNIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNN--NLSFLLIDSVKLEDSGTY--ICQGFTNKELISECKITLNVV---DNISDTLQCQVKFEKDKYSIEINQDVTMRALIECTSTHYSVSWFFNGEIL---EMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCSNNGIFN-STKNKNCFNLTKLKAEITDSGVYKFEGMVDGKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLR--NDMPFGDPCVL---DNPFIDLYIESPQVNEHSGLYKCIVTNEKSETEFVEITVKFKDEKVVSPILGEL-----LSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLKINESSVD-----ILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAI-WFFENEEI--DAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETL--DSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTD 6361
            +W+ N + + N   K +   + + LEI + QL D+  YK+    +  +A     +T + L  IA I K L+    + E   G+   L V+      K+IKW       K  K +      Q  ++  N   L+I     +D+  Y  +          S C +T+ +      I   L+ QV        + I   + +   IE + +  +V W+ NG+ L     K+  +  I +N  + E+      ++  G Y+  + N+ G S+ +  ++ VE  +I  L  + K+  ITEG      V +  +  +  +W K+  +   N  F    K    + L    A   D+  YK        +LE      + +   ++        K++    + +++    ++  V++    + V +WLR  N +  G   ++   D+    L I S  + + +G Y   V NE                K  S   GE+     +   +E +   E +     VE   P + +    W K+++ +          + P  Y L +   ++ D   Y + ++ ++ D      L  V+P  ++              I   L+D+ +  EP+ V+ + +VE  G  K I W+   +E+  DA+  +F +      F+LTIP++ +   G Y + + ND G V S G +  +  ++ SE    +  ++PL     KD E+   + + L C +  +P P+++W KDG  L  D +   R    LD     TL I  A+  D G+Y     N  G  T++  + VT+
Sbjct: 4431 KWYKNGKEIPNAKAKDNGDGSYS-LEIPNAQLDDTADYKVVVSNDAGDADSSAALT-VKLPGIA-IVKGLE----DAEVPKGKKAVLQVETNK-KPKEIKW------YKNGKEITPSDKAQPGSDGDNKPQLVIPDAGDDDAAEYKVVLTDEDGNTADSSCALTVKLPAKEPKIIKGLEDQV--------VSIGSPIKLE--IETSGSPKTVKWYKNGKELPGAAAKTIKIQKIDDNKYVLEIPSSVVEDT--GDYKVEVANEAG-SANSSGKITVEP-KITFLKPL-KDQSITEGENAEFSVETNTKPRI-VKWYKNGQEIKPNSRFIIEQKTDTKYQLVIKNAVRDDADTYKI-------VLENTAGEAESSAQLTVKKAKAGLCKIVKGLEDQVVAKGAKMVFEVKIQGEPEDV-RWLRDANVISAGANAIIEKIDDTTYRLIIPSADLKD-AGEYTVEVINESG--------------KAKSDAKGEVDEKPEIVRGLENIEIPEGDDDVFKVEVSAPVRQVK---WYKNDQEIKPNSHLEAKKIGPKKYELAINRAQLDDGADYKVVLSNAAGDCDSSAALTVVKPNVLK--------------IVDGLKDVDVE-EPQPVELKVKVE--GIPKVIKWYKNGQELKPDADGFKFEEKPESGEFSLTIPSSKKSDGGAYRVVLGNDKGEVYS-GSVVHVKSAKSSEPTSGANFLSPL-----KDTEVEEGDMLTLQCTIAGEPFPEVIWEKDGVVLQKDDRITMRVA--LDG--TATLRIRSAKKSDIGQYRVTAKNEAGSATSDCKVTVTE 5163          

HSP 5 Score: 74.3294 bits (181), Expect = 3.709e-11
Identity = 62/273 (22.71%), Postives = 127/273 (46.52%), Query Frame = 2
Query: 9584 KKSVQINIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQ--IEFIGKFFEINNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVPKEDFGSRRHMGLTSPFSAPEL-LKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQLYNEDSNDAISNSAC-------VFIRKCLLLKTG-------ERLTSSDSLSHEWF 10351
            K ++Q+   D   R+       KG +S  +  ++ +T+       K    ++  I  SE++ +++  H N+  +  A    + +L L+ E+L     + ++    ++ E QV + + Q+  A+ +LH   + HLD+ P NI+   K + ++KL  F  A  ++  G+ + +   + +++PE  +   P+   SDMW +G++TF  L G      E D+   E+  + + N  C          ++CL   T         R+ + ++LSH++ 
Sbjct: 7771 KSNLQLQTDDPTGRFQIGGLKFKGRFSVIRDAVDSTTEGHAHCAVKIRHPSSEAI--SEYESLRDGQHENVQRLIAAFNNSN-FLYLLSERLYEDVFSRFVFN-DYYTEEQVALTMRQVTSALHFLHFKGIAHLDVNPHNIMFQSKRSWVVKLVDFGRA--QKVSGAVKPVDFDTKWASPEFHIPETPVTVQSDMWGMGVVTFCLLAGFHPFTSEYDR--EEEIKENVINVKCDPNLIPVNASQECLSFATWALKKSPVRRMRTDEALSHKFL 8035          

HSP 6 Score: 73.559 bits (179), Expect = 5.779e-11
Identity = 169/795 (21.26%), Postives = 299/795 (37.61%), Query Frame = 2
Query: 4082 QLEIAHCQLSDSGQYKICFNPLEASKCGKVTGLFLVSIAP-IKKNLKPIDSNIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNNNLSFLLIDSVKLEDSGTY-ICQGFTNKELISECKIT------LNVVDNISDTLQCQVKFEKDKYSIEINQDVTMRALIECTSTHYSVSWFFNGEILEMKSD--ILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTA-----RTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCS-NNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGMVD-GKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMP--FGDPCVLDNPFIDLY-IESPQVNEHS-GLYKCIVTNEKSETEFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELS----VESRVPTKSIDSAVWLKDEK---------LLNETDPRLTIIMQPFCYNLILRDVKMTDAGMY-SLKINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNF--TLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIV 6355
            +L I    L D+G+Y +    +  S   K      V   P I + L+    NIE   G+     V+V    ++ +KW   + ++K +  L+ K+I  K       L I+  +L+D   Y +       +  S   +T      L +VD + D              +E  Q V ++  +E       + W+ NG+ L+  +D     +   +G+ + L I +  +S  G Y  ++ N  G   +      ++  + E        S  K+ E+ EG+ L L+     E   +  W KD +    ++ I           L    A+ +D G Y+     + G        TV     Q      + +  +  +    +  D K    +V+V    +  +QW  N +P  F D   LD+     Y +    V E   G  KCI  NE    E V    +F+          + L         + D +I +     +E  V         W KD K         + N  D    I + PF         + +D G+Y  + +NE             I +  +E  +    P+I  PL+D  + N  + ++   +V+       +W+ +   + A++   IQ+  D    L I  + E+  G Y     N  G + +    S  +  ++ +Q ++     P FTK L D+     ++  L C +  DP P+I W ++G+ L     N    +++  P+   +L + E+ + D G Y C   N  G   T+A   V
Sbjct: 4836 RLIIPSADLKDAGEYTVEV--INESGKAKSDAKGEVDEKPEIVRGLE----NIEIPEGDDDVFKVEVSAPVRQ-VKWYKNDQEIKPNSHLEAKKIGPKKYE----LAINRAQLDDGADYKVVLSNAAGDCDSSAALTVVKPNVLKIVDGLKDV------------DVEEPQPVELKVKVEGIPK--VIKWYKNGQELKPDADGFKFEEKPESGEFS-LTIPSSKKSDGGAYRVVLGNDKGEVYSGSVVHVKSAKSSEPTSGANFLSPLKDTEVEEGDMLTLQCTIAGEPFPEVIWEKDGVVLQKDDRITMRVALDGTATLRIRSAKKSDIGQYRVTAKNEAGSATSDCKVTVTEQGEQP----SKPKFVIPLKTGAALPGDKKEF--NVKVRGLPKPTLQWFLNGIPIKFDDRITLDDMADGNYCLTIRDVREEDFGTLKCIAKNENGTDETV---CEFQQGAGHDDGSRDDLRYPPRFNVPLWDRRIPVGDPMFIECHVDANPTAEVEWFKDGKKIEHTAHTEIRNTVDGACRIKIIPF---------EESDIGVYMCVAVNELGQAETQATYQVEILEHVEEEKRREYAPKINPPLEDKTV-NGGQPIRLSCKVDAIPRASVVWYKDGLPLRADSRTSIQYEEDGTATLAINDSTEEDIGAYRCVATNAHGTINT----SCSVNVKVPKQEVKKEGEEPFFTKGLVDLWADRGDSFTLKCAVTGDPFPEIKWYRNGQLL----RNGPRTVIETSPDGSCSLTVNESTMSDEGIYRCEAENAHGKAKTQATAHV 5577          

HSP 7 Score: 70.4774 bits (171), Expect = 5.306e-10
Identity = 116/503 (23.06%), Postives = 200/503 (39.76%), Query Frame = 2
Query: 4919 WSKDDIDCSNN--GIFNSTKNKNCFNLTKLKAEITDSGVY------KFEGMVDGKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMPFGDP----CVLDNPFIDLYIESPQVNEHSGLYKCIVTNEKSETEF-VEITVKFK-DEKVVSPILGELLSCTVEEVNTIEDEKIEL-SVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMY----SLKINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFE--NEEI--DAENMEFIQWSCDNYFALTIP-AAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIV 6355
            W KDD+    +    F S ++   F +T    ++TD+G Y      ++          ++    +  P   +    +      C++ ++I           EV  W +  + WL +D P           D     L I   Q ++ +G+Y   + NE    E   E+ V+   D+  V+P        T+E V   E E++   SV +  P   I   +W  + K L+E++    I     C  L ++DV     GM     S ++  +S D  +KVR  P              P   KPL+D  ++ +   V   FEV+ SG  +    F    +E+    E +E +    D ++ ++IP  + +KH G+   +  N+ G   S  RL++       EQ  E    AP F K ++D  + + E       +  +P P++ W  +G  +D       VKI     +  L I  A+   +G   C   N +G   T+A ++V
Sbjct:  581 WYKDDVQLHEDERHTFYSDED-GFFAMTIDPVQVTDTGRYTCMATNEYGQASTSAFFRVLKVEKEAAPPAFVTKLRDKE----CKEGDVI-------DFECEVEGWPEPELVWLVDDQPLRPSHDFRLQYDGQTAKLEIRDAQPDD-TGVYTVKIQNEFGSIESKAELFVQADPDKNHVAP----EFQATIEYVECDEGEEVRFKSVITGDPNPEI---IWFINGKPLSESEKVKFISEDGICI-LTIKDVTRHFDGMVTCQGSNRLGSASCDGRLKVRVPPAP------------PTFNKPLEDKTVQEKSTVV---FEVDVSGWPEPTLTFTLCGKELKNGEEGVEIV--GHDGFYRISIPNTSMDKHDGEIVAKAQNEHGTAESRARLTV-------EQEEEESRSAPTFLKDIEDQTVKTGEFAVFETTVRGNPNPEVTWFINGHKMDQGSPG--VKIEAHNHDHKLTIDSAQY--AGTVLCRAENAVGRFETKARLVV 1034          

HSP 8 Score: 69.707 bits (169), Expect = 8.477e-10
Identity = 64/235 (27.23%), Postives = 105/235 (44.68%), Query Frame = 2
Query: 5792 EPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDG--------RLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFT--LIITEAEVEDSGRYCCLGTNFLGYDTT--EAVIIVTDSEPKESDSS-RIIVKPLCAPVLTAEYSKGADVI 6457
            E + +K E +V+ S   + +W+ +   +   +   I  S D    L IP+      G Y +   N  G  +  G        R S   RS  +++ +     AP   + L++I I  K++ RL C+   DPKP I W KDGE +       R++++ E P+    L++  A  +D+G Y C+  N  G   T  +  +I  D +P++ DSS R    P     LT   +K  D +
Sbjct: 5714 EGQPLKLECKVDASPLPEMVWYKDGAIVTPSDRIQISLSPDGVATLLIPSCVYDDDGIYRVIATNPSGTAQDKGTATVKKLPRDSGARRS--ADRDVFDANKAPKLMEPLENIRIPEKQSFRLRCKFSGDPKPTIKWFKDGERV---FPYGRLQLI-ESPDGVCELVVDSATRQDAGGYRCVAENTYGSARTSCDVNVIRGDRKPRDIDSSIREGKAPGFTTPLTIRRAKPGDSV 5942          

HSP 9 Score: 69.3218 bits (168), Expect = 1.002e-9
Identity = 225/1066 (21.11%), Postives = 428/1066 (40.15%), Query Frame = 2
Query: 3260 FFTNLKQIETISGENLHVQFKAYNIVLDTLKKGSWFVNNELLDFKKWNGSVNVSESQVEINFPKSTNELSGIWQFRIDKPMKLFSPEISVNVLAKEVAPLSTGFLDCEIEEIDLKIGETLSLTLNAKDIPIMTLKNGGWFLNSEPIHAVKFRGNEVIEENKVKIVIPNVTKEFSGLLQYRIVKPVELYSPEIIIKIRGSLIKQTPKIEEEKFESNLILELHNVSLNISENERILLEAKIISGNINSYKTPPQWFWNDEAVKNINCKKDFTSNLAQLEIAHCQLSDSGQYKICFNPLEASKCGKVTGLFLVSIAPIKKNLKP--IDSNIETC--PGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNNNLSFLL-IDSVKLEDSGTY-ICQGFTNKELISECKITLNVVDNISDTLQCQVKFEKDKYSIEINQDVTMRALIECTSTHYSVSWFFNG-EILEMKSDILSDIKNNGKIA-ELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKD--DIDCSNNGIFNSTKNKNCFNLTKLKAEITDSGVYKFE-GMVDGKLLEL-VHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRN--DMPFGDPCVL------DNPFIDLYIESPQVNEHSGLYKCIVTNEK-SETEFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFC---YNLILRDVKMTDAGMYSLKIN------ESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIF---IRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGY-DTTEAVIIV 6355
            FF  L  I+    E    + K      D      WF +   L   K     +  +    +    S  +  G ++  +     + + ++ + V+  E   +  G  D  + +     G  + L++  +  P  T+K   W+  +E + + +      + E++ K+ I +   E S    YR+V   + +S E    +  ++ K   KI    F+  L         ++ +   ++LE +I  G     K    W+ N + +K+   + D  +   +L I   Q  D G+Y +      A++ G++      S A +  + KP  +   + T    GE+ T  V V+G   K +KW       K  K + + +   K N + S+ L I + ++ED+  Y +       +  S   +T+ + D+  D ++ ++       +++  +  T    ++       V W+ NG EI   K+      K+NG  +  L+I N        Y+ ++ N  G++ ++   L V+   I  +  + ++ E+ +G +  L+V +  +K  + +W K+  +I  S+     S  + N   L    A   D+  YK      DG   +     TV+       L   E ++    ED   ++S   P+ + +E     +  ++W +N  ++P      +      DN ++ L I S  V E +G YK  V NE  S     +ITV+ K    + P+  + ++         E E  E SVE+    + +    W K+ +   E  P    I++      Y L++++    DA  Y + +       ESS  + VK     + K    I K L+   + K  + +F   I+ EPE V+              W  +   I A     I+   D  + L IP+A  K  G+YT++V N+ G  +SD       + E+ E+        P   + L++IEI   ++      +   P  ++ W K+ + +         KI  +   + L I  A+++D   Y  + +N  G  D++ A+ +V
Sbjct: 4020 FFKELSAIQVKETETAKFECKVSGTKPDV----KWFKDGTPLKEDKRVHFESTDDGTQRLVIEDSKTDDQGNYRIEVSNDAGVANSKVPLTVVPSETLKIKKGLTDVNVTQ-----GTKILLSVEVEGKP-KTVK---WYKGTETVTSSQTTKIVQVTESEYKLEIESA--EMSDTGAYRVVLSTDSFSVESSATV--TVTKAAEKISLPSFKKGL------ADQSVPKGTPLVLEVEI-EGKPKDVK----WYKNGDEIKDGKVE-DLGNGKYRLTIPDFQEKDVGEYSVTA----ANEAGEIE-----SKAKVNVSAKPEIVSGLVPTTVKQGETATFNVKVKG-PVKGVKW------YKNGKEIPDAKT--KDNGDGSYSLEIPNAQVEDAADYKVVVSNDAGDADSSAALTVKLADDGKDKVKPEIVSGLIPTTVKQGETATFNVKVKGPVKQ--VKWYKNGKEIPNAKA------KDNGDGSYSLEIPNAQLDDTADYKVVVSNDAGDADSS-AALTVKLPGIAIVKGL-EDAEVPKGKKAVLQVETN-KKPKEIKWYKNGKEITPSDKAQPGSDGD-NKPQLVIPDAGDDDAAEYKVVLTDEDGNTADSSCALTVK-------LPAKEPKIIKGLEDQ--VVSIGSPIKLEIETSGSPK-TVKWYKNGKELPGAAAKTIKIQKIDDNKYV-LEIPS-SVVEDTGDYKVEVANEAGSANSSGKITVEPKI-TFLKPLKDQSIT---------EGENAEFSVETNTKPRIVK---WYKNGQ---EIKPNSRFIIEQKTDTKYQLVIKNAVRDDADTYKIVLENTAGEAESSAQLTVKKAKAGLCK----IVKGLEDQVVAKGAKMVFEVKIQGEPEDVR--------------WLRDANVISAGANAIIEKIDDTTYRLIIPSADLKDAGEYTVEVINESGKAKSDA------KGEVDEK--------PEIVRGLENIEIPEGDDDVFKVEVSA-PVRQVKWYKNDQEIKPNSHLEAKKIGPK--KYELAINRAQLDDGADYKVVLSNAAGDCDSSAALTVV 4963          

HSP 10 Score: 68.9366 bits (167), Expect = 1.400e-9
Identity = 157/732 (21.45%), Postives = 287/732 (39.21%), Query Frame = 2
Query: 4394 LLIDSVKLEDSGTYICQGF-------TNKELISE--CKITLNVVD------------NISDTLQCQVKFEKDKYS-IEINQDVTM----RALIECT---STHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNS-------STARTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCS-NNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGMVD-GKLLELVHFTV----QVNP-----IQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMPFGDPCVL-----DNPFIDLYIESPQVNEHSGLYKCIVTNEKS-ETEFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLKIN------ESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAI-WFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDG-ETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRIIVKP 6406
            L I + K ED G Y C+         TN +L  +   K+  +V D             + DT   +    +     +E+ +  T+    +A+++C         + W   G+ +EM + + ++ K++G +  L   N  ++  G Y C  EN+ G++        T      ++    D L  V   + +T G    LE     +     +W K+  +   ++ +     +     LT   A++ D   Y+ E   + G +   V  TV    QV P     + +I   +    K  C+     +S +KP +             +W ++  P  +   +     D+    L IE  + ++  G Y+  V+N+       V +TV      V S  L   +   + +VN  +  KI LSVE     K++    W K  + +  +     + +    Y L +   +M+D G Y + ++      ESS  + V          TK   K + +P  KK L D  +   P+      EVE  G  K + W+   +EI    +E +    +  + LTIP   EK  G+Y++  AN+ G + S  ++++  + EI   ++ +               +   E    N ++   P   + W K+G E  D+K  +      +   +++L I  A+VED+  Y  + +N  G   + A + V     K +D  +  VKP
Sbjct: 3744 LTIQNAKKEDVGAYRCEAVNVAGKANTNADLKIQFAAKVEEHVTDESGQLEEIGQFETVGDTASSKTDTGRGAPEFVELLRSCTVTEKQQAILKCKVKGEPRPKIKWTKEGKEVEMSARVRAEHKDDGTLT-LTFDNVTQADAGEYRCEAENEYGSAWTEGPIIVTLEGAPKIDGEAPDFLQPVKPAV-VTVGETAVLEGKISGKPKPSVKWYKNGEELKPSDRVKIENLDDGTQRLTVTNAKLDDMDEYRCEASNEFGDVWSDVTLTVKEPAQVAPGFFKELSAIQVKETETAKFECK-----VSGTKPDV-------------KWFKDGTPLKEDKRVHFESTDDGTQRLVIEDSKTDDQ-GNYRIEVSNDAGVANSKVPLTV------VPSETL--KIKKGLTDVNVTQGTKILLSVEVEGKPKTVK---WYKGTETVTSSQTTKIVQVTESEYKLEIESAEMSDTGAYRVVLSTDSFSVESSATVTV----------TKAAEK-ISLPSFKKGLADQSV---PKGTPLVLEVEIEGKPKDVKWYKNGDEIKDGKVEDL---GNGKYRLTIPDFQEKDVGEYSVTAANEAGEIESKAKVNVSAKPEIVSGLVPTT--------------VKQGETATFNVKVKG-PVKGVKWYKNGKEIPDAKTKD------NGDGSYSLEIPNAQVEDAADYKVVVSNDAGDADSSAALTV-----KLADDGKDKVKP 4400          

HSP 11 Score: 66.2402 bits (160), Expect = 8.898e-9
Identity = 85/362 (23.48%), Postives = 148/362 (40.88%), Query Frame = 2
Query: 5333 YKCIVTNE-KSETEFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQP--FCYNLILRDVKMTDAGMYSLKIN------ESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFI-QWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDE---FPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVI-IVTDSEPKE 6376
            YK I TN   + T   +IT K     V +P+  + L  T   V   E+ K+E+ V    P        W KD+K ++E D    +   P    + L+++    TDAG Y+ K +      ESS +               E+ ++L+ P   + L    ++   ET      V+        W  + + +  ++   I +      +++TI  A  +  GKY  +  N  G  +++   +++              + P F +KL  +E+  KE+  L+ +++  P+P + W KD    D+      V ++ +     +F+L I +A   D G Y C   N  G   T A   I+ DS P E
Sbjct: 3165 YKAIATNSIGTATSTSKITTK-----VEAPVFEQGLKKT--SVKEKEEIKMEVKVGGSAP-----DVEWFKDDKPVSE-DGNHEMKKNPETGVFTLVVKQAATTDAGKYTAKASNPAGTAESSAEA--------------EVTQSLEKPTFVRELVTTEVKIN-ETATLSVTVKGVPDPSVEWLKDGQPVQTDSSHVIAKVEGSGSYSITIKDARLEDSGKYACRATNPAGEAKTEANFAVV-----------KNLVPPEFVEKLSPLEVKEKESTTLSVKVVGTPEPSVEWFKD----DTPISIDNVHVIQKQTAVGSFSLTINDARQGDVGIYSCRARNEAGEALTTANFGIIRDSIPPE 3483          

HSP 12 Score: 59.6918 bits (143), Expect = 9.480e-7
Identity = 94/384 (24.48%), Postives = 157/384 (40.89%), Query Frame = 2
Query: 5282 FIDLYIESPQVNEHSGLYKCIVTNEKSETEFVEITVKFKDEKVVSP--ILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNET-DPRLTIIMQPFCYNLILRDVKMTDAGMYSLKIN------ESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEI-DAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRIIVK 6403
            F  + I+  QV + +G Y C+ TNE  +          K EK  +P   + +L     +E + I+    E  VE   P   +   VWL D++ L  + D RL    Q     L +RD +  D G+Y++KI       ES  ++ V+  P           KN   P+ +  ++ +   +E E V+F+  +      + IWF   + + ++E ++FI  S D    LTI        G  T Q +N +G    DGRL + +               P F K L+D  +  K  +     +   P+P + +T  G+ L +      +   D F   ++  T  +  D G       N  G   + A + V + E +ES S+   +K
Sbjct:  603 FFAMTIDPVQVTD-TGRYTCMATNEYGQASTSAFFRVLKVEKEAAPPAFVTKLRDKECKEGDVID---FECEVEG-WPEPEL---VWLVDDQPLRPSHDFRLQYDGQ--TAKLEIRDAQPDDTGVYTVKIQNEFGSIESKAELFVQADPD----------KNHVAPEFQATIEYVEC-DEGEEVRFKSVITGDPNPEIIWFINGKPLSESEKVKFI--SEDGICILTIKDVTRHFDGMVTCQGSNRLGSASCDGRLKVRVPP-----------APPTFNKPLEDKTVQEKSTVVFEVDVSGWPEPTLTFTLCGKELKNGEEGVEIVGHDGFYRISIPNTSMDKHD-GEIVAKAQNEHGTAESRARLTV-EQEEEESRSAPTFLK 950          

HSP 13 Score: 58.5362 bits (140), Expect = 2.263e-6
Identity = 40/181 (22.10%), Postives = 79/181 (43.65%), Query Frame = 2
Query: 9044 CCLSQKAELKFTKLMEYKLDKITWTFNNAKVDVNDERYKIFSAETYGIY-FIIKNLEEDDFGEYCA-----LDEVQDPIQSFILIKSDAPTILNCLPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIFSSYRTVITEDKEQGTYSLLISKCILSDGGEYSIRAENAIGFAEVKFNLRV 9568
              + +K E+K    +      + W F + K    D  +++      G++  ++K     D G+Y A         +   ++ +    + PT +  L    + ++E  ++SV +   P P V W ++ + + +    VI + +  G+YS+ I    L D G+Y+ RA N  G A+ + N  V
Sbjct: 3198 TSVKEKEEIKMEVKVGGSAPDVEW-FKDDKPVSEDGNHEMKKNPETGVFTLVVKQAATTDAGKYTAKASNPAGTAESSAEAEVTQSLEKPTFVRELVTTEVKINETATLSVTVKGVPDPSVEWLKDGQPVQTDSSHVIAKVEGSGSYSITIKDARLEDSGKYACRATNPAGEAKTEANFAV 3377          

HSP 14 Score: 56.9954 bits (136), Expect = 5.493e-6
Identity = 39/138 (28.26%), Postives = 64/138 (46.38%), Query Frame = 2
Query: 5957 CGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEP 6370
             GKYT  V N  G    +  L+++   E   +       AP F   L+D    + E + L C+++ +PKPK+ W  D +T+  + +   V+ ++     T  IT +E+   G+Y C+  N  G   TEA + V    P
Sbjct: 2959 AGKYTCIVENTAGKDTCEATLTVIESLEKKSEKK-----APEFIVALQDKTTKTSEKVVLECKVIGEPKPKVSWLHDNKTITQESIT--VESVEGVERVT--ITSSELSHQGKYTCIAENTEGTSKTEAFLTVQGEAP 3087          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|A8DYP0|OBSCN_DROME (Obscurin OS=Drosophila melanogaster OX=7227 GN=Unc-89 PE=1 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 1.346e-29
Identity = 136/610 (22.30%), Postives = 257/610 (42.13%), Query Frame = 2
Query: 8705 EREITLSWSPP-RISPDLYIPFTVDVECRPVNYSYSDEEGWSVFKTNIKKNRVDIADLDPNINYQLRIVPVTDFGIGKPSMVIKKIRRSDNLNSPTT------------EKAMMLQEKHCLAVPMFCCLSQKAELKF-------------TKLM----EYKLDKITWTFNNAKVDVNDERYKIFSAETYGIYFIIKNLEED-DFGEYCALDEVQDPIQSFILIKSDAPTILNCLPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIFSSYRTVITEDKEQGTYSLLISKCILSDGGEYSIRAENAIGFAEVKFNLRVDA------------HPEKKSVQINIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFF----EINNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLA-EYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLC--GFSNAVPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGH-----------LKVNFEGDQLYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWF 10351
            +R + LSW+P   ++P   I + +++   P       E  W   +T ++    DI +L+P  +Y+ R+     FG+  PS   +  R+    + P T            E +    +   +  P    L+Q  +                T+LM     Y   K+T+ F++  ++      + ++       FI K L+ D  + E  A +E  +  Q   L  ++ P  L       +   +N  I  ++   P PEV W ++WK I  S R  I+   +   Y L I   I+ DGG YSI A N  G       + ++             HP  +S Q+      D+Y    +L +G+       +E+S+   +  K      E+    +  +E + +   +H+N++  +DA    D+ + LI E   G  L  + + +  ++ E  +   I Q +  + ++HE  V H+ +  ++++++    +I+K+   G S  + + +  +  + G+   F +PE++  E + F+ DMW++G++T++ L GH           L    EG   + ++    IS+    FI + LL    ER+    +L H WF
Sbjct: 2847 DRGLLLSWNPSVPLTPRYPITYQIEMMDLP-------EGDWRTLRTGVRSCACDIRNLEPFRDYRFRVRVENKFGVSDPSPYTQTYRQKLVPDPPKTYTYLPPGTDFRPETSPYFPKDFDIERPPHDGLAQAPQFLLREQDISYGVKDHNTELMWFVYGYPKPKMTYYFDDMLIESGGRFDQSYTRNGQATLFINKMLDRDVGWYEAVATNEHGEARQRVRLEIAEHPRFLKRPDETFIMARKNGRIEAKLVGIPLPEVHWFKDWKPIVDSSRIKIS-SYDPDIYVLSIHDSIIKDGGLYSISARNIAGSISTSVTVHIEENEDQYIYKTYGRHPYVRSKQLRY---QDKYDIGDELGRGTQGITYHAVERSSGDNYAAKIMYGRPELRPFML--NELEMMNTFNHKNLIRPYDAYDT-DRSVTLIMELAAGGELVRDNLLRRDYYTERDIAHYIRQTLWGLEHMHEMGVGHMGLTIKDLLISVVGGDIIKVSDFGLSRKINRHNLSTLDY-GMPE-FVSPEVVNKEGVNFSHDMWTVGLITYVLLGGHNPFLGIDDRETLTKIREGRWDFKDEIWTHISDDGRDFISRLLLYSPEERMDVKTALKHPWF 3440          

HSP 2 Score: 116.316 bits (290), Expect = 6.869e-24
Identity = 103/426 (24.18%), Postives = 192/426 (45.07%), Query Frame = 2
Query: 10808 LGSEPISISWYKNQELLTDDSRIKLEVIKGGFLSCTILNATETDVGIFRCIARCHSLRTETSARLVLGDVPPQPEQLSVYYTNQEEVLLKWSPYLSAIDDVIYRIDIRTIDSR-NKIRNWKTIGYSVDNR-YLLENLDRTQQYIARIIAQNKYGYSPYSI--ATSVFQNKIRNIHSLK-----QALIFNRKWMLTSRQSNHFNDLHDLIKDISSDDIRMNVIREHYSTLSQKSSGFAVLKLKNTNVNFPEYIVQRTFKMED-----ICPAFDLCVRIKYYHFPILFGEICDSSLGNRITFEEFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRYESDIWSLGILSFLLLATQLP 12043
            +G     + W+KN  +LT+  RIK+ V + G        A   DVG+++ +AR    +T    R+V+  +P  P+   +   +  E+LL+W       DD    +   ++  + +    W T+  ++D+  YLL +L     Y  R+ ++N+ G+S   I  + S        IH  K     Q L  N   ++   +  H  D H   +    + +  + + + YS +S+ + G     +K    +    +V +  ++ D     +   FD    +++   P LF      ++   I   E + G ++L+   +R  YSE  V T++ QLL  +Q+LH     H NI+P  ++++  + +S  +KL+   + + V  +  +  +T      F+ PE   +     +SDIWSLG L++LLL+   P
Sbjct: 3678 VGDPKPCVQWFKNDMVLTESKRIKISVDEDGRSILRFEPALHFDVGVYKVVARNKVGQTVARCRIVVATLPDAPDSPEISANSGTEILLRWK---QPRDDGHSTVLCYSLQYKLSNCDAWTTVADNIDHEFYLLHDLQPNTNYQFRLASKNRIGWSEMGIPVSASTVGGDAPKIHITKAMKHLQQLTENGHQVVPEEERVH-TDYH--CEREPPNWVTDSSVSDKYSFISEIARGEFSTIVKGIQKSTDTVVVAKILEVTDENEDNVVAEFDNFKTLRHERIPALFSAYKPLNVPIAIFVMEKLQGADVLTYFSSRHEYSEQMVATVVTQLLDALQYLHWRGYCHLNIQPDNVVMA--SVRSIQVKLVDFGSAKKVNKLGMK--VTPCGSLDFQPPEMINDEPIFPQSDIWSLGALTYLLLSGCSP 4093          

HSP 3 Score: 109.768 bits (273), Expect = 6.380e-22
Identity = 73/264 (27.65%), Postives = 119/264 (45.08%), Query Frame = 2
Query: 9614 VNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEINNMGIGR--SEFQCIQNISHRNIVEIFDA---IAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQLYNEDSN------------DAISNSACVFIRKCLLLKTGERLTSSDSLSHEWFI 10354
            V+D+Y  + ++A+G +S     I+KST    + K  E+ +       +EF   + + H  I  +F A   + +P    + + EKLQG  +  Y +    + E  V  ++ QL+ A+ YLH    CHL+I+P+N++M    +  +KL  F +A      G +     +  F  PE++  EPI   SD+WS+G LT+L L G     F G   Y    N              ++  A  FI         +R  + D L H W +
Sbjct: 3893 VSDKYSFISEIARGEFSTIVKGIQKSTDTVVVAKILEVTDENEDNVVAEFDNFKTLRHERIPALFSAYKPLNVP--IAIFVMEKLQGADVLTYFSSRHEYSEQMVATVVTQLLDALQYLHWRGYCHLNIQPDNVVMASVRSIQVKLVDFGSAKKVNKLGMKVTPCGSLDFQPPEMINDEPIFPQSDIWSLGALTYLLLSGCSP--FRGADEYETKQNISFVRYRFENLFKEVTPEATRFIMLLFKRHPTKRPYTEDCLEHRWLM 4152          

HSP 4 Score: 95.9005 bits (237), Expect = 1.023e-17
Identity = 180/814 (22.11%), Postives = 305/814 (37.47%), Query Frame = 2
Query: 4073 NLAQLEIAHCQLSDSGQYKICFNPLEASKCGKVTGLFLVSIAP----IKKNLKPID----SNIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQD----KILQEKRITQKFNNNLSF--LLIDSVKLEDSGTYICQGFTNKELISECKITLNVVD--NISDTLQCQVKFEKDKYSIEINQDVTMRALIECTSTHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNS-VTKNIEITEGNELNLEVVSEIEKDLQ--------FQWSKD----DIDCSNNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGMVD-GKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRN--DMPFGDPCVLDNPFIDLYIESPQVN------EHSGLYKCIVTNEKSET-EFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLK-INE-----SSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIA----PLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSE 6367
            N  +L+I +C  +D+G Y I      AS+   V+    V  AP     K N +P       + E          V + G  K  +K+   E ++ +     +I+++K       + L F  L+I  V+  D+GTY C+  TNK   + C+     V+  N    L  Q+    +K   +                     W  NGE  + +         +     L  Q+      GIY C+ +   GN S +  EL+V+   I  LN    K   + E  E N  +      +LQ         QW  D     +D  +  ++   +++   +L     +  D+GVY  E + + G+    ++  V+  P          ++K I +   I  S  + + + +EV  + Q  +Q   N  D+       + +  I   +E   V         +G Y    TN+ S+T E+   TVK K      P++ +       E   I  EK  + +  R+         W  DE  +  TD + T+      Y L +      DAG Y++K  NE     SS  +L+K  P+   K                 L++I +      V+    V+      A W+ +  EID +  +F      N F L +        G YT ++ ND G                  ++ ++C +     P   + LK++E+   ++  L   +  +P+ KI W KDG  +      +  +      N+ L +  A  ED+G Y    TNF+G  T+   + V  SE
Sbjct: 1072 NSYRLDIKNCSETDAGTYTI--RAQSASETTTVSAQLAVGQAPGHDETKTNTEPAFLVSLKDAEMIENTLFRFMVKIIGDPKPRVKFYKDEKEILETNDRIQIIRDK-------DYLGFYELVIADVQKTDAGTYSCKA-TNKHGEANCEAIATTVEDKNPFGALSGQILPAGEKPVFQ---------------------WKRNGEEFDPEERFKVLFGEDEDSLALVFQHVKPEDAGIYTCVAQTSTGNISCS-AELSVQGA-IQTLNREPEKPTLVIEHREANASIGGSAILELQCKGFPKPAVQWKHDGEVIQVDDRHKFMY---EDEESMSLVIKNVDTVDAGVYTIEAINELGQDESSINLVVKAPP----------KIKKITD---ITCSAGETIKMEIEVEGFPQPTVQVTNNGKDVTAESNVKISSSSIGKSLEKVVVEVKEIKLSQAGNYSIKATNDLSQTSEYWSCTVKSK------PVIVKNF-----ESEYIHGEKENVQMTVRIDAYPEAKLTWYHDETEIKITDSKYTVSSDGNAYTLKITGATRVDAGKYTVKATNEHGSATSSTQLLIKCAPEFTHK-----------------LKNITVAEGDSNVELVVGVDAYPRPHAKWYIDGIEIDEKRNDFRHVEEGNDFKLIMNQVATNMQGNYTCKIMNDYG------------------KLEDNCVVTVNCKPKVKRGLKNVEVQEGKSFTLEVEVYSEPEAKIKWFKDGHEIYEDARIKISRDTQRIENYYLTLNLARTEDAGTYEMKATNFIGETTSTCKVAVLTSE 1790          

HSP 5 Score: 92.4337 bits (228), Expect = 1.131e-16
Identity = 110/405 (27.16%), Postives = 176/405 (43.46%), Query Frame = 2
Query: 5150 DNEIILSDSKPLIISVEVLNWKQGVIQWLRND---MPFGDPCVLDNP--FIDLYIESPQVNEHSGLYKCIVTNEKSETEFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCY-NLILRDVKMTDAGMYSLKINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIF-IRNEPETVKFEFEVEESGAKKAIWFFENEEI--DAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTT 6337
            DN + +   +PL++   V       +QWL++     P     +  NP   + L I S Q N+ SG YK I++N   E +     V  K E++    L  + S TV     +  E ++L  E++V         W KD  LL  + P +  I  P     LI+   +  DAG+Y   I     +I    + + + K++K +F           LQD   I   P  VK + +V  +   K  WF    EI  DA ++  ++ + DN  +L I        G Y +   N  G   S  +L +  +++  E   E    AP F   L+D+     + + L+   + +P P+++W+KDG TL     N R+ +  +  +  L I  AE  DSG Y CL  N LG D++
Sbjct: 2227 DNALDVLQGEPLVLECCVDGSPLPTVQWLKDGDEVKPSESIKISTNPDGLVKLEINSCQPND-SGAYKLIISNPHGE-KVALCAVAVKPEEMQPKFLKPITSQTV-----VVGEPLKL--EAQVTGFPAPEVKWYKDGMLLRPS-PEINFINSPNGQIGLIIDAAQPLDAGVYKCLIANKGGEIEGVSKVEIVPKESKPVFV--------AELQDASSIEGFP--VKMDIKVVGNPKPKLQWFHNGHEIKPDASHIAIVE-NPDNSSSLIIEKTAPGDSGLYEVIAQNPEGSTASKAKLYVAPKAD--ETATEE---APQFVSALRDVNADEGQELVLSAPFISNPMPEVIWSKDGVTLTP---NERLLMTCDGKHIGLTIKPAEAADSGNYTCLLANPLGEDSS 2602          

HSP 6 Score: 68.9366 bits (167), Expect = 1.560e-9
Identity = 99/386 (25.65%), Postives = 160/386 (41.45%), Query Frame = 2
Query: 3929 SLNISENERILLEAKIISGNINSYKTPPQWFWNDEAVKNINCKKDFTS--NLAQLEIAHCQLSDSGQYK-ICFNPLEASKCGKVTGLFLVSIAPIK---KNLKPIDSNIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFN--NNLSFLLIDSVKLEDSGTYICQGFTNKELISECKITLNVVDNISDTLQCQVKFEKDKYSIE---INQDVTMRALIECTSTHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLN-------SVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCSNNGIFNSTKNKNCFNLTKLKAEITDSGVY 5032
            +L++ + E ++LE  +    + +     QW  + + VK     K  T+   L +LEI  CQ +DSG YK I  NP      G+   L  V++ P +   K LKPI S      GE + L   V GF   ++KW       K   +L+        N  N    L+ID+ +  D+G Y C    NK    E    + +V   S  +   V   +D  SIE   +  D+ +       +    + WF NG  ++  +  ++ ++N    + L I+       G+YE + +N +G S+ ++ +L V     +          S  +++   EG EL L          +  WSKD +  + N     T +     LT   AE  DSG Y
Sbjct: 2229 ALDVLQGEPLVLECCVDGSPLPTV----QWLKDGDEVKPSESIKISTNPDGLVKLEINSCQPNDSGAYKLIISNP-----HGEKVALCAVAVKPEEMQPKFLKPITSQTVVV-GEPLKLEAQVTGFPAPEVKW------YKDGMLLRPSPEINFINSPNGQIGLIIDAAQPLDAGVYKCL-IANKGGEIEGVSKVEIVPKESKPVF--VAELQDASSIEGFPVKMDIKV-----VGNPKPKLQWFHNGHEIKPDASHIAIVENPDNSSSLIIEKTAPGDSGLYEVIAQNPEG-STASKAKLYVAPKADETATEEAPQFVSALRDVNADEGQELVLSAPFISNPMPEVIWSKDGVTLTPNERLLMTCDGKHIGLTIKPAEAADSGNY 2589          

HSP 7 Score: 64.3142 bits (155), Expect = 3.428e-8
Identity = 201/958 (20.98%), Postives = 369/958 (38.52%), Query Frame = 2
Query: 3629 LNAKDIPIMTLKNGGWFLNSEPIHAVKFRGNEVIEENKVKIVIPNVTKEFSGLLQYRIVKPVELYSPEIIIKIRGSLIKQTPKIEEEKFESNLILELHNVSLNISENERILLEAKIISGNINSYKTPPQWFWNDEAVKNINCKKDFT---SNLAQLEIAHCQLSDSGQYKI-CFNPLEASKCGKVTGLFLVSIAPIKKNLKPIDSNIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNNNLSFLLIDSVKLEDSGTYICQGFTNKELISECKITLNVVDNISDTLQCQVK--------FEKDKYSIEINQDVTMRALIECTSTHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVT---KNIEITEGNELNLEVVSEIEK--DLQFQWSKDDIDCS-NNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGMVD-GKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMPF---------GDPCVLDNPFIDLYIESPQVNEHSGLYKCIVTNEKSETEFV-EITVKFKDEKVVSPILGELLSCTVEE-----------VNTIED---EKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLKI----------NESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPET----VKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEF--PNFTLIITEAEVEDSGRYCCLGTNFLG 6325
            L A + P+   K  G   + E    V F  +E    + + +V  +V  E +G+            S    + ++G++  QT   E EK    L++E    + +I  +  + L+ K        +  P   + +D  V  ++ +  F         L I +    D+G Y I   N L   +    + + LV  AP K  +K I ++I    GE++ + ++VEGF +  ++      D+  +  ++    +   +     + +  +KL  +G Y  +               N +   S+   C VK        FE +    E  ++V M   I+       ++W+ +   +++ +D    + ++G    LKI        G Y     N+ G S+T+ T+L      I C    T   KNI + EG+  N+E+V  ++       +W  D I+       F   +  N F L   +      G Y  + M D GKL +    TV   P          ++K   ++ E+   + K   + VEV +  +  I+W ++              D   ++N ++ L +      E +G Y+   TN   ET    ++ V   +   +   + + L  T EE           V+  +    E + L  E          A+W  D K +   D    I +    Y L ++ + + DAG Y + +           E S+  + + R KPI  Q   + K++K+ +  K  + +    +P      +K    V E+   K     + ++ DAEN   +Q++C     L I  A  K  G+Y ++V N  G + + G + ++ + EIS                L D + L  + I     +  +PKPK+ WT+  E L   C +   +++ +     + L+       + G+Y    TN  G
Sbjct: 1231 LPAGEKPVFQWKRNGEEFDPEERFKVLFGEDE----DSLALVFQHVKPEDAGIYTCVAQTSTGNISCSAELSVQGAI--QTLNREPEK--PTLVIEHREANASIGGSAILELQCK-------GFPKPAVQWKHDGEVIQVDDRHKFMYEDEESMSLVIKNVDTVDAGVYTIEAINELGQDE----SSINLVVKAPPK--IKKI-TDITCSAGETIKMEIEVEGFPQPTVQVTNNGKDVTAESNVKISSSSIGKSLEKVVVEVKEIKLSQAGNYSIKA-------------TNDLSQTSEYWSCTVKSKPVIVKNFESEYIHGE-KENVQMTVRIDAYP-EAKLTWYHDETEIKI-TDSKYTVSSDGNAYTLKITGATRVDAGKYTVKATNEHG-SATSSTQL-----LIKCAPEFTHKLKNITVAEGDS-NVELVVGVDAYPRPHAKWYIDGIEIDEKRNDFRHVEEGNDFKLIMNQVATNMQGNYTCKIMNDYGKLEDNCVVTVNCKP----------KVKRGLKNVEV--QEGKSFTLEVEVYSEPEAKIKWFKDGHEIYEDARIKISRDTQRIENYYLTLNLAR---TEDAGTYEMKATNFIGETTSTCKVAVLTSEALSLEQTVTKTLIATTEEPEEGAVPEIVHVDVFQQHSYESVPLKYEVIATGIPKPEAIWYHDGKPIT-PDKHTAITVDGDHYKLEVQSLDLVDAGEYKVVVQNKVGEKSHQGELSLSGIAEYR-KPILTQGPGL-KDIKVNKGDKVCEPVVFTADPAPEIVLLKDGQPVVETNNVK----LKVDKKDAENG-LVQYTC----TLNILEAEIKDSGRYELKVKNKYGELVTSGWIDVLAKPEIS---------------GLNDTKCLPGDTICFEALVQANPKPKVSWTRGNENL---CNHENCEVIADVDADKYRLVFQSVSPCEDGKYTITATNSEG 2098          

HSP 8 Score: 63.1586 bits (152), Expect = 8.258e-8
Identity = 122/575 (21.22%), Postives = 230/575 (40.00%), Query Frame = 2
Query: 4703 LKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCS-NNGIFNSTKNKNCFNLTKLKAEITDSGVYKFE-GMVDGKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDM---PFGDPCVLDNP--FIDLYIESPQVNEHSGLYKCIVTNEKSETEFV-EITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQP-FCYNLILRDVKMTDAGMYSLKIN--ESSVDILVK--VRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDN-YFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDS 6385
            L I++  E+  G Y C+  N+ G  + A  +L + ++    +  +   +++ +G  L LE   +       QW KD  +   +  I  ST       L     +  DSG YK       G+ + L    V+   +Q         LK I     ++    +PL +  +V  +    ++W ++ M   P  +   +++P   I L I++ Q  + +G+YKC++ N+  E E V ++ +  K+ K V   + EL     ++ ++IE   +++ +  +V         W  +   +      + I+  P    +LI+      D+G+Y +     E S     K  V PK     T+E       PQ    L+D+   +E + +        +   + IW    + +     E +  +CD  +  LTI  A     G YT  +AN +G             S      +      P+FT+K+ D + +   N ++   +   P P + W    + +     + +  I ++  +  LI+   E  D G Y C+ +N  G D T+  + + +   K S S
Sbjct: 2183 LDIKSFRENDVGAYTCVATNEIG-VTKAPFKLAMLSLAPSFVKKLDNALDVLQGEPLVLECCVDGSPLPTVQWLKDGDEVKPSESIKISTNPDGLVKLEINSCQPNDSGAYKLIISNPHGEKVALCAVAVKPEEMQPKF------LKPITSQTVVV---GEPLKLEAQVTGFPAPEVKWYKDGMLLRPSPEINFINSPNGQIGLIIDAAQPLD-AGVYKCLIANKGGEIEGVSKVEIVPKESKPV--FVAEL-----QDASSIEGFPVKMDI--KVVGNPKPKLQWFHNGHEIKPDASHIAIVENPDNSSSLIIEKTAPGDSGLYEVIAQNPEGSTASKAKLYVAPKADETATEEA------PQFVSALRDVNA-DEGQELVLSAPFISNPMPEVIW--SKDGVTLTPNERLLMTCDGKHIGLTIKPAEAADSGNYTCLLANPLG-----------EDSSACNANVRKVYKPPVFTQKISDQQQVFGNNAKIPVTVSGVPYPDLEWYFQDKPIPK---SEKYSIKNDGDHHMLIVNNCEKGDQGVYKCIASNREGKDITQGRLDIVNEIKKHSRS 2714          

HSP 9 Score: 57.7658 bits (138), Expect = 3.636e-6
Identity = 59/237 (24.89%), Postives = 104/237 (43.88%), Query Frame = 2
Query: 5711 RKQTKEIFKNLKIPQIKKPLQDIFIRNEP-ETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCD--NYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKD-GETLDSKCLNRRVKIL---DEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAV-IIVTDSEPKESDSSRII 6397
            R Q     +++  P + K L+ + +  EP ET  FE + ++       W  +N+ ++    + I  +    N + L I    E   G YTI+  +         +L++       E    +    P F   LKD E++     R   +++ DPKP++ + KD  E L++   N R++I+   D    + L+I + +  D+G Y C  TN  G    EA+   V D  P  + S +I+
Sbjct: 1004 RLQEDRPLRSVDKPVVVKMLKSVQV--EPGETAHFEIQFKDQPGL-VTWLKDNKPLEDRLADRITQTAAPMNSYRLDIKNCSETDAGTYTIRAQSASETTTVSAQLAVGQAPGHDETKTNT---EPAFLVSLKDAEMIENTLFRFMVKIIGDPKPRVKFYKDEKEILET---NDRIQIIRDKDYLGFYELVIADVQKTDAGTYSCKATNKHGEANCEAIATTVEDKNPFGALSGQIL 1231          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|Q15772|SPEG_HUMAN (Striated muscle preferentially expressed protein kinase OS=Homo sapiens OX=9606 GN=SPEG PE=1 SV=4)

HSP 1 Score: 134.035 bits (336), Expect = 3.190e-29
Identity = 133/603 (22.06%), Postives = 270/603 (44.78%), Query Frame = 2
Query: 8708 REITLSWSPPRISPDLYIPFTVDVECRPVNYSYS------DEEGWSVFKTNIKKNRVDIADLDPNINYQLRIVPVTDFGIGKPSMVIKKIRRSDNLNSPTTEKAMMLQEKHCLAVPMFCCLSQKAELKFTKLMEYKLDKITW-TFNNAKVDVNDERYKIFSAETYGIYFIIKNLEEDDFGEYCALDEVQDPIQ--SFILIKSDAPTILNCLPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIF-SSYRTVITEDKEQGTYSLLISKCILSDGGEYSIRAENAIGFAEVKFNLRVDAHPEKKSVQI-NIGD--------VNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFF--EINNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIM--TGKYNEILKLCGFSNA---VPKE----DFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQ-----------LYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWFIKPGNNLNAALDYI 10393
            R +TL+W+PPR         ++D+   P + +Y+        + W+   T +++       L   + +  R++  T     KPS   + ++  ++   PT E+A  + +K  +   ++    Q A +  T    +   ++ W +   A ++     Y++   +       I  +   D G        +   Q  S  L  ++AP   + + +  +   E    +V ++ +P P+++W ++   +  SS+ + + E+ E    SL++      DGG Y+  A+N  G    K  L V  H  + ++++  +G+        ++D Y   +++ +G++S  + ++E+S+ +EF  KF   +       R E + +  + H  ++   +A     + LV++ E L    L E I +    CES++R  + Q+++ + YLH+  V HLD+KPEN+++       + +++C F NA    P E     +G       T  F APE++   P+   +D+W +G++ FLCL G      E D+            + E +  ++S  A  F+ K +L++   R T+ ++L H WF         + D++
Sbjct: 1297 RMVTLTWNPPR---------SLDMAIDPDSLTYTVQHQVLGSDQWTALVTGLREPGWAATGLRKGVQHIFRVLSTTVKSSSKPSPPSEPVQLLEH--GPTLEEAPAMLDKPDI---VYVVEGQPASVTVT--FNHVEAQVVWRSCRGALLEARAGVYELSQPDDDQYCLRICRVSRRDMGALTCTARNRHGTQTCSVTLELAEAPRFESIMEDVEVGAGETARFAVVVEGKPLPDIMWYKDEVLLTESSHVSFVYEENE---CSLVVLSTGAQDGGVYTCTAQNLAGEVSCKAELAV--HSAQTAMEVEGVGEDEDHRGRRLSDFYDIHQEIGRGAFSYLRRIVERSSGLEFAAKFIPSQAKPKASARREARLLARLQHDCVLYFHEAFER-RRGLVIVTE-LCTEELLERIARKPTVCESEIRAYMRQVLEGIHYLHQSHVLHLDVKPENLLVWDGAAGEQQVRICDFGNAQELTPGEPQYCQYG-------TPEFVAPEIVNQSPVSGVTDIWPVGVVAFLCLTGISPFVGENDRTTLMNIRNYNVAFEETTFLSLSREARGFLIK-VLVQDRLRPTAEETLEHPWFKTQAKGAEVSTDHL 1868          

HSP 2 Score: 115.546 bits (288), Expect = 1.019e-23
Identity = 79/270 (29.26%), Postives = 124/270 (45.93%), Query Frame = 2
Query: 9599 INIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEINNMGIGR--SEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVPKEDFGSR--RHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGH---------------LKVNFEGDQLYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWF 10351
            +  G     Y  +++ A+G +   +   E +T   F+ K       G  R   E++ ++ + H  I+ + +A   P +YLVLI E      L   ++    + E  V   + QL+Q + YLH H V HLDIKP+N+++    +  LK+  F +A P      R   H   T  F APE++KGEPI   +D+W  G+LT++ L G                +   F+  QLY        S SA +F+RK L +    R +  D L+H W 
Sbjct: 2957 LRQGPPQKPYTFLEEKARGRFGVVRACRENATGRTFVAKIVPYAAEGKRRVLQEYEVLRTLHHERIMSLHEAYITP-RYLVLIAESCGNRELLCGLSDRFRYSEDDVATYMVQLLQGLDYLHGHHVLHLDIKPDNLLLA--PDNALKIVDFGSAQPYNPQALRPLGHRTGTLEFMAPEMVKGEPIGSATDIWGAGVLTYIMLSGRSPFYEPDPQETEARIVGGRFDAFQLYPN-----TSQSATLFLRKVLSVHPWSRPSLQDCLAHPWL 3218          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|Q696W0|SPEG_DANRE (Striated muscle preferentially expressed protein kinase OS=Danio rerio OX=7955 GN=speg PE=2 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 1.595e-27
Identity = 136/607 (22.41%), Postives = 259/607 (42.67%), Query Frame = 2
Query: 8708 REITLSWSPPRISPDLYIPFTVDVECRPVNYSYSDEEG------WSVFKTNIKKNRVDIADLDPNINYQLRIVPVTDFGIGKPSMVIKKIRRSDNLNSPTTEKAMMLQEKHCLAVPMFCCLSQKAELKFTKLMEYKLDKITWTFNNAKVDVNDERYKIFSAETYGIYFI-----------IKNLEEDDFGE--YCALDEVQDPIQSFILIKSDAPTILNCLPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIF-SSYRTVITEDKEQGTYSLLISKCILSDGGEYSIRAENAIGFAEVKFNLRVDAHPE----------KKSVQINIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEI--NNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAV---PKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQ-----------LYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWF--IKPGNNLNAAL 10384
            R I LSW  P+          +D    P +  Y  ++       W+   +++      +  L   + Y  R++  T   + KPS              PT    ++ + ++    P+      K ++ +   +E +   IT T N+ +     +R  +      G   +           I  ++  D G+  + A ++    + +  L+ +  P     + +  + + E    +V +D +P P+++W ++   +  SS+ T + +D+E    SL++      D G Y+  A+N  G    K  L V               + ++   +  + D Y   K++ +G++S  + V  K+ Q  F  KF  +          E   +  + H++IV   DA     + +V+I  +L    L E IT+ +   ES+V+ II QL++ + YLH++ + HLD+KPENI+M  +  + +++C F NA+   P E+   +   G+   F APE++   PI  ++D+W +G++T+LCL G      E D+            + E     +   A  FI K +L+    R  +++ L H WF  +  G ++N  L
Sbjct:  949 RMILLSWKKPK---------NLDPSIDPASLMYVVQQQVLGSTQWTTIASSLTDTSYTVTSLSKGVCYSFRVLSTTGKTLSKPSQ-------------PTDLVQLVDRGEYFRKAPVII---DKPDIVYA--VENQPVTITITINHVQATCTWKRRGVVLVNKLGALEMTTPDDDQHALHIAKVKSTDVGQLIFMANNQYGSDLGTLQLVIAVPPIFETIMEDLDVCVGETCHFAVVVDGKPDPDILWYKDGVLLAESSHLTFVYDDRE---CSLVVLNAQPEDVGVYTCTAKNLAGSVSCKAELTVHTAQNVEEEEEQMEDEATILRRMRMLTDYYDIHKEIGRGAFSYVKRVKHKNDQ-SFAAKFISVRAKKKTCALRELALLAELDHKSIVRFHDAFE--KRRVVIILTELCHEELLERITKRTTILESEVQSIIRQLLEGIEYLHQNDIIHLDLKPENILMADQKTDQIRICDFGNALKVKPNEELYCK--YGIPE-FIAPEIVNQSPISKSTDIWPVGVITYLCLTGVSPFAGENDRDTLLNIRNYNVAFEESMFKDLCREAKGFIIK-VLVSNKLRPDATECLLHPWFKSLTKGKSINTTL 1518          

HSP 2 Score: 92.8189 bits (229), Expect = 9.076e-17
Identity = 71/257 (27.63%), Postives = 124/257 (48.25%), Query Frame = 2
Query: 9626 YYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEINNMGIGR--SEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAV---PKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQLYNEDSNDA----------ISNSACVFIRKCLLLKTGERLTSSDSLSHEWF 10351
            Y  + + A+G +   +   E +T   FI K    +         E++ ++++    I+ + +A   P +YLVLI E   G  + + +     + E  V   I Q++Q + YLH  ++ HLDIKP+NI++T     ++K+  F +A    P       R++G T  + APE+LKG+ +   +D+WS+G+L+++ L G      +  QL     ++A          +S SA  F++K L      R T  D L+H W 
Sbjct: 2682 YSFLDEKARGRFGVIRDCRENATGKMFIAKIIPYDQQTKQTIIKEYEILKSLRCERIMALHEAYITP-RYLVLITEYCSGKEILQNLIDRFCYSEDDVVGFIVQILQGLEYLHNCKILHLDIKPDNIMVTNL--NVIKIIDFGSAQRFNPLSLQQCSRYLG-TLEYMAPEMLKGDLVGPPADIWSLGVLSYIMLSGRHPFEDKDPQLTEAKIHEAKFDSTKLYPKVSQSASTFLKKILNSYPWCRPTIKDCLNHSWL 2934          

HSP 3 Score: 79.7221 bits (195), Expect = 7.433e-13
Identity = 102/444 (22.97%), Postives = 177/444 (39.86%), Query Frame = 2
Query: 5756 IKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAE----NMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPK-ESDSSRIIVKP--------------------LCAPVLTAEYSKGADVILSWTSVATTDTLNIIYNIEKQKSLTSTNWKKIMKNLTETTYSLSSSCLPPQESHLLRCVAISEYGFETVSNIIEIPIRANSPILPPDKPTIIFK-DATCVKISWMRGKCKNLTPEESIGKIMYSLEMKDNPKSSWQIVSNDLVDNEYSL-SLEPGVSYMFRVIAFNDFGISEPSQ--SLISRIDR 7000
            I +P+QD+ ++   ET   E  +  S A    W    + I        M+F    C   F     +A E   G YT        C  S  +  L+     +  ++      PLFT+KL+ +E +   + + +C++   P P++ WT   + L     +  + IL+   + +L+IT    E  G Y  +  N  G   + A + V +  P   +  SR+   P                       P+   E  +G + +L              Y+    K + STN +K+ +     +  + S C     S + +CV  ++ G       + + +   S   PPD P +I       + +SW   K KNL P      +MY ++ +    + W  +++ L D  Y++ SL  GV Y FRV++     +S+PSQ   L+  +DR
Sbjct:  620 ITRPMQDVKVKAG-ETALLECFIAGSQAVDVDWLANGKLIQPALFDCKMQFDGHRCRLLFK----SAHENDSGCYT--------CKLSTAKEELI----CTANLLVIPSKEPLFTRKLEVLEAIEGRSAQFDCKVSGCPPPEVTWTHCEKPL---VESDNIHILNVNGHHSLLITHVNKESEGLYTAIAQNVHGKAASSAELYVQEPRPAISTHMSRLEKMPSIPEEPEVPEGEVERRTMPDFIKPLSDLEVIEGKEAVLKCRVTGLPYPKITWYH--NGKKIESTNDRKMTQYRDVHSLVIQSVCH--DHSGVYKCVISNKVGKAACYAHLYVAV---SLPEPPDGPPVIESVTGRMILLSWK--KPKNLDPSIDPASLMYVVQQQVLGSTQWTTIASSLTDTSYTVTSLSKGVCYSFRVLSTTGKTLSKPSQPTDLVQLVDR 1034          

HSP 4 Score: 69.3218 bits (168), Expect = 1.055e-9
Identity = 86/384 (22.40%), Postives = 154/384 (40.10%), Query Frame = 2
Query: 5534 WLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLKINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRN-------EPETVKFEFEVEESGAKKAIWFF-ENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLM-LRSEISEQM-----MESCC-------------IAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRIIVKPLCAPVLTAEYSKGADVILSWTSV----ATTDTLNIIYNIEKQKSLTSTNWKKIMKNLTETTYSLSS 6592
            WL + KL+        +        L+ +     D+G Y+ K++ +  +++                 NL +   K+PL   F R        E  + +F+ +V      +  W   E   ++++N+  +  + + + +L I    ++  G YT    N  G   S   L +   R  IS  M     M S                 P F K L D+E++  +   L CR+   P PKI W  +G+ ++S    +  +  D     +L+I     + SG Y C+ +N +G     A + V  S P+  D   +I           E   G  ++LSW        + D  +++Y ++ Q+ L ST W  I  +LT+T+Y+++S
Sbjct:  651 WLANGKLIQPALFDCKMQFDGHRCRLLFKSAHENDSGCYTCKLSTAKEELICTA--------------NLLVIPSKEPL---FTRKLEVLEAIEGRSAQFDCKVSGCPPPEVTWTHCEKPLVESDNIHIL--NVNGHHSLLITHVNKESEGLYTAIAQNVHGKAASSAELYVQEPRPAISTHMSRLEKMPSIPEEPEVPEGEVERRTMPDFIKPLSDLEVIEGKEAVLKCRVTGLPYPKITWYHNGKKIESTNDRKMTQYRDV---HSLVIQSVCHDHSGVYKCVISNKVGKAACYAHLYVAVSLPEPPDGPPVI-----------ESVTGRMILLSWKKPKNLDPSIDPASLMYVVQ-QQVLGSTQWTTIASSLTDTSYTVTS 1000          

HSP 5 Score: 64.3142 bits (155), Expect = 3.780e-8
Identity = 78/317 (24.61%), Postives = 130/317 (41.01%), Query Frame = 2
Query: 11417 SSDDIRMNVIREHYSTLSQKSSG-FAVLKLKNTNVNFPEYIV----------QRTFKMEDICPAFDLCVRIKYYHFPILFGEICDSSLGNRITFEEFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRYESDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNTNTLLLPVPHTHFRAPKLSMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWFKQDPQTIYEMEHQTISSTPLVDFVN 12334
            S   +R  V ++ YS L +K+ G F V++    N     +I           Q   K  +I  +   C RI   H   +            +   E+  G  +L  L+ R  YSE  VV  I Q+L  +++LH+  ++H +I+P  I++   TN +  IK+I   + Q    +  Q+         + APE     +    +DIWSLG+LS+++L+ + P  ED           K+       +    F + KL    + S+S+  F+   L   P  R      L HSW           +  T ++T L +F+ 
Sbjct: 2669 SETTLRQGVPQKPYSFLDEKARGRFGVIRDCRENATGKMFIAKIIPYDQQTKQTIIKEYEILKSLR-CERIMALHEAYITPRYL-------VLITEYCSGKEILQNLIDRFCYSEDDVVGFIVQILQGLEYLHNCKILHLDIKPDNIMV---TNLNV-IKIIDFGSAQRFNPLSLQQCSRYLGTLEYMAPEMLKGDLVGPPADIWSLGVLSYIMLSGRHP-FED-----------KDPQLTEAKIHEAKFDSTKL--YPKVSQSASTFLKKILNSYPWCRPTIKDCLNHSWLHDSYLKKLRRQTLTFTTTRLKEFMG 2959          

HSP 6 Score: 62.7734 bits (151), Expect = 1.008e-7
Identity = 58/219 (26.48%), Postives = 93/219 (42.47%), Query Frame = 2
Query: 11615 ILFGEICDSSLGNRITFEEFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVK---EQESLTTHKPSIFKAPEYRYESITRYESDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNTNTLLLPVPHTHFRAPKLSMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWFK 12262
            I+  E+C   L  RIT                R+   E  V +IIRQLL  I++LH N+++H +++P  IL++       D K   +  C F   +K    +E    +    F APE   +S     +DIW +G++++L L    P   +  +D D    ++N N              + SM     + ++ F+   L  S   R +A   L H WFK
Sbjct: 1324 IILTELCHEELLERIT---------------KRTTILESEVQSIIRQLLEGIEYLHQNDIIHLDLKPENILMA-------DQKTDQIRICDFGNALKVKPNEELYCKYGIPEFIAPEIVNQSPISKSTDIWPVGVITYLCLTGVSPFAGE--NDRDTLLNIRNYNVAF-----------EESMFKDLCREAKGFIIKVL-VSNKLRPDATECLLHPWFK 1506          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|Q9UIK4|DAPK2_HUMAN (Death-associated protein kinase 2 OS=Homo sapiens OX=9606 GN=DAPK2 PE=1 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 9.931e-27
Identity = 85/281 (30.25%), Postives = 138/281 (49.11%), Query Frame = 2
Query: 9614 VNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFE-----INNMGIGRSEFQ----CIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEI--LKLCGFSNAVPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQL-------------YNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWFIKPGNNLNAAL 10384
            V D Y   ++L  G ++  +   EKST +E+  KF +      +  G+ R E +     ++ + H N++ + D        +VLI E + G  L +++ Q     E +    I Q++  V+YLH  ++ H D+KPENI++  K   I  +KL  F  A   ED    +++  T  F APE++  EP+   +DMWSIG++T++ L G     F GD               ++E+     S  A  FIRK L+ +T +RLT  ++L H W I P +N  A +
Sbjct:   19 VEDFYDIGEELGSGQFAIVKKCREKSTGLEYAAKFIKKRQSRASRRGVSREEIEREVSILRQVLHHNVITLHDVYENRTD-VVLILELVSGGELFDFLAQKESLSEEEATSFIKQILDGVNYLHTKKIAHFDLKPENIMLLDKNIPIPHIKLIDFGLAHEIEDGVEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSG--ASPFLGDTKQETLANITAVSYDFDEEFFSQTSELAKDFIRKLLVKETRKRLTIQEALRHPW-ITPVDNQQAMV 295          

HSP 2 Score: 63.5438 bits (153), Expect = 2.023e-8
Identity = 39/139 (28.06%), Postives = 67/139 (48.20%), Query Frame = 2
Query: 11669 EFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRY-----ESDIWSLGILSFLLLATQLPAIEDACSDS 12070
            E V GG L   L  +   SE    + I+Q+L  + +LH+  + H +++P  I++  +      IKLI        G   E E     K +IF  PE+    I  Y     E+D+WS+G+++++LL+   P + D   ++
Sbjct:  104 ELVSGGELFDFLAQKESLSEEEATSFIKQILDGVNYLHTKKIAHFDLKPENIMLLDKNIPIPHIKLIDF------GLAHEIEDGVEFK-NIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQET 235          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: G7Y5N7 (Striated muscle preferentially expressed protein kinase OS=Clonorchis sinensis OX=79923 GN=CLF_101401 PE=4 SV=1)

HSP 1 Score: 580.096 bits (1494), Expect = 7.598e-162
Identity = 518/2018 (25.67%), Postives = 889/2018 (44.05%), Query Frame = 2
Query: 5390 KFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSID----SAVWLKDEKLLNETDPRLTIIMQP--FCYNLILRDVKMTDAGMYSLKINESSVDILVKVRPK--PIRKQTKE-IFKNLKIPQIKKPLQDIFI----RNEPETVK---FEFEV-------EESGAKKAIWFFENEEI-DAE------------NMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLM-LRSEISE-QMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEP-----------------KESDSSRIIVKPLCAPVLTAEYSKGADVILSWTSVATTDTLNIIYNIEKQKSLTSTNWKKIMKNLTETTYSLSSSCLPPQESHLLRCVAISEYGFETVSNI-IEIPIRANSPILPPDKPTIIFKDATCVKISWMRGKCKNL----------TPEESIGKIMYSLEMKDNPKSSWQIVSNDLVDNEYSLSLEPGVSYMFRVIAFNDFGISEPSQSLISRIDRLKLVPDFSVDPPWLHL-----------KGQP---CLKWRAATVPEFCDSCVSGILPDYKVEYRNGRLSPWKIYQENIMQNE------TYLTQKIIDDAQ----------------EFRVSCRNKFGQNGPTRSYRLQANIVGKTSFRSPSVEKVKTIIKYDQLKQAEIESI---------------------------SKDGLSLKWSQWV------------PDQINKYIIQR-----------KNSFSQDWEQIH---STIFGENCFVEMILSENFSRQLRILSLDDNKT--ELHDGYNILYIPSKDECIPTIPENLQV-----NDLT------------NYHEIFWSESKSIEIVDS------PITYSLQSKVNNQF-----WFTITEKLDKCFYTNTRIDKYGVTG-YRV--LARNSIGSSPFSMEVFTKSLINILSNEQIIKSLRYFVINPREIEIKWHLCESIFD------------------SGIT--TEDLSFQIEKKTVKEGSDWVP----ISNIVERNSILISITFEDENLF-RIQPFYRDEKLSASRIFRMYVSKDLLVPDMSFTRPNLVIDSVTSCAIEWPEPELQSGFSPDGIEICVPSVLLVDLQYEIQFVVVDPIVGSKIRGKDVKNLQWKPLQEDLEENTFNWENPDPTQEYLFRIVAKNQFGSGLPSQIVKLHPQIIIPDFSFIRLTIDDT--VIPGSNGEREITLSWSPPRISP--DLYIPFTVDVECRPV--------------NYSYS-------DEEGWSVFKTNIKKNRVDIADLDPNINYQLRIVPVTDFGIGKPSMVIKKI-----RRSDNLNSP--TTEKAMMLQEKHC--LAVPMFCCLSQKAELKFTKLMEYKLD---KITWTFNNAKVDVND-------ERYKIFSAETYGIYFI-IKNLEEDDFGEYC--ALDEVQDPIQSFILIKSDAPTILNC-LPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIFSSYRTVI----TEDKEQG-----TYSLLISKCILSDGGEYSIRAENAIGFAEVKFNLRVDAHPEKKSVQINIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEINN-MG--IGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIM----------------------------------TGKY-----NEILKLCGFSNAVPKEDFGSRRHMGLTSP------FSAPELL---------KGEP---IQFNSDMWSIGILTFLCLHG-------H---------LKVNFEGDQLYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWFIKPGNNLNAALDYIIDQI 10405
            + KD    SP   E L CT       E   +EL   +R PT  +D       WL D K ++     + +   P     +L++  ++   AG YS++ ++++   +    P   P+   +K  +F+ L I  +K+P     +    R +P   +   FE E+       E   AK       N EI D E              ++  W  DN  ALTIP       G Y ++V  +     +   L +   R++IS  ++  +  + PLFTK+L+D E+   + +R   R+M +P   I+W  +G  +     + R+K+ ++  N +L I  A  ED GRYCC+ TN LG   TE V+ V D++                  KE   S+    P  AP +       +++ L W  + + + +  I  + K        WK I+  L ET  S++     P E   LR V  +E+G    S   + IP RA  P +P  KP I F++A  V I W +     +          +P   +G++ Y++E+++  +S W+ V+ +L +  Y+  L PG S   RV+A N FG S P+   ++ +D   L P+   +PPW+ L           + QP    + W+ A +PEFC SCV G+ P Y++E+R GR   W+   +++   E      T L   + DDA+                E R+ C NK+G++GPT+  RL A+ +    FR   + K  TI+  D ++ ++I  +                           + +G+ L W ++             P+  N+Y I++            N+   DW+      + I+GE+ F+     +   +  R+L+L++ +T     DGYN + IP   E +P+ P +L V     ND T            N H +      S E+V++      P+    + +  +       W  + E          R  + G+   YR+  + R   GSS  S  + T  L + L  E  I+ +RY ++ P EI+++W L ++  D                  SG    +E +SF +E +    G DW P    I   +   ++L    + + ++  RI      ++   SR  R+ V  D + PD +F +P + +++V    I W EP++Q  +S   + +  P  L   + Y +Q              +     QW+ +   L+E  + W  P+P Q Y  R++  NQFG+G+PS+ V++ PQ++IPD SFIR +I+    ++ GS       L W  PR         P T +V+ R V              ++S S       DE  W V +TN+K+ R+ +  LDP   + LRIV VTD+G G PS  ++K+     +R   +++   T  +A  +           ++  +  + EL+ + L   + D   + +W+ N   +++ +        RY+ + ++T  +  + + N+ E DFG Y   A++      + FI+ K+DAP  L   +P  ++ LH +F +   +DA P   + W R+ K++  S+RT I    +  KE         SL + +CI  D G Y++ AEN  G  +    +RV+  P  KS  +   D+   YY +++L KG  S  +++I+K T  E++GK + +++ +G   G  EF+C+  + H N+V++ DAI + D  LVL+ E+L G +L + +   ++W ES    ++ Q+++AV +LH   + HLD++PEN++                                   T ++     + ++KL GFS+A P  +  +   +    P      +SAPE+L           EP   +   +DMWS+G+LT++ L G       H         L  NF  D        D+IS++A  F+R  L +  G R T+++ L H W     N+    ++Y ++++
Sbjct: 1842 RSKDVPATSPFEFEKLRCTDLSAPITEGSNLELV--ARFPTFGLDYDENDFQWLVDGKAVSSEGSLVRVDTDPNQGHVSLVIPTIQPEHAGTYSIRFSDNAQKRIQDNAPANSPMGDLSKALVFQPLAI--LKRPQTSQAMSYSERWQPSNYRPSAFERELPPSTSIKEGEHAKLEARLGRNHEIFDHEWLVNGKPILPEFTSDYTIWRADNLLALTIPRMRRDLAGIYELRVFGEQDIYTTSTDLIVEPSRAKISSYKLTPADGLKPLFTKRLQDYEVDVGDCVRFTARVMAEPPAVIVWKHNGNIVTG---DHRIKLFNDDANPSLTIRHARPEDRGRYCCIATNALGRVDTEGVLQVHDTDRYVPLGDEFDAGGSLAGRKEIGGSKRTALPRTAPEVALVSMSVSNIDLRWKPIQSDEGITYIVELSKDGG---KWWKPIITGLRETHASIAEELASPLEPVQLRVVGENEFGTGPASTPPVRIPARACIPTMPQVKPDIEFEEAASVLIKWPKATASIMEHTLLTEHVISPSAMLGQVWYAVEVREGAQSEWRRVATNLKNQFYTYHLRPGASTAIRVVAANRFGESTPTPIGLAHLDPNTLAPNLDFNPPWVSLSRPVSDDGSTYEMQPLAVTVYWKPAYMPEFCSSCVRGLEPMYRLEWRRGRSGMWQALADDLTDPEAGFRLPTDLVLALQDDAKRMKDSRSLVALNSQAIELRLFCWNKYGESGPTKPCRLVASQL----FRG-QLYKNSTIVDKDSMQLSQITDVLQELDQLPVMSANDRCSRLLTRISSLSTTEGIGLSWEKFTLTGLPKTSGDQPPEPHNRYRIEKYIAKPSSTLDSPNTNQADWKVASLDAAVIYGED-FILDTRPDKEEQIYRLLALNETETCSMWVDGYNRIRIPPLSELVPSAPTDLTVQCVPVNDSTISAENHITWKPANQHPLLVELPPSSELVEARELATPPLDLRYRIEARSTLSELSPWRQVAEVYGGATSAVDRKAEPGLALIYRITPINRFGEGSSVTSPPIRTPILYSAL--EGCIEDVRYVILGPTEIQLRWRLGDAAIDALKHDQPTTWGRKRSLCRSGSVDYSERVSFMVEVRGGYAG-DWSPAVEQIQGDLNAKALLQDCHYLEHDISCRIVALIDGQRSVPSRPIRLNVRADAMTPDYTFVKPKVHVETVEEYVISWDEPDVQEIYSSHTLGLTTPQTLQRGMNYAVQV-------------QRESKPQWETIATQLKEPHYTWAQPNPLQAYHVRVLPANQFGTGIPSRSVRVEPQVVIPDLSFIRPSIEAPADILAGSTAPE---LVWQLPRTYSLEKTLTPVTYEVQVRGVANASRLALGPVPHADHSTSRQSAADDDETVWRVLETNVKRTRLPLGRLDPEQEFWLRIVAVTDYGRGAPSQSVRKLVDLAAKRQQRMSASIVTIHEATPVSPTFVDPKGTVLYAPVGGRLELR-SNLQTTQPDADIRFSWSLNGRPIEIPESVQQNRLSRYQSYVSKTCDVAVLQVHNVTESDFGVYVCKAVNIRGSTTKEFIVKKADAPVFLEVPVPVMTVKLHCSFELPCWVDAVPTATLYWTRDSKRVVESHRTKIGSRLSRTKEDAQCFTINASLSVDRCIYQDAGLYTLVAENIAGRVQTSCLIRVEESPIPKSPTLRWTDIGLHYYVLRRLEKGDVSELRLLIDKQTNQEYVGKLYFLDDPVGRVAGAREFECLSRLCHSNVVQLHDAI-VSDNVLVLVMERLTGPNLLKAMLHCNNWSESATASVVRQVLEAVQHLHSEGIVHLDLQPENLLFARNVTAETWDGQTSYTDLFKALSPLVSDTMGLRETDRHKMSVLSSLIKLVGFSSAEPLVNKSNAGPVYCYPPQRFRPEYSAPEVLIAASQSASTDAEPPNLVGPAADMWSVGVLTYVLLTGWCPFFDVHANEPLREQILSANFSMDL----SEFDSISDNAKQFVRDLLQINPGSRPTAAECLQHPWLSTLKNSGGQDVEYRLERL 3818          

HSP 2 Score: 103.219 bits (256), Expect = 1.747e-17
Identity = 72/242 (29.75%), Postives = 120/242 (49.59%), Query Frame = 2
Query: 11618 LFGEICDSSLGNRITFEEFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSN--NVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRYESDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNTNTLLLPVPHTHFRAPKL------SMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWFKQDPQTIYEMEHQTISSTPL 12319
            L  +    S+G  +++  ++PGG L  VL++R+ Y+EF+++   +QLL  +++L+S      HG I P  IL +RR++   DI L G     F G+++E       +P  F APE          SD+WS+G L++LL+    P  +   +++      + T     P    H   P +        LH FSK ++KFV+N L+  P  RG+ D+WL   WF    + +     Q ++ TP+
Sbjct: 4402 LTNDAVKPSIGVSVSY--WIPGGQLFDVLVSRTEYTEFSIMRWTQQLLMALRWLYSKLFGRPHGAIIPRHILAARRSSTLPDIVLTG-----FGGSIEE----INGRPE-FTAPEVSQGEPISVFSDLWSIGALNYLLMTGNCP--DAKLAETSYKVLTETTADEEKPKLTGHQGDPHIPHYIDFKKLHMFSKPAKKFVYNCLQLVPKKRGHIDFWLESRWFDISTENV-----QRLTRTPI 4624          

HSP 3 Score: 93.5893 bits (231), Expect = 1.418e-14
Identity = 73/253 (28.85%), Postives = 112/253 (44.27%), Query Frame = 2
Query: 10721 FTVPLKDQTFKSDSTAGKITVTLTCQLSLLGSEPISI----------------------------SWYKNQELLTDDSRIKLEVIKGGFLSCTI--LNATETDVGIFRCIARCHSLRTETSARLVLGDVPPQPEQLSVYYTNQEEVLLKWSPYLSAID---DVIYRIDIRTIDSRNKIRNWKTIGYSVDNRYLLENLDRTQQYIARIIAQNKYGYSPYSIATSVFQNKIRNIHSLKQALIFN-RKWMLTSRQS 11377
            F  PL+D  F   S   +     +CQL+     P  I                            +WY    LL+D   ++L    GG+L   +  LN  ++   + +C+ R  + + +T ARL++ D P  P +  +   +  E L+ W+P  S +D   D+IYR+D +   + N    W T+G++VD R+L  NL     Y  R+ A N  G+  YSIA+S F         +   L  N R+WMLT RQS
Sbjct: 3998 FASPLRDAYFNIHSGEAR----FSCQLAGFAHLPPGIHGHREAIAELYPTDVVNAQTGHSSATVAAWYLGGCLLSDGPGVQLGTGPGGWLWLYLSELNVDQSGT-VVKCVVRNRAGKAKTQARLLIADPPKPPGRPGMAEVHPTEALITWAP--SDVDVGGDLIYRVDAK-FAANNGPAAWHTLGFTVDCRFLAMNLQPGLCYRMRVSAGNSCGWGNYSIASSEFYTPTDRSSEVISLLNKNDREWMLTWRQS 4242          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: A0A5J4NRQ3 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0005864 PE=4 SV=1)

HSP 1 Score: 572.778 bits (1475), Expect = 1.140e-159
Identity = 487/1863 (26.14%), Postives = 810/1863 (43.48%), Query Frame = 2
Query: 5606 NLILRDVKMTDAGMYSLKINESS---------VDILVKVRPKPIRKQTKEIFKNLKIPQIK---KPLQDIFIRN----EPETVKFEFE----------------VEESGAKKAI-----WFFENEEIDAE-NMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSL---MLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVT-------------DSEPK--------ESDSSRIIVKPLCAPVLTAEYSKGADVILSWTSVATTDTLNIIYNIEKQKSLTSTNWKKIMKNLTETTYSLSSSCLPPQESHLLRCVAISEYGFETVSNIIEIPIRANSPILPPDKPTIIFKDATCVKISWMRGKCK------------NLTPEESIGKIMYSLEMKDNPKSSWQIVSNDLVDNEYSLSLEPGVSYMFRVIAFNDFGISEPSQSLISRIDRLKLVPDFSVDPPWLHLKGQP---CLK-----------WRAATVPEFCDSCVSGILPDYKVEYRNGRLSPWKIYQENIMQNETY------LTQKIIDDAQ----------------EFRVSCRNKFGQNGPTRSYRLQANIVGKTSFRSPSVEK-----------------------VKTIIKYDQLKQAEIESISK-DGLSLKWSQW-----------VPDQIN-KYIIQRK---NSFSQD--------WEQIHST---IFGENCFVEMILS-ENFSRQLRILSLDDNKTELHDGYNILYIPSKDECIPTIPENLQVNDL-----------------TNYHEIFWSESKSIEIVDSPITYSLQSK-VNNQF--WFTITEKLDKCFYTNTRIDKYGVTG----YRVLARNSIGSSP--FSMEVFTKSLINILSNEQIIKSLRYFVINPREIEIKWHLCESIFD----------------SGITTEDLS----FQIEKKTVKEGSDWVPISNIVERNSILISITFEDENLF------RIQPFYRDEKLSASRIFRMYVSKDLLVPDMSFTRPNLVIDSVTSCAIEWPEPELQSGFSPDGIEICVPSVLLVDLQYEIQFVVVDPIVGSKIRGKDVKNLQWKPLQEDLEENTFNWENPDPTQEYLFRIVAKNQFGSGLPSQIVKLHPQIIIPDFSFIRLTIDDTV-IPGSNGEREITLSWSPPRISP--DLYIPFTVDVECRPVNYSY-------------SDEEG---------WSVFKTNIKKNRVDIADLDPNINYQLRIVPVTDFGIGKPSMVIKKIRRSDNLNSPT--TEKAMMLQEKHCLAVPMFCCLSQKAELKFTKLMEYKLD-KITWTFNNAKVDVNDERY--KIFSAETY----GIYFIIK--NLEEDDFGEYC--ALDEVQDPIQSFILIKSDAPTILNC-LPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIFSSYRTVI-------TEDKEQGT------YSLLISKCILSDGGEYSIRAENAIGFAEVKFNLRVDAHPEKKSVQINIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEINN---MGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENI-------------------------------IMTGKYNE--------ILKLCGFSNA------VPKEDFGSRRH---MGLTSPFSAPELL----------------KGEPIQFNSDMWSIGILTFLCLHG 10198
            +L L++V+   +G YSL   E +         +D L  + P+ +      + K L  P++    KP  D  + +    EP    + FE                +E + AKK       W F  + I  E   ++  W  +N   LTIP A  +  G Y ++V  D G   +  +L +    LRS  + ++  +  + P+FTK+L D  +   + +RL  R+M +P   I+W  +G  +     + RVK+ ++  N +L I +    D GRY C+ TN LG  TTE+++ V              DSE +        E + S     P  AP L  +     +V LSW  +   D   I Y +E  +      W+ I+  + +T  ++SS    P +S L R +A +++G    S  I IP RA  P +P  KP + F++A  V I W +                 + P    G + Y++E+++  +S W+ V+ DL    Y   L PGVS   RV+A N FG S P+   +  +D   L P    DPPW+ +  Q    C K           W+ A +PE+C +CVSG+ P Y++E+R GR   W+   +++   E        L   ++DD +                E RV C NKFG++GPT+  RL A+ + +      S++                        V T  +Y +L+   I SIS  DG+ L W ++           +P + + +Y I+++   +  +Q+        W+  ++    I+GENC +++    E    +L  LS  D+ +   D YN + IP   E  P+ P  L +  +                 +  H +F       + +   I Y ++++ V +    W  + E      Y    +DK    G    YR+   N  G  P   S  + T  L + L  E  ++ LRY ++ P  ++++W L +S  D                SG ++ DL+    F +E ++   G DW P+   ++   +   +  +D +        R+  F   ++ + SR  ++ +  D L PD S  +P++VI SV      W EP +Q  +S   + +  P VL  D +Y +Q              +   N  W+ L E+LEE  ++W  P+P   Y FR++  NQFGSG+PS+ V++ PQ++IPD SF+R TI+  V I  +    E  L W  PR         PFT +V+ R V +S              S+  G         W V +TN+K+ R+ ++ LDP   + LR+V VTD+G G PS  ++K+     + SPT    K  ++       + + CCL         + M Y  + + +W  N   +++N+  Y  ++    +Y      Y +++  +L + DFG Y   A++      + F++ K+DAP  L   +P  ++ LH  F +   +DA PP  + W R+ K++  S+RT I       +E KE          SL + +CI  D G Y++ AEN  G  +    +R++  P   +V I   D+   YY ++ L KG  S  +++I+K    E++ K F +++      G  EF+C+  + H N+V++ DA+ + D  L+LI E+L G  + E +   S W E   + +I Q+ QA+ +LH HRV H +I+P ++                               + TG  +          +KL GFS A       P  ++    H     +   FSAPELL                    +   +D+WS+G+LT++ L G
Sbjct: 1565 SLSLKEVRPDQSGTYSLGFTEDAASAIAQSAALDTLTSLPPRDV------LLKKLAFPKLTIKPKPEHDGLVGSGPQYEPTRAAYAFERDLPSTVSIKEGERVNLEATVAKKCKILMHEWLFNGKPIIPEFTPDYTVWRTNNSLMLTIPRARPELNGTYELRVYEDTGVYCTKTQLDVEQTRLRSS-NYKLTPADGLKPIFTKRLHDHTMDVGDCLRLAVRVMAEPPAVIVWKHNGAVVTG---DHRVKLFNDDANASLTIRQVRPSDRGRYSCIATNALGRVTTESILQVNGVEQFAALGDEDDDSEDQVRRSADGTERNRSAYTALPRTAPELRLDSVDTMNVALSWKPLMQPD---ITYIVELSRD-GGKWWRPILNGVADTFVNISSVLASPLDSLLFRVLAENKFGIGPASQSIRIPARACIPTMPAIKPKVEFEEAAAVLIRWPKATTGLSTEPCMVVDDYTINPAAKFGHVWYAVEVREGAQSEWRRVAADLTGLSYLYHLRPGVSSAIRVVAINQFGESNPTPITLVHLDPSTLAPAMDFDPPWVAVTHQAYDGCPKPGQQKTGITVYWKPAHMPEYCTACVSGLEPMYRIEWRRGRTGMWQALADDVTDPEAGFRLPNNLVMAVLDDVKRTSDSQNTIAINNQTVELRVFCWNKFGESGPTKPCRLVASQLFRGQTYKNSIKNMDKHQDSILRMEDCFNEWDQFPVVTTDDRYLRLR-TYINSISPVDGIELSWEKFTQTCLPNGAEEIPIETHGRYRIEQRLPVDRSTQERIGRSRYRWKVCNTDTALIYGENCVLDVRPGKEEQVYRLLALSETDSCSVWVDAYNTIRIPPLTELCPSAPMELTIRTVPVTGCTVSAENHLSWRSSTSHPVFSQGHDKQDTMSPIIRYRVEARSVQSDLAPWRQVCETFADDTYA---VDKKAEAGLQLIYRITPVNEFGEGPALISSPIRTPPLYSSL--EGCVEDLRYTILGPSGLQLRWRLGDSAIDILEFERSASNHTGPKRSGSSSLDLADRVNFTVEVRSGYAG-DWSPLVEQIQ-GDLAAKVKLDDVHYMKNDLSCRVVAFIDGQRSAPSRPVQLNIKADSLTPDFSLVKPHVVISSVDEYLFSWDEPHVQETYSAHILALTTPQVLQKDTRYAVQI-------------QREGNSTWETLAENLEEPHWSWSQPNPLWSYHFRVLPSNQFGSGVPSRAVRIEPQVVIPDLSFMRPTIESPVDILAATTAPE--LVWQLPRAYSLEKTLTPFTYEVQVRGVGHSRSALASVPDRGRSTSNSRGTTTEEEETMWRVLETNVKRTRLTLSRLDPEKEFWLRVVAVTDYGRGAPSQPVRKLVDLAAI-SPTFIEPKGQVIYAPIGGHLELKCCL---------QPMRYDPEIRFSWFLNEKPININESHYPHRMSRHHSYVSKNSDYAVLQVDHLTDTDFGIYVCKAVNIRGTATKEFVVKKADAPVFLEVPVPLLTVRLHTGFELPCWVDAVPPASLYWTRDSKRVVESHRTKIGCTVMSQSESKESTVSQMTTNASLSVDRCIYQDAGLYTLVAENIAGRVQTSCLVRIEDAPTPNTVSIRWADIGKHYYVLRCLKKGPISELRLLIDKRNNQEYMAKLFPLDDPVSRVCGAREFECLSRVCHSNVVQLVDAV-VSDNVLILIMERLTGPDILESMLYCSSWSEGAAKAVIRQVTQAIEHLHSHRVVHFNIQPNSLRFVQHLTPDSWDTQTAYTDLFRTLSPLVSDTMGTGLTDRHKMSVLSSSIKLLGFSVAEPLVTDQPATNWLQSDHPPPQRIQPEFSAPELLFVQSTATDGSRTKTEASAAEVGTPADIWSLGVLTYVLLAG 3379          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: A0A4S2LRW1 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005285 PE=4 SV=1)

HSP 1 Score: 569.311 bits (1466), Expect = 1.876e-158
Identity = 513/2019 (25.41%), Postives = 883/2019 (43.73%), Query Frame = 2
Query: 5390 KFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSID----SAVWLKDEKLLNETDP--RLTIIMQPFCYNLILRDVKMTDAGMYSLKINESSVDILVKVRPK--PIRKQTKE-IFKNLKI------------PQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEI-DAE------------NMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLM-LRSEISEQMMESC-CIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEP-----------------KESDSSRIIVKPLCAPVLTAEYSKGADVILSWTSVATTDTLNIIYNIEKQKSLTSTNWKKIMKNLTETTYSLSSSCLPPQESHLLRCVAISEYGFETVSNI-IEIPIRANSPILPPDKPTIIFKDATCVKISWMRGKCKNL----------TPEESIGKIMYSLEMKDNPKSSWQIVSNDLVDNEYSLSLEPGVSYMFRVIAFNDFGISEPSQSLISRIDRLKLVPDFSVDPPWLHLKG-----------QP---CLKWRAATVPEFCDSCVSGILPDYKVEYRNGRLSPWKIYQENIMQNE------TYLTQKIIDDAQ----------------EFRVSCRNKFGQNGPTRSYRLQANIVGKTSFRSPSVEKVKTIIKYDQLKQAEIESI---------------------------SKDGLSLKWSQWV------------PDQINKYIIQR-----------KNSFSQDWEQIH---STIFGENCFVEMILSENFSRQLRILSLDDNKT--ELHDGYNILYIPSKDECIPTIPENLQ-----VNDLT------------NYHEIFWSESKSIEIVDS------PITYSLQSKVNNQF-----WFTITEKLDKCFYTNTRIDKYGVTG----YRV--LARNSIGSSPFSMEVFTKSLINILSNEQIIKSLRYFVINPREIEIKWHLCESIFD------------------SGIT--TEDLSFQIEKKTVKEGSDWVP----ISNIVERNSILISITFEDENLF-RIQPFYRDEKLSASRIFRMYVSKDLLVPDMSFTRPNLVIDSVTSCAIEWPEPELQSGFSPDGIEICVPSVLLVDLQYEIQFVVVDPIVGSKIRGKDVKNLQWKPLQEDLEENTFNWENPDPTQEYLFRIVAKNQFGSGLPSQIVKLHPQIIIPDFSFIRLTID--DTVIPGSNGEREITLSWSPPRISP--DLYIPFTVDVECR-----------PVNYSY----------SDEEGWSVFKTNIKKNRVDIADLDPNINYQLRIVPVTDFGIGKPSMVIKKI-----RRSDNLNSPTTEKAMMLQEKHCLAVP----MFCCLSQKAELKFTKLMEYKLD---KITWTFNNAKVDVND-------ERYKIFSAETYGIYFI-IKNLEEDDFGEYC--ALDEVQDPIQSFILIKSDAPTILNC-LPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIFSSYRTVI----TEDKEQG-----TYSLLISKCILSDGGEYSIRAENAIGFAEVKFNLRVDAHPEKKSVQINIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEINN-MG--IGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIM----------------------------------TGKY-----NEILKLCGFSNAVPKEDFGSRRHMGLTSP------FSAPELL---------KGEP---IQFNSDMWSIGILTFLCLHG-------H---------LKVNFEGDQLYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWFIKPGNNLNAALDYIIDQI 10405
            + +D    SP   E L CT  +++T   E   L + +R PT  +D       WL D   ++      R+         +L++ +++   AG YS++ ++++   +    P   P+   +K  +F  L I            P   +P    F R  P +   +   E   AK       N EI D E              ++  W  DN  ALTIP       G Y ++V  +     +   L +   R++IS   + S   + PLFTK+L+D E+   + +R   R+M +P   I+W  +G  +     + R+K+ ++  N +L I  A  ED GRYCC+ TN LG   TE V+ V D++                  KE   S+    P  AP +       +++ L W  + + + +  I  + K        WK I+  L ET  S+S     P E   +R V  +E+G    S   + IP RA  P +P  KP I F++A  V I W +     +          +P   +G++ Y++E+++  +S W+ V+ +L +  Y+  L PG S   RV+A N FG S P+   ++ +D   L P+   +PPW+ L             QP    + W+ A +PEFC SCV G+ P Y++E+R GR   W+   +++   E      T L   + DDA+                E R+ C NK+G++GPT+  RL A+ +    FR   + K  T++  D ++ ++I  +                           + +G+ L W ++             P+   +Y I++            N+   DW+      + I+GE+ F+     +   +  R+L+L++ +T     DGYN + IPS  E +P+ P +L      VND T            N H +    S S E+V++      P+    + +  +       W  + E       T + +D+    G    YR+  + R   GSS  S  + T  L + L  E  I+ +R  ++ P EI+++W L ++  D                  SG    +E +SF +E +    G DW P    I   +   ++L    + + ++  R+      ++ + SR  R+ V  D + PD +F +P + +++V    I W EP++Q  +S   + +  P  L   + Y +Q              +     QW+ +   L+E  + W  P+P Q Y  R++  NQFG+G+PS+ V++ PQ++IPD SFIR +I+    ++ GS       L W  PR         P T +V+ R           PV ++            DE  W V +TN+K+ R+ +  LDP   + LRIV VTD+G G PS  ++K+     +R   +++               A P    ++  +  + EL+ + L   + D   + +W+ N+  +++ +        RY+ + ++T  +  + + NL E DFG Y   A++      + FI+ K+DAP  L   +P  ++ LH +F +   +DA P   + W R+ K++  S+RT I    +  KE         SL + +CI  D G Y++ AEN  G  +    +RV+  P  K   +   DV   YY +++L KG  S  +++I+K T  E++GK + +++ +G   G  EF+C+  + H N+V++ DAI + D  LVL+ E+L G +L + +   ++W ES    ++ Q+++A+ +LH   V HLD++PEN++                                   T ++     + ++KL GFS+A P  +  +   +    P      +SAPE+L           EP   +   +DMWS+G+LT++ L G       H         L  +F  D        D+IS++A  F+R  L +  G R T+++ L H W     N+    ++Y ++++
Sbjct: 2556 RSEDTPATSPFGFEKLRCT--DLSTPITEGSNLELVARFPTFGLDYDENDFQWLADGNAVSNKGSLVRVDTDETQGHVSLVIPNIQPEHAGTYSIRFSDNAQKRIKDNAPTTPPMGDLSKALVFPPLVILKRAMSCSERWQPSKYRP--SAFDRELPPSTSIK---EGEHAKLEARLGRNHEIFDHEWLVNGKPILPEFTSDYTIWRADNLLALTIPRMRRDLAGIYELRVFGEQDVYTTSTDLIVEPSRAKISSYKLTSADGLKPLFTKRLQDYEVDVGDCVRFTARVMAEPPAVIVWKHNGSIVTG---DHRIKLFNDDANPSLTIRHARPEDRGRYCCIATNALGRVDTEGVLQVHDTDRYVPLGNEFDAGGSVAGRKEIGGSKRTALPRTAPEVALVSMSVSNIDLRWKPIQSDEGVTYIVELSKDGG---KWWKPIITGLRETHASVSEELASPLEPVQIRVVGENEFGTGPASAPPVRIPARACIPTMPQVKPDIEFEEAASVLIKWPKATASIMEHTLLTEHVISPSAMLGQVWYAVEVREGAQSEWRRVATNLKNQFYTYHLRPGASTAIRVVAANRFGESSPTPIGLTHLDPNSLAPNLDFNPPWVSLSRPVSDDGSTYEIQPLGVTVYWKPAYMPEFCSSCVRGLEPMYRLEWRRGRSGMWQALADDLTDPEAGFRLPTDLVLALQDDAKRMKDSRSLVTLNSQAIELRLFCWNKYGESGPTKPCRLVASEL----FRG-QLYKNSTVMDKDSMQLSQITDVLQELDQLPVMSANDRCSRLLTRISSLSTTEGIGLSWEKFTLTGLPKASGDQPPEPHGRYRIEKYIARPTSPMDSPNTNQTDWKVASLDAAVIYGED-FILDTRPDKEEQIYRLLALNETETCSMWVDGYNRIRIPSLSELVPSAPTDLTIQCVPVNDSTISAENHINWKPANQHPLLVELSPSSELVEAKELANPPLDLRYRIEARSTLSELSPWRQVAEVYGG---TTSVVDRKAEPGLALIYRITPINRFGEGSSVTSPPIRTPILYSAL--EGCIEDVRSVILGPTEIQLRWRLGDAAIDALKHDQPNTWGRKRSLCRSGSVDYSERVSFTVEVRGGYAG-DWSPAVEQIQGDLNAKALLQDCHYLEHDISCRVVALIDGQRSAPSRPIRLNVRADAMTPDYTFVKPKVHVETVEEYVISWDEPDVQEIYSSHTLGLTTPQTLQRGMNYAVQV-------------QRESKPQWETIATQLKEPHYTWAQPNPLQAYHVRVLPANQFGTGIPSRSVRVEPQVVIPDLSFIRPSIEAPADILAGSTAPE---LVWQLPRAYSLEKTLTPVTYEVQVRGVANASRLALGPVPHAVHSASRQSAADDDETVWRVLETNVKRTRLPLGRLDPEQEFWLRIVAVTDYGRGAPSQSVRKLVDLAAKRQQRMSASIVTIHEATPVSPTFADPKGTVLYAPVGGRLELR-SNLQTIQPDADIRFSWSLNDRPIEIPETAQQNRLSRYQSYVSKTSDVAVLQVHNLTESDFGVYICKAVNIRGSTTKEFIVKKADAPVFLEVPVPVMTIKLHCSFELPCWVDAVPTATLYWTRDSKRVGESHRTKIGSRMSRTKEDAQCFTINASLSVDRCIYQDAGLYTLVAENIAGRVQTSCLIRVEESPIPKYPTLRWTDVGLHYYVLRRLEKGDISELRLLIDKQTNQEYVGKLYFLDDPIGRVAGAREFECLSRLCHSNVVQLHDAI-VSDNVLVLVMERLTGPNLLKAMLHCNNWSESATASVVRQVLEALQHLHCEGVVHLDLQPENLLFARNVTAETWDGQTSYTDLFKALSPLVSDTMGLRETDRHKMSVLSSLIKLVGFSSAEPLVNKSNADPVYCYPPQRFRPEYSAPEVLVAASQSASTDAEPPILVGPAADMWSVGVLTYVLLTGWCPFFDMHTSEPLREQILSASFTMDL----SEFDSISDNAKQFVRDLLQINPGSRPTATECLQHPWLSTLKNSDGQDVEYRLERL 4527          

HSP 2 Score: 100.908 bits (250), Expect = 1.019e-16
Identity = 71/242 (29.34%), Postives = 118/242 (48.76%), Query Frame = 2
Query: 11618 LFGEICDSSLGNRITFEEFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSN--NVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRYESDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNTNTLLLPVPHTHFRAPKL------SMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWFKQDPQTIYEMEHQTISSTPL 12319
            L  +    S+G  +++  ++PGG L  VL++R+ Y+EF+++   +QLL  +++L+S      HG I P  IL +RR++   DI L G     F G+ +E      +  S F APE          SD+WS+G L++LL+    P  +   +++      + T     P    H   P +        LH FSK ++K V+N L+  P  RG+ D+WL   WF    + +     Q ++ TP+
Sbjct: 5111 LTNDAVKPSIGVSVSY--WIPGGQLFDVLVSRTEYTEFSIMRWTQQLLMALRWLYSKLFGRPHGAIIPRHILAARRSSTLPDIVLTG-----FGGSNEE-----INGRSEFTAPEVSQGETISVFSDLWSIGALNYLLMTGNCP--DAKLAETSYKVLAETTTDEEKPKLTGHQGDPHIPHYIDFKKLHMFSKPAKKLVYNCLQLLPKKRGHIDFWLESRWFDISTENV-----QRLTRTPI 5333          

HSP 3 Score: 97.4413 bits (241), Expect = 1.215e-15
Identity = 135/525 (25.71%), Postives = 222/525 (42.29%), Query Frame = 2
Query:  725 KRNPRESFREDILQISNKNQESTMKRKYALADLIECDREYCATXXXXXXXXXXXXXTENEFGVEIDSLFEEVCKLIVE------------------LVEFHENLILPELSSCVMIP-------IRVANILKNQKLQFYRYSEFQSQWX--------XXXXXXXXXXXXXXFVKNVNTI-----EKSKFSVLSFNDLMLKVENKLPQYNLFLFDIIRYTGRIDGEVNDLQKAITVFQKIRRRNQEKVYLSKLIEKTN------INI-SNERFIRVTNQVMISETQIMSKSYENLQFIREEM--CSLILLKNYLLCV--SDLSQPTD-RKIMNLDYTKIYTKENYERQNELI-IW-SKMNKLEFRIFILYFPNKVSKLGWLRDLTKRLK---KKGIDEIFVSSTEYDIQYKQYLGKNQRLVATEMESIGLESASLENECSSISDQIEDLTSMADSITDVR--FESAILDMPS----------SMTSGSYKTAPETFKSTMDKASRPISGISQDSVSTLDGVRTPFSD 2098
            KR+PRE FRE+++ ISNK QES MKR+YAL +LIE +REY   L  + D L         FG  +     E  +  ++                  +++F E  +L EL++C M P       IR A  L++  +       F  Q           L +L D S       +N ++      +++  +     +L    + +L  Y + L D+ RYT +       L+  +TV  +  RR +E +     I +T       IN+  N+R   +    ++  T + +     L+ I  E     LILL  ++L +   +LS   D   I+ LD  +I   E  ++Q     IW ++ +    +I  +Y  + +S+  W+ D+ + L    + G +E  V S       +  L K  +  A  ME     S SLE+      D ++   +   S+ D+    +  ++D+ S          S TS SY TA E         ++  S    +S +TLD VRTPFS+
Sbjct:  420 KRDPRELFREEVITISNKQQESKMKRRYALTELIETEREYVKALTPLLDAL-------TRFGTRVTLHLGEATEETIDIPKPLQQCIRNLRDKLKKIIDFTEKTLLDELAACTMNPPSAAECFIRNAAALEHYSIYLLHLDAFVKQLTLINGPDSDALFVLQDSSSPPRSPTENGDSTSALCNQRTSITYKYLLELFDLPKLRLLAYRVLLRDVARYTSQAGASTEQLEHGMTVIARTSRRTEETLMFWTKINQTTSECVEWINMYKNKRTGNLMPPALVRLTDLETNIRTGLRPISSETKKGRLILLPQHILFLQKQELSDTWDISWIIKLDGLRIGASELSDKQPPWFEIWNTEGSDPTKKIVRIYCADTLSQNAWMEDIRRALMNLLQCGDEETLVDSAVVSAHEEADLRKRLKF-AHVMELPAFRSDSLEDFFVDALDDLQKQQATFSSVDDIHNGQKPQVVDLVSMSTATSKKQDSSTSSSYHTA-EELSDHQTSCAKETSTTLYESYTTLDDVRTPFSE 935          

HSP 4 Score: 94.7449 bits (234), Expect = 7.662e-15
Identity = 70/250 (28.00%), Postives = 109/250 (43.60%), Query Frame = 2
Query: 10721 FTVPLKDQTFKSDSTAGKITVTLTCQLSLLGSEPISI----------------------------SWYKNQELLTDDSRIKLEVIKGGFLSCTILNATETDVG-IFRCIARCHSLRTETSARLVLGDVPPQPEQLSVYYTNQEEVLLKWSPYLSAID-DVIYRIDIRTIDSRNKIRNWKTIGYSVDNRYLLENLDRTQQYIARIIAQNKYGYSPYSIATSVFQNKI-RNIHSLKQALIFNRKWMLTSRQS 11377
            F  PL+D  F   S   +     +CQL+     P  I                            +WY    LL+D   ++L    GG+L   +        G + +C+ R  + + +T ARL++ D P  P +  +   +  E L+ W+P    +D D+IYR+D +   + N    W T+G++VD R+L  NL     Y  R+ A N  G+  YSIA+S F     R+   +      +R+WMLT RQS
Sbjct: 4707 FASPLRDAYFNIHSGEAR----FSCQLAGFAHLPPGIHGHREAIAELYPTDVVNAQTGHSSATVAAWYLGGCLLSDGPGVQLGTGPGGWLWLYLSELNVDQAGTVVKCVVRNRAGKAKTQARLLIADPPKPPGRPGMAEVHPTEALITWAPSDVDVDGDLIYRVDAK-FAANNGPAAWHTLGFTVDCRFLAMNLQPGLCYRMRVSAGNSCGWGNYSIASSEFYTPTDRSSEVISLLSKDDREWMLTWRQS 4951          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: A0A4S2LXN5 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005285 PE=4 SV=1)

HSP 1 Score: 568.926 bits (1465), Expect = 2.222e-158
Identity = 513/2019 (25.41%), Postives = 883/2019 (43.73%), Query Frame = 2
Query: 5390 KFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSID----SAVWLKDEKLLNETDP--RLTIIMQPFCYNLILRDVKMTDAGMYSLKINESSVDILVKVRPK--PIRKQTKE-IFKNLKI------------PQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEI-DAE------------NMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLM-LRSEISEQMMESC-CIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEP-----------------KESDSSRIIVKPLCAPVLTAEYSKGADVILSWTSVATTDTLNIIYNIEKQKSLTSTNWKKIMKNLTETTYSLSSSCLPPQESHLLRCVAISEYGFETVSNI-IEIPIRANSPILPPDKPTIIFKDATCVKISWMRGKCKNL----------TPEESIGKIMYSLEMKDNPKSSWQIVSNDLVDNEYSLSLEPGVSYMFRVIAFNDFGISEPSQSLISRIDRLKLVPDFSVDPPWLHLKG-----------QP---CLKWRAATVPEFCDSCVSGILPDYKVEYRNGRLSPWKIYQENIMQNE------TYLTQKIIDDAQ----------------EFRVSCRNKFGQNGPTRSYRLQANIVGKTSFRSPSVEKVKTIIKYDQLKQAEIESI---------------------------SKDGLSLKWSQWV------------PDQINKYIIQR-----------KNSFSQDWEQIH---STIFGENCFVEMILSENFSRQLRILSLDDNKT--ELHDGYNILYIPSKDECIPTIPENLQ-----VNDLT------------NYHEIFWSESKSIEIVDS------PITYSLQSKVNNQF-----WFTITEKLDKCFYTNTRIDKYGVTG----YRV--LARNSIGSSPFSMEVFTKSLINILSNEQIIKSLRYFVINPREIEIKWHLCESIFD------------------SGIT--TEDLSFQIEKKTVKEGSDWVP----ISNIVERNSILISITFEDENLF-RIQPFYRDEKLSASRIFRMYVSKDLLVPDMSFTRPNLVIDSVTSCAIEWPEPELQSGFSPDGIEICVPSVLLVDLQYEIQFVVVDPIVGSKIRGKDVKNLQWKPLQEDLEENTFNWENPDPTQEYLFRIVAKNQFGSGLPSQIVKLHPQIIIPDFSFIRLTID--DTVIPGSNGEREITLSWSPPRISP--DLYIPFTVDVECR-----------PVNYSY----------SDEEGWSVFKTNIKKNRVDIADLDPNINYQLRIVPVTDFGIGKPSMVIKKI-----RRSDNLNSPTTEKAMMLQEKHCLAVP----MFCCLSQKAELKFTKLMEYKLD---KITWTFNNAKVDVND-------ERYKIFSAETYGIYFI-IKNLEEDDFGEYC--ALDEVQDPIQSFILIKSDAPTILNC-LPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIFSSYRTVI----TEDKEQG-----TYSLLISKCILSDGGEYSIRAENAIGFAEVKFNLRVDAHPEKKSVQINIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEINN-MG--IGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIM----------------------------------TGKY-----NEILKLCGFSNAVPKEDFGSRRHMGLTSP------FSAPELL---------KGEP---IQFNSDMWSIGILTFLCLHG-------H---------LKVNFEGDQLYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWFIKPGNNLNAALDYIIDQI 10405
            + +D    SP   E L CT  +++T   E   L + +R PT  +D       WL D   ++      R+         +L++ +++   AG YS++ ++++   +    P   P+   +K  +F  L I            P   +P    F R  P +   +   E   AK       N EI D E              ++  W  DN  ALTIP       G Y ++V  +     +   L +   R++IS   + S   + PLFTK+L+D E+   + +R   R+M +P   I+W  +G  +     + R+K+ ++  N +L I  A  ED GRYCC+ TN LG   TE V+ V D++                  KE   S+    P  AP +       +++ L W  + + + +  I  + K        WK I+  L ET  S+S     P E   +R V  +E+G    S   + IP RA  P +P  KP I F++A  V I W +     +          +P   +G++ Y++E+++  +S W+ V+ +L +  Y+  L PG S   RV+A N FG S P+   ++ +D   L P+   +PPW+ L             QP    + W+ A +PEFC SCV G+ P Y++E+R GR   W+   +++   E      T L   + DDA+                E R+ C NK+G++GPT+  RL A+ +    FR   + K  T++  D ++ ++I  +                           + +G+ L W ++             P+   +Y I++            N+   DW+      + I+GE+ F+     +   +  R+L+L++ +T     DGYN + IPS  E +P+ P +L      VND T            N H +    S S E+V++      P+    + +  +       W  + E       T + +D+    G    YR+  + R   GSS  S  + T  L + L  E  I+ +R  ++ P EI+++W L ++  D                  SG    +E +SF +E +    G DW P    I   +   ++L    + + ++  R+      ++ + SR  R+ V  D + PD +F +P + +++V    I W EP++Q  +S   + +  P  L   + Y +Q              +     QW+ +   L+E  + W  P+P Q Y  R++  NQFG+G+PS+ V++ PQ++IPD SFIR +I+    ++ GS       L W  PR         P T +V+ R           PV ++            DE  W V +TN+K+ R+ +  LDP   + LRIV VTD+G G PS  ++K+     +R   +++               A P    ++  +  + EL+ + L   + D   + +W+ N+  +++ +        RY+ + ++T  +  + + NL E DFG Y   A++      + FI+ K+DAP  L   +P  ++ LH +F +   +DA P   + W R+ K++  S+RT I    +  KE         SL + +CI  D G Y++ AEN  G  +    +RV+  P  K   +   DV   YY +++L KG  S  +++I+K T  E++GK + +++ +G   G  EF+C+  + H N+V++ DAI + D  LVL+ E+L G +L + +   ++W ES    ++ Q+++A+ +LH   V HLD++PEN++                                   T ++     + ++KL GFS+A P  +  +   +    P      +SAPE+L           EP   +   +DMWS+G+LT++ L G       H         L  +F  D        D+IS++A  F+R  L +  G R T+++ L H W     N+    ++Y ++++
Sbjct: 2506 RSEDTPATSPFGFEKLRCT--DLSTPITEGSNLELVARFPTFGLDYDENDFQWLADGNAVSNKGSLVRVDTDETQGHVSLVIPNIQPEHAGTYSIRFSDNAQKRIKDNAPTTPPMGDLSKALVFPPLVILKRAMSCSERWQPSKYRP--SAFDRELPPSTSIK---EGEHAKLEARLGRNHEIFDHEWLVNGKPILPEFTSDYTIWRADNLLALTIPRMRRDLAGIYELRVFGEQDVYTTSTDLIVEPSRAKISSYKLTSADGLKPLFTKRLQDYEVDVGDCVRFTARVMAEPPAVIVWKHNGSIVTG---DHRIKLFNDDANPSLTIRHARPEDRGRYCCIATNALGRVDTEGVLQVHDTDRYVPLGNEFDAGGSVAGRKEIGGSKRTALPRTAPEVALVSMSVSNIDLRWKPIQSDEGVTYIVELSKDGG---KWWKPIITGLRETHASVSEELASPLEPVQIRVVGENEFGTGPASAPPVRIPARACIPTMPQVKPDIEFEEAASVLIKWPKATASIMEHTLLTEHVISPSAMLGQVWYAVEVREGAQSEWRRVATNLKNQFYTYHLRPGASTAIRVVAANRFGESSPTPIGLTHLDPNSLAPNLDFNPPWVSLSRPVSDDGSTYEIQPLGVTVYWKPAYMPEFCSSCVRGLEPMYRLEWRRGRSGMWQALADDLTDPEAGFRLPTDLVLALQDDAKRMKDSRSLVTLNSQAIELRLFCWNKYGESGPTKPCRLVASEL----FRG-QLYKNSTVMDKDSMQLSQITDVLQELDQLPVMSANDRCSRLLTRISSLSTTEGIGLSWEKFTLTGLPKASGDQPPEPHGRYRIEKYIARPTSPMDSPNTNQTDWKVASLDAAVIYGED-FILDTRPDKEEQIYRLLALNETETCSMWVDGYNRIRIPSLSELVPSAPTDLTIQCVPVNDSTISAENHINWKPANQHPLLVELSPSSELVEAKELANPPLDLRYRIEARSTLSELSPWRQVAEVYGG---TTSVVDRKAEPGLALIYRITPINRFGEGSSVTSPPIRTPILYSAL--EGCIEDVRSVILGPTEIQLRWRLGDAAIDALKHDQPNTWGRKRSLCRSGSVDYSERVSFTVEVRGGYAG-DWSPAVEQIQGDLNAKALLQDCHYLEHDISCRVVALIDGQRSAPSRPIRLNVRADAMTPDYTFVKPKVHVETVEEYVISWDEPDVQEIYSSHTLGLTTPQTLQRGMNYAVQV-------------QRESKPQWETIATQLKEPHYTWAQPNPLQAYHVRVLPANQFGTGIPSRSVRVEPQVVIPDLSFIRPSIEAPADILAGSTAPE---LVWQLPRAYSLEKTLTPVTYEVQVRGVANASRLALGPVPHAVHSASRQSAADDDETVWRVLETNVKRTRLPLGRLDPEQEFWLRIVAVTDYGRGAPSQSVRKLVDLAAKRQQRMSASIVTIHEATPVSPTFADPKGTVLYAPVGGRLELR-SNLQTIQPDADIRFSWSLNDRPIEIPETAQQNRLSRYQSYVSKTSDVAVLQVHNLTESDFGVYICKAVNIRGSTTKEFIVKKADAPVFLEVPVPVMTIKLHCSFELPCWVDAVPTATLYWTRDSKRVGESHRTKIGSRMSRTKEDAQCFTINASLSVDRCIYQDAGLYTLVAENIAGRVQTSCLIRVEESPIPKYPTLRWTDVGLHYYVLRRLEKGDISELRLLIDKQTNQEYVGKLYFLDDPIGRVAGAREFECLSRLCHSNVVQLHDAI-VSDNVLVLVMERLTGPNLLKAMLHCNNWSESATASVVRQVLEALQHLHCEGVVHLDLQPENLLFARNVTAETWDGQTSYTDLFKALSPLVSDTMGLRETDRHKMSVLSSLIKLVGFSSAEPLVNKSNADPVYCYPPQRFRPEYSAPEVLVAASQSASTDAEPPILVGPAADMWSVGVLTYVLLTGWCPFFDMHTSEPLREQILSASFTMDL----SEFDSISDNAKQFVRDLLQINPGSRPTATECLQHPWLSTLKNSDGQDVEYRLERL 4477          

HSP 2 Score: 100.523 bits (249), Expect = 1.098e-16
Identity = 71/242 (29.34%), Postives = 118/242 (48.76%), Query Frame = 2
Query: 11618 LFGEICDSSLGNRITFEEFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSN--NVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRYESDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNTNTLLLPVPHTHFRAPKL------SMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWFKQDPQTIYEMEHQTISSTPL 12319
            L  +    S+G  +++  ++PGG L  VL++R+ Y+EF+++   +QLL  +++L+S      HG I P  IL +RR++   DI L G     F G+ +E      +  S F APE          SD+WS+G L++LL+    P  +   +++      + T     P    H   P +        LH FSK ++K V+N L+  P  RG+ D+WL   WF    + +     Q ++ TP+
Sbjct: 5071 LTNDAVKPSIGVSVSY--WIPGGQLFDVLVSRTEYTEFSIMRWTQQLLMALRWLYSKLFGRPHGAIIPRHILAARRSSTLPDIVLTG-----FGGSNEE-----INGRSEFTAPEVSQGETISVFSDLWSIGALNYLLMTGNCP--DAKLAETSYKVLAETTTDEEKPKLTGHQGDPHIPHYIDFKKLHMFSKPAKKLVYNCLQLLPKKRGHIDFWLESRWFDISTENV-----QRLTRTPI 5293          

HSP 3 Score: 97.4413 bits (241), Expect = 1.204e-15
Identity = 135/525 (25.71%), Postives = 222/525 (42.29%), Query Frame = 2
Query:  725 KRNPRESFREDILQISNKNQESTMKRKYALADLIECDREYCATXXXXXXXXXXXXXTENEFGVEIDSLFEEVCKLIVE------------------LVEFHENLILPELSSCVMIP-------IRVANILKNQKLQFYRYSEFQSQWX--------XXXXXXXXXXXXXXFVKNVNTI-----EKSKFSVLSFNDLMLKVENKLPQYNLFLFDIIRYTGRIDGEVNDLQKAITVFQKIRRRNQEKVYLSKLIEKTN------INI-SNERFIRVTNQVMISETQIMSKSYENLQFIREEM--CSLILLKNYLLCV--SDLSQPTD-RKIMNLDYTKIYTKENYERQNELI-IW-SKMNKLEFRIFILYFPNKVSKLGWLRDLTKRLK---KKGIDEIFVSSTEYDIQYKQYLGKNQRLVATEMESIGLESASLENECSSISDQIEDLTSMADSITDVR--FESAILDMPS----------SMTSGSYKTAPETFKSTMDKASRPISGISQDSVSTLDGVRTPFSD 2098
            KR+PRE FRE+++ ISNK QES MKR+YAL +LIE +REY   L  + D L         FG  +     E  +  ++                  +++F E  +L EL++C M P       IR A  L++  +       F  Q           L +L D S       +N ++      +++  +     +L    + +L  Y + L D+ RYT +       L+  +TV  +  RR +E +     I +T       IN+  N+R   +    ++  T + +     L+ I  E     LILL  ++L +   +LS   D   I+ LD  +I   E  ++Q     IW ++ +    +I  +Y  + +S+  W+ D+ + L    + G +E  V S       +  L K  +  A  ME     S SLE+      D ++   +   S+ D+    +  ++D+ S          S TS SY TA E         ++  S    +S +TLD VRTPFS+
Sbjct:  420 KRDPRELFREEVITISNKQQESKMKRRYALTELIETEREYVKALTPLLDAL-------TRFGTRVTLHLGEATEETIDIPKPLQQCIRNLRDKLKKIIDFTEKTLLDELAACTMNPPSAAECFIRNAAALEHYSIYLLHLDAFVKQLTLINGPDSDALFVLQDSSSPPRSPTENGDSTSALCNQRTSITYKYLLELFDLPKLRLLAYRVLLRDVARYTSQAGASTEQLEHGMTVIARTSRRTEETLMFWTKINQTTSECVEWINMYKNKRTGNLMPPALVRLTDLETNIRTGLRPISSETKKGRLILLPQHILFLQKQELSDTWDISWIIKLDGLRIGASELSDKQPPWFEIWNTEGSDPTKKIVRIYCADTLSQNAWMEDIRRALMNLLQCGDEETLVDSAVVSAHEEADLRKRLKF-AHVMELPAFRSDSLEDFFVDALDDLQKQQATFSSVDDIHNGQKPQVVDLVSMSTATSKKQDSSTSSSYHTA-EELSDHQTSCAKETSTTLYESYTTLDDVRTPFSE 935          

HSP 4 Score: 91.2781 bits (225), Expect = 7.465e-14
Identity = 70/260 (26.92%), Postives = 111/260 (42.69%), Query Frame = 2
Query: 10721 FTVPLKDQTFKSDSTAGKITVTLTCQLSLLGSEPISI----------------------------SWYKNQELLTDDSRIKLEVIKGGFLSCTILNATETDVG-IFRCIARCHSLRTETSARLVLGDVPPQPEQLSVYYTNQEEVLLKWSPYLSAID-DVIYRIDIRTIDSRNKIRNWKTIGYSVDNRYLLENLDRTQQYIARIIAQNKYGYSPYSIATSVF-----------QNKIRNIHSLKQALIFNRKWMLTSRQS 11377
            F  PL+D  F   S   +     +CQL+     P  I                            +WY    LL+D   ++L    GG+L   +        G + +C+ R  + + +T ARL++ D P  P +  +   +  E L+ W+P    +D D+IYR+D +   + N    W T+G++VD R+L  NL     Y  R+ A N  G+  YSIA+S F            ++ R+   +      +R+WMLT RQS
Sbjct: 4657 FASPLRDAYFNIHSGEAR----FSCQLAGFAHLPPGIHGHREAIAELYPTDVVNAQTGHSSATVAAWYLGGCLLSDGPGVQLGTGPGGWLWLYLSELNVDQAGTVVKCVVRNRAGKAKTQARLLIADPPKPPGRPGMAEVHPTEALITWAPSDVDVDGDLIYRVDAK-FAANNGPAAWHTLGFTVDCRFLAMNLQPGLCYRMRVSAGNSCGWGNYSIASSEFYTPTDHPSRFDSSEDRSSEVISLLSKDDREWMLTWRQS 4911          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: A0A4S2LYL9 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005285 PE=4 SV=1)

HSP 1 Score: 568.926 bits (1465), Expect = 2.243e-158
Identity = 513/2019 (25.41%), Postives = 883/2019 (43.73%), Query Frame = 2
Query: 5390 KFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSID----SAVWLKDEKLLNETDP--RLTIIMQPFCYNLILRDVKMTDAGMYSLKINESSVDILVKVRPK--PIRKQTKE-IFKNLKI------------PQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEI-DAE------------NMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLM-LRSEISEQMMESC-CIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEP-----------------KESDSSRIIVKPLCAPVLTAEYSKGADVILSWTSVATTDTLNIIYNIEKQKSLTSTNWKKIMKNLTETTYSLSSSCLPPQESHLLRCVAISEYGFETVSNI-IEIPIRANSPILPPDKPTIIFKDATCVKISWMRGKCKNL----------TPEESIGKIMYSLEMKDNPKSSWQIVSNDLVDNEYSLSLEPGVSYMFRVIAFNDFGISEPSQSLISRIDRLKLVPDFSVDPPWLHLKG-----------QP---CLKWRAATVPEFCDSCVSGILPDYKVEYRNGRLSPWKIYQENIMQNE------TYLTQKIIDDAQ----------------EFRVSCRNKFGQNGPTRSYRLQANIVGKTSFRSPSVEKVKTIIKYDQLKQAEIESI---------------------------SKDGLSLKWSQWV------------PDQINKYIIQR-----------KNSFSQDWEQIH---STIFGENCFVEMILSENFSRQLRILSLDDNKT--ELHDGYNILYIPSKDECIPTIPENLQ-----VNDLT------------NYHEIFWSESKSIEIVDS------PITYSLQSKVNNQF-----WFTITEKLDKCFYTNTRIDKYGVTG----YRV--LARNSIGSSPFSMEVFTKSLINILSNEQIIKSLRYFVINPREIEIKWHLCESIFD------------------SGIT--TEDLSFQIEKKTVKEGSDWVP----ISNIVERNSILISITFEDENLF-RIQPFYRDEKLSASRIFRMYVSKDLLVPDMSFTRPNLVIDSVTSCAIEWPEPELQSGFSPDGIEICVPSVLLVDLQYEIQFVVVDPIVGSKIRGKDVKNLQWKPLQEDLEENTFNWENPDPTQEYLFRIVAKNQFGSGLPSQIVKLHPQIIIPDFSFIRLTID--DTVIPGSNGEREITLSWSPPRISP--DLYIPFTVDVECR-----------PVNYSY----------SDEEGWSVFKTNIKKNRVDIADLDPNINYQLRIVPVTDFGIGKPSMVIKKI-----RRSDNLNSPTTEKAMMLQEKHCLAVP----MFCCLSQKAELKFTKLMEYKLD---KITWTFNNAKVDVND-------ERYKIFSAETYGIYFI-IKNLEEDDFGEYC--ALDEVQDPIQSFILIKSDAPTILNC-LPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIFSSYRTVI----TEDKEQG-----TYSLLISKCILSDGGEYSIRAENAIGFAEVKFNLRVDAHPEKKSVQINIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEINN-MG--IGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIM----------------------------------TGKY-----NEILKLCGFSNAVPKEDFGSRRHMGLTSP------FSAPELL---------KGEP---IQFNSDMWSIGILTFLCLHG-------H---------LKVNFEGDQLYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWFIKPGNNLNAALDYIIDQI 10405
            + +D    SP   E L CT  +++T   E   L + +R PT  +D       WL D   ++      R+         +L++ +++   AG YS++ ++++   +    P   P+   +K  +F  L I            P   +P    F R  P +   +   E   AK       N EI D E              ++  W  DN  ALTIP       G Y ++V  +     +   L +   R++IS   + S   + PLFTK+L+D E+   + +R   R+M +P   I+W  +G  +     + R+K+ ++  N +L I  A  ED GRYCC+ TN LG   TE V+ V D++                  KE   S+    P  AP +       +++ L W  + + + +  I  + K        WK I+  L ET  S+S     P E   +R V  +E+G    S   + IP RA  P +P  KP I F++A  V I W +     +          +P   +G++ Y++E+++  +S W+ V+ +L +  Y+  L PG S   RV+A N FG S P+   ++ +D   L P+   +PPW+ L             QP    + W+ A +PEFC SCV G+ P Y++E+R GR   W+   +++   E      T L   + DDA+                E R+ C NK+G++GPT+  RL A+ +    FR   + K  T++  D ++ ++I  +                           + +G+ L W ++             P+   +Y I++            N+   DW+      + I+GE+ F+     +   +  R+L+L++ +T     DGYN + IPS  E +P+ P +L      VND T            N H +    S S E+V++      P+    + +  +       W  + E       T + +D+    G    YR+  + R   GSS  S  + T  L + L  E  I+ +R  ++ P EI+++W L ++  D                  SG    +E +SF +E +    G DW P    I   +   ++L    + + ++  R+      ++ + SR  R+ V  D + PD +F +P + +++V    I W EP++Q  +S   + +  P  L   + Y +Q              +     QW+ +   L+E  + W  P+P Q Y  R++  NQFG+G+PS+ V++ PQ++IPD SFIR +I+    ++ GS       L W  PR         P T +V+ R           PV ++            DE  W V +TN+K+ R+ +  LDP   + LRIV VTD+G G PS  ++K+     +R   +++               A P    ++  +  + EL+ + L   + D   + +W+ N+  +++ +        RY+ + ++T  +  + + NL E DFG Y   A++      + FI+ K+DAP  L   +P  ++ LH +F +   +DA P   + W R+ K++  S+RT I    +  KE         SL + +CI  D G Y++ AEN  G  +    +RV+  P  K   +   DV   YY +++L KG  S  +++I+K T  E++GK + +++ +G   G  EF+C+  + H N+V++ DAI + D  LVL+ E+L G +L + +   ++W ES    ++ Q+++A+ +LH   V HLD++PEN++                                   T ++     + ++KL GFS+A P  +  +   +    P      +SAPE+L           EP   +   +DMWS+G+LT++ L G       H         L  +F  D        D+IS++A  F+R  L +  G R T+++ L H W     N+    ++Y ++++
Sbjct: 2556 RSEDTPATSPFGFEKLRCT--DLSTPITEGSNLELVARFPTFGLDYDENDFQWLADGNAVSNKGSLVRVDTDETQGHVSLVIPNIQPEHAGTYSIRFSDNAQKRIKDNAPTTPPMGDLSKALVFPPLVILKRAMSCSERWQPSKYRP--SAFDRELPPSTSIK---EGEHAKLEARLGRNHEIFDHEWLVNGKPILPEFTSDYTIWRADNLLALTIPRMRRDLAGIYELRVFGEQDVYTTSTDLIVEPSRAKISSYKLTSADGLKPLFTKRLQDYEVDVGDCVRFTARVMAEPPAVIVWKHNGSIVTG---DHRIKLFNDDANPSLTIRHARPEDRGRYCCIATNALGRVDTEGVLQVHDTDRYVPLGNEFDAGGSVAGRKEIGGSKRTALPRTAPEVALVSMSVSNIDLRWKPIQSDEGVTYIVELSKDGG---KWWKPIITGLRETHASVSEELASPLEPVQIRVVGENEFGTGPASAPPVRIPARACIPTMPQVKPDIEFEEAASVLIKWPKATASIMEHTLLTEHVISPSAMLGQVWYAVEVREGAQSEWRRVATNLKNQFYTYHLRPGASTAIRVVAANRFGESSPTPIGLTHLDPNSLAPNLDFNPPWVSLSRPVSDDGSTYEIQPLGVTVYWKPAYMPEFCSSCVRGLEPMYRLEWRRGRSGMWQALADDLTDPEAGFRLPTDLVLALQDDAKRMKDSRSLVTLNSQAIELRLFCWNKYGESGPTKPCRLVASEL----FRG-QLYKNSTVMDKDSMQLSQITDVLQELDQLPVMSANDRCSRLLTRISSLSTTEGIGLSWEKFTLTGLPKASGDQPPEPHGRYRIEKYIARPTSPMDSPNTNQTDWKVASLDAAVIYGED-FILDTRPDKEEQIYRLLALNETETCSMWVDGYNRIRIPSLSELVPSAPTDLTIQCVPVNDSTISAENHINWKPANQHPLLVELSPSSELVEAKELANPPLDLRYRIEARSTLSELSPWRQVAEVYGG---TTSVVDRKAEPGLALIYRITPINRFGEGSSVTSPPIRTPILYSAL--EGCIEDVRSVILGPTEIQLRWRLGDAAIDALKHDQPNTWGRKRSLCRSGSVDYSERVSFTVEVRGGYAG-DWSPAVEQIQGDLNAKALLQDCHYLEHDISCRVVALIDGQRSAPSRPIRLNVRADAMTPDYTFVKPKVHVETVEEYVISWDEPDVQEIYSSHTLGLTTPQTLQRGMNYAVQV-------------QRESKPQWETIATQLKEPHYTWAQPNPLQAYHVRVLPANQFGTGIPSRSVRVEPQVVIPDLSFIRPSIEAPADILAGSTAPE---LVWQLPRAYSLEKTLTPVTYEVQVRGVANASRLALGPVPHAVHSASRQSAADDDETVWRVLETNVKRTRLPLGRLDPEQEFWLRIVAVTDYGRGAPSQSVRKLVDLAAKRQQRMSASIVTIHEATPVSPTFADPKGTVLYAPVGGRLELR-SNLQTIQPDADIRFSWSLNDRPIEIPETAQQNRLSRYQSYVSKTSDVAVLQVHNLTESDFGVYICKAVNIRGSTTKEFIVKKADAPVFLEVPVPVMTIKLHCSFELPCWVDAVPTATLYWTRDSKRVGESHRTKIGSRMSRTKEDAQCFTINASLSVDRCIYQDAGLYTLVAENIAGRVQTSCLIRVEESPIPKYPTLRWTDVGLHYYVLRRLEKGDISELRLLIDKQTNQEYVGKLYFLDDPIGRVAGAREFECLSRLCHSNVVQLHDAI-VSDNVLVLVMERLTGPNLLKAMLHCNNWSESATASVVRQVLEALQHLHCEGVVHLDLQPENLLFARNVTAETWDGQTSYTDLFKALSPLVSDTMGLRETDRHKMSVLSSLIKLVGFSSAEPLVNKSNADPVYCYPPQRFRPEYSAPEVLVAASQSASTDAEPPILVGPAADMWSVGVLTYVLLTGWCPFFDMHTSEPLREQILSASFTMDL----SEFDSISDNAKQFVRDLLQINPGSRPTATECLQHPWLSTLKNSDGQDVEYRLERL 4527          

HSP 2 Score: 100.523 bits (249), Expect = 1.099e-16
Identity = 71/242 (29.34%), Postives = 118/242 (48.76%), Query Frame = 2
Query: 11618 LFGEICDSSLGNRITFEEFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSN--NVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRYESDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNTNTLLLPVPHTHFRAPKL------SMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWFKQDPQTIYEMEHQTISSTPL 12319
            L  +    S+G  +++  ++PGG L  VL++R+ Y+EF+++   +QLL  +++L+S      HG I P  IL +RR++   DI L G     F G+ +E      +  S F APE          SD+WS+G L++LL+    P  +   +++      + T     P    H   P +        LH FSK ++K V+N L+  P  RG+ D+WL   WF    + +     Q ++ TP+
Sbjct: 5121 LTNDAVKPSIGVSVSY--WIPGGQLFDVLVSRTEYTEFSIMRWTQQLLMALRWLYSKLFGRPHGAIIPRHILAARRSSTLPDIVLTG-----FGGSNEE-----INGRSEFTAPEVSQGETISVFSDLWSIGALNYLLMTGNCP--DAKLAETSYKVLAETTTDEEKPKLTGHQGDPHIPHYIDFKKLHMFSKPAKKLVYNCLQLLPKKRGHIDFWLESRWFDISTENV-----QRLTRTPI 5343          

HSP 3 Score: 97.4413 bits (241), Expect = 1.205e-15
Identity = 135/525 (25.71%), Postives = 222/525 (42.29%), Query Frame = 2
Query:  725 KRNPRESFREDILQISNKNQESTMKRKYALADLIECDREYCATXXXXXXXXXXXXXTENEFGVEIDSLFEEVCKLIVE------------------LVEFHENLILPELSSCVMIP-------IRVANILKNQKLQFYRYSEFQSQWX--------XXXXXXXXXXXXXXFVKNVNTI-----EKSKFSVLSFNDLMLKVENKLPQYNLFLFDIIRYTGRIDGEVNDLQKAITVFQKIRRRNQEKVYLSKLIEKTN------INI-SNERFIRVTNQVMISETQIMSKSYENLQFIREEM--CSLILLKNYLLCV--SDLSQPTD-RKIMNLDYTKIYTKENYERQNELI-IW-SKMNKLEFRIFILYFPNKVSKLGWLRDLTKRLK---KKGIDEIFVSSTEYDIQYKQYLGKNQRLVATEMESIGLESASLENECSSISDQIEDLTSMADSITDVR--FESAILDMPS----------SMTSGSYKTAPETFKSTMDKASRPISGISQDSVSTLDGVRTPFSD 2098
            KR+PRE FRE+++ ISNK QES MKR+YAL +LIE +REY   L  + D L         FG  +     E  +  ++                  +++F E  +L EL++C M P       IR A  L++  +       F  Q           L +L D S       +N ++      +++  +     +L    + +L  Y + L D+ RYT +       L+  +TV  +  RR +E +     I +T       IN+  N+R   +    ++  T + +     L+ I  E     LILL  ++L +   +LS   D   I+ LD  +I   E  ++Q     IW ++ +    +I  +Y  + +S+  W+ D+ + L    + G +E  V S       +  L K  +  A  ME     S SLE+      D ++   +   S+ D+    +  ++D+ S          S TS SY TA E         ++  S    +S +TLD VRTPFS+
Sbjct:  420 KRDPRELFREEVITISNKQQESKMKRRYALTELIETEREYVKALTPLLDAL-------TRFGTRVTLHLGEATEETIDIPKPLQQCIRNLRDKLKKIIDFTEKTLLDELAACTMNPPSAAECFIRNAAALEHYSIYLLHLDAFVKQLTLINGPDSDALFVLQDSSSPPRSPTENGDSTSALCNQRTSITYKYLLELFDLPKLRLLAYRVLLRDVARYTSQAGASTEQLEHGMTVIARTSRRTEETLMFWTKINQTTSECVEWINMYKNKRTGNLMPPALVRLTDLETNIRTGLRPISSETKKGRLILLPQHILFLQKQELSDTWDISWIIKLDGLRIGASELSDKQPPWFEIWNTEGSDPTKKIVRIYCADTLSQNAWMEDIRRALMNLLQCGDEETLVDSAVVSAHEEADLRKRLKF-AHVMELPAFRSDSLEDFFVDALDDLQKQQATFSSVDDIHNGQKPQVVDLVSMSTATSKKQDSSTSSSYHTA-EELSDHQTSCAKETSTTLYESYTTLDDVRTPFSE 935          

HSP 4 Score: 91.2781 bits (225), Expect = 7.470e-14
Identity = 70/260 (26.92%), Postives = 111/260 (42.69%), Query Frame = 2
Query: 10721 FTVPLKDQTFKSDSTAGKITVTLTCQLSLLGSEPISI----------------------------SWYKNQELLTDDSRIKLEVIKGGFLSCTILNATETDVG-IFRCIARCHSLRTETSARLVLGDVPPQPEQLSVYYTNQEEVLLKWSPYLSAID-DVIYRIDIRTIDSRNKIRNWKTIGYSVDNRYLLENLDRTQQYIARIIAQNKYGYSPYSIATSVF-----------QNKIRNIHSLKQALIFNRKWMLTSRQS 11377
            F  PL+D  F   S   +     +CQL+     P  I                            +WY    LL+D   ++L    GG+L   +        G + +C+ R  + + +T ARL++ D P  P +  +   +  E L+ W+P    +D D+IYR+D +   + N    W T+G++VD R+L  NL     Y  R+ A N  G+  YSIA+S F            ++ R+   +      +R+WMLT RQS
Sbjct: 4707 FASPLRDAYFNIHSGEAR----FSCQLAGFAHLPPGIHGHREAIAELYPTDVVNAQTGHSSATVAAWYLGGCLLSDGPGVQLGTGPGGWLWLYLSELNVDQAGTVVKCVVRNRAGKAKTQARLLIADPPKPPGRPGMAEVHPTEALITWAPSDVDVDGDLIYRVDAK-FAANNGPAAWHTLGFTVDCRFLAMNLQPGLCYRMRVSAGNSCGWGNYSIASSEFYTPTDHPSRFDSSEDRSSEVISLLSKDDREWMLTWRQS 4961          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: spegb (striated muscle enriched protein kinase b [Source:ZFIN;Acc:ZDB-GENE-081104-517])

HSP 1 Score: 128.642 bits (322), Expect = 1.325e-28
Identity = 130/595 (21.85%), Postives = 245/595 (41.18%), Query Frame = 2
Query: 8708 REITLSWSPPRISPDLYIPFTVDVECRPVNYSYSDEEG------WSVFKTNIKKNRVDIADLDPNINYQLRIVPVTDFGIGKPSMVIKKIRRSDNLNSPTTEKAMMLQEKHCLAVPMFCCLSQKAELKFTKLMEYKLDKITWTFNNAKVDVNDERYKIFSAETYGIYFIIKNLEEDDFGEYCALDEVQDPIQSFILIKS-------------DAPTILNCLPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIF-SSYRTVITEDKEQGTYSLLISKCILSDGGEYSIRAENAIGFAEVKFNLRVDA---HPEK-------KSVQINIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFF--EINNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEI----LKLCGFSNAVPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQ-----------LYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWF 10351
            + ITLSW  PR          +D    P    Y+ ++       W++  +++K+    +  L   + Y  RI+ +T     KPS     ++  D    P  ++A ++ +K  +                  ++E +   IT T N+   +V  +R  +  +   G++ +    ++    + C +        +F    S               PT  + + +  +++ E    +V ++ +P P++ W +N   +  SS+ T + +D E    SL++      D G Y+  A+N  G    K  L V      PEK       +++   +  + D Y   K++ +G++S  + V  K  ++E+  KF             E   + ++ H  I+   DA     +  V+I  ++    L + +T+ S   E+++R  I Q+++ + +LH+H + HLDIKP+NI+M     +I     + C +                 T  F APE++   P+   +D+W +G+LT+LCL G      E D+            + E     + + A  F+ K LL+    R  SS+ L H WF
Sbjct:  874 KTITLSWKKPR---------RLDPSIDPGTLMYAVQQQALGSIQWTIIASSLKQTTYTVTSLSKGVRYAFRILSITSKAFSKPSNATDPVQLIDR--GPYVQEAPVIIDKPDVVY----------------VVENQSVSITVTLNHVNANVTWKRRGVTLSNRVGLFEMSMPDDDQHMLKLCKVKYSDVGPLTFTASNSYGTDSCLLTLELAAPPTFESIMEDLDVSVGETPRFAVVVEGKPIPDIFWYKNDVLLSESSHFTFVYDDNE---CSLVVLNTQPDDSGVYTCTAKNLAGSVSCKAELTVHTSMTKPEKDRPMEDKETMLRRMRRLTDYYDVHKEIGRGAFSYVKRVTHKVGKMEYAAKFISARAKRKASALREMNILSHLDHERIIYFHDAFE--KKNAVIIITEICHEELLDRLTKKSTVMEAEIRSSIRQILEGIHFLHQHDILHLDIKPDNILMADSTMKITPDEAQYCKYG----------------TPEFVAPEIVNQTPVSKATDIWPVGVLTYLCLTGVSPFAGENDRSSVFNIRNYNVAFEESMFADLCHEAKGFVIK-LLVADRLRPDSSECLRHPWF 1419          

HSP 2 Score: 98.5969 bits (244), Expect = 1.787e-19
Identity = 72/264 (27.27%), Postives = 125/264 (47.35%), Query Frame = 2
Query: 9626 YYTMKKLAKGSYSRCQIVIEKSTQIEFIGKF--FEINNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVPKEDFGSRRHMGLTSP-----FSAPELLKGEPIQFNSDMWSIGILTFLCLHGH---------------LKVNFEGDQLYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWF 10351
            Y  M + A+G +   +   E +T   F+ K   +E  +      E++ ++++ H  I+ + +A   P +YLVLI E   G  +   +     + E  V   I Q++Q + YLH  R+ HLDIKP+NII+T  Y  ++K+  F +A   + F        + P     + +PE+LKG+ +   +D+WS+G++TF+ L G                L   F+  +LY       +S SA +F++K L      R +  D  ++ W 
Sbjct: 2481 YTFMDEKARGRFGVIRECRENATGNLFMAKIVPYEPESKQTVLQEYEILKSLHHDKIMALHEAYVTP-RYLVLISECCAGKEILYSLIDRFRYSEDDVVAYIVQVLQGLDYLHNRRILHLDIKPDNIIVT--YMNVVKIIDFGSA---QTFNPLFLKQFSPPIGTLDYMSPEMLKGDVVGPPADIWSVGVMTFIMLSGRLPFTDSDPAETEARILAAKFDLSKLYQN-----VSQSASLFLKKILCSYPWARPSIKDCYNNSWL 2733          

HSP 3 Score: 81.6481 bits (200), Expect = 2.023e-14
Identity = 99/460 (21.52%), Postives = 181/460 (39.35%), Query Frame = 2
Query: 5756 IKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAE----NMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTK-DGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDS---------------------SRIIVKPLCAPVLTAEYSKGADVILSWTSVATT-DTLNIIYNIEKQKSLTSTNWKKIMKNLTETTYSLSSSCLPPQESHLLRCVAISEYGFET------VSNIIEIPIRANSPILPPDKPTIIFKDATCVKISWMRGKCKNLTPEESIGKIMYSLEMKDNPKSSWQIVSNDLVDNEYSL-SLEPGVSYMFRVIAFNDFGISEPSQSL--ISRIDRLKLVPDFSV 7027
            I +P++D+ ++   ET  FE  V         W  + + I        M F    C     L + +  E   G YT +++     + S  +L ++              I PLFT+KL  +E++   N R +C++   P PK++W+  D   ++S+     ++IL E    +L+I+    +D G Y  +  N  G D   A + V +  P  S                        R  +     P+   +  +G + +L          T++  +N    K + ST  +K+ +     +  + S C       + + V  ++ G  T      V++++  P        P   P I       + +SW   K + L P    G +MY+++ +      W I+++ L    Y++ SL  GV Y FR+++      S+PS +   +  IDR   V +  V
Sbjct:  545 IVRPVRDVLVKAG-ETAVFECHVIGPQDVDVDWLSDGKLIQPALLNCKMHFDGRRC----RLLLNSVHEDDSGTYTCKLSTAKEELTSSAKLKVL------------ASIEPLFTRKLDMLEVIEGRNARFDCKVSGTPPPKVIWSHFDHPLIESE----DIRILKEGGRHSLVISHVSSDDEGFYTVVARNPHGEDECSAELYVQEPRPAISSQMAKLEKMPSIPEEPEVPESEVERFTMPDFVKPLYDLDVIEGKEAVLKCKVAGLPYPTISWFHN---GKKIDSTEDRKMTQFRDIHSLVIRSVCH--AHGGVYKSVISNKMGKATCYAHLYVTDVLPDP--------PDGAPVIESITGKTITLSWK--KPRRLDPSIDPGTLMYAVQQQALGSIQWTIIASSLKQTTYTVTSLSKGVRYAFRILSITSKAFSKPSNATDPVQLIDRGPYVQEAPV 968          

HSP 4 Score: 57.7658 bits (138), Expect = 3.407e-7
Identity = 47/176 (26.70%), Postives = 74/176 (42.05%), Query Frame = 2
Query: 10781 VTLTCQLSLLGSEPISISWYKNQELLTDDSRIKLEVIKGGFLSCTILNATETDVGIFRCIARCHSLRTETSARLVLGDVPPQPEQLSVYYTNQEEVLLKWSPYLSAIDDVIYRIDIRTIDSRNKIRNWKTIGYSV-DNRYLLENLDRTQQYIARIIAQNKYGYSPYSIATSVFQNK 11305
            VTL+C  +  GS    I+W K+++ L  D R+ +     G     I+  T+ D G++ C+A        +S +L L  +P +P    V    +   L+ W P    +    Y ++ RT        NW  +   V D  Y + +L     Y  R+   NK G  PYS   S   +K
Sbjct: 2174 VTLSCLPA--GSPHPHIAWMKDKKPLEIDQRMNMISCPDGRQLLMIMKTTKNDAGLYECVATNPLASISSSCKLSLARLPNRPGTPEVPQKYKNTALVVWRPS-DTMSPCTYSLERRT----EGESNWLIVATGVADCYYNVNDLPTGAAYRFRVACVNKAGQGPYSNLQSQIHSK 2342          

HSP 5 Score: 53.1434 bits (126), Expect = 9.496e-6
Identity = 36/133 (27.07%), Postives = 66/133 (49.62%), Query Frame = 2
Query: 11657 ITFEEFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSI----FKAPEYRYESITRYESDIWSLGILSFLLLATQLP 12043
            +   E   G  +L  L+ R  YSE  VV  I Q+L  + +LH+  ++H +I+P  I+++        +K+I   + Q    +     L    P I    + +PE     +    +DIWS+G+++F++L+ +LP
Sbjct: 2551 VLISECCAGKEILYSLIDRFRYSEDDVVAYIVQVLQGLDYLHNRRILHLDIKPDNIIVTYMNV----VKIIDFGSAQTFNPL----FLKQFSPPIGTLDYMSPEMLKGDVVGPPADIWSVGVMTFIMLSGRLP 2675          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: dapk2b (death associated protein kinase 2 [Source:NCBI gene;Acc:103026419])

HSP 1 Score: 117.087 bits (292), Expect = 4.743e-27
Identity = 85/277 (30.69%), Postives = 135/277 (48.74%), Query Frame = 2
Query: 9614 VNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFE-----INNMGIGRSEFQ----CIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEI--LKLCGFSNAVPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHG----------HLKVNFEG-DQLYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWFIKPGNNLNA 10378
            V D Y   ++L  G ++  +   EKST +E+  KF +      +  G+ R E +     +Q++ H NI+ + D        +VLI E + G  L +++ Q     E +    I Q++  V YLH  R+ H D+KPENI++      +  +KL  F  A   ED    +++  T  F APE++  EP+   +DMWSIG++T++ L G              N  G +  ++E+   + S  A  FIR+ L   T +RLT   +L+H W IKP N   A
Sbjct:   14 VEDFYEIGEELGNGQFAIVKRCKEKSTGVEYAAKFIKKRQSRASRRGVRREEIEREVNILQHLQHPNIISLHDVYENRTD-VVLILELVSGGELFDFLAQKESLSEEEATEFIKQILDGVQYLHSKRISHFDLKPENIMLLDNNVPLPRIKLIDFGLAHKIEDGVEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGESKQETMANISGMNYEFDEEFFGSTSELAKNFIRQLLTKDTRKRLTIEGALNHPW-IKPVNPRQA 288          

HSP 2 Score: 62.003 bits (149), Expect = 6.120e-9
Identity = 50/203 (24.63%), Postives = 87/203 (42.86%), Query Frame = 2
Query: 11669 EFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRY-----ESDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNTNTLLLPVPHTHFRAPKLSMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWFK 12262
            E V GG L   L  +   SE      I+Q+L  +Q+LHS  + H +++P  I++         IKLI        G   + E     K +IF  PE+    I  Y     E+D+WS+G+++++LL+   P + ++  ++     + N + +        F +         S+ ++ F+   L K    R   +  L H W K
Sbjct:   99 ELVSGGELFDFLAQKESLSEEEATEFIKQILDGVQYLHSKRISHFDLKPENIMLLDNNVPLPRIKLIDF------GLAHKIEDGVEFK-NIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGESKQET-----MANISGMNYEFDEEFFGST--------SELAKNFIRQLLTKDTRKRLTIEGALNHPWIK 281          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: si:dkey-240h12.4 (death-associated protein kinase 2-like [Source:NCBI gene;Acc:103045656])

HSP 1 Score: 112.464 bits (280), Expect = 1.545e-25
Identity = 78/290 (26.90%), Postives = 146/290 (50.34%), Query Frame = 2
Query: 9593 VQINIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEI-----NNMGIGRS----EFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEI--LKLCGFSNA---VPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQ-------------LYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWFIKPGNNLNAA 10381
             Q N+ +V D Y   + L  G + + + + E+++ + + GKF ++     + +G+ R     E + +Q + H NI+ + D      + +V++ E ++G  L +++ +  +  E +    + Q+++ V+++H  ++ H D+KPENI+++ K  E   +K+  F  A    P E++   R +  T  +  PE++  EP+   SDMWSIG++T++ L G     F+GD               + E      S+ A  FI K L+ +  ER+T+ + L H W IKP     AA
Sbjct:    2 AQFNLQNVEDFYEIGEILGSGHFGQVRELRERASGVSWAGKFVKLRRSVSSRLGLERKSVEREVEILQALQHTNIMALKDVFESRAE-VVIVVELIRGGELFDFVAEKENLTEIEAIEFLKQILKGVAFMHSKQIAHFDLKPENIMLSDKKVEHPEIKIIDFGLAQRLTPGEEY---RSLCGTPQYIGPEVINYEPLSVASDMWSIGVITYILLSGL--SPFQGDTDEETLRNIVDMKYEFEEQYFSQTSDMAKDFIEKLLIKEPSERMTAEECLLHPW-IKPLTRKQAA 284          

HSP 2 Score: 72.7886 bits (177), Expect = 1.965e-12
Identity = 53/229 (23.14%), Postives = 104/229 (45.41%), Query Frame = 2
Query: 11669 EFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRYE-----SDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNTNTLLLPVPHTHFRAPKLSMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWFKQDPQTIYEMEHQTISSTPLVDFVNAN 12340
            E + GG L   +  +   +E   +  ++Q+L  + F+HS  + H +++P  I++S +  +  +IK+I     Q +   +E  SL          P+Y    +  YE     SD+WS+G+++++LL+   P   D   ++     ++N   +       +F         + S  ++ F+   L K P++R  A+  L H W K  P T  +  +++ SS  + +F   N
Sbjct:   94 ELIRGGELFDFVAEKENLTEIEAIEFLKQILKGVAFMHSKQIAHFDLKPENIMLSDKKVEHPEIKIIDFGLAQRLTPGEEYRSLCG-------TPQYIGPEVINYEPLSVASDMWSIGVITYILLSGLSPFQGDTDEET-----LRNIVDMKYEFEEQYF--------SQTSDMAKDFIEKLLIKEPSERMTAEECLLHPWIK--PLTRKQAANRSRSSINMKNFKKFN 300          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: si:dkey-240h12.4 (death-associated protein kinase 2-like [Source:NCBI gene;Acc:103045656])

HSP 1 Score: 112.464 bits (280), Expect = 1.545e-25
Identity = 78/290 (26.90%), Postives = 146/290 (50.34%), Query Frame = 2
Query: 9593 VQINIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEI-----NNMGIGRS----EFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEI--LKLCGFSNA---VPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQ-------------LYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWFIKPGNNLNAA 10381
             Q N+ +V D Y   + L  G + + + + E+++ + + GKF ++     + +G+ R     E + +Q + H NI+ + D      + +V++ E ++G  L +++ +  +  E +    + Q+++ V+++H  ++ H D+KPENI+++ K  E   +K+  F  A    P E++   R +  T  +  PE++  EP+   SDMWSIG++T++ L G     F+GD               + E      S+ A  FI K L+ +  ER+T+ + L H W IKP     AA
Sbjct:    2 AQFNLQNVEDFYEIGEILGSGHFGQVRELRERASGVSWAGKFVKLRRSVSSRLGLERKSVEREVEILQALQHTNIMALKDVFESRAE-VVIVVELIRGGELFDFVAEKENLTEIEAIEFLKQILKGVAFMHSKQIAHFDLKPENIMLSDKKVEHPEIKIIDFGLAQRLTPGEEY---RSLCGTPQYIGPEVINYEPLSVASDMWSIGVITYILLSGL--SPFQGDTDEETLRNIVDMKYEFEEQYFSQTSDMAKDFIEKLLIKEPSERMTAEECLLHPW-IKPLTRKQAA 284          

HSP 2 Score: 72.7886 bits (177), Expect = 1.965e-12
Identity = 53/229 (23.14%), Postives = 104/229 (45.41%), Query Frame = 2
Query: 11669 EFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRYE-----SDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNTNTLLLPVPHTHFRAPKLSMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWFKQDPQTIYEMEHQTISSTPLVDFVNAN 12340
            E + GG L   +  +   +E   +  ++Q+L  + F+HS  + H +++P  I++S +  +  +IK+I     Q +   +E  SL          P+Y    +  YE     SD+WS+G+++++LL+   P   D   ++     ++N   +       +F         + S  ++ F+   L K P++R  A+  L H W K  P T  +  +++ SS  + +F   N
Sbjct:   94 ELIRGGELFDFVAEKENLTEIEAIEFLKQILKGVAFMHSKQIAHFDLKPENIMLSDKKVEHPEIKIIDFGLAQRLTPGEEYRSLCG-------TPQYIGPEVINYEPLSVASDMWSIGVITYILLSGLSPFQGDTDEET-----LRNIVDMKYEFEEQYF--------SQTSDMAKDFIEKLLIKEPSERMTAEECLLHPWIK--PLTRKQAANRSRSSINMKNFKKFN 300          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: trioa (trio Rho guanine nucleotide exchange factor a [Source:NCBI gene;Acc:557667])

HSP 1 Score: 116.316 bits (290), Expect = 6.547e-25
Identity = 98/383 (25.59%), Postives = 183/383 (47.78%), Query Frame = 2
Query: 9293 PTILNCLPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIFSSYRTVITEDKEQGTYSLLISKCILSDGGEYSIRAENAIGFAEVKFNLRVDAHPEKKSVQINIGDVNDRYYT-MKKLAKGSYS---RC-QIVIEKSTQIEFIGKFFEINNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNE-ILKLCGFSNAVPKEDFGSRRHMGLTSP-FSAPELLKGEPIQFNSDMWSIGILTFLCLHGH---LKVNFEG--------DQLYNEDSNDAISNSACVFIRKCLLLKT--GERLTSSDSLSHEWFIKPGNNLNAA 10381
            P +L  L + +    E  ++  ++  +P   + W+  ++   ++         E G  +L I      D G Y+  A N IG      +LRV + P    +++   D  + +YT + +L +G ++   RC Q   +++  ++ + K     +      E   ++ + H +IV + D    P  Y +++    QG  L +YI    +  E +V   +  +++A+ YLH  R+ HLD+KPEN+++    ++ ++KL  F +AV + +     H  L SP F+APEL+ G+P+   SD+WS+G++T++ L G    L  + E         D  + ED    +S +A  F+  CLLL+    +R  ++  L   W ++PG    +A
Sbjct: 2650 PEMLVPLSDVTCDKGECVTLRCKVCGRPKATITWKGPYQNTLTNNGHFSIAYSETGEATLRIVGVASEDDGVYTCIATNDIGSVTSSASLRVLS-PSSDGIRVMWKDNFESFYTEVAELGRGRFAVVKRCDQKGSKRTVAVKLVNKKLMKRDQVT--QELSILKRLQHPHIVCLQDTFETPGSYALVLEMADQG-RLLDYIVSWGNLTEEKVAFYLRDILEALHYLHNCRIAHLDVKPENLLVDQSSSQPVVKLTDFGDAV-QLNSAHYVHPLLGSPEFAAPELVLGDPVSLTSDLWSLGVVTYVMLSGASPFLDESVEETCLNICRLDFSFPEDYFQGVSQAARDFM--CLLLRVEPSKRPPAATCLQEPW-LRPGGGRRSA 3024          

HSP 2 Score: 59.3066 bits (142), Expect = 1.389e-7
Identity = 61/290 (21.03%), Postives = 127/290 (43.79%), Query Frame = 2
Query: 11417 SSDDIRM---NVIREHYSTLSQKSSG-FAVLKL---KNTNVNFPEYIV-QRTFKMEDICPAFDLCVRIKYYHFPILFGEICDSSLGNRITFEEFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRYESDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNTNTLLLPVPHTHFRAPKLSMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWFK 12262
            SSD IR+   +     Y+ +++   G FAV+K    K +       +V ++  K + +     +  R+++ H   L       + G+     E    G LL  +++    +E  V   +R +L  + +LH+  + H +++P  +L+ + ++Q   +KL    +   + +      L    P  F APE          SD+WSLG++++++L+   P ++++  ++ ++ C      L    P  +F+          S+++R F+   L+  P+ R  A   L   W +
Sbjct: 2745 SSDGIRVMWKDNFESFYTEVAELGRGRFAVVKRCDQKGSKRTVAVKLVNKKLMKRDQVTQELSILKRLQHPHIVCLQDTF--ETPGSYALVLEMADQGRLLDYIVSWGNLTEEKVAFYLRDILEALHYLHNCRIAHLDVKPENLLVDQSSSQPV-VKLTDFGDAVQLNSAHYVHPLLG-SPE-FAAPELVLGDPVSLTSDLWSLGVVTYVMLSGASPFLDESVEETCLNIC-----RLDFSFPEDYFQG--------VSQAARDFMCLLLRVEPSKRPPAATCLQEPWLR 3016          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004663.1 (pep scaffold:Pmarinus_7.0:GL479759:1154:24713:-1 gene:ENSPMAG00000004240.1 transcript:ENSPMAT00000004663.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 115.161 bits (287), Expect = 3.139e-25
Identity = 116/570 (20.35%), Postives = 236/570 (41.40%), Query Frame = 2
Query: 8792 VNYSYSDEEGWSVFKTNIKKNRVDIADLDPNINYQLRIVPVTDFGIGKPSMVIKKIRRSDNLNSPTTEKAMMLQEKHCLAVPMFCC------LSQKAELKFTKLMEYKLDKITWTFNNAKVDVNDERYKI-FSAETYGIYFI-IKNLEEDDFGEY--CALDEVQDPIQSFILIKSDAPTILNCLPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIFSSYRTVITEDKEQGTYSLLISKCILSDGGEYSIRAENAIG----FAEVKFNLRVDAHPEKKSVQINIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEINNMG--IGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNA---VPKEDFGSRRHMGLTSP-FSAPELLKGEPIQFNSDM-WSIGILTFLCLHGHLKVNFEGDQL-----------YNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWFIKPGNNLNAALDYIIDQI 10405
            + Y       W V  +N+      +  L P ++Y  R + V+  G  +PS            ++PT    ++  E      P F          +   L+ T  + +    ++WT     + V++   ++  S+   G + + +     +  GE    A  E      + ++ +++AP     + +  +   +   +SV +  +P P+V+W ++  ++  +   + +  +     SLL+     SD G Y+  A +  G     AE+   +      +++  +  +  + D Y  ++++ +G++   + V   S       K      +       E +    ++H  +V + DA     + ++++ E      L + + +     E QV++ I Q+++ +SYLH   + HLDI+P NI+M     + +K+  F  A   VP    GS ++    +P F +PE+ +  P+   SD+ W +G++T++CL G      E D+            ++E +    S  A  FI + L+   G R  + D L H WF K    L A  +   D++
Sbjct:  222 LQYQVVGRSQWIVVASNVPGTSHAVRTLRPGLHYLFRALTVSPHGCSRPSPA----------SAPT---CLLPHEPFLNEPPRFVKKYEEIFAVENEPLEITCRLNHVQATVSWTRCRDGIPVDESSGEVRLSSRPGGTWALEMPRARAELLGELVCTARGEFGSDSYTAVVSQAEAPHFEVIMEDVEVQEGDPVRLSVVVHGRPEPDVLWYKDGARLAEAG-GLASVTRSGSACSLLLRDVRGSDRGLYACEARSRAGTARCMAELTVRMEKSEARQREMPEEEVRKLKDHYEILEEIGRGAFGSVRRVRALSGGSPCAAKSLPRGRVRREAAERELRVAARLAHERVVCLHDAFRS-RRRVIIVMELCSNEELLDRLVKKPALYEHQVKMYIKQILEGISYLHSINILHLDIEPSNILMADAGKDDIKISDFGFAQEVVP----GSPQYSEFGTPEFVSPEVARHSPVYKASDIWWPVGVITYVCLSGLSPFLGENDRATLLNVTRKTLNFDERTAAITSREAQDFISRVLVQDIGRRPLADDCLKHPWF-KSFTTLRAVTNISTDRL 771          

HSP 2 Score: 70.0922 bits (170), Expect = 1.336e-11
Identity = 89/360 (24.72%), Postives = 148/360 (41.11%), Query Frame = 2
Query: 5927 LTIPAAGEKHCGKYTIQVANDMGCVR-------SDGRLSLMLRSEISEQ-MMESCC-----------IAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRIIVKPLCAPVLTAEYSKGADVILSWTS----VATTDTLNIIYNIEKQKSLTSTNWKKIMKNLTETTYSLSSSCLPPQESHLLRCVAISEYGFETVSNIIEIPIRANSPILPP-----DKPTIIFK------------DATC------VKISWMRGKCKNLTP-EESIGKIMYSLEMKDNPKSSWQI 6865
            L++P A  +  G+YT+  AN  G V        S+ R      S IS++ MM S              AP F++ L D+ +L      L CR      P++ W + GE +    L  RV   +E   F LII  A++ D+G Y C+ +N  G     A + V D+ P   D   I+        +T +      V LSW       A ++  ++ Y ++ Q  +  + W  +  N+  T++++ +  L P   +L R + +S +G    S     P  A + +LP      + P  + K            + TC        +SW R  C++  P +ES G++  S      P  +W +
Sbjct:   21 LSVPHASAEDEGEYTVTAANTHGEVSCSCTLIVSEPRAPHA--SNISKRDMMPSIAEEPELGEAERDAAPDFSQPLCDVAVLEGGCAVLECRGQARIPPQVSWLRQGEQVP---LGGRVTSKEENGTFRLIIQSAKLADAGVYKCILSNSAGRAFCHAHLHVVDATPGPPDGPPIVTD------VTDD-----SVTLSWKPPKAFQAFSEPGSVTYALQYQ-VVGRSQWIVVASNVPGTSHAVRT--LRPGLHYLFRALTVSPHGCSRPS-----PASAPTCLLPHEPFLNEPPRFVKKYEEIFAVENEPLEITCRLNHVQATVSWTR--CRDGIPVDESSGEVRLS----SRPGGTWAL 350          

HSP 3 Score: 53.9138 bits (128), Expect = 1.174e-6
Identity = 51/180 (28.33%), Postives = 82/180 (45.56%), Query Frame = 2
Query: 10676 SADRLSVSNTTKEL-LFTVPLKDQTFKSDSTAGKITVTLTCQLSLLGSEPISISWYKNQELLTDDSRIKLEVIKGGFLSCTILNATETDVGIFRCIARCHSLRTETSARLVLGDVPPQ-----PEQLSVYYTNQEEVLLKWSPYLSAIDDVIYRIDIRTIDSRNKIRNWKTIGYSVDNRY 11197
            S+ R S+++ ++ L  FTV LKD+            VTL C  S  GS   +ISW K+++LL  D R++L     G    TI+ A   D G++ C+A  +SL   T++  +    PP      PE   V+ +     L+ W P + A   + Y ++I           WK +   + + Y
Sbjct: 1444 SSSRDSLASVSQSLPAFTVKLKDELLVEGEP-----VTLCC--SPTGSPAPTISWLKDRKLLEPDERVRLAGSADGRQLLTIVRAGMADAGVYECMA-VNSLGIATTSCTLARAEPPSWTGAAPEVPQVFESG---ALVVWKP-VQARTPLTYCLEITV----GPGEPWKEVASGLSDTY 1607          

HSP 4 Score: 53.5286 bits (127), Expect = 1.332e-6
Identity = 47/175 (26.86%), Postives = 71/175 (40.57%), Query Frame = 2
Query: 6077 PLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLI-ITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRIIVKPLCAPVLTAEYSKGADVILSWTSVATTDTLNIIYNIEKQKSLTSTNWKKIMKNLTETTYSLSSSC 6598
            P FT KLKD  ++  E + L C     P P I W KD + L+    + RV++        L+ I  A + D+G Y C+  N LG  TT   +    +EP     +        AP +   +  GA V+  W  V     L     I          WK++   L++T + +   C
Sbjct: 1458 PAFTVKLKDELLVEGEPVTLCCSPTGSPAPTISWLKDRKLLEP---DERVRLAGSADGRQLLTIVRAGMADAGVYECMAVNSLGIATTSCTL--ARAEPPSWTGA--------APEVPQVFESGALVV--WKPVQARTPLTYCLEITVGP---GEPWKEVASGLSDTYHHVGGLC 1614          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000175.1 (pep scaffold:Pmarinus_7.0:GL476590:10927:25170:1 gene:ENSPMAG00000000155.1 transcript:ENSPMAT00000000175.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.4413 bits (241), Expect = 2.769e-21
Identity = 68/269 (25.28%), Postives = 127/269 (47.21%), Query Frame = 2
Query: 9629 YTMKK---LAKGSYSRCQIVIEKSTQIEFIGKFF---------EINNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSH-WCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAV---PKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQL-----------YNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWFI 10354
            Y++K+   L  G + R    +E+++ +    K           E+NN      E   +  + H N+++++DA    + + VLI E + G  L + I    +   E    I I Q+ + + Y+H+  + HLD+KPENI+   +    +K+  F  A    P+E    + H G T  F APE++  + + F +DMWS+G++ ++ L G      E D             +++++ + +S  A  FI + L+ +   R+++S  L H W +
Sbjct:   31 YSIKQKDVLGGGRFGRVHKCVERTSGMTLAAKVIKAKGVKEKDEVNN------EISIMNQLKHNNLLQLYDAYESKNDF-VLIMEYIHGGELFDRIVSEDYNLTELDAIIFIRQICEGIHYMHQQYILHLDLKPENILCVNRKGNQIKIIDFGLARRYKPREKL--KVHFG-TPEFLAPEVVNYDYVSFPTDMWSLGVIAYMLLSGLSPFMGEDDNETLTNIVNVNWDFDDEAFENVSEEAKDFISRLLIKEKSGRMSASQCLKHNWLV 289          

HSP 2 Score: 60.077 bits (144), Expect = 4.980e-9
Identity = 48/204 (23.53%), Postives = 91/204 (44.61%), Query Frame = 2
Query: 11669 EFVPGGNLLSVLMARSV-YSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKIL-ISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRYE-----SDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNTNTLLLPVPHTHFRAPKLSMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWF 12259
            E++ GG L   +++     +E   +  IRQ+   I ++H   ++H +++P  IL ++R+ NQ   IK+I           K +E L  H    F  PE+    +  Y+     +D+WSLG+++++LL+   P + +   D++    + N N                      S+ ++ F+   L K  + R +A   L H+W 
Sbjct:  108 EYIHGGELFDRIVSEDYNLTELDAIIFIRQICEGIHYMHQQYILHLDLKPENILCVNRKGNQ---IKIIDF---GLARRYKPREKLKVH----FGTPEFLAPEVVNYDYVSFPTDMWSLGVIAYMLLSGLSPFMGE--DDNETLTNIVNVNWDF-----------DDEAFENVSEEAKDFISRLLIKEKSGRMSASQCLKHNWL 288          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: mylk3 (myosin light chain kinase 3 [Source:NCBI gene;Acc:561635])

HSP 1 Score: 96.2857 bits (238), Expect = 3.197e-21
Identity = 74/273 (27.11%), Postives = 130/273 (47.62%), Query Frame = 2
Query: 9644 LAKGSYSRCQIVIEKSTQIEFIGKFFEINNMGIG---RSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNA---VPKE----DFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGH---------------LKVNFEGD-QLYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWFIKPGNNLNAAL 10384
            L  G + R     EKS+ +    K   + +       ++E   +  ++H N+V++FDA       + LI E ++G  L   I   S   E    + + Q+ + V Y+H+  + HLD+KPENI+   ++   +K+  F  A    P+E     FG       TS F APE++  E + F +DMWS+G++T++ L G                +  N+E D ++++E S DA      + ++     K   RL++  +L H+W +K  +NL++ L
Sbjct:   33 LGGGRFGRVMRCQEKSSGLTLAAKVIRVKSPKEKEEVKNEINIMNQLNHVNLVQLFDAYESRSD-ITLIMEYVEGGELFNRIIDQSGLSELDTVLFVRQICEGVHYMHQQYILHLDLKPENILCLSRWGYQIKIIDFGLARRYKPREKLKVSFG-------TSEFLAPEVVNYEFVSFPTDMWSVGVITYMLLSGLSPFLGDDESETLNNIVTSNWEFDGEVFSEVSEDAKDFITNLLVKG----KKRWRLSAKGALQHQWLLK--SNLHSRL 291          

HSP 2 Score: 59.6918 bits (143), Expect = 4.866e-9
Identity = 37/135 (27.41%), Postives = 70/135 (51.85%), Query Frame = 2
Query: 11669 EFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESL-TTHKPSIFKAPEYRYESITRYESDIWSLGILSFLLLATQLPAIEDACSDS 12070
            E+V GG L + ++ +S  SE   V  +RQ+   + ++H   ++H +++P  IL   R    + IK+I   +       K +E L  +   S F APE        + +D+WS+G+++++LL+   P + D  S++
Sbjct:  102 EYVEGGELFNRIIDQSGLSELDTVLFVRQICEGVHYMHQQYILHLDLKPENILCLSR--WGYQIKII---DFGLARRYKPREKLKVSFGTSEFLAPEVVNYEFVSFPTDMWSVGVITYMLLSGLSPFLGDDESET 231          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010891.1 (pep scaffold:Pmarinus_7.0:GL476752:24038:27952:-1 gene:ENSPMAG00000009868.1 transcript:ENSPMAT00000010891.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 91.6633 bits (226), Expect = 3.678e-20
Identity = 62/214 (28.97%), Postives = 104/214 (48.60%), Query Frame = 2
Query: 9749 SEFQCIQNISHRNIVEIFDAIAMPD-QYLVLIYEKLQGLSLAEYITQLSH-WCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHG-----------HLKVNFEGDQLYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWF 10351
            +E Q +   SH N++++ D   + D + +VL+ E ++G  L E ++       E +V  I+ QL  A+ +LH   V HLD+KPE + +  + ++ LK+ G   A+  +D     H      F+APE++  E + FN+D W +G+L  + L G            +K          E+   A+S  A  FI K L+    +RL  +D+L H W 
Sbjct:   36 NEAQLLYGASHPNVLQLLDVYHLLDTKQMVLVTEPVEGGELFERLSGKGFALTERKVSGILKQLCLALQHLHSLNVLHLDVKPECLWLASRESDELKVAGLGCALRYQDNLKAPHQIPVPEFAAPEVVANEVVTFNTDAWPVGLLACVMLSGVSPFWDQWDSETVKKVVAATYSLPEEEFKAVSRPAREFISKLLVKAPPKRLGVADALKHPWL 249          

HSP 2 Score: 64.6994 bits (156), Expect = 5.400e-11
Identity = 59/206 (28.64%), Postives = 98/206 (47.57%), Query Frame = 2
Query: 11657 ITFEEFVPGGNLLSVLMARS-VYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESL-TTHKPSI--FKAPEYRYESITRYESDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNTNTLLLPVPHTHFRAPKLSMLHRFSKSSRKFVHNSLKKSPNDR-GNADYWLAHSWF 12259
            +   E V GG L   L  +    +E  V  I++QL   +Q LHS NV+H +++P  + ++ R  +S ++K+ GL  C     ++ Q++L   H+  +  F APE     +  + +D W +G+L+ ++L+   P   D      V   V  T +L    P   F+A         S+ +R+F+   L K+P  R G AD  L H W 
Sbjct:   65 VLVTEPVEGGELFERLSGKGFALTERKVSGILKQLCLALQHLHSLNVLHLDVKPECLWLASR--ESDELKVAGL-GC----ALRYQDNLKAPHQIPVPEFAAPEVVANEVVTFNTDAWPVGLLACVMLSGVSP-FWDQWDSETVKKVVAATYSL----PEEEFKA--------VSRPAREFISKLLVKAPPKRLGVADA-LKHPWL 249          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: stk17b (serine/threonine kinase 17b (apoptosis-inducing) [Source:ZFIN;Acc:ZDB-GENE-040426-1499])

HSP 1 Score: 93.9745 bits (232), Expect = 4.640e-20
Identity = 66/264 (25.00%), Postives = 119/264 (45.08%), Query Frame = 2
Query: 9644 LAKGSYSRCQIVIEKSTQIEFIGKFFEINNMGIGRSEFQCIQNISHR-----------NIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLS-HWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYN-EILKLCGFSNAVPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQ-----------LYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWFIKPG 10363
            L +G ++  +  +E +T IEF  KF      G       C  +++H            +I+++ DA   P + ++++   + G    + + +    + E  VR ++ Q+++ V++LH + V HLD+KP+NI++T       +K+  F  +         R +  T  + APE+L  EPI   +DMWS+G+L ++ L G      E  Q            Y  +  + +S  A  FI++ L+     R T+   L H W    G
Sbjct:    1 LPRGKFAVVRRCVEVATGIEFAAKFLRKRRKGQ-----DCRADVTHEMAILEAARSCPHIIDLHDAFETPTEIILVLEYAVGGEIFNQCVAEGEDAFTEVDVRRLMRQILEGVAFLHRNDVVHLDLKPQNILLTSASPLGDIKIVDFGLSRRVNSAEELREIMGTPEYVAPEVLNYEPISKATDMWSVGVLAYVMLTGESPFLGEDKQETFLNVSQLNVSYEPEVFEGVSVQAVAFIQQLLVKAPHRRATAEHCLRHPWLSARG 259          

HSP 2 Score: 70.0922 bits (170), Expect = 3.563e-12
Identity = 52/201 (25.87%), Postives = 102/201 (50.75%), Query Frame = 2
Query: 11669 EFVPGGNLLSVLMARS--VYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKE-QESLTTHKPSIFKAPE-YRYESITRYESDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNTNTLLLPVPHTHFRAPKLSMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWF 12259
            E+  GG + +  +A     ++E  V  ++RQ+L  + FLH N+VVH +++P  IL++  +    DIK++     + V + +E +E + T +   + APE   YE I++  +D+WS+G+L++++L  + P + +   ++ ++  V   N    P            +    S  +  F+   L K+P+ R  A++ L H W 
Sbjct:   73 EYAVGGEIFNQCVAEGEDAFTEVDVRRLMRQILEGVAFLHRNDVVHLDLKPQNILLTSASPLG-DIKIVDFGLSRRVNSAEELREIMGTPE---YVAPEVLNYEPISKA-TDMWSVGVLAYVMLTGESPFLGEDKQETFLN--VSQLNVSYEP-----------EVFEGVSVQAVAFIQQLLVKAPHRRATAEHCLRHPWL 255          
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Match: SNF1 (AMP-activated S/T protein kinase; forms a complex with Snf4p and members of the Sip1p/Sip2p/Gal83p family; required for transcription of glucose-repressed genes, thermotolerance, sporulation, and peroxisome biogenesis; regulates nucleocytoplasmic shuttling of Hxk2p; regulates filamentous growth and acts as a non-canonical GEF, activating Arf3p during invasive growth; SUMOylation by Mms21p inhibits its function and targets Snf1p for destruction via the Slx5-Slx8 Ub ligase [Source:SGD;Acc:S000002885])

HSP 1 Score: 86.6557 bits (213), Expect = 3.910e-17
Identity = 65/259 (25.10%), Postives = 123/259 (47.49%), Query Frame = 2
Query: 9626 YYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEINNMGIGRSEFQC--------IQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVPKEDFGSRRHMGLTSP-FSAPELLKGEPIQFNS-DMWSIGILTFLCLHGHLKVNFEG-DQLYNEDSNDA------ISNSACVFIRKCLLLKTGERLTSSDSLSHEWF 10351
            Y  +K L +GS+ + ++    +T  +   K   IN   + +S+ Q         ++ + H +I++++D I   D+ +++I  +  G  L +YI Q     E + R    Q+I AV Y H H++ H D+KPEN+++    N  +   G SN +   +F         SP ++APE++ G+       D+WS G++ ++ L   L  + E    L+   SN        +S  A   I++ L++    R++  + +  +WF
Sbjct:   55 YQIVKTLGEGSFGKVKLAYHTTTGQKVALKI--INKKVLAKSDMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVI--EYAGNELFDYIVQRDKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNF---LKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPGAAGLIKRMLIVNPLNRISIHEIMQDDWF 306          
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Match: RAD53 (DNA damage response protein kinase; required for cell-cycle arrest, regulation of copper genes in response to DNA damage; phosphorylates nuclear pores to counteract gene gating, preventing aberrant transitions at forks approaching transcribed genes; activates downstream kinase Dun1p; differentially senses mtDNA depletion, mitochondrial ROS; relocalizes to cytosol under hypoxia; human homolog CHEK2 implicated in breast cancer can complement yeast null mutant [Source:SGD;Acc:S000006074])

HSP 1 Score: 85.5001 bits (210), Expect = 1.170e-16
Identity = 69/267 (25.84%), Postives = 124/267 (46.44%), Query Frame = 2
Query: 9644 LAKGSYSRCQIVIEKST----QIEFIGKFFEINNM-GIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVPKEDFGSRRHMGLTSPFSAPELLKGE-----PIQFNS--------DMWSIGILTFLCLHGHLKVNFEG---DQLYNEDSNDA----------ISNSACVFIRKCLLLKTGERLTSSDSLSHEWF 10351
            + +G+++  +  IE++T     ++ I K   I NM G+ R E + +Q ++H  IV +       + Y  ++ E + G  L +++       E   R I  Q++ A+ Y+H   + H D+KP+NI++      ++K+  F  A  + +    +    T  + APE+++G+     P ++          DMWS+G L ++ L GHL   F G   DQLY +    +          IS  A  FI   L +    R T++ +L+H W 
Sbjct:  204 VGQGAFATVKKAIERTTGKTFAVKIISKRKVIGNMDGVTR-ELEVLQKLNHPRIVRLKGFYEDTESYY-MVMEFVSGGDLMDFVAAHGAVGEDAGREISRQILTAIKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPEVIRGKDTSVSPDEYEERNEYSSLVDMWSMGCLVYVILTGHLP--FSGSTQDQLYKQIGRGSYHEGPLKDFRISEEARDFIDSLLQVDPNNRSTAAKALNHPWI 466          

HSP 2 Score: 72.7886 bits (177), Expect = 9.311e-13
Identity = 57/210 (27.14%), Postives = 89/210 (42.38%), Query Frame = 2
Query: 11669 EFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQ--ESLTTHKPSIFKAPEY-----RYESITRYES--DIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNTNTLLLPVPHTHFRAPKLSMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWFKQDP 12271
            EFV GG+L+  + A     E     I RQ+L  I+++HS  + H +++P  ILI +       I   GL   Q  G+  +    +L    P + +  +       YE    Y S  D+WS+G L +++L   LP    + S  D          L   +    +    L    R S+ +R F+ + L+  PN+R  A   L H W K  P
Sbjct:  274 EFVSGGDLMDFVAAHGAVGEDAGREISRQILTAIKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPEVIRGKDTSVSPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPF---SGSTQD---------QLYKQIGRGSYHEGPLKDF-RISEEARDFIDSLLQVDPNNRSTAAKALNHPWIKMSP 470          
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Match: DUN1 (Cell-cycle checkpoint S/T protein kinase; required for transient G2/M arrest after DNA damage, damage-induced transcription, and nuclear-to-cytoplasmic redistribution of Rnr2p-Rnr4p after genotoxic stress and iron deprivation; phosphorylates repair protein Rad55p, transcriptional repressor Sml1p, superoxide dismutase, and ribonucleotide reductase inhibitors Crt1p and Dif1p; functions in the Mec1p pathway to regulate dNTP pools and telomere length; postreplicative repair role [Source:SGD;Acc:S000002259])

HSP 1 Score: 81.6481 bits (200), Expect = 1.126e-15
Identity = 75/285 (26.32%), Postives = 114/285 (40.00%), Query Frame = 2
Query: 9620 DRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEINNMGIG------RSEFQCIQNISHRNIVEIFDAIAMP------DQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIM--TGKYNEILKLCG------FSNAVPKEDFGSRRHMGL---------TSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHG-----------HLKVN-FEGDQLYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWF 10351
            D+Y   K+L  G Y+  +    K T  +   K F              R E   +  + H NIV + D+   P       +YLVL  EK+    L E I + +   + + + +  QL+  + YLHE  + H DIKPENI++  T + N      G          V   DFG  +  G          T  + APE+L  +      D+WS G++ ++CL G            LK    +    +     D I +S    I   L+L   ER    ++L+H WF
Sbjct:  198 DKYLLGKELGAGHYALVKEAKNKKTGQQVAVKIFHAQQNDDQKKNKQFREETNILMRVQHPNIVNLLDSFVEPISKSQIQKYLVL--EKIDDGELFERIVRKTCLRQDESKALFKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENPSQVQLGPWDEDEIDIQVKIADFGLAKFTGEMQFTNTLCGTPSYVAPEVLTKKGYTSKVDLWSAGVILYVCLCGFPPFSDQLGPPSLKEQILQAKYAFYSPYWDKIDDSVLHLISNLLVLNPDERYNIDEALNHPWF 480          

HSP 2 Score: 50.8322 bits (120), Expect = 3.766e-6
Identity = 49/212 (23.11%), Postives = 88/212 (41.51%), Query Frame = 2
Query: 11669 EFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKIL--ISRRTNQS-------------FDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRYESDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNTNTLLLPVPHTHFRAPKLSMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWF 12259
            E +  G L   ++ ++   +     + +QLL  +++LH  N++H +I+P  IL  I+RR N S               +K+      +F G ++   +L    PS + APE   +     + D+WS G++ ++ L    P   D      +          +L   +  F +P      +   S    + N L  +P++R N D  L H WF
Sbjct:  283 EKIDDGELFERIVRKTCLRQDESKALFKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENPSQVQLGPWDEDEIDIQVKIADFGLAKFTGEMQFTNTLCG-TPS-YVAPEVLTKKGYTSKVDLWSAGVILYVCLCG-FPPFSDQLGPPSLK-------EQILQAKYA-FYSP---YWDKIDDSVLHLISNLLVLNPDERYNIDEALNHPWF 480          
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Match: GIN4 (Protein kinase involved in bud growth and assembly of the septin ring; proposed to have kinase-dependent and kinase-independent activities; undergoes autophosphorylation; similar to Hsl1p; GIN4 has a paralog, KCC4, that arose from the whole genome duplication [Source:SGD;Acc:S000002915])

HSP 1 Score: 82.4185 bits (202), Expect = 1.157e-15
Identity = 68/221 (30.77%), Postives = 102/221 (46.15%), Query Frame = 2
Query: 9737 GIGRSEFQCIQNISHRNIVEIFDAIAM-PDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVPKEDFGSRRHMGLTSP-FSAPELLKGEPIQ-FNSDMWSIGILTFLCLHGHLKVNFEGDQL-----------YNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWFIK 10357
            GI R E   ++ ++H N++ ++D      D YLVL Y   +   L   + +     E +      Q+I  VSY H   + H D+KPEN+++  KYN  +K+  F  A   E  G        SP ++APE++ G P Q F SD+WS G++ F  L G L  + E   +           +   S+D IS  A   IRK L +    R+ + D L H    K
Sbjct:   77 GIER-EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEY--AEKGELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYN--IKIADFGMAA-LETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQK 291          

HSP 2 Score: 58.151 bits (139), Expect = 2.968e-8
Identity = 52/226 (23.01%), Postives = 92/226 (40.71%), Query Frame = 2
Query: 11669 EFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTH--KPSIFKAPEYRYESITRYESDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNTNTLLLPVPHTHFRAPKLSMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWFKQ-----DPQTIYEMEHQTISSTPLVD 12325
            E+   G L ++L+ R    E   +   RQ++  + + H+  +VH +++P  +L+  + N    I   G+   +  G + E    + H   P I     Y+      + SD+WS G++ F LL  +LP  E+            N  TLLL V    F  P    +   S+ ++  +   L   P  R      L H   ++     D ++I  +  +    TPL +
Sbjct:  111 EYAEKGELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYN--IKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQG-----FASDVWSCGVILFALLTGRLPFDEEDG----------NIRTLLLKVQKGEFEMPSDDEI---SREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKSIRGLPREDTYLTPLSE 316          
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Match: HSL1 (Nim1p-related protein kinase; septin-binding kinase that localizes to the bud neck septin ring and regulates the morphogenesis checkpoint; phosphorylates Hsl7p and cooperates with Elm1p to recruit Hsl7p to the mother-bud neck, as a prerequisite for the subsequent recruitment, phosphorylation, and degradation of Swe1p; autophosphorylation enhances interactions with Hsl7p [Source:SGD;Acc:S000001584])

HSP 1 Score: 82.4185 bits (202), Expect = 1.342e-15
Identity = 68/230 (29.57%), Postives = 107/230 (46.52%), Query Frame = 2
Query: 9722 EINNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQ-YLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFS-------NAVPKEDFGSRRHMGLTSPFSAPELLKGEPIQFN-SDMWSIGILTFLCLHGHLKVNFEG---------DQLYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWFIK 10357
            + N  GI R E   ++ ISH N++ +F+      + YLVL Y  + G  L +Y+       E +      Q+++ VSY H   +CH D+KPEN+++  K N  +K+  F        N + K   GS         +++PE++ G P     SD+WS GI+ F  L GHL  N +             Y   SN  +S+ A   I K L++   +R+T+ + L H    K
Sbjct:  155 QTNPYGIER-EIVIMKLISHTNVMALFEVWENKSELYLVLEY--VDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLL-DKKNRRIKIADFGMAALELPNKLLKTSCGSPH-------YASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPSN--LSSEARDLISKILVIDPEKRITTQEILKHPLIKK 371          

HSP 2 Score: 52.7582 bits (125), Expect = 1.600e-6
Identity = 48/201 (23.88%), Postives = 80/201 (39.80%), Query Frame = 2
Query: 11669 EFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTH--KPSIFKAPEYRYESITRYESDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNTNTLLLPVPHTHFRAPKLSMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWFKQ 12265
            E+V GG L   L+++    E   +   +Q++  + + HS N+ H +++P  +L+ ++ N+   I   G+   +    + +    + H   P I     Y         SD+WS GI+ F LL   LP  +D            N   LLL V     ++ K  M    S  +R  +   L   P  R      L H   K+
Sbjct:  194 EYVDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKK-NRRIKIADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHG-----GPSDVWSCGIVLFALLTGHLPFNDD------------NIKKLLLKV-----QSGKYQMPSNLSSEARDLISKILVIDPEKRITTQEILKHPLIKK 371          
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Match: OBSCURIN (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGL2])

HSP 1 Score: 108.997 bits (271), Expect = 3.629e-25
Identity = 78/268 (29.10%), Postives = 129/268 (48.13%), Query Frame = 2
Query: 9611 DVNDRYYTMK-KLAKGSYSRCQIVIEKSTQIEFIGKFFEINNMGIGRS---EFQCIQNISHRNIVEIFDAIAMPDQY-LVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAV---PKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQLYNEDSN-------------DAISNSACVFIRKCLLLKTGERLTSSDSLSHEWF 10351
            D   +YYT+K +L KG +      + K T  +F  KF + +          E + +  I H+ ++ + DA   P Q  ++L+ E + G  L E + +     E+ V   + Q+++ + ++H+  V HLD+KPENI++  + +  +KL  F  A    PKE+    + M  T  F APE+L  + I   +DMWSIG++ ++ L G     F GD      +N             D IS+ A  FI K L+LK   R++ +  + H W 
Sbjct:   15 DAITKYYTIKDELGKGRFGVVCKCVNKKTGKQFAAKFIKCSKPQDREDVIHEMEIMNTIRHKRLLRLADAFETPSQQEMILVMELVTGGELFEKVVEEEFISENDVTHYMKQILEGLEHMHKQEVLHLDLKPENIMIVKQDSRQIKLIDFGLARKYNPKENL---KVMFGTPEFVAPEVLTYDRITPATDMWSIGVIAYVLLSGL--SPFMGDNDAETLANVQTAEWDFDDPVFDDISDEAKDFIEKLLVLKATARISVAKCMEHPWL 277          

HSP 2 Score: 53.5286 bits (127), Expect = 8.278e-7
Identity = 34/134 (25.37%), Postives = 68/134 (50.75%), Query Frame = 2
Query: 11669 EFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRYE-----SDIWSLGILSFLLLATQLPAIED 12055
            E V GG L   ++     SE  V   ++Q+L  ++ +H   V+H +++P  I+I ++ ++   IKLI   +         +E+L      +F  PE+    +  Y+     +D+WS+G+++++LL+   P + D
Sbjct:   98 ELVTGGELFEKVVEEEFISENDVTHYMKQILEGLEHMHKQEVLHLDLKPENIMIVKQDSRQ--IKLI---DFGLARKYNPKENLKV----MFGTPEFVAPEVLTYDRITPATDMWSIGVIAYVLLSGLSPFMGD 222          
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Match: EDO49547 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGL1])

HSP 1 Score: 105.145 bits (261), Expect = 1.608e-24
Identity = 74/247 (29.96%), Postives = 125/247 (50.61%), Query Frame = 2
Query: 9668 CQIVIEKSTQIEFIGKF--FEINNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVPKEDFGSRRHMGLTSP-FSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQLYNEDS-NDAISNSACVFIRKC--------------LLLKT-GERLTSSDSLSHEWF 10351
            CQ V   +TQ +F+ K   ++  +      EF   + I    +V + +A  +   YLVLI ++L G  + ++++  +   E    ++I  ++ A+ YLHE  + HLDI+P NI++ G     +KL  F NA   +       + + +P F+APE+L  EP+   +DMWS+GI+T+  L G L   F GD   N+D+  +A+  + C F+ +               LL K   +RL  + +L+HEW 
Sbjct:    9 CQDV---TTQKDFVAKLIRYDEEDREDAVQEFSVHRGIDCNQVVRLHNAFLLR-SYLVLIMDRLDGEDVLKFMSSKTKVTEEDAALVIRGILNALCYLHELNIVHLDIRPANIMVQGSD---VKLIDFGNARKLKSRHGEVGVVVGNPSFTAPEVLSFEPVNMAADMWSVGIVTYALLSGQLP--FPGD---NDDAVEEAVKQARCTFVGRAFRSLTDHSKGFIEKLLYKIPSKRLEVAGALTHEWL 243          

HSP 2 Score: 72.0182 bits (175), Expect = 3.629e-13
Identity = 52/193 (26.94%), Postives = 87/193 (45.08%), Query Frame = 2
Query: 11681 GGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRYESDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNTNTLLLPVPHTHFRAPKLSMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWF 12259
            G ++L  + +++  +E     +IR +L  + +LH  N+VH +I P  I++     Q  D+KLI   N + + +   +  +    PS F APE          +D+WS+GI+++ LL+ QLP   D  +D  V   VK      +      FR+         +  S+ F+   L K P+ R      L H W 
Sbjct:   70 GEDVLKFMSSKTKVTEEDAALVIRGILNALCYLHELNIVHLDIRPANIMV-----QGSDVKLIDFGNARKLKSRHGEVGVVVGNPS-FTAPEVLSFEPVNMAADMWSVGIVTYALLSGQLPFPGD--NDDAVEEAVKQARCTFVG---RAFRS--------LTDHSKGFIEKLLYKIPSKRLEVAGALTHEWL 243          
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Match: EDO43755 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXD2])

HSP 1 Score: 102.834 bits (255), Expect = 1.126e-23
Identity = 58/199 (29.15%), Postives = 104/199 (52.26%), Query Frame = 2
Query: 9611 DVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFE---INNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHG 10198
            D++  Y    +L +G Y+  +  +EKST  EF  K  +   ++ + I R E   ++ + H N+    DA   P  Y++ + E L G  L +Y+  +    E      +HQ+++ V +LH+  + HLD+KP+N+++ G     +K+  F +A           +  +  F+APEL+  EP+ F +D WSIG++T++ L G
Sbjct:    3 DIDQYYNIYAELGRGRYAVVKKCVEKSTGKEFAAKMVKKRMLDPVDIDR-EVTVLRMLKHPNLCIFLDAYDTPKNYII-VTELLAGGRLFDYLVVMDALTEKVAIGYMHQVVEGVQHLHDLNIVHLDLKPQNLLLDGGPLPKVKIIDFGSAHILSGSPVNHKVYGSPEFAAPELIMEEPLTFKTDTWSIGVITYVMLSG 199          

HSP 2 Score: 54.6842 bits (130), Expect = 2.546e-7
Identity = 46/192 (23.96%), Postives = 82/192 (42.71%), Query Frame = 2
Query: 11579 DLCVRIKYYHFPILFGEICDSSLGNRITFEEFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHK----PSIFKAPEYRYESITRYESDIWSLGILSFLLLATQLPAIEDACSDSDVHCC-VKNTNTLLLPVPHTHFRA 12139
            +LC+ +  Y  P            N I   E + GG L   L+     +E   +  + Q++  +Q LH  N+VH +++P  +L+         +K+I   +   +       S   HK    P  F APE   E    +++D WS+G++++++L+   P   D    +D  C  ++  N      P+ HF A
Sbjct:   63 NLCIFLDAYDTP-----------KNYIIVTELLAGGRLFDYLVVMDALTEKVAIGYMHQVVEGVQHLHDLNIVHLDLKPQNLLLDGGPLPK--VKIIDFGSAHILSG-----SPVNHKVYGSPE-FAAPELIMEEPLTFKTDTWSIGVITYVMLSGVSPFQADT---TDEMCERIRKAN---FSFPNKHFSA 229          
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Match: EDO41242 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4Z6])

HSP 1 Score: 101.679 bits (252), Expect = 3.935e-23
Identity = 71/257 (27.63%), Postives = 128/257 (49.81%), Query Frame = 2
Query: 9626 YYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEINNMGIGR---SEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEI-LKLC--GFSNAVPKE-DFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGH-----------LKVNFEGDQLYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSH 10342
            Y  ++ + +GS+++    IE+ T +EF  K   + ++        E    +++ H NIV ++ +I    + + LI E + G SL + + Q +++ E Q R++  QL+ A+ YLH  R+ H DIKP+N+++    N + +KL   G + A+P + D  S    G    F APE +  EPI    D+W+ G++ +L L G+           L     G         D +SN A   + K +++    R+++ ++LSH
Sbjct:    5 YDMLELIGEGSFAKVFRCIERKTGLEFAAKELRLTDVEDKEKIEQEIAVWKDLRHENIVSLYSSI-REGETVCLIMEYVAGGSLFDEVIQQTYYSEKQARLVTRQLLNALEYLHSRRIVHRDIKPDNLLLKRTGNNVTIKLADFGLAQALPNDTDVISCGASG-APMFLAPETVLEEPIGRAVDIWACGVIFYLLLVGYPPFWSNSDEQLLLSILRGQYTMPSPFWDNVSNDARDLVHKLIVVDPEARISAKEALSH 259          

HSP 2 Score: 76.6406 bits (187), Expect = 1.324e-14
Identity = 57/200 (28.50%), Postives = 90/200 (45.00%), Query Frame = 2
Query: 11669 EFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRYESDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNTNTLLLPVPHTHFRAPKLSMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWFKQD 12268
            E+V GG+L   ++ ++ YSE     + RQLL  +++LHS  +VH +I+P  +L+ +RT  +  IKL      Q +    +  S       +F APE   E       DIW+ G++ +LLL    P      S+SD          LLL +    +  P        S  +R  VH  +   P  R +A   L+H   K++
Sbjct:   80 EYVAGGSLFDEVIQQTYYSEKQARLVTRQLLNALEYLHSRRIVHRDIKPDNLLL-KRTGNNVTIKLADFGLAQALPNDTDVISCGASGAPMFLAPETVLEEPIGRAVDIWACGVIFYLLLVGYPP----FWSNSD--------EQLLLSILRGQYTMPS-PFWDNVSNDARDLVHKLIVVDPEARISAKEALSHPALKEN 265          
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Match: EDO42287 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1Z6])

HSP 1 Score: 100.908 bits (250), Expect = 6.288e-23
Identity = 70/231 (30.30%), Postives = 116/231 (50.22%), Query Frame = 2
Query: 9614 VNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEINNMGIGRS---------EFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEI-LKLCGFSNAVPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQLYNEDSNDAISNSACV 10276
            V+ ++    ++  G ++  +   EKS+ +EF  KF +       R          E   +++++H+ I+ + D      ++ VLI E L G  L E++++     E +    + Q+I+A+ YLH+  + HLDIKPENI++  +   + LKL  F  A         R M  T  F APE++  E + F +DMWSIG+LT++ L G     F GD     D+N+  SN + V
Sbjct:   13 VHHKFDIGDEIGSGQFAVVKKCSEKSSGLEFAAKFMKKRRSKALRRGVTLEQIIREATVLRSVAHQGIIYLHDIYETKMEF-VLILELLSGGELFEFLSEQDFLTEDEAVGFLIQVIRAIEYLHDLSIVHLDIKPENIVLKNRTRPLHLKLIDFGLARKISKGEPVREMMGTPEFVAPEIIDFEVVGFPTDMWSIGVLTYIMLSG--ASPFLGD-----DNNETFSNISHV 235          

HSP 2 Score: 56.225 bits (134), Expect = 7.330e-8
Identity = 35/130 (26.92%), Postives = 69/130 (53.08%), Query Frame = 2
Query: 11669 EFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKE-QESLTTHKPSIFKAPEYRYESITRYESDIWSLGILSFLLLATQLPAIED 12055
            E + GG L   L  +   +E   V  + Q++  I++LH  ++VH +I+P  I++  RT +   +KLI     + +   +  +E + T +   F APE     +  + +D+WS+G+L++++L+   P + D
Sbjct:   98 ELLSGGELFEFLSEQDFLTEDEAVGFLIQVIRAIEYLHDLSIVHLDIKPENIVLKNRT-RPLHLKLIDFGLARKISKGEPVREMMGTPE---FVAPEIIDFEVVGFPTDMWSIGVLTYIMLSGASPFLGD 223          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: spegb (striated muscle preferentially expressed protein kinase [Source:NCBI gene;Acc:101174306])

HSP 1 Score: 152.91 bits (385), Expect = 5.405e-36
Identity = 149/626 (23.80%), Postives = 267/626 (42.65%), Query Frame = 2
Query: 8564 LFRIVAKNQFGSGLPSQIVKLHPQIIIPDFSFIRLTIDDTVIPGSNGEREITLSWSPPRISPDLYIPFTVDVECRPVNYSYSDEEG------WSVFKTNIKKNRVDIADLDPNINYQLRIVPVTDFGIGKPSMVIKKIRRSDNLNSPTTEKAMMLQEKHCLAVPMFCCLSQKAELKFTKLMEYKLDKITWTFNNAKVDVNDERYKIFSAETYGIYFIIKNLEEDDFGE--YCALDEVQDPIQSFILIKSDAPTILNCLPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIF-SSYRTVITEDKEQGTYSLLISKCILSDGGEYSIRAENAIGFAEVKFNLRV-------DAHPEKKSVQINIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEINNMGIGRS--EFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVP-KEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQL-------YNEDSNDAISNSACV----FIRKCLLLKTGERLTSSDSLSHEWF 10351
            +++ V  N+ G    +    L+   I+PD        D T +  S   + ITLSW  PR          +D    P +  Y+ ++       W++  + +K+    I  L   + Y  R++ +T     KPS     ++  D    P  ++A  + +K     P    + +   +  +  + +    +TW      +      Y++   +       +  ++  D GE  + A +E      +FI+  +  PT    + +  +   E    +V ++ +P P+++W +    +  SS+ T + +D E    SL++      D G Y+  A N  G    K  L V       D+  +++S+   +  + D Y   K++ +G++S  + V  K +++E++ KF          S  E   +  + H  I+   DA    +  +++I EK     L +  T+ S   ES VR  I QL++ + YLH   + HLDIKPEN++M   +++ +++C F NAV  K D       G T  F APE++   PI   +D+W +G++ +LCL G      E D+        YN    +++    C     FI K LL+    R  S   L H WF
Sbjct:  735 VYKSVISNKIGKA--TCYAHLYVTDILPD------PPDGTPVIESITGKTITLSWKKPR---------RLDPSIDPSSLMYAIQQQALGSIQWTIIASGLKETTFTITTLSKGVRYTFRVLTITSKAFSKPSPATDPVQLLDR--GPYLQEAPAIIDK-----PDVVYVIEHQSVTISININHVNAAVTWKRKGVTLANKPSLYEMTMPDDDQHMLKLLKVKSTDVGEMTFVASNEYGSDSCTFIVEMAAPPTFETIMEDLDVCAGETPRFAVVVEGKPIPDILWFKGDNLLSESSHYTFVYDDNE---CSLVVLNAHPEDSGVYTCTARNLAGSVSCKAELTVHEAKHKEDSMEDEESILRKMRRLTDYYDIHKEIGRGAFSYVKRVTHKGSKMEYVAKFISTRAKKKTSSLREMNLLSRLDHERIIYFHDAFEKKNA-VIIITEKCHE-ELLDRFTRKSAILESDVRSCIRQLLEGLGYLHHQNIIHLDIKPENVLMADPHSDQIRICDFGNAVEIKPDEVQYCKYG-TPEFVAPEIVNQSPISKATDIWPVGVIAYLCLTGISPFAGENDRSSVLNIRNYNVAFEESMFADLCRESKGFIIK-LLVADRLRPDSQACLRHPWF 1329          

HSP 2 Score: 98.5969 bits (244), Expect = 1.465e-19
Identity = 73/262 (27.86%), Postives = 127/262 (48.47%), Query Frame = 2
Query: 9626 YYTMKKLAKGSYSRCQIVIEKSTQIEFIGKF--FEINNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVPKEDFGSRRH---MGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGH---------------LKVNFEGDQLYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWF 10351
            Y  M + A+G +   +   E +T   F+ K   +E ++      E+  ++++ H  I+ + +A   P +YLVLI E   G  L   +T+   + E  V   I Q++Q + YLH  R+ HLDIKPENII+T  +  I+K+  F ++        ++    +G T  + +PE+LKG+ +   +D+WS+G++TF+ L G                L    +  +LY       +S SA +F++K L      R +  D  ++ W 
Sbjct: 2371 YTFMDEKARGRFGVIRECRENATGNLFLAKIVPYEADSKQAVLQEYDILKSLHHDRIMALHEAYVTP-RYLVLISEYCSGKELLYSLTERFRYSEDDVVTYIVQVLQGLDYLHTRRILHLDIKPENIIVT--HMNIIKIIDFGSSQTYNPLFLKQFNPPIG-TLEYMSPEMLKGDVVGPPADIWSLGVVTFIMLSGRLPFMEINPQETEAKILAAKLDLSKLYQN-----VSQSASLFLKKILCSYPWARPSIKDCFNNSWL 2623          

HSP 3 Score: 70.8626 bits (172), Expect = 4.010e-11
Identity = 88/438 (20.09%), Postives = 172/438 (39.27%), Query Frame = 2
Query: 5756 IKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAE----NMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRIIVKP--------------------LCAPVLTAEYSKGADVILSWTSVATT-DTLNIIYNIEKQKSLTSTNWKKIMKNLTETTYSLSSSCLPPQESHLLRCVAISEYGFET------VSNIIEIPIRANSPILPPDKPTIIFKDATCVKISWMRGKCKNLTPEESIGKIMYSLEMKDNPKSSWQIVSNDLVDNEYSL-SLEPGVSYMFRVIAFNDFGISEPS 6973
            I +P++DI  +   ETV FE  V         W  + + I        M F    C     L + +  E   G Y  +++     + S G+L ++              + PLFT++L  +E++   N R +C++   P PK+ W+   ++L     +  + IL E    +L+I+    +D G Y  +  N  G   + + + + +  P  S  +++   P                       P+   +  +G + +L          T++  +N    + + ST+ +K+ +     +  + S C       + + V  ++ G  T      V++I+  P        P   P I       + +SW   K + L P      +MY+++ +      W I+++ L +  +++ +L  GV Y FRV+       S+PS
Sbjct:  447 IIRPVRDITAKAG-ETVLFECHVVGPKDTDVDWLADGKLIQPALLNCKMHFDGRKC----RLLLNSVHEDDSGTYMCKLSTAKEELTSCGKLKVV------------PSLEPLFTRRLDILEVMEGRNARFDCKISGTPPPKVTWSHFDQSL---VESEDIHILQEGGRHSLVISHVTSQDEGLYTIIAQNCHGEAESSSELYIQEPRPAISSQAKLEKMPSIPEEPEVPENEVERFTMPDFIKPLYDLDVIEGKEAVLKCKVAGLPYPTISWFHN---GRRIESTDDRKMTQFHDVHSLVIRSVCH--AHGGVYKSVISNKIGKATCYAHLYVTDILPDP--------PDGTPVIESITGKTITLSWK--KPRRLDPSIDPSSLMYAIQQQALGSIQWTIIASGLKETTFTITTLSKGVRYTFRVLTITSKAFSKPS 849          

HSP 4 Score: 63.1586 bits (152), Expect = 9.020e-9
Identity = 90/408 (22.06%), Postives = 153/408 (37.50%), Query Frame = 2
Query: 5534 WLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLKINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRN-------EPETVKFEFEVEESGAKKAIW-FFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLM-LRSEISEQM----MESCCIA-------------PLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRIIVKPLCAPVLTAEYSKGADVILSWTSV----ATTDTLNIIYNIEKQKSLTSTNWKKIMKNLTETTYSLSSSCLPPQESHLLRCVAISEYGFETVS 6667
            WL D KL+        +        L+L  V   D+G Y  K++ +                 KE   +    ++   L+ +F R        E    +F+ ++  +   K  W  F+   +++E++  +Q       +L I     +  G YTI   N  G   S   L +   R  IS Q     M S                 P F K L D++++  +   L C++   P P I W  +G  ++S    +  +  D     +L+I        G Y  + +N +G  T  A + VTD  P   D + +I           E   G  + LSW        + D  +++Y I+ Q++L S  W  I   L ETT+++++  L     +  R + I+   F   S
Sbjct:  478 WLADGKLIQPALLNCKMHFDGRKCRLLLNSVHEDDSGTYMCKLSTA-----------------KEELTSCGKLKVVPSLEPLFTRRLDILEVMEGRNARFDCKISGTPPPKVTWSHFDQSLVESEDIHILQEG--GRHSLVISHVTSQDEGLYTIIAQNCHGEAESSSELYIQEPRPAISSQAKLEKMPSIPEEPEVPENEVERFTMPDFIKPLYDLDVIEGKEAVLKCKVAGLPYPTISWFHNGRRIESTDDRKMTQFHDV---HSLVIRSVCHAHGGVYKSVISNKIGKATCYAHLYVTDILPDPPDGTPVI-----------ESITGKTITLSWKKPRRLDPSIDPSSLMYAIQ-QQALGSIQWTIIASGLKETTFTITT--LSKGVRYTFRVLTITSKAFSKPS 849          

HSP 5 Score: 61.2326 bits (147), Expect = 3.597e-8
Identity = 41/136 (30.15%), Postives = 69/136 (50.74%), Query Frame = 2
Query: 11657 ITFEEFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSI----FKAPEYRYESITRYESDIWSLGILSFLLLATQLPAIE 12052
            +   E+  G  LL  L  R  YSE  VVT I Q+L  + +LH+  ++H +I+P  I+++        IK+I   + Q    +     L    P I    + +PE     +    +DIWSLG+++F++L+ +LP +E
Sbjct: 2441 VLISEYCSGKELLYSLTERFRYSEDDVVTYIVQVLQGLDYLHTRRILHLDIKPENIIVTHMNI----IKIIDFGSSQTYNPL----FLKQFNPPIGTLEYMSPEMLKGDVVGPPADIWSLGVVTFIMLSGRLPFME 2568          

HSP 6 Score: 53.1434 bits (126), Expect = 9.171e-6
Identity = 47/188 (25.00%), Postives = 79/188 (42.02%), Query Frame = 2
Query: 10781 VTLTCQLSLLGSEPISISWYKNQELLTDDSRIKLEVIKGGFLSCTILNATETDVGIFRCIARCHSLRTETSARLVLGDVPPQPEQLSVYYTNQEEVLLKWSPYLSAIDDVIYRIDIRTIDSRNKIRNWKTIGYSV-DNRYLLENLDRTQQYIARIIAQNKYGYSPYSIATSVFQNKIRNIHSLKQALI 11341
            VTL+C  +  GS    ISW K+++ L  D+R+ +     G     I+  T+ D G++ C+A        +S  + L  +P +P    +        L+ W P    +    Y ++ R  +  N   NW  +   V D  Y + +L     +  R+   NK G  PYS  + V       ++  K+ LI
Sbjct: 2045 VTLSCLPA--GSPHPHISWQKDKKPLEIDARMNMISCPDGRQLLMIMQTTKKDAGVYECVATNPLASVSSSCTISLARLPNRPGTPEIPQKYNNTALVLWRPS-DTMAPCTYSLE-RKSEGDN---NWLIVATGVADCYYNVADLPAGGSFRFRVACVNKAGQGPYSNLSEVVHLDSFGMYKHKERLI 2225          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: ENSORLT00000028146.1 (striated muscle enriched protein kinase [Source:NCBI gene;Acc:101164136])

HSP 1 Score: 142.124 bits (357), Expect = 1.280e-32
Identity = 138/593 (23.27%), Postives = 251/593 (42.33%), Query Frame = 2
Query: 8708 REITLSWS-PPRISPDLYIPFTVDVECRPVNYSYSDEEGWSVFKTNIKKNRVDIADLDPNINYQLRIVPVTDFGIGKPSMVIKKIRRSDNLNSPTTEKAMMLQEKHCL-AVPMFCCLSQKAELKFTKLMEYKLDKITWTFNNAKVDVNDERYKIFSAETYGIYFI-----------IKNLEEDDFGEY--CALDEVQDPIQSFILIKSDAPTILNCLPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIF-SSYRTVITEDKEQGTYSLLISKCILSDGGEYSIRAENAIGFAEVKFNLRVD------AHP--EKKSVQINIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEINNM--GIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQ-----------LYNEDSNDAISNSACVFIRKCLLLKTGERLTSS--DSLSHEWFIKPGNN 10369
            + ITLSW  P R+ P L     + V    V   +     WSV  +N+K+    +  L   + Y  R++  T   + KPS              P+T+   +L     L   P+      K ++ +  ++E +   IT T N+    V  +R  +      G Y +           +  +   D G+    A ++    + +  L+ +  P     + +  + + E   ++V ++ +P P+++W ++   +  SS+ T + +D E   YSL+I        G Y+  A+N  G    K  L V       A P  ++ S+   +  + D Y   K++ +G++S  + V  K  + EF  KF         +   E   +  + +  I+   DA     + +V++  +L    L + + + +   E ++R  I Q+++ + YLH+  + HLDIKPENI+M     + +++C F NA   E+         T  + APE++   P+   +D+W +G++T+LCL G      E D+            + E     +   A  F+ K L++   +RL  S  D L H WF  P N 
Sbjct: 1134 KTITLSWKRPKRLDPSLDTSSLLYV----VQQQHLGSIQWSVVASNLKETTYTVTTLSKGVRYAFRVLTSTGKSLSKPS--------------PSTDLVQLLDRGPYLRKAPVIV---DKPDIVY--VVENQPTSITITLNHVHAVVTWKRRGVVLVNKLGTYEMSMPDDDQHTLKLLRVRNSDIGQLVVTASNQFGSDLCTLQLVMAVRPKFETIMEDVDVHIGETTRLAVVVEGKPDPDILWYKDDVLLSESSHFTFVYDDPE---YSLVILSAQPEHSGVYTCTAQNLAGSCSCKAELTVHTEQLEPAQPMEDEASILRKMRRLTDYYDIHKEIGRGAFSYVKKVTLKEGKAEFAAKFITARGKRKPLALREMDLLAELDNERILYFHDAFE--KKNIVILITELCHEELLDRMAKKTTVMELEIRKSIQQVLEGLRYLHQKSIAHLDIKPENILMASPRCDQIRICDFGNAQKLENLEEHYCKYGTPEYVAPEIVNQTPVSTTTDIWPVGVITYLCLTGVSPFAGENDRATALNIRNYNVAFEEGMFSGLCKEAKGFVIKLLVV---DRLRPSAVDCLRHPWFKSPTNK 1695          

HSP 2 Score: 97.8265 bits (242), Expect = 2.651e-19
Identity = 75/278 (26.98%), Postives = 128/278 (46.04%), Query Frame = 2
Query: 9590 SVQINIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKF--FEINNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNA-------VPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLK---------------VNFEGDQLYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWF 10351
            S  +  G     Y  +++ A+G Y   +   E +T   ++ K   +   N      E++ ++++    I+ + +A   P +YLVL+ E   G  L   +     + E  V   + Q++QAV YLH  RV HLD+KP+NII+T     ++K+  F +A       + +++ G+      T  + APE LK E +   +DMW++G++T++ L G L                  F+  +LY       +S SA  F++K L      R T+ D  SH W 
Sbjct: 2902 STTLRQGVPQKPYTFLEEKARGRYGVVRECRENATGKMYMAKIIPYTQENKKDVLKEYEILKSLHSDKIMALHEAYVTP-RYLVLVAEYCTGKELLYTLIDRFRYSEDDVASYLVQILQAVEYLHNRRVLHLDLKPDNIIVTNL--NVVKVVDFGSAQSFNPLSLQQQESGAG-----TLEYMAPETLKREVVGPPADMWTVGVVTYIMLSGRLPFEDKEPHQVESKILMAKFDPSKLYPN-----VSQSASTFLKKMLSSYPWARPTTRDCFSHAWL 3166          

HSP 3 Score: 58.9214 bits (141), Expect = 1.709e-7
Identity = 32/129 (24.81%), Postives = 70/129 (54.26%), Query Frame = 2
Query: 11657 ITFEEFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRYESDIWSLGILSFLLLATQLP 12043
            +   E+  G  LL  L+ R  YSE  V + + Q+L  +++LH+  V+H +++P  I++   TN +  +K++   + Q    +  Q+  +      + APE     +    +D+W++G++++++L+ +LP
Sbjct: 2984 VLVAEYCTGKELLYTLIDRFRYSEDDVASYLVQILQAVEYLHNRRVLHLDLKPDNIIV---TNLNV-VKVVDFGSAQSFNPLSLQQQESGAGTLEYMAPETLKREVVGPPADMWTVGVVTYIMLSGRLP 3108          

HSP 4 Score: 57.7658 bits (138), Expect = 4.086e-7
Identity = 59/225 (26.22%), Postives = 103/225 (45.78%), Query Frame = 2
Query: 6044 SEQMMESCC-IAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFT--LIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRIIVKPLCAPVLTAEYSKGADVILSWTSVATTDTLNIIYNIEKQKSLTSTNWKKIMKNLTETTYSLSSSCLPPQESHLLRCVAISEYG---FETVSNIIEIPIRANS 6700
            S+Q + S    AP+F  KLKD  +L  E++ L+C     P P+I W KD + LD+   + R+K L   P+    LII+++   D+G Y C+ TN +   TT   + +  S PK   +          P +   Y+  A V+  W    T    +  Y++E+ K     NW  +   + +  Y+++   LP   ++  R   +++ G   +   S  + +P  A+ 
Sbjct: 2509 SQQFIRSASDFAPVFHIKLKDHVLLEGESVTLSCLHAGSPHPEITWMKDRKPLDT--TDNRIK-LTSHPDGRQLLIISKSSHRDTGVYECVATNPIATITTSCTLSIA-SFPKRPGT----------PEVAQTYNNTALVL--WKPADTKPPCS--YSLER-KDEREANWVLVATGIADCYYNVTD--LPVGGTYKFRVSCVNKAGQGPYSCCSTPVTLPGTADG 2712          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: ENSORLT00000032086.1 (striated muscle enriched protein kinase [Source:NCBI gene;Acc:101164136])

HSP 1 Score: 141.739 bits (356), Expect = 1.486e-32
Identity = 138/593 (23.27%), Postives = 251/593 (42.33%), Query Frame = 2
Query: 8708 REITLSWS-PPRISPDLYIPFTVDVECRPVNYSYSDEEGWSVFKTNIKKNRVDIADLDPNINYQLRIVPVTDFGIGKPSMVIKKIRRSDNLNSPTTEKAMMLQEKHCL-AVPMFCCLSQKAELKFTKLMEYKLDKITWTFNNAKVDVNDERYKIFSAETYGIYFI-----------IKNLEEDDFGEY--CALDEVQDPIQSFILIKSDAPTILNCLPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIF-SSYRTVITEDKEQGTYSLLISKCILSDGGEYSIRAENAIGFAEVKFNLRVD------AHP--EKKSVQINIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEINNM--GIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQ-----------LYNEDSNDAISNSACVFIRKCLLLKTGERLTSS--DSLSHEWFIKPGNN 10369
            + ITLSW  P R+ P L     + V    V   +     WSV  +N+K+    +  L   + Y  R++  T   + KPS              P+T+   +L     L   P+      K ++ +  ++E +   IT T N+    V  +R  +      G Y +           +  +   D G+    A ++    + +  L+ +  P     + +  + + E   ++V ++ +P P+++W ++   +  SS+ T + +D E   YSL+I        G Y+  A+N  G    K  L V       A P  ++ S+   +  + D Y   K++ +G++S  + V  K  + EF  KF         +   E   +  + +  I+   DA     + +V++  +L    L + + + +   E ++R  I Q+++ + YLH+  + HLDIKPENI+M     + +++C F NA   E+         T  + APE++   P+   +D+W +G++T+LCL G      E D+            + E     +   A  F+ K L++   +RL  S  D L H WF  P N 
Sbjct: 1217 KTITLSWKRPKRLDPSLDTSSLLYV----VQQQHLGSIQWSVVASNLKETTYTVTTLSKGVRYAFRVLTSTGKSLSKPS--------------PSTDLVQLLDRGPYLRKAPVIV---DKPDIVY--VVENQPTSITITLNHVHAVVTWKRRGVVLVNKLGTYEMSMPDDDQHTLKLLRVRNSDIGQLVVTASNQFGSDLCTLQLVMAVRPKFETIMEDVDVHIGETTRLAVVVEGKPDPDILWYKDDVLLSESSHFTFVYDDPE---YSLVILSAQPEHSGVYTCTAQNLAGSCSCKAELTVHTEQLEPAQPMEDEASILRKMRRLTDYYDIHKEIGRGAFSYVKKVTLKEGKAEFAAKFITARGKRKPLALREMDLLAELDNERILYFHDAFE--KKNIVILITELCHEELLDRMAKKTTVMELEIRKSIQQVLEGLRYLHQKSIAHLDIKPENILMASPRCDQIRICDFGNAQKLENLEEHYCKYGTPEYVAPEIVNQTPVSTTTDIWPVGVITYLCLTGVSPFAGENDRATALNIRNYNVAFEEGMFSGLCKEAKGFVIKLLVV---DRLRPSAVDCLRHPWFKSPTNK 1778          

HSP 2 Score: 97.8265 bits (242), Expect = 2.574e-19
Identity = 75/278 (26.98%), Postives = 128/278 (46.04%), Query Frame = 2
Query: 9590 SVQINIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKF--FEINNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNA-------VPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLK---------------VNFEGDQLYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWF 10351
            S  +  G     Y  +++ A+G Y   +   E +T   ++ K   +   N      E++ ++++    I+ + +A   P +YLVL+ E   G  L   +     + E  V   + Q++QAV YLH  RV HLD+KP+NII+T     ++K+  F +A       + +++ G+      T  + APE LK E +   +DMW++G++T++ L G L                  F+  +LY       +S SA  F++K L      R T+ D  SH W 
Sbjct: 2985 STTLRQGVPQKPYTFLEEKARGRYGVVRECRENATGKMYMAKIIPYTQENKKDVLKEYEILKSLHSDKIMALHEAYVTP-RYLVLVAEYCTGKELLYTLIDRFRYSEDDVASYLVQILQAVEYLHNRRVLHLDLKPDNIIVTNL--NVVKVVDFGSAQSFNPLSLQQQESGAG-----TLEYMAPETLKREVVGPPADMWTVGVVTYIMLSGRLPFEDKEPHQVESKILMAKFDPSKLYPN-----VSQSASTFLKKMLSSYPWARPTTRDCFSHAWL 3249          

HSP 3 Score: 58.9214 bits (141), Expect = 1.615e-7
Identity = 32/129 (24.81%), Postives = 70/129 (54.26%), Query Frame = 2
Query: 11657 ITFEEFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRYESDIWSLGILSFLLLATQLP 12043
            +   E+  G  LL  L+ R  YSE  V + + Q+L  +++LH+  V+H +++P  I++   TN +  +K++   + Q    +  Q+  +      + APE     +    +D+W++G++++++L+ +LP
Sbjct: 3067 VLVAEYCTGKELLYTLIDRFRYSEDDVASYLVQILQAVEYLHNRRVLHLDLKPDNIIV---TNLNV-VKVVDFGSAQSFNPLSLQQQESGAGTLEYMAPETLKREVVGPPADMWTVGVVTYIMLSGRLP 3191          

HSP 4 Score: 57.7658 bits (138), Expect = 3.641e-7
Identity = 59/225 (26.22%), Postives = 103/225 (45.78%), Query Frame = 2
Query: 6044 SEQMMESCC-IAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFT--LIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRIIVKPLCAPVLTAEYSKGADVILSWTSVATTDTLNIIYNIEKQKSLTSTNWKKIMKNLTETTYSLSSSCLPPQESHLLRCVAISEYG---FETVSNIIEIPIRANS 6700
            S+Q + S    AP+F  KLKD  +L  E++ L+C     P P+I W KD + LD+   + R+K L   P+    LII+++   D+G Y C+ TN +   TT   + +  S PK   +          P +   Y+  A V+  W    T    +  Y++E+ K     NW  +   + +  Y+++   LP   ++  R   +++ G   +   S  + +P  A+ 
Sbjct: 2592 SQQFIRSASDFAPVFHIKLKDHVLLEGESVTLSCLHAGSPHPEITWMKDRKPLDT--TDNRIK-LTSHPDGRQLLIISKSSHRDTGVYECVATNPIATITTSCTLSIA-SFPKRPGT----------PEVAQTYNNTALVL--WKPADTKPPCS--YSLER-KDEREANWVLVATGIADCYYNVTD--LPVGGTYKFRVSCVNKAGQGPYSCCSTPVTLPGTADG 2795          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: ENSORLT00000002709.2 (striated muscle enriched protein kinase [Source:NCBI gene;Acc:101164136])

HSP 1 Score: 141.739 bits (356), Expect = 1.716e-32
Identity = 138/593 (23.27%), Postives = 251/593 (42.33%), Query Frame = 2
Query: 8708 REITLSWS-PPRISPDLYIPFTVDVECRPVNYSYSDEEGWSVFKTNIKKNRVDIADLDPNINYQLRIVPVTDFGIGKPSMVIKKIRRSDNLNSPTTEKAMMLQEKHCL-AVPMFCCLSQKAELKFTKLMEYKLDKITWTFNNAKVDVNDERYKIFSAETYGIYFI-----------IKNLEEDDFGEY--CALDEVQDPIQSFILIKSDAPTILNCLPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIF-SSYRTVITEDKEQGTYSLLISKCILSDGGEYSIRAENAIGFAEVKFNLRVD------AHP--EKKSVQINIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEINNM--GIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQ-----------LYNEDSNDAISNSACVFIRKCLLLKTGERLTSS--DSLSHEWFIKPGNN 10369
            + ITLSW  P R+ P L     + V    V   +     WSV  +N+K+    +  L   + Y  R++  T   + KPS              P+T+   +L     L   P+      K ++ +  ++E +   IT T N+    V  +R  +      G Y +           +  +   D G+    A ++    + +  L+ +  P     + +  + + E   ++V ++ +P P+++W ++   +  SS+ T + +D E   YSL+I        G Y+  A+N  G    K  L V       A P  ++ S+   +  + D Y   K++ +G++S  + V  K  + EF  KF         +   E   +  + +  I+   DA     + +V++  +L    L + + + +   E ++R  I Q+++ + YLH+  + HLDIKPENI+M     + +++C F NA   E+         T  + APE++   P+   +D+W +G++T+LCL G      E D+            + E     +   A  F+ K L++   +RL  S  D L H WF  P N 
Sbjct: 1125 KTITLSWKRPKRLDPSLDTSSLLYV----VQQQHLGSIQWSVVASNLKETTYTVTTLSKGVRYAFRVLTSTGKSLSKPS--------------PSTDLVQLLDRGPYLRKAPVIV---DKPDIVY--VVENQPTSITITLNHVHAVVTWKRRGVVLVNKLGTYEMSMPDDDQHTLKLLRVRNSDIGQLVVTASNQFGSDLCTLQLVMAVRPKFETIMEDVDVHIGETTRLAVVVEGKPDPDILWYKDDVLLSESSHFTFVYDDPE---YSLVILSAQPEHSGVYTCTAQNLAGSCSCKAELTVHTEQLEPAQPMEDEASILRKMRRLTDYYDIHKEIGRGAFSYVKKVTLKEGKAEFAAKFITARGKRKPLALREMDLLAELDNERILYFHDAFE--KKNIVILITELCHEELLDRMAKKTTVMELEIRKSIQQVLEGLRYLHQKSIAHLDIKPENILMASPRCDQIRICDFGNAQKLENLEEHYCKYGTPEYVAPEIVNQTPVSTTTDIWPVGVITYLCLTGVSPFAGENDRATALNIRNYNVAFEEGMFSGLCKEAKGFVIKLLVV---DRLRPSAVDCLRHPWFKSPTNK 1686          

HSP 2 Score: 97.8265 bits (242), Expect = 2.695e-19
Identity = 75/278 (26.98%), Postives = 128/278 (46.04%), Query Frame = 2
Query: 9590 SVQINIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKF--FEINNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNA-------VPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLK---------------VNFEGDQLYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWF 10351
            S  +  G     Y  +++ A+G Y   +   E +T   ++ K   +   N      E++ ++++    I+ + +A   P +YLVL+ E   G  L   +     + E  V   + Q++QAV YLH  RV HLD+KP+NII+T     ++K+  F +A       + +++ G+      T  + APE LK E +   +DMW++G++T++ L G L                  F+  +LY       +S SA  F++K L      R T+ D  SH W 
Sbjct: 2893 STTLRQGVPQKPYTFLEEKARGRYGVVRECRENATGKMYMAKIIPYTQENKKDVLKEYEILKSLHSDKIMALHEAYVTP-RYLVLVAEYCTGKELLYTLIDRFRYSEDDVASYLVQILQAVEYLHNRRVLHLDLKPDNIIVTNL--NVVKVVDFGSAQSFNPLSLQQQESGAG-----TLEYMAPETLKREVVGPPADMWTVGVVTYIMLSGRLPFEDKEPHQVESKILMAKFDPSKLYPN-----VSQSASTFLKKMLSSYPWARPTTRDCFSHAWL 3157          

HSP 3 Score: 58.9214 bits (141), Expect = 1.843e-7
Identity = 32/129 (24.81%), Postives = 70/129 (54.26%), Query Frame = 2
Query: 11657 ITFEEFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRYESDIWSLGILSFLLLATQLP 12043
            +   E+  G  LL  L+ R  YSE  V + + Q+L  +++LH+  V+H +++P  I++   TN +  +K++   + Q    +  Q+  +      + APE     +    +D+W++G++++++L+ +LP
Sbjct: 2975 VLVAEYCTGKELLYTLIDRFRYSEDDVASYLVQILQAVEYLHNRRVLHLDLKPDNIIV---TNLNV-VKVVDFGSAQSFNPLSLQQQESGAGTLEYMAPETLKREVVGPPADMWTVGVVTYIMLSGRLP 3099          

HSP 4 Score: 57.7658 bits (138), Expect = 3.757e-7
Identity = 59/225 (26.22%), Postives = 103/225 (45.78%), Query Frame = 2
Query: 6044 SEQMMESCC-IAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFT--LIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRIIVKPLCAPVLTAEYSKGADVILSWTSVATTDTLNIIYNIEKQKSLTSTNWKKIMKNLTETTYSLSSSCLPPQESHLLRCVAISEYG---FETVSNIIEIPIRANS 6700
            S+Q + S    AP+F  KLKD  +L  E++ L+C     P P+I W KD + LD+   + R+K L   P+    LII+++   D+G Y C+ TN +   TT   + +  S PK   +          P +   Y+  A V+  W    T    +  Y++E+ K     NW  +   + +  Y+++   LP   ++  R   +++ G   +   S  + +P  A+ 
Sbjct: 2500 SQQFIRSASDFAPVFHIKLKDHVLLEGESVTLSCLHAGSPHPEITWMKDRKPLDT--TDNRIK-LTSHPDGRQLLIISKSSHRDTGVYECVATNPIATITTSCTLSIA-SFPKRPGT----------PEVAQTYNNTALVL--WKPADTKPPCS--YSLER-KDEREANWVLVATGIADCYYNVTD--LPVGGTYKFRVSCVNKAGQGPYSCCSTPVTLPGTADG 2703          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: dapk2b (death associated protein kinase 2 [Source:NCBI gene;Acc:101165975])

HSP 1 Score: 116.316 bits (290), Expect = 6.945e-27
Identity = 85/287 (29.62%), Postives = 136/287 (47.39%), Query Frame = 2
Query: 9611 DVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFE-----INNMGIGRSEFQ----CIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEI--LKLCGFSNAVPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGH---------------LKVNFEGDQLYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWFIKPGNNLNAALDYI 10393
            +V D Y   ++L  G ++  +   EKS+  EF  KF +      +  G+ R E +     +Q + H NIV + D        +VLI E + G  L +++ Q     E +    I Q++  V YLH  R+ H D+KPENI++  +   +  +KL  F  A   E     +++  T  F APE++  E +   +DMWSIG++T++ L G                  VN+E    ++ED     S  A  FIR+ L   T +R+   D+L+H W IKP N+  A +  +
Sbjct:   13 NVEDFYEMGEQLGSGQFAVVKRCKEKSSGTEFAAKFIKKRISRASRRGVKREEIEREVGILQQLQHPNIVALHDVYENRTD-VVLIMELVSGGELFDFLAQKESLSEEEATQFIKQILDGVQYLHSKRIAHFDLKPENIMLLDRNASLPRIKLIDFGLAHQIEAGADFKNIFGTPEFVAPEIVNYEQLGLEADMWSIGVITYILLSGASPFLGDTKQETLGNISAVNYE----FDEDFFGNTSELAKSFIRQLLEKDTRKRMAIEDALNHPW-IKPLNSRQAMVKRL 293          

HSP 2 Score: 68.1662 bits (165), Expect = 6.402e-11
Identity = 52/203 (25.62%), Postives = 88/203 (43.35%), Query Frame = 2
Query: 11669 EFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRY-----ESDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNTNTLLLPVPHTHFRAPKLSMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWFK 12262
            E V GG L   L  +   SE      I+Q+L  +Q+LHS  + H +++P  I++  R      IKLI        G   + E+    K +IF  PE+    I  Y     E+D+WS+G+++++LL+   P + D   ++     + N + +        F           S+ ++ F+   L+K    R   +  L H W K
Sbjct:   99 ELVSGGELFDFLAQKESLSEEEATQFIKQILDGVQYLHSKRIAHFDLKPENIMLLDRNASLPRIKLIDF------GLAHQIEAGADFK-NIFGTPEFVAPEIVNYEQLGLEADMWSIGVITYILLSGASPFLGDTKQET-----LGNISAVNYEFDEDFF--------GNTSELAKSFIRQLLEKDTRKRMAIEDALNHPWIK 281          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000022977.1 (SMESG000022977.1)

HSP 1 Score: 8185.48 bits (21238), Expect = 0.000e+0
Identity = 4094/4094 (100.00%), Postives = 4094/4094 (100.00%), Query Frame = 2
Query:   62 MIFQLLWSLIGIFSILGYLFLWLQQRLERDNAILSKPRSSNLSDEEYLNNLIINSPSVSSISQKNDSSVDPEFITTDLDDDNEAVENLDTSQYSDVTDLDELEDTNMSDSLERNKLHYERSFDATIEDVASDFQSNDDLLSFIKTCKPIPGTKYYANCTIKCKENSELIKTTEGSAVSIEDADNLDYWISFSDDLPIPLSIVPRCCLSNSPNAENPDSESRKRNPRESFREDILQISNKNQESTMKRKYALADLIECDREYCATXXXXXXXXXXXXXTENEFGVEIDSLFEEVCKLIVELVEFHENLILPELSSCVMIPIRVANILKNQKLQFYRYSEFQSQWXXXXXXXXXXXXXXXFVKNVNTIEKSKFSVLSFNDLMLKVENKLPQYNLFLFDIIRYTGRIDGEVNDLQKAITVFQKIRRRNQEKVYLSKLIEKTNINISNERFIRVTNQVMISETQIMSKSYENLQFIREEMCSLILLKNYLLCVSDLSQPTDRKIMNLDYTKIYTKENYERQNELIIWSKMNKLEFRIFILYFPNKVSKLGWLRDLTKRLKKKGIDEIFVSSTEYDIQYKQYLGKNQRLVATEMESIGLESASLENECSSISDQIEDLTSMADSITDVRFESAILDMPSSMTSGSYKTAPETFKSTMDKASRPISGISQDSVSTLDGVRTPFSDXXXXXXXXXXXXXXXXXXXXXXDFVWSLKLVNFDPILHDIVWSLVGKTLDLTSQNSSIKIEEQNNKVYECQLKRQKLTKLESGQLSCKIIDKINGSLIVSKIVNVFISPPCISTELSCELTEVTVLENNPITFQLISGTNCLKNSFLNHITWYKDNERLVKEEGRIKTFXXXXXXXXXXXXEKASISDAGIYTISCAPNSEIFIKNVSNISILLLVERQKKTIYKTASLENQPIIEDSHTHAISPLKELVNIGNTFDGSDLYSNAVSSTTQLSEYDSRQLVGYFECEIEEIDLKIGELLSLQIKPISIPLSTLNLGSWYLNSKKLNLTELNGNEDISESQVSINIPGIVKDFSGVLQFRIETPMKIYSPEVVIKIRVGNLKSKPNGYFFTNLKQIETISGENLHVQFKAYNIVLDTLKKGSWFVNNELLDFKKWNGSVNVSESQVEINFPKSTNELSGIWQFRIDKPMKLFSPEISVNVLAKEVAPLSTGFLDCEIEEIDLKIGETLSLTLNAKDIPIMTLKNGGWFLNSEPIHAVKFRGNEVIEENKVKIVIPNVTKEFSGLLQYRIVKPVELYSPEIIIKIRGSLIKQTPKIEEEKFESNLILELHNVSLNISENERILLEAKIISGNINSYKTPPQWFWNDEAVKNINCKKDFTSNLAQLEIAHCQLSDSGQYKICFNPLEASKCGKVTGLFLVSIAPIKKNLKPIDSNIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNNNLSFLLIDSVKLEDSGTYICQGFTNKELISECKITLNVVDNISDTLQCQVKFEKDKYSIEINQDVTMRALIECTSTHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCSNNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGMVDGKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMPFGDPCVLDNPFIDLYIESPQVNEHSGLYKCIVTNEKSETEFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLKINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRIIVKPLCAPVLTAEYSKGADVILSWTSVATTDTLNIIYNIEKQKSLTSTNWKKIMKNLTETTYSLSSSCLPPQESHLLRCVAISEYGFETVSNIIEIPIRANSPILPPDKPTIIFKDATCVKISWMRGKCKNLTPEESIGKIMYSLEMKDNPKSSWQIVSNDLVDNEYSLSLEPGVSYMFRVIAFNDFGISEPSQSLISRIDRLKLVPDFSVDPPWLHLKGQPCLKWRAATVPEFCDSCVSGILPDYKVEYRNGRLSPWKIYQENIMQNETYLTQKIIDDAQEFRVSCRNKFGQNGPTRSYRLQANIVGKTSFRSPSVEKVKTIIKYDQLKQAEIESISKDGLSLKWSQWVPDQINKYIIQRKNSFSQDWEQIHSTIFGENCFVEMILSENFSRQLRILSLDDNKTELHDGYNILYIPSKDECIPTIPENLQVNDLTNYHEIFWSESKSIEIVDSPITYSLQSKVNNQFWFTITEKLDKCFYTNTRIDKYGVTGYRVLARNSIGSSPFSMEVFTKSLINILSNEQIIKSLRYFVINPREIEIKWHLCESIFDSGITTEDLSFQIEKKTVKEGSDWVPISNIVERNSILISITFEDENLFRIQPFYRDEKLSASRIFRMYVSKDLLVPDMSFTRPNLVIDSVTSCAIEWPEPELQSGFSPDGIEICVPSVLLVDLQYEIQFVVVDPIVGSKIRGKDVKNLQWKPLQEDLEENTFNWENPDPTQEYLFRIVAKNQFGSGLPSQIVKLHPQIIIPDFSFIRLTIDDTVIPGSNGEREITLSWSPPRISPDLYIPFTVDVECRPVNYSYSDEEGWSVFKTNIKKNRVDIADLDPNINYQLRIVPVTDFGIGKPSMVIKKIRRSDNLNSPTTEKAMMLQEKHCLAVPMFCCLSQKAELKFTKLMEYKLDKITWTFNNAKVDVNDERYKIFSAETYGIYFIIKNLEEDDFGEYCALDEVQDPIQSFILIKSDAPTILNCLPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIFSSYRTVITEDKEQGTYSLLISKCILSDGGEYSIRAENAIGFAEVKFNLRVDAHPEKKSVQINIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEINNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQLYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWFIKPGNNLNAALDYIIDQIVKLMTYPEEMVPNFPSDMKNAIETLLIDSRPKVIFNSSLSNPEGSVXXXXXXXXXXXXXXXRDGINYERCDTPNDNSSEEVKSDRSETFPSADRLSVSNTTKELLFTVPLKDQTFKSDSTAGKITVTLTCQLSLLGSEPISISWYKNQELLTDDSRIKLEVIKGGFLSCTILNATETDVGIFRCIARCHSLRTETSARLVLGDVPPQPEQLSVYYTNQEEVLLKWSPYLSAIDDVIYRIDIRTIDSRNKIRNWKTIGYSVDNRYLLENLDRTQQYIARIIAQNKYGYSPYSIATSVFQNKIRNIHSLKQALIFNRKWMLTSRQSNHFNDLHDLIKDISSDDIRMNVIREHYSTLSQKSSGFAVLKLKNTNVNFPEYIVQRTFKMEDICPAFDLCVRIKYYHFPILFGEICDSSLGNRITFEEFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRYESDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNTNTLLLPVPHTHFRAPKLSMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWFKQDPQTIYEMEHQTISSTPLVDFVNANL 12343
            MIFQLLWSLIGIFSILGYLFLWLQQRLERDNAILSKPRSSNLSDEEYLNNLIINSPSVSSISQKNDSSVDPEFITTDLDDDNEAVENLDTSQYSDVTDLDELEDTNMSDSLERNKLHYERSFDATIEDVASDFQSNDDLLSFIKTCKPIPGTKYYANCTIKCKENSELIKTTEGSAVSIEDADNLDYWISFSDDLPIPLSIVPRCCLSNSPNAENPDSESRKRNPRESFREDILQISNKNQESTMKRKYALADLIECDREYCATLKLIKDILKSLDKTENEFGVEIDSLFEEVCKLIVELVEFHENLILPELSSCVMIPIRVANILKNQKLQFYRYSEFQSQWKKLKILLDISKKKYIFVKNVNTIEKSKFSVLSFNDLMLKVENKLPQYNLFLFDIIRYTGRIDGEVNDLQKAITVFQKIRRRNQEKVYLSKLIEKTNINISNERFIRVTNQVMISETQIMSKSYENLQFIREEMCSLILLKNYLLCVSDLSQPTDRKIMNLDYTKIYTKENYERQNELIIWSKMNKLEFRIFILYFPNKVSKLGWLRDLTKRLKKKGIDEIFVSSTEYDIQYKQYLGKNQRLVATEMESIGLESASLENECSSISDQIEDLTSMADSITDVRFESAILDMPSSMTSGSYKTAPETFKSTMDKASRPISGISQDSVSTLDGVRTPFSDEELIKSVLIISEIEEINISEGSDFVWSLKLVNFDPILHDIVWSLVGKTLDLTSQNSSIKIEEQNNKVYECQLKRQKLTKLESGQLSCKIIDKINGSLIVSKIVNVFISPPCISTELSCELTEVTVLENNPITFQLISGTNCLKNSFLNHITWYKDNERLVKEEGRIKTFINSSNNKISLIIEKASISDAGIYTISCAPNSEIFIKNVSNISILLLVERQKKTIYKTASLENQPIIEDSHTHAISPLKELVNIGNTFDGSDLYSNAVSSTTQLSEYDSRQLVGYFECEIEEIDLKIGELLSLQIKPISIPLSTLNLGSWYLNSKKLNLTELNGNEDISESQVSINIPGIVKDFSGVLQFRIETPMKIYSPEVVIKIRVGNLKSKPNGYFFTNLKQIETISGENLHVQFKAYNIVLDTLKKGSWFVNNELLDFKKWNGSVNVSESQVEINFPKSTNELSGIWQFRIDKPMKLFSPEISVNVLAKEVAPLSTGFLDCEIEEIDLKIGETLSLTLNAKDIPIMTLKNGGWFLNSEPIHAVKFRGNEVIEENKVKIVIPNVTKEFSGLLQYRIVKPVELYSPEIIIKIRGSLIKQTPKIEEEKFESNLILELHNVSLNISENERILLEAKIISGNINSYKTPPQWFWNDEAVKNINCKKDFTSNLAQLEIAHCQLSDSGQYKICFNPLEASKCGKVTGLFLVSIAPIKKNLKPIDSNIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNNNLSFLLIDSVKLEDSGTYICQGFTNKELISECKITLNVVDNISDTLQCQVKFEKDKYSIEINQDVTMRALIECTSTHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCSNNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGMVDGKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMPFGDPCVLDNPFIDLYIESPQVNEHSGLYKCIVTNEKSETEFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLKINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRIIVKPLCAPVLTAEYSKGADVILSWTSVATTDTLNIIYNIEKQKSLTSTNWKKIMKNLTETTYSLSSSCLPPQESHLLRCVAISEYGFETVSNIIEIPIRANSPILPPDKPTIIFKDATCVKISWMRGKCKNLTPEESIGKIMYSLEMKDNPKSSWQIVSNDLVDNEYSLSLEPGVSYMFRVIAFNDFGISEPSQSLISRIDRLKLVPDFSVDPPWLHLKGQPCLKWRAATVPEFCDSCVSGILPDYKVEYRNGRLSPWKIYQENIMQNETYLTQKIIDDAQEFRVSCRNKFGQNGPTRSYRLQANIVGKTSFRSPSVEKVKTIIKYDQLKQAEIESISKDGLSLKWSQWVPDQINKYIIQRKNSFSQDWEQIHSTIFGENCFVEMILSENFSRQLRILSLDDNKTELHDGYNILYIPSKDECIPTIPENLQVNDLTNYHEIFWSESKSIEIVDSPITYSLQSKVNNQFWFTITEKLDKCFYTNTRIDKYGVTGYRVLARNSIGSSPFSMEVFTKSLINILSNEQIIKSLRYFVINPREIEIKWHLCESIFDSGITTEDLSFQIEKKTVKEGSDWVPISNIVERNSILISITFEDENLFRIQPFYRDEKLSASRIFRMYVSKDLLVPDMSFTRPNLVIDSVTSCAIEWPEPELQSGFSPDGIEICVPSVLLVDLQYEIQFVVVDPIVGSKIRGKDVKNLQWKPLQEDLEENTFNWENPDPTQEYLFRIVAKNQFGSGLPSQIVKLHPQIIIPDFSFIRLTIDDTVIPGSNGEREITLSWSPPRISPDLYIPFTVDVECRPVNYSYSDEEGWSVFKTNIKKNRVDIADLDPNINYQLRIVPVTDFGIGKPSMVIKKIRRSDNLNSPTTEKAMMLQEKHCLAVPMFCCLSQKAELKFTKLMEYKLDKITWTFNNAKVDVNDERYKIFSAETYGIYFIIKNLEEDDFGEYCALDEVQDPIQSFILIKSDAPTILNCLPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIFSSYRTVITEDKEQGTYSLLISKCILSDGGEYSIRAENAIGFAEVKFNLRVDAHPEKKSVQINIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEINNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQLYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWFIKPGNNLNAALDYIIDQIVKLMTYPEEMVPNFPSDMKNAIETLLIDSRPKVIFNSSLSNPEGSVSPPISQLSSRASSSSRDGINYERCDTPNDNSSEEVKSDRSETFPSADRLSVSNTTKELLFTVPLKDQTFKSDSTAGKITVTLTCQLSLLGSEPISISWYKNQELLTDDSRIKLEVIKGGFLSCTILNATETDVGIFRCIARCHSLRTETSARLVLGDVPPQPEQLSVYYTNQEEVLLKWSPYLSAIDDVIYRIDIRTIDSRNKIRNWKTIGYSVDNRYLLENLDRTQQYIARIIAQNKYGYSPYSIATSVFQNKIRNIHSLKQALIFNRKWMLTSRQSNHFNDLHDLIKDISSDDIRMNVIREHYSTLSQKSSGFAVLKLKNTNVNFPEYIVQRTFKMEDICPAFDLCVRIKYYHFPILFGEICDSSLGNRITFEEFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRYESDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNTNTLLLPVPHTHFRAPKLSMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWFKQDPQTIYEMEHQTISSTPLVDFVNANL
Sbjct:    1 MIFQLLWSLIGIFSILGYLFLWLQQRLERDNAILSKPRSSNLSDEEYLNNLIINSPSVSSISQKNDSSVDPEFITTDLDDDNEAVENLDTSQYSDVTDLDELEDTNMSDSLERNKLHYERSFDATIEDVASDFQSNDDLLSFIKTCKPIPGTKYYANCTIKCKENSELIKTTEGSAVSIEDADNLDYWISFSDDLPIPLSIVPRCCLSNSPNAENPDSESRKRNPRESFREDILQISNKNQESTMKRKYALADLIECDREYCATLKLIKDILKSLDKTENEFGVEIDSLFEEVCKLIVELVEFHENLILPELSSCVMIPIRVANILKNQKLQFYRYSEFQSQWKKLKILLDISKKKYIFVKNVNTIEKSKFSVLSFNDLMLKVENKLPQYNLFLFDIIRYTGRIDGEVNDLQKAITVFQKIRRRNQEKVYLSKLIEKTNINISNERFIRVTNQVMISETQIMSKSYENLQFIREEMCSLILLKNYLLCVSDLSQPTDRKIMNLDYTKIYTKENYERQNELIIWSKMNKLEFRIFILYFPNKVSKLGWLRDLTKRLKKKGIDEIFVSSTEYDIQYKQYLGKNQRLVATEMESIGLESASLENECSSISDQIEDLTSMADSITDVRFESAILDMPSSMTSGSYKTAPETFKSTMDKASRPISGISQDSVSTLDGVRTPFSDEELIKSVLIISEIEEINISEGSDFVWSLKLVNFDPILHDIVWSLVGKTLDLTSQNSSIKIEEQNNKVYECQLKRQKLTKLESGQLSCKIIDKINGSLIVSKIVNVFISPPCISTELSCELTEVTVLENNPITFQLISGTNCLKNSFLNHITWYKDNERLVKEEGRIKTFINSSNNKISLIIEKASISDAGIYTISCAPNSEIFIKNVSNISILLLVERQKKTIYKTASLENQPIIEDSHTHAISPLKELVNIGNTFDGSDLYSNAVSSTTQLSEYDSRQLVGYFECEIEEIDLKIGELLSLQIKPISIPLSTLNLGSWYLNSKKLNLTELNGNEDISESQVSINIPGIVKDFSGVLQFRIETPMKIYSPEVVIKIRVGNLKSKPNGYFFTNLKQIETISGENLHVQFKAYNIVLDTLKKGSWFVNNELLDFKKWNGSVNVSESQVEINFPKSTNELSGIWQFRIDKPMKLFSPEISVNVLAKEVAPLSTGFLDCEIEEIDLKIGETLSLTLNAKDIPIMTLKNGGWFLNSEPIHAVKFRGNEVIEENKVKIVIPNVTKEFSGLLQYRIVKPVELYSPEIIIKIRGSLIKQTPKIEEEKFESNLILELHNVSLNISENERILLEAKIISGNINSYKTPPQWFWNDEAVKNINCKKDFTSNLAQLEIAHCQLSDSGQYKICFNPLEASKCGKVTGLFLVSIAPIKKNLKPIDSNIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNNNLSFLLIDSVKLEDSGTYICQGFTNKELISECKITLNVVDNISDTLQCQVKFEKDKYSIEINQDVTMRALIECTSTHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCSNNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGMVDGKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMPFGDPCVLDNPFIDLYIESPQVNEHSGLYKCIVTNEKSETEFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLKINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRIIVKPLCAPVLTAEYSKGADVILSWTSVATTDTLNIIYNIEKQKSLTSTNWKKIMKNLTETTYSLSSSCLPPQESHLLRCVAISEYGFETVSNIIEIPIRANSPILPPDKPTIIFKDATCVKISWMRGKCKNLTPEESIGKIMYSLEMKDNPKSSWQIVSNDLVDNEYSLSLEPGVSYMFRVIAFNDFGISEPSQSLISRIDRLKLVPDFSVDPPWLHLKGQPCLKWRAATVPEFCDSCVSGILPDYKVEYRNGRLSPWKIYQENIMQNETYLTQKIIDDAQEFRVSCRNKFGQNGPTRSYRLQANIVGKTSFRSPSVEKVKTIIKYDQLKQAEIESISKDGLSLKWSQWVPDQINKYIIQRKNSFSQDWEQIHSTIFGENCFVEMILSENFSRQLRILSLDDNKTELHDGYNILYIPSKDECIPTIPENLQVNDLTNYHEIFWSESKSIEIVDSPITYSLQSKVNNQFWFTITEKLDKCFYTNTRIDKYGVTGYRVLARNSIGSSPFSMEVFTKSLINILSNEQIIKSLRYFVINPREIEIKWHLCESIFDSGITTEDLSFQIEKKTVKEGSDWVPISNIVERNSILISITFEDENLFRIQPFYRDEKLSASRIFRMYVSKDLLVPDMSFTRPNLVIDSVTSCAIEWPEPELQSGFSPDGIEICVPSVLLVDLQYEIQFVVVDPIVGSKIRGKDVKNLQWKPLQEDLEENTFNWENPDPTQEYLFRIVAKNQFGSGLPSQIVKLHPQIIIPDFSFIRLTIDDTVIPGSNGEREITLSWSPPRISPDLYIPFTVDVECRPVNYSYSDEEGWSVFKTNIKKNRVDIADLDPNINYQLRIVPVTDFGIGKPSMVIKKIRRSDNLNSPTTEKAMMLQEKHCLAVPMFCCLSQKAELKFTKLMEYKLDKITWTFNNAKVDVNDERYKIFSAETYGIYFIIKNLEEDDFGEYCALDEVQDPIQSFILIKSDAPTILNCLPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIFSSYRTVITEDKEQGTYSLLISKCILSDGGEYSIRAENAIGFAEVKFNLRVDAHPEKKSVQINIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEINNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQLYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWFIKPGNNLNAALDYIIDQIVKLMTYPEEMVPNFPSDMKNAIETLLIDSRPKVIFNSSLSNPEGSVSPPISQLSSRASSSSRDGINYERCDTPNDNSSEEVKSDRSETFPSADRLSVSNTTKELLFTVPLKDQTFKSDSTAGKITVTLTCQLSLLGSEPISISWYKNQELLTDDSRIKLEVIKGGFLSCTILNATETDVGIFRCIARCHSLRTETSARLVLGDVPPQPEQLSVYYTNQEEVLLKWSPYLSAIDDVIYRIDIRTIDSRNKIRNWKTIGYSVDNRYLLENLDRTQQYIARIIAQNKYGYSPYSIATSVFQNKIRNIHSLKQALIFNRKWMLTSRQSNHFNDLHDLIKDISSDDIRMNVIREHYSTLSQKSSGFAVLKLKNTNVNFPEYIVQRTFKMEDICPAFDLCVRIKYYHFPILFGEICDSSLGNRITFEEFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRYESDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNTNTLLLPVPHTHFRAPKLSMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWFKQDPQTIYEMEHQTISSTPLVDFVNANL 4094          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000022977.1 (SMESG000022977.1)

HSP 1 Score: 7975.16 bits (20692), Expect = 0.000e+0
Identity = 3988/3988 (100.00%), Postives = 3988/3988 (100.00%), Query Frame = 2
Query:  380 MSDSLERNKLHYERSFDATIEDVASDFQSNDDLLSFIKTCKPIPGTKYYANCTIKCKENSELIKTTEGSAVSIEDADNLDYWISFSDDLPIPLSIVPRCCLSNSPNAENPDSESRKRNPRESFREDILQISNKNQESTMKRKYALADLIECDREYCATXXXXXXXXXXXXXTENEFGVEIDSLFEEVCKLIVELVEFHENLILPELSSCVMIPIRVANILKNQKLQFYRYSEFQSQWXXXXXXXXXXXXXXXFVKNVNTIEKSKFSVLSFNDLMLKVENKLPQYNLFLFDIIRYTGRIDGEVNDLQKAITVFQKIRRRNQEKVYLSKLIEKTNINISNERFIRVTNQVMISETQIMSKSYENLQFIREEMCSLILLKNYLLCVSDLSQPTDRKIMNLDYTKIYTKENYERQNELIIWSKMNKLEFRIFILYFPNKVSKLGWLRDLTKRLKKKGIDEIFVSSTEYDIQYKQYLGKNQRLVATEMESIGLESASLENECSSISDQIEDLTSMADSITDVRFESAILDMPSSMTSGSYKTAPETFKSTMDKASRPISGISQDSVSTLDGVRTPFSDXXXXXXXXXXXXXXXXXXXXXXDFVWSLKLVNFDPILHDIVWSLVGKTLDLTSQNSSIKIEEQNNKVYECQLKRQKLTKLESGQLSCKIIDKINGSLIVSKIVNVFISPPCISTELSCELTEVTVLENNPITFQLISGTNCLKNSFLNHITWYKDNERLVKEEGRIKTFXXXXXXXXXXXXEKASISDAGIYTISCAPNSEIFIKNVSNISILLLVERQKKTIYKTASLENQPIIEDSHTHAISPLKELVNIGNTFDGSDLYSNAVSSTTQLSEYDSRQLVGYFECEIEEIDLKIGELLSLQIKPISIPLSTLNLGSWYLNSKKLNLTELNGNEDISESQVSINIPGIVKDFSGVLQFRIETPMKIYSPEVVIKIRVGNLKSKPNGYFFTNLKQIETISGENLHVQFKAYNIVLDTLKKGSWFVNNELLDFKKWNGSVNVSESQVEINFPKSTNELSGIWQFRIDKPMKLFSPEISVNVLAKEVAPLSTGFLDCEIEEIDLKIGETLSLTLNAKDIPIMTLKNGGWFLNSEPIHAVKFRGNEVIEENKVKIVIPNVTKEFSGLLQYRIVKPVELYSPEIIIKIRGSLIKQTPKIEEEKFESNLILELHNVSLNISENERILLEAKIISGNINSYKTPPQWFWNDEAVKNINCKKDFTSNLAQLEIAHCQLSDSGQYKICFNPLEASKCGKVTGLFLVSIAPIKKNLKPIDSNIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNNNLSFLLIDSVKLEDSGTYICQGFTNKELISECKITLNVVDNISDTLQCQVKFEKDKYSIEINQDVTMRALIECTSTHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCSNNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGMVDGKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMPFGDPCVLDNPFIDLYIESPQVNEHSGLYKCIVTNEKSETEFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLKINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRIIVKPLCAPVLTAEYSKGADVILSWTSVATTDTLNIIYNIEKQKSLTSTNWKKIMKNLTETTYSLSSSCLPPQESHLLRCVAISEYGFETVSNIIEIPIRANSPILPPDKPTIIFKDATCVKISWMRGKCKNLTPEESIGKIMYSLEMKDNPKSSWQIVSNDLVDNEYSLSLEPGVSYMFRVIAFNDFGISEPSQSLISRIDRLKLVPDFSVDPPWLHLKGQPCLKWRAATVPEFCDSCVSGILPDYKVEYRNGRLSPWKIYQENIMQNETYLTQKIIDDAQEFRVSCRNKFGQNGPTRSYRLQANIVGKTSFRSPSVEKVKTIIKYDQLKQAEIESISKDGLSLKWSQWVPDQINKYIIQRKNSFSQDWEQIHSTIFGENCFVEMILSENFSRQLRILSLDDNKTELHDGYNILYIPSKDECIPTIPENLQVNDLTNYHEIFWSESKSIEIVDSPITYSLQSKVNNQFWFTITEKLDKCFYTNTRIDKYGVTGYRVLARNSIGSSPFSMEVFTKSLINILSNEQIIKSLRYFVINPREIEIKWHLCESIFDSGITTEDLSFQIEKKTVKEGSDWVPISNIVERNSILISITFEDENLFRIQPFYRDEKLSASRIFRMYVSKDLLVPDMSFTRPNLVIDSVTSCAIEWPEPELQSGFSPDGIEICVPSVLLVDLQYEIQFVVVDPIVGSKIRGKDVKNLQWKPLQEDLEENTFNWENPDPTQEYLFRIVAKNQFGSGLPSQIVKLHPQIIIPDFSFIRLTIDDTVIPGSNGEREITLSWSPPRISPDLYIPFTVDVECRPVNYSYSDEEGWSVFKTNIKKNRVDIADLDPNINYQLRIVPVTDFGIGKPSMVIKKIRRSDNLNSPTTEKAMMLQEKHCLAVPMFCCLSQKAELKFTKLMEYKLDKITWTFNNAKVDVNDERYKIFSAETYGIYFIIKNLEEDDFGEYCALDEVQDPIQSFILIKSDAPTILNCLPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIFSSYRTVITEDKEQGTYSLLISKCILSDGGEYSIRAENAIGFAEVKFNLRVDAHPEKKSVQINIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEINNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQLYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWFIKPGNNLNAALDYIIDQIVKLMTYPEEMVPNFPSDMKNAIETLLIDSRPKVIFNSSLSNPEGSVXXXXXXXXXXXXXXXRDGINYERCDTPNDNSSEEVKSDRSETFPSADRLSVSNTTKELLFTVPLKDQTFKSDSTAGKITVTLTCQLSLLGSEPISISWYKNQELLTDDSRIKLEVIKGGFLSCTILNATETDVGIFRCIARCHSLRTETSARLVLGDVPPQPEQLSVYYTNQEEVLLKWSPYLSAIDDVIYRIDIRTIDSRNKIRNWKTIGYSVDNRYLLENLDRTQQYIARIIAQNKYGYSPYSIATSVFQNKIRNIHSLKQALIFNRKWMLTSRQSNHFNDLHDLIKDISSDDIRMNVIREHYSTLSQKSSGFAVLKLKNTNVNFPEYIVQRTFKMEDICPAFDLCVRIKYYHFPILFGEICDSSLGNRITFEEFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRYESDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNTNTLLLPVPHTHFRAPKLSMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWFKQDPQTIYEMEHQTISSTPLVDFVNANL 12343
            MSDSLERNKLHYERSFDATIEDVASDFQSNDDLLSFIKTCKPIPGTKYYANCTIKCKENSELIKTTEGSAVSIEDADNLDYWISFSDDLPIPLSIVPRCCLSNSPNAENPDSESRKRNPRESFREDILQISNKNQESTMKRKYALADLIECDREYCATLKLIKDILKSLDKTENEFGVEIDSLFEEVCKLIVELVEFHENLILPELSSCVMIPIRVANILKNQKLQFYRYSEFQSQWKKLKILLDISKKKYIFVKNVNTIEKSKFSVLSFNDLMLKVENKLPQYNLFLFDIIRYTGRIDGEVNDLQKAITVFQKIRRRNQEKVYLSKLIEKTNINISNERFIRVTNQVMISETQIMSKSYENLQFIREEMCSLILLKNYLLCVSDLSQPTDRKIMNLDYTKIYTKENYERQNELIIWSKMNKLEFRIFILYFPNKVSKLGWLRDLTKRLKKKGIDEIFVSSTEYDIQYKQYLGKNQRLVATEMESIGLESASLENECSSISDQIEDLTSMADSITDVRFESAILDMPSSMTSGSYKTAPETFKSTMDKASRPISGISQDSVSTLDGVRTPFSDEELIKSVLIISEIEEINISEGSDFVWSLKLVNFDPILHDIVWSLVGKTLDLTSQNSSIKIEEQNNKVYECQLKRQKLTKLESGQLSCKIIDKINGSLIVSKIVNVFISPPCISTELSCELTEVTVLENNPITFQLISGTNCLKNSFLNHITWYKDNERLVKEEGRIKTFINSSNNKISLIIEKASISDAGIYTISCAPNSEIFIKNVSNISILLLVERQKKTIYKTASLENQPIIEDSHTHAISPLKELVNIGNTFDGSDLYSNAVSSTTQLSEYDSRQLVGYFECEIEEIDLKIGELLSLQIKPISIPLSTLNLGSWYLNSKKLNLTELNGNEDISESQVSINIPGIVKDFSGVLQFRIETPMKIYSPEVVIKIRVGNLKSKPNGYFFTNLKQIETISGENLHVQFKAYNIVLDTLKKGSWFVNNELLDFKKWNGSVNVSESQVEINFPKSTNELSGIWQFRIDKPMKLFSPEISVNVLAKEVAPLSTGFLDCEIEEIDLKIGETLSLTLNAKDIPIMTLKNGGWFLNSEPIHAVKFRGNEVIEENKVKIVIPNVTKEFSGLLQYRIVKPVELYSPEIIIKIRGSLIKQTPKIEEEKFESNLILELHNVSLNISENERILLEAKIISGNINSYKTPPQWFWNDEAVKNINCKKDFTSNLAQLEIAHCQLSDSGQYKICFNPLEASKCGKVTGLFLVSIAPIKKNLKPIDSNIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNNNLSFLLIDSVKLEDSGTYICQGFTNKELISECKITLNVVDNISDTLQCQVKFEKDKYSIEINQDVTMRALIECTSTHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCSNNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGMVDGKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMPFGDPCVLDNPFIDLYIESPQVNEHSGLYKCIVTNEKSETEFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLKINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRIIVKPLCAPVLTAEYSKGADVILSWTSVATTDTLNIIYNIEKQKSLTSTNWKKIMKNLTETTYSLSSSCLPPQESHLLRCVAISEYGFETVSNIIEIPIRANSPILPPDKPTIIFKDATCVKISWMRGKCKNLTPEESIGKIMYSLEMKDNPKSSWQIVSNDLVDNEYSLSLEPGVSYMFRVIAFNDFGISEPSQSLISRIDRLKLVPDFSVDPPWLHLKGQPCLKWRAATVPEFCDSCVSGILPDYKVEYRNGRLSPWKIYQENIMQNETYLTQKIIDDAQEFRVSCRNKFGQNGPTRSYRLQANIVGKTSFRSPSVEKVKTIIKYDQLKQAEIESISKDGLSLKWSQWVPDQINKYIIQRKNSFSQDWEQIHSTIFGENCFVEMILSENFSRQLRILSLDDNKTELHDGYNILYIPSKDECIPTIPENLQVNDLTNYHEIFWSESKSIEIVDSPITYSLQSKVNNQFWFTITEKLDKCFYTNTRIDKYGVTGYRVLARNSIGSSPFSMEVFTKSLINILSNEQIIKSLRYFVINPREIEIKWHLCESIFDSGITTEDLSFQIEKKTVKEGSDWVPISNIVERNSILISITFEDENLFRIQPFYRDEKLSASRIFRMYVSKDLLVPDMSFTRPNLVIDSVTSCAIEWPEPELQSGFSPDGIEICVPSVLLVDLQYEIQFVVVDPIVGSKIRGKDVKNLQWKPLQEDLEENTFNWENPDPTQEYLFRIVAKNQFGSGLPSQIVKLHPQIIIPDFSFIRLTIDDTVIPGSNGEREITLSWSPPRISPDLYIPFTVDVECRPVNYSYSDEEGWSVFKTNIKKNRVDIADLDPNINYQLRIVPVTDFGIGKPSMVIKKIRRSDNLNSPTTEKAMMLQEKHCLAVPMFCCLSQKAELKFTKLMEYKLDKITWTFNNAKVDVNDERYKIFSAETYGIYFIIKNLEEDDFGEYCALDEVQDPIQSFILIKSDAPTILNCLPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIFSSYRTVITEDKEQGTYSLLISKCILSDGGEYSIRAENAIGFAEVKFNLRVDAHPEKKSVQINIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEINNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQLYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWFIKPGNNLNAALDYIIDQIVKLMTYPEEMVPNFPSDMKNAIETLLIDSRPKVIFNSSLSNPEGSVSPPISQLSSRASSSSRDGINYERCDTPNDNSSEEVKSDRSETFPSADRLSVSNTTKELLFTVPLKDQTFKSDSTAGKITVTLTCQLSLLGSEPISISWYKNQELLTDDSRIKLEVIKGGFLSCTILNATETDVGIFRCIARCHSLRTETSARLVLGDVPPQPEQLSVYYTNQEEVLLKWSPYLSAIDDVIYRIDIRTIDSRNKIRNWKTIGYSVDNRYLLENLDRTQQYIARIIAQNKYGYSPYSIATSVFQNKIRNIHSLKQALIFNRKWMLTSRQSNHFNDLHDLIKDISSDDIRMNVIREHYSTLSQKSSGFAVLKLKNTNVNFPEYIVQRTFKMEDICPAFDLCVRIKYYHFPILFGEICDSSLGNRITFEEFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRYESDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNTNTLLLPVPHTHFRAPKLSMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWFKQDPQTIYEMEHQTISSTPLVDFVNANL
Sbjct:    1 MSDSLERNKLHYERSFDATIEDVASDFQSNDDLLSFIKTCKPIPGTKYYANCTIKCKENSELIKTTEGSAVSIEDADNLDYWISFSDDLPIPLSIVPRCCLSNSPNAENPDSESRKRNPRESFREDILQISNKNQESTMKRKYALADLIECDREYCATLKLIKDILKSLDKTENEFGVEIDSLFEEVCKLIVELVEFHENLILPELSSCVMIPIRVANILKNQKLQFYRYSEFQSQWKKLKILLDISKKKYIFVKNVNTIEKSKFSVLSFNDLMLKVENKLPQYNLFLFDIIRYTGRIDGEVNDLQKAITVFQKIRRRNQEKVYLSKLIEKTNINISNERFIRVTNQVMISETQIMSKSYENLQFIREEMCSLILLKNYLLCVSDLSQPTDRKIMNLDYTKIYTKENYERQNELIIWSKMNKLEFRIFILYFPNKVSKLGWLRDLTKRLKKKGIDEIFVSSTEYDIQYKQYLGKNQRLVATEMESIGLESASLENECSSISDQIEDLTSMADSITDVRFESAILDMPSSMTSGSYKTAPETFKSTMDKASRPISGISQDSVSTLDGVRTPFSDEELIKSVLIISEIEEINISEGSDFVWSLKLVNFDPILHDIVWSLVGKTLDLTSQNSSIKIEEQNNKVYECQLKRQKLTKLESGQLSCKIIDKINGSLIVSKIVNVFISPPCISTELSCELTEVTVLENNPITFQLISGTNCLKNSFLNHITWYKDNERLVKEEGRIKTFINSSNNKISLIIEKASISDAGIYTISCAPNSEIFIKNVSNISILLLVERQKKTIYKTASLENQPIIEDSHTHAISPLKELVNIGNTFDGSDLYSNAVSSTTQLSEYDSRQLVGYFECEIEEIDLKIGELLSLQIKPISIPLSTLNLGSWYLNSKKLNLTELNGNEDISESQVSINIPGIVKDFSGVLQFRIETPMKIYSPEVVIKIRVGNLKSKPNGYFFTNLKQIETISGENLHVQFKAYNIVLDTLKKGSWFVNNELLDFKKWNGSVNVSESQVEINFPKSTNELSGIWQFRIDKPMKLFSPEISVNVLAKEVAPLSTGFLDCEIEEIDLKIGETLSLTLNAKDIPIMTLKNGGWFLNSEPIHAVKFRGNEVIEENKVKIVIPNVTKEFSGLLQYRIVKPVELYSPEIIIKIRGSLIKQTPKIEEEKFESNLILELHNVSLNISENERILLEAKIISGNINSYKTPPQWFWNDEAVKNINCKKDFTSNLAQLEIAHCQLSDSGQYKICFNPLEASKCGKVTGLFLVSIAPIKKNLKPIDSNIETCPGESVTLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNNNLSFLLIDSVKLEDSGTYICQGFTNKELISECKITLNVVDNISDTLQCQVKFEKDKYSIEINQDVTMRALIECTSTHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKIQNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVTKNIEITEGNELNLEVVSEIEKDLQFQWSKDDIDCSNNGIFNSTKNKNCFNLTKLKAEITDSGVYKFEGMVDGKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEIILSDSKPLIISVEVLNWKQGVIQWLRNDMPFGDPCVLDNPFIDLYIESPQVNEHSGLYKCIVTNEKSETEFVEITVKFKDEKVVSPILGELLSCTVEEVNTIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNLILRDVKMTDAGMYSLKINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIKKPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSCDNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMMESCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRIIVKPLCAPVLTAEYSKGADVILSWTSVATTDTLNIIYNIEKQKSLTSTNWKKIMKNLTETTYSLSSSCLPPQESHLLRCVAISEYGFETVSNIIEIPIRANSPILPPDKPTIIFKDATCVKISWMRGKCKNLTPEESIGKIMYSLEMKDNPKSSWQIVSNDLVDNEYSLSLEPGVSYMFRVIAFNDFGISEPSQSLISRIDRLKLVPDFSVDPPWLHLKGQPCLKWRAATVPEFCDSCVSGILPDYKVEYRNGRLSPWKIYQENIMQNETYLTQKIIDDAQEFRVSCRNKFGQNGPTRSYRLQANIVGKTSFRSPSVEKVKTIIKYDQLKQAEIESISKDGLSLKWSQWVPDQINKYIIQRKNSFSQDWEQIHSTIFGENCFVEMILSENFSRQLRILSLDDNKTELHDGYNILYIPSKDECIPTIPENLQVNDLTNYHEIFWSESKSIEIVDSPITYSLQSKVNNQFWFTITEKLDKCFYTNTRIDKYGVTGYRVLARNSIGSSPFSMEVFTKSLINILSNEQIIKSLRYFVINPREIEIKWHLCESIFDSGITTEDLSFQIEKKTVKEGSDWVPISNIVERNSILISITFEDENLFRIQPFYRDEKLSASRIFRMYVSKDLLVPDMSFTRPNLVIDSVTSCAIEWPEPELQSGFSPDGIEICVPSVLLVDLQYEIQFVVVDPIVGSKIRGKDVKNLQWKPLQEDLEENTFNWENPDPTQEYLFRIVAKNQFGSGLPSQIVKLHPQIIIPDFSFIRLTIDDTVIPGSNGEREITLSWSPPRISPDLYIPFTVDVECRPVNYSYSDEEGWSVFKTNIKKNRVDIADLDPNINYQLRIVPVTDFGIGKPSMVIKKIRRSDNLNSPTTEKAMMLQEKHCLAVPMFCCLSQKAELKFTKLMEYKLDKITWTFNNAKVDVNDERYKIFSAETYGIYFIIKNLEEDDFGEYCALDEVQDPIQSFILIKSDAPTILNCLPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIFSSYRTVITEDKEQGTYSLLISKCILSDGGEYSIRAENAIGFAEVKFNLRVDAHPEKKSVQINIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEINNMGIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQLYNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWFIKPGNNLNAALDYIIDQIVKLMTYPEEMVPNFPSDMKNAIETLLIDSRPKVIFNSSLSNPEGSVSPPISQLSSRASSSSRDGINYERCDTPNDNSSEEVKSDRSETFPSADRLSVSNTTKELLFTVPLKDQTFKSDSTAGKITVTLTCQLSLLGSEPISISWYKNQELLTDDSRIKLEVIKGGFLSCTILNATETDVGIFRCIARCHSLRTETSARLVLGDVPPQPEQLSVYYTNQEEVLLKWSPYLSAIDDVIYRIDIRTIDSRNKIRNWKTIGYSVDNRYLLENLDRTQQYIARIIAQNKYGYSPYSIATSVFQNKIRNIHSLKQALIFNRKWMLTSRQSNHFNDLHDLIKDISSDDIRMNVIREHYSTLSQKSSGFAVLKLKNTNVNFPEYIVQRTFKMEDICPAFDLCVRIKYYHFPILFGEICDSSLGNRITFEEFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEYRYESITRYESDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNTNTLLLPVPHTHFRAPKLSMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWFKQDPQTIYEMEHQTISSTPLVDFVNANL 3988          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000051697.1 (SMESG000051697.1)

HSP 1 Score: 115.546 bits (288), Expect = 1.045e-24
Identity = 76/274 (27.74%), Postives = 135/274 (49.27%), Query Frame = 2
Query: 9587 KSVQINIGDVNDRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEINNM---GIGRSEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSH-WCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQLY-------------NEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWFIK 10357
            + V+I  G V+D Y  +++L  G++ +     E ST   F+ KF +  +     + + E   + ++ H  ++ + DA    D+ + LI E L G  L + IT+  +   E++    I Q+   + ++H+    HLD+KPENI+     +  +K+  F  +         +    T+ F+APE+ + EP+ F +DMW++G+L+++ L G     F GD  Y             N+D    +S+ A  FIRK L+ +  +R+T  + L H W IK
Sbjct: 3544 QPVEIKNGSVHDHYEILEELGSGAFGQVYRCRELSTGKIFVAKFIDTPHQVDKNVVKHEIDTLNHLHHPKLLNLHDAFDDKDE-MCLIMEFLSGGELFDRITEDGYNMNEAEAANYIRQVCDGLKFMHDEGYIHLDLKPENIMCETSNSNRIKIIDFGLSTKLNPDEPVKVTTATAEFAAPEVAEIEPVGFYTDMWAVGVLSYVLLSGLSP--FGGDDDYETLQNVKKCAYDFNDDIFKNVSDDAKDFIRKLLIRQPQKRMTVYECLDHPWLIK 3814          

HSP 2 Score: 74.7146 bits (182), Expect = 1.948e-12
Identity = 98/452 (21.68%), Postives = 169/452 (37.39%), Query Frame = 2
Query: 10787 LTCQLSLLGSEPISISWYKNQELLTDDSRIKLEVIKGGFLSCTILNATETDVGIFRCIARCHSLRTETSARLVLGDVPPQPEQLSVYYTNQEEVLLKWSPYLSAIDDVIYRIDIRTIDSRNKIRNWKTIGYSVDNRYLLENLDRTQQYIARIIAQNKYGYS-------PYSIATSVFQNKIRNIHSLKQALIFNRKWMLTSRQSNHFNDLHDLIKDISSD--DIRMNVIREHYSTLSQKSSG-----FAVLKLKNTN------VNFPEYIVQRTFKMEDICPAFDLCVRIKYYHFPILFG---------EICDSSLGNRITFEEFVPGGNLLSVLMARSV-YSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVK---EQESLTTHKPSIFKAPEYRYESITRYESDIWSLGILSFLLLATQLP 12043
            +  ++  +G       W  N E L     + ++ +K      TI NAT+++ GI+                + + D P +P  + V       V+L W+P +S      Y  +           NW  I  S  N   L+NL   + Y  RIIA+N +G S       P +I   + + K  N+   +     NR         N+    HDL         +I+   + +HY  L +  SG     +   +L          ++ P  + +   K E           + + H P L           E+C           EF+ GG L   +       +E      IRQ+   ++F+H    +H +++P  I+    T+ S  IK+I      F  + K   ++    T   + F APE        + +D+W++G+LS++LL+   P
Sbjct: 3331 IVVKIPFVGFPRPKARWTLNGEELKPSRNVTID-LKERHAILTIENATKSNSGIYNLTLENELGSDSAKFEIEVNDAPNKPTGVRVDSHLDNGVILSWTPPISDSGKKGYISEYHIEKQEIPDGNWVRIATSRFNNVQLDNLRNGKDYNFRIIAENLHGRSEPSDKIGPITIGEGLIKPKKSNLDQSR-----NRGDYSGPDIDNYDKFYHDLWNRYKPQPVEIKNGSVHDHYEILEELGSGAFGQVYRCRELSTGKIFVAKFIDTPHQVDKNVVKHE--------IDTLNHLHHPKLLNLHDAFDDKDEMC--------LIMEFLSGGELFDRITEDGYNMNEAEAANYIRQVCDGLKFMHDEGYIHLDLKPENIMC--ETSNSNRIKII-----DFGLSTKLNPDEPVKVTTATAEFAAPEVAEIEPVGFYTDMWAVGVLSYVLLSGLSP 3753          

HSP 3 Score: 58.9214 bits (141), Expect = 1.325e-7
Identity = 85/376 (22.61%), Postives = 141/376 (37.50%), Query Frame = 2
Query: 8444 PIVGSKIRGKDVKNLQWKPLQEDLEENTFNWENPDPTQEYLFRIVAKNQFGSGLPSQIVKLHPQIIIPDFSFIRLTIDDTVIPGSNGEREITLSWSPPRISPDLYIPFTVDVECRPVNYSYSDEEGWSVFKTN-IKKNRVDIADLDPNINYQLRIVPVTDFGIGKPSMVIKKIRRSDNLNSPTTEKAMMLQEKHCLAVPMFCCLSQKAELKFTKLMEYKLDKITWTFNNAKVDVNDERYKIFSAETYGIYFIIKNLEEDDFGEY-------CALDEVQD---PIQSFILIKSDAPTILNCLPNWSLTLHENFSISVQIDAQPPPEVVWRRNWKKIFSSYRTVITEDKEQGTYSLLISKCILSDGGEYSIRAENAIG 9538
            P+    +  K+    +WKPL   ++   F     D  + Y FR+ A+N+FG G P +  K     II    F        V P    E  +TL W+ P+      I     VE +P     SDE  W       +K     I +L  +  YQ R+    D G+ +PS     ++       P      ++ +     V +    S+  +    K++ Y+++K     N   V               G    I NL+E++  E+           E  D   P + F       P  L+ +   +  +    +   ++D +P PEV W +N  ++  S +  +T+D   G  +L IS     DGG  +   +N  G
Sbjct: 2555 PVSNYVVEMKEPSTGEWKPLSRFVKGTDFEVFGLDEGKPYSFRVKAENEFGIGEPLETDKQ----IIAQSPFSAPDCPTNVTPVDVDENSVTLEWTKPKNDGGKRI-AGYQVEYKPEG---SDE--WIKAPIGLVKTPSATIPNLKKDQKYQFRVKAKNDAGLSEPSQCTNTVQCKPKYTVPDAPSTPLIDKVGKDYVDL--SWSKPIKDGGNKVVGYQVEKRKKGGNWEPV---------TDKPIIGNQTTIPNLDENEEYEFRVRAVNAAGPGEPSDSTLPTKIFDKTAGTTPEFLSKITPTTSPIGGTATFQCRVDGKPTPEVKWLKNGIELRPSGKVKMTDD--DGLLTLEISDIDDKDGGNITCEIKNKAG 2907          

HSP 4 Score: 58.151 bits (139), Expect = 2.208e-7
Identity = 80/332 (24.10%), Postives = 134/332 (40.36%), Query Frame = 2
Query: 6092 KLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIIT-----------EAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRIIVKPLC--APVLTAEYSKGADVILSWTSVATTDTLNIIYNIEKQKSLTSTNWKKIMKNLTETTYSLSSSCLPPQESHLLRCVAISEYGF-ETVSNIIEIPIRANSPILPPD---KPTIIFKDATCVKISWMRGKCKNLTPEESIGKIMYSLEMKDNPKSSWQIVSNDLV-DNEYSL-SLEPGVSYMFRVIAFNDFGISEPS-QSLISRIDRLKLVPDFSV 7027
            K+  I+I   +   +    + +P P+  WT              VK +   PN  ++IT            ++ + +G Y    TN +G+D+ E  ++V             + KP     P++ +E +K +   LSW          I   + ++  L    W+K+   +  T++++    L     +  R  A S  G  E +    E  I A +P   PD   KP II  D   V+I W   K     P +      Y +E K+   + W  V+ DL+ DN +   S++ G  Y +RV A N+ G S+PS  S ++     K  P F +
Sbjct: 1444 KIAPIKIKVGQPATIELNYVGEPDPEAKWT--------------VKNIGVQPNENILITYKERSTRIDFTNSQRKHTGLYQLTVTNEVGHDSAEVELVV-------------LGKPSSPQGPLVISEVTKNS-AKLSWEKPKDDGGAEISNYVVEKMDLKKGKWEKVSDMINGTSFTVPK--LETGHEYKFRVSAESPLGTSEPLEG--EKSIEAKNPFDEPDAPSKPEIIDHDNNMVEIKWSPPKSDGGAPIQ-----HYIIERKEPKSNRWVKVNKDLIRDNTFKDDSVKTGKQYEYRVTAVNEAGPSKPSLPSDVATAKPSKEAPKFDL 1738          

HSP 5 Score: 57.7658 bits (138), Expect = 2.483e-7
Identity = 108/449 (24.05%), Postives = 172/449 (38.31%), Query Frame = 2
Query: 6080 LFTKKLKDIEILSKENIRLNCRMMCD-PKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEV---------EDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRIIVKPLCAPVLTAEYSKGADVILSWTSVATTDTLNIIYNIEKQKSLTSTNWKKIMKNLTETTYSLSSSCLPPQESHLLRCVAISEYG----FETVSNIIEIPIRANSPILPPDKPTIIFK---DATCVKISWMRGKCKNLTPEESIGKIM--YSLEMKDNPKSSWQIVSNDLVDNEYSL--SLEPGVSYMFRVIAFNDFGISEPSQSLISRIDRLKLVPDFSV-DPPWLHL-----KGQPCLKWRAATVPEFCDSCVSGILPDYKVEYR--NGRLSPWKIYQENIMQNETYLTQKIIDDAQEFRVSCRNKFGQNGPTRSYRLQANIVGKTSFRSP 7339
            +  K  K I+ ++ E  ++        P P++L   +GE + +             PNF + +   EV         +D G Y     N  G D+    + V D +P + D       PL    +T +  K     LSW          +   + + K  ++  WK + + +  T + +    L   + +  R  A +E+G     ET   II     A SP   PD PT +     D   V + W +       P+   GK +  Y +E K      W      LV    +   +L+    Y FRV A ND G+SEPSQ      + ++  P ++V D P   L     K    L W +  + +  +  V      Y+VE R   G   P  +  + I+ N+T +     ++  EFRV   N  G   P+ S  L   I  KT+  +P
Sbjct: 2431 ILDKNPKQIKAIAGEKFQIKIPYSGGYPPPEVLCELNGEPISAN------------PNFKVEVKPDEVVITNLNPQKQDQGHYNITLKNPKGSDSVPVKVTVFD-KPDKPDG------PLEVSQVTGDSCK-----LSWKPPKENGGSPVSNYVVEMKEPSTGEWKPLSRFVKGTDFEVFG--LDEGKPYSFRVKAENEFGIGEPLETDKQII-----AQSPFSAPDCPTNVTPVDVDENSVTLEWTK-------PKNDGGKRIAGYQVEYKPEGSDEWIKAPIGLVKTPSATIPNLKKDQKYQFRVKAKNDAGLSEPSQC----TNTVQCKPKYTVPDAPSTPLIDKVGKDYVDLSW-SKPIKDGGNKVVG-----YQVEKRKKGGNWEP--VTDKPIIGNQTTIPNLDENEEYEFRVRAVNAAGPGEPSDS-TLPTKIFDKTAGTTP 2828          

HSP 6 Score: 56.225 bits (134), Expect = 7.687e-7
Identity = 86/345 (24.93%), Postives = 138/345 (40.00%), Query Frame = 2
Query: 6452 VILSWTSVATTDTLNIIYNIEKQKSLTSTNWKKIMKNLTETTYSLSSSCLPPQESHLLRCVAISEYGFETVSNIIEIPIRANSPILPPDKPTIIFKDA---TCVKISWMRGKCKNLTPEESIGKIMYSLEMKDNPKSSWQIVSNDLVDNEYS--LSLEPGVSYMFRVIAFNDFGISEPSQSLISRIDRLKLVPDFSVDPPWLHLKGQPCLKWRAATVPEFCDSCVSGILPDYKVEYRNGRLSP---WKIYQENIMQNE-TYLT-----QKII--------DDAQEFRVSCRNKFGQN----------------GPTRSYRLQANIVGKTSFRSPSVEKVKTIIKY 7372
            V L+W     +D  N I   + +K L   +W+K    L   + S +   L   + +  R  AI++ G    S + + P     PI P D PT    D      +K+SW + K       +   KI   +  K N    W+ V     + E +  + ++PG    FRVIA ND G SEPS+   +++    L  +   + P L+L G      R  TV    D  +       KV Y  G  +P   WK  +E I  ++ T+++     Q +I         D+ +  ++ +N  GQ+                GP  +  +QAN V   S++ P     + I  Y
Sbjct: 1946 VTLAWKP-PISDGGNPIKGYQVEKKLVGGDWQKASPALAPGS-SQTVMNLIEGKQYEFRVRAINDAGPGEPSKVTK-PHTVKDPIFPADSPTTPNVDKITKNGIKLSWNKPK------HDGGSKIKEYIIEKKNKDGEWEPVKEVPANGENTAEIPMKPGEEAQFRVIAVNDAGPSEPSKP--TKV----LTAEDQPEAPKLNLSG-----LRDITVKAGQDFQI-------KVPYTGGFPTPIVNWKKNEEPITDDQRTHISVNPEDQVVILAVSNAKRSDSGKISLTLKNDSGQDIGSCEVKVLDVPAAPEGPLEASEIQANSV-TLSWKPPKDNGGEPITNY 2262          

HSP 7 Score: 53.1434 bits (126), Expect = 6.951e-6
Identity = 99/409 (24.21%), Postives = 161/409 (39.36%), Query Frame = 2
Query: 6101 DIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKCLNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTDSEPKESDSSRIIVKPLCAPVLTAEYSKGADVILSWTSVATTDTLNIIYNIEKQKSLTSTNWKKIMKNLTETTYSLSSSCLPPQESHLLRCVAISEYGFETVSNIIEIPIRANSPILPPDKP---TIIFKDATCVKISWMRGKCKNLTPEESIGKIMYSLEMKDNPKSSWQIVSNDLV--DNEYSLSLEPGVSYMFRVIAFNDFGISEPSQSLISRIDRLKLVPDFSVDPPWLH--LKGQPCLKWRAATVPEFCDSCVSGILPDYKVEYRN--GRLSPWKIYQENIMQNETYLTQKIIDDAQEFRVSCRNKFGQNGPTRSYRL 7300
            +I + + E + L   +   PKP+ +WTK+G  L         K+ D+     + I   + +DSG Y    TN  G D  E  +IV D +P   +  ++I        + +E  K     L+W          I   I ++    ST W+KI   + +   S++   L   + +  R  A+++ G    +   E+ I A +P   P  P    I   D   V ++W         P +      Y +E K      WQ  S  L    ++  ++L  G  Y FRV A ND G  EPS+       +  + P  S   P +    K    L W     P+         + +Y +E +N  G   P K    N  +N   +  K  ++AQ FRV   N  G + P++  ++
Sbjct: 1748 EIRLKAGEKLNLPIAITGAPKPECVWTKNGIALPG-----NAKVTDKEDLTGIEIPSVKRDDSGVYKIKLTNPYGTDEAEIKVIVMD-KPGAPEEPKVI-------DILSESCK-----LTWNPPKDNGACEITDYIVEKCEEGSTYWQKIPGIIKDN--SMAVKNLEKDKRYKFRISAVNKMGTGKPAE-TEL-ITAKNPFDAPGSPEELKITQFDRMSVTLAWKPPISDGGNPIKG-----YQVEKKLV-GGDWQKASPALAPGSSQTVMNLIEGKQYEFRVRAINDAGPGEPSKVTKPHTVKDPIFPADSPTTPNVDKITKNGIKLSWNK---PKHDGGSK---IKEYIIEKKNKDGEWEPVKEVPAN-GENTAEIPMKPGEEAQ-FRVIAVNDAGPSEPSKPTKV 2120          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000081259.1 (SMESG000081259.1)

HSP 1 Score: 109.768 bits (273), Expect = 1.786e-23
Identity = 79/272 (29.04%), Postives = 131/272 (48.16%), Query Frame = 2
Query: 9620 DRYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEINNMGIGRSEFQCIQNI----------SHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLC--GFSNAVPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQL-------------YNEDSNDAISNSACVFIRKCLLLKTGERLTSSDSLSHEWFIKP 10360
            D Y   +KL  G ++  +  I+K T  EF  KF  +  +   +S    I+ I          +H+NI+++F    +  + + L+ E + G  L ++I+      E +    I Q++  V ++HE +V HLD+KPEN+++       +KL   G +  + K+D  +   M  T+ F APE++  E I + +DMW+IG++T++ L G     F GD               + ED    +S  A  FI   LLL   +R T++  L H W IKP
Sbjct:   10 DIYKVGEKLGHGHFAEVKHCIDKQTNTEFAAKFIRVRQLLDSKSAGMSIEEIEREAHILKMLNHQNIIKLFFCHHL-GKTVALVLELVAGGELFDHISDSEKLSEEEASEFIEQILYGVQHMHEKKVVHLDLKPENVMIEDLDERKIKLIDFGLAREIKKQD--TIIEMQGTAEFLAPEVINYEAISYATDMWAIGVITYIMLTG--VSPFSGDDQSSTFQNIVTCKLDFEEDVCSDMSEMAKGFINSLLLLDPRKRSTANLCLKHHW-IKP 275          

HSP 2 Score: 63.5438 bits (153), Expect = 2.850e-9
Identity = 50/200 (25.00%), Postives = 90/200 (45.00%), Query Frame = 2
Query: 11669 EFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSI-FKAPEY-RYESITRYESDIWSLGILSFLLLATQLPAIEDACSDSDVHCCVKNTNTLLLPVPHTHFRAPKLSMLHRFSKSSRKFVHNSLKKSPNDRGNADYWLAHSWFK 12262
            E V GG L   +      SE      I Q+L  +Q +H   VVH +++P  ++I     +  D + I L +      +K+Q+++   + +  F APE   YE+I+ Y +D+W++G++++++L    P      S  D     +N  T  L             +    S+ ++ F+++ L   P  R  A+  L H W K
Sbjct:   94 ELVAGGELFDHISDSEKLSEEEASEFIEQILYGVQHMHEKKVVHLDLKPENVMI-----EDLDERKIKLIDFGLAREIKKQDTIIEMQGTAEFLAPEVINYEAIS-YATDMWAIGVITYIMLTGVSP-----FSGDDQSSTFQNIVTCKLDFEE--------DVCSDMSEMAKGFINSLLLLDPRKRSTANLCLKHHWIK 274          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000011366.1 (SMESG000011366.1)

HSP 1 Score: 104.375 bits (259), Expect = 4.191e-23
Identity = 80/303 (26.40%), Postives = 142/303 (46.86%), Query Frame = 2
Query: 9623 RYYTMKKLAKGSYSRCQIVIEKSTQIEFIGKFFEINNMGIGR---------SEFQCIQNISHRNIVEIFDAIAMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHEHRVCHLDIKPENIIMTGKYNEILKLCGFSNAVPKEDFGSRRHMGLTSPFSAPELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGD-QLYNE------DSNDA----ISNSACVFIRKCLLLKTGERLTSSDSLSH--EWFIKPGNNLNAALDYII--DQIVKLMTYPEEMVPNFPSDM 10459
            +Y   + + KG Y+  ++     T I++  KF +   + + R          E + +  +SH NI++I++A    D   VLI E + G  L EYI+      E +    + Q++  V ++H   + HLD+KPENI++     + +K+  F  +    D       G T  F APE++  +P+ F +DMWSIGI+ ++ L G+     E   +++N       D ND+    +S+ A  F+   ++    +RL+  D L H     + P   +    +  I  D++ KL  Y   + P+ P+ M
Sbjct:   11 KYILGQHIGKGHYATVKMCTNIETNIDYAAKFIKKKRIAMSRIGTKTDDIVREARILSKLSHPNIIQIYEAFDRKDMS-VLILELVTGGELFEYISNKVTLSEEEASKFMRQILLGVHHMHSKNILHLDLKPENILVEDPDTQKIKIIDFGFSKEINDAPILELQG-TPEFVAPEVINYDPLTFATDMWSIGIIAYIMLTGNSPFYHETQSEVFNRITRCQLDLNDSTCSMMSDLAKSFLSSLIVKTPSKRLSCEDCLKHFGSKLVYPEKKIERKRNSFISQDKLNKLRNY--VVSPSRPTSM 309          

HSP 2 Score: 58.151 bits (139), Expect = 7.742e-8
Identity = 35/126 (27.78%), Postives = 60/126 (47.62%), Query Frame = 2
Query: 11669 EFVPGGNLLSVLMARSVYSEFTVVTIIRQLLGTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQESLTTHKPSIFKAPEY-RYESITRYESDIWSLGILSFLLLATQLP 12043
            E V GG L   +  +   SE      +RQ+L  +  +HS N++H +++P  IL+     Q   I   G     F   + +   L       F APE   Y+ +T + +D+WS+GI+++++L    P
Sbjct:   93 ELVTGGELFEYISNKVTLSEEEASKFMRQILLGVHHMHSKNILHLDLKPENILVEDPDTQKIKIIDFG-----FSKEINDAPILELQGTPEFVAPEVINYDPLT-FATDMWSIGIIAYIMLTGNSP 212          
The following BLAST results are available for this feature:
BLAST of Serine/threonine kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SPEG6.644e-3022.06striated muscle enriched protein kinase [Source:HG... [more]
DAPK22.068e-2730.25death associated protein kinase 2 [Source:HGNC Sym... [more]
DAPK22.068e-2730.25death associated protein kinase 2 [Source:HGNC Sym... [more]
DAPK24.191e-2629.71death associated protein kinase 2 [Source:HGNC Sym... [more]
DAPK24.191e-2629.71death associated protein kinase 2 [Source:HGNC Sym... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-893.377e-3125.45Muscle M-line assembly protein unc-89 [Source:Uni... [more]
unc-893.618e-3125.45Muscle M-line assembly protein unc-89 [Source:Uni... [more]
unc-894.521e-3125.45Muscle M-line assembly protein unc-89 [Source:Uni... [more]
unc-894.752e-3125.45Muscle M-line assembly protein unc-89 [Source:Uni... [more]
unc-895.082e-3125.45Muscle M-line assembly protein unc-89 [Source:Uni... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Unc-899.079e-3122.31gene:FBgn0053519 transcript:FBtr0343286[more]
Unc-891.343e-3022.30gene:FBgn0053519 transcript:FBtr0113464[more]
Unc-891.376e-3022.30gene:FBgn0053519 transcript:FBtr0343284[more]
Unc-891.385e-3022.30gene:FBgn0053519 transcript:FBtr0343285[more]
Unc-891.435e-3022.30gene:FBgn0053519 transcript:FBtr0343283[more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spegb2.839e-2922.40striated muscle enriched protein kinase b [Source:... [more]
spega1.523e-2822.41striated muscle enriched protein kinase a [Source:... [more]
spega1.536e-2822.41striated muscle enriched protein kinase a [Source:... [more]
si:dkey-240h12.47.498e-2829.58si:dkey-240h12.4 [Source:ZFIN;Acc:ZDB-GENE-070705-... [more]
obscna6.223e-2727.27obscurin, cytoskeletal calmodulin and titin-intera... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
phyh2.598e-2923.86phytanoyl-CoA 2-hydroxylase [Source:Xenbase;Acc:XB... [more]
c7orf261.377e-2628.57chromosome 7 open reading frame 26 [Source:Xenbase... [more]
nek23.612e-2629.03NIMA-related kinase 2 [Source:NCBI gene;Acc:407849... [more]
nek26.874e-2629.14NIMA-related kinase 2 [Source:NCBI gene;Acc:407849... [more]
nek27.298e-2629.14NIMA-related kinase 2 [Source:NCBI gene;Acc:407849... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Speg4.712e-2722.31SPEG complex locus [Source:MGI Symbol;Acc:MGI:1092... [more]
Speg5.339e-2722.31SPEG complex locus [Source:MGI Symbol;Acc:MGI:1092... [more]
Dapk23.158e-2629.43death-associated protein kinase 2 [Source:MGI Symb... [more]
Dapk21.106e-2530.29death-associated protein kinase 2 [Source:MGI Symb... [more]
Obscn2.101e-2523.09obscurin, cytoskeletal calmodulin and titin-intera... [more]
back to top
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O01761|UNC89_CAEEL6.465e-3025.45Muscle M-line assembly protein unc-89 OS=Caenorhab... [more]
sp|A8DYP0|OBSCN_DROME1.346e-2922.30Obscurin OS=Drosophila melanogaster OX=7227 GN=Unc... [more]
sp|Q15772|SPEG_HUMAN3.190e-2922.06Striated muscle preferentially expressed protein k... [more]
sp|Q696W0|SPEG_DANRE1.595e-2722.41Striated muscle preferentially expressed protein k... [more]
sp|Q9UIK4|DAPK2_HUMAN9.931e-2730.25Death-associated protein kinase 2 OS=Homo sapiens ... [more]
back to top
BLAST of Serine/threonine kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G7Y5N77.598e-16225.67Striated muscle preferentially expressed protein k... [more]
A0A5J4NRQ31.140e-15926.14Uncharacterized protein OS=Paragonimus westermani ... [more]
A0A4S2LRW11.876e-15825.41Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2LXN52.222e-15825.41Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2LYL92.243e-15825.41Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spegb1.325e-2821.85striated muscle enriched protein kinase b [Source:... [more]
dapk2b4.743e-2730.69death associated protein kinase 2 [Source:NCBI gen... [more]
si:dkey-240h12.41.545e-2526.90death-associated protein kinase 2-like [Source:NCB... [more]
si:dkey-240h12.41.545e-2526.90death-associated protein kinase 2-like [Source:NCB... [more]
trioa6.547e-2525.59trio Rho guanine nucleotide exchange factor a [Sou... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004663.13.139e-2520.35pep scaffold:Pmarinus_7.0:GL479759:1154:24713:-1 g... [more]
ENSPMAT00000000175.12.769e-2125.28pep scaffold:Pmarinus_7.0:GL476590:10927:25170:1 g... [more]
mylk33.197e-2127.11myosin light chain kinase 3 [Source:NCBI gene;Acc:... [more]
ENSPMAT00000010891.13.678e-2028.97pep scaffold:Pmarinus_7.0:GL476752:24038:27952:-1 ... [more]
stk17b4.640e-2025.00serine/threonine kinase 17b (apoptosis-inducing) [... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SNF13.910e-1725.10AMP-activated S/T protein kinase; forms a complex ... [more]
RAD531.170e-1625.84DNA damage response protein kinase; required for c... [more]
DUN11.126e-1526.32Cell-cycle checkpoint S/T protein kinase; required... [more]
GIN41.157e-1530.77Protein kinase involved in bud growth and assembly... [more]
HSL11.342e-1529.57Nim1p-related protein kinase; septin-binding kinas... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
OBSCURIN3.629e-2529.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495471.608e-2429.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO437551.126e-2329.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412423.935e-2327.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO422876.288e-2330.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spegb5.405e-3623.80striated muscle preferentially expressed protein k... [more]
ENSORLT00000028146.11.280e-3223.27striated muscle enriched protein kinase [Source:NC... [more]
ENSORLT00000032086.11.486e-3223.27striated muscle enriched protein kinase [Source:NC... [more]
ENSORLT00000002709.21.716e-3223.27striated muscle enriched protein kinase [Source:NC... [more]
dapk2b6.945e-2729.62death associated protein kinase 2 [Source:NCBI gen... [more]
back to top
BLAST of Serine/threonine kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022977.10.000e+0100.00SMESG000022977.1[more]
SMESG000022977.10.000e+0100.00SMESG000022977.1[more]
SMESG000051697.11.045e-2427.74SMESG000051697.1[more]
SMESG000081259.11.786e-2329.04SMESG000081259.1[more]
SMESG000011366.14.191e-2326.40SMESG000011366.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005039 ID=SMED30005039|Name=Serine/threonine kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=12483bp
ATTTATCATTCTCGAACAGTTGTTATAGTTTTTTCGTTCATTTATTTCCT
GTGTGATAAAAATGATTTTTCAATTATTATGGTCTTTAATTGGAATATTT
AGTATATTGGGATATTTGTTTCTATGGTTACAACAACGGCTTGAAAGAGA
CAATGCCATTTTATCGAAGCCTCGATCAAGCAATCTATCCGATGAAGAAT
ATTTAAACAACCTGATTATTAATTCTCCAAGTGTTTCATCAATTTCACAA
AAAAATGATAGTTCCGTTGATCCAGAATTTATTACAACGGATCTTGACGA
TGACAATGAAGCTGTTGAAAACTTAGACACTTCTCAATATTCGGACGTTA
CCGATTTAGATGAACTAGAGGATACAAACATGTCAGATTCACTGGAACGA
AACAAGCTTCATTATGAACGATCTTTCGATGCAACAATTGAAGATGTGGC
TTCTGATTTTCAGTCAAATGATGATTTATTGAGCTTCATCAAAACATGCA
AACCGATTCCAGGCACAAAATATTATGCGAACTGCACAATAAAGTGCAAA
GAGAATTCAGAGCTTATCAAAACAACTGAAGGTAGTGCGGTTTCAATTGA
AGATGCGGATAATTTGGACTACTGGATAAGCTTTAGTGACGATTTGCCCA
TTCCATTATCAATCGTTCCAAGGTGTTGCCTATCCAATTCACCAAATGCT
GAAAATCCAGACAGTGAAAGCAGGAAAAGAAATCCCAGAGAATCATTTCG
TGAAGATATTCTACAAATATCCAACAAAAATCAGGAATCCACAATGAAAC
GAAAATACGCATTGGCCGACCTGATTGAGTGTGACCGGGAATATTGCGCA
ACTCTGAAACTTATCAAAGATATTCTGAAGAGCTTAGACAAAACCGAGAA
CGAATTCGGAGTTGAAATAGATTCTTTATTCGAAGAAGTCTGCAAATTGA
TTGTGGAGTTGGTAGAATTCCATGAAAATTTAATTTTACCGGAACTCTCC
AGTTGTGTTATGATTCCAATCCGAGTGGCCAATATTCTAAAAAATCAGAA
ATTACAATTTTATCGGTACTCAGAATTTCAAAGCCAGTGGAAAAAATTGA
AAATTCTTCTAGATATCTCGAAAAAGAAATATATTTTCGTCAAAAATGTA
AACACCATTGAAAAGTCAAAGTTTTCAGTGTTGTCTTTCAATGATTTGAT
GTTAAAAGTCGAGAACAAATTGCCTCAGTATAACTTATTTTTATTCGACA
TCATCCGATATACTGGTCGCATTGACGGAGAAGTCAACGATTTACAAAAG
GCGATCACAGTTTTCCAGAAAATACGAAGACGTAACCAAGAAAAGGTCTA
TTTGTCCAAGTTAATTGAGAAAACGAATATAAACATTTCAAACGAAAGAT
TCATACGAGTGACTAATCAAGTGATGATTTCTGAAACTCAAATCATGTCC
AAATCGTACGAAAATCTCCAATTCATCCGTGAGGAAATGTGCTCATTAAT
CCTACTGAAAAACTATTTACTCTGCGTTTCCGACCTCTCACAACCGACCG
ACAGAAAAATAATGAATCTTGATTATACGAAAATATATACGAAAGAAAAT
TATGAAAGACAAAATGAATTGATCATATGGTCGAAAATGAACAAATTGGA
ATTCAGAATATTCATTTTATATTTTCCAAATAAAGTCAGTAAACTCGGTT
GGTTACGTGATCTTACAAAAAGATTAAAAAAGAAAGGCATAGATGAAATA
TTCGTGAGTTCGACTGAATACGATATTCAATATAAGCAATATTTGGGAAA
AAACCAACGATTAGTTGCAACAGAAATGGAATCAATTGGCTTGGAAAGTG
CCAGTTTGGAGAATGAATGCTCGTCGATCTCTGACCAAATTGAAGATTTA
ACTTCGATGGCTGATAGCATCACCGACGTTCGATTTGAAAGTGCAATATT
GGACATGCCAAGTTCCATGACGAGCGGATCGTACAAAACTGCTCCTGAAA
CGTTCAAATCAACGATGGATAAAGCAAGTAGACCTATCAGTGGGATAAGT
CAAGATTCAGTTTCAACTCTTGACGGGGTTCGAACCCCGTTTTCAGATGA
AGAACTAATCAAGTCTGTGCTAATTATCAGTGAAATTGAGGAAATCAATA
TTTCTGAAGGCAGTGATTTTGTTTGGTCTTTGAAATTAGTTAATTTTGAT
CCTATACTGCATGACATAGTCTGGTCTCTGGTTGGGAAAACTCTAGATTT
AACGAGCCAGAATTCATCTATAAAAATTGAAGAACAAAACAATAAAGTTT
ATGAATGTCAATTGAAACGACAAAAACTAACGAAATTAGAAAGTGGTCAG
TTGTCTTGTAAAATCATTGATAAAATTAACGGAAGCTTAATAGTGTCAAA
AATTGTAAATGTATTTATTTCACCCCCTTGCATATCAACTGAATTAAGCT
GCGAATTAACCGAAGTGACAGTTTTAGAAAACAACCCAATAACATTTCAA
CTTATTTCTGGAACGAACTGTTTAAAAAATTCGTTTTTAAACCATATAAC
TTGGTATAAAGATAATGAAAGACTTGTCAAAGAAGAAGGAAGAATAAAGA
CTTTTATCAATTCTTCAAACAACAAGATTTCATTAATCATTGAAAAAGCA
TCTATTTCTGATGCGGGGATTTACACAATTAGTTGTGCGCCAAACTCGGA
AATCTTTATTAAAAATGTATCTAATATATCCATTCTGCTCTTAGTGGAAA
GACAAAAGAAAACCATCTACAAAACCGCGAGCTTAGAAAATCAGCCTATA
ATTGAAGATTCACACACTCACGCTATTTCTCCATTAAAAGAACTTGTCAA
CATTGGGAATACATTTGACGGAAGCGATTTATATTCCAATGCTGTCTCAT
CAACGACTCAACTCTCTGAATATGATTCCAGACAGTTGGTGGGATATTTC
GAGTGTGAAATTGAAGAAATCGACTTGAAAATCGGGGAATTATTAAGTTT
ACAAATAAAACCAATTTCTATCCCATTGTCGACTTTAAATCTTGGAAGTT
GGTATTTGAATTCAAAAAAATTAAACTTGACCGAATTAAACGGCAATGAG
GATATTTCAGAAAGTCAAGTAAGCATTAATATTCCAGGGATTGTAAAAGA
CTTTTCTGGAGTTCTGCAATTTCGAATCGAAACGCCAATGAAAATATACT
CACCGGAAGTTGTTATCAAAATCAGAGTAGGTAACTTAAAATCCAAGCCA
AATGGGTATTTTTTCACAAATCTTAAACAAATCGAAACGATTTCCGGGGA
AAACTTACATGTTCAATTTAAAGCTTATAATATTGTGTTAGATACTTTGA
AAAAAGGATCCTGGTTTGTTAATAATGAACTACTGGATTTTAAAAAATGG
AATGGCTCAGTCAATGTATCAGAATCTCAAGTAGAAATTAATTTCCCAAA
ATCAACCAATGAGCTTTCAGGAATTTGGCAGTTCCGAATCGATAAACCAA
TGAAATTGTTTTCTCCGGAAATATCAGTCAACGTATTGGCCAAAGAAGTT
GCACCCTTATCGACAGGGTTTCTAGATTGTGAAATTGAAGAAATAGATTT
AAAAATCGGAGAAACTTTGTCACTAACTTTAAATGCAAAAGATATTCCAA
TAATGACTCTGAAAAATGGAGGTTGGTTTTTGAACTCCGAACCAATCCAT
GCTGTTAAGTTTAGAGGAAACGAAGTAATCGAAGAAAATAAAGTAAAAAT
TGTAATTCCTAACGTTACAAAAGAGTTTTCTGGTTTACTGCAATATCGAA
TCGTAAAGCCAGTTGAATTATATTCTCCTGAAATTATTATAAAAATCAGA
GGAAGTTTGATAAAGCAAACTCCAAAAATTGAAGAGGAAAAATTCGAATC
TAATCTGATTTTGGAACTACACAATGTTTCATTAAATATTTCAGAAAATG
AACGGATTCTTTTGGAAGCAAAGATTATTAGTGGAAATATTAATTCGTAT
AAAACACCTCCTCAGTGGTTTTGGAATGACGAAGCTGTCAAAAATATAAA
TTGCAAAAAAGATTTCACCAGCAATCTCGCTCAATTAGAAATTGCCCATT
GTCAATTAAGCGACTCTGGTCAATATAAAATTTGTTTTAATCCACTTGAA
GCCAGCAAATGCGGAAAGGTGACCGGATTATTTTTGGTGTCTATTGCACC
AATAAAGAAAAACTTAAAACCAATTGATTCGAACATTGAAACTTGTCCAG
GTGAATCGGTGACTTTGTGTGTCGACGTGGAAGGGTTCTCGAAAAAAGAT
ATAAAATGGAAAGTACTCGAGGATGATTTGAAACAAGATAAAATCTTACA
AGAAAAAAGAATTACTCAAAAGTTCAACAATAATCTTTCATTCTTATTAA
TCGATAGTGTAAAGTTGGAGGACAGTGGAACGTACATTTGCCAAGGGTTT
ACCAATAAGGAACTCATATCAGAGTGTAAGATAACGTTAAACGTTGTTGA
CAACATAAGTGATACACTTCAGTGTCAAGTAAAATTTGAAAAAGATAAGT
ATTCCATTGAGATTAACCAAGATGTCACAATGAGGGCTTTGATTGAGTGC
ACTAGTACTCATTATAGTGTCAGTTGGTTTTTCAACGGGGAAATTTTGGA
AATGAAATCGGACATTTTGAGTGACATCAAAAACAATGGAAAAATTGCCG
AATTAAAAATCCAAAATTGTAATGAATCACATCGTGGAATCTACGAATGC
ATGATAGAAAACAAAGACGGAAACTCTTCAACTGCCAGGACGGAATTAAA
CGTCGAAAATATCCAAATAGATTGTTTAAATTCTGTCACCAAAAATATTG
AAATAACCGAAGGAAATGAATTGAATTTGGAAGTGGTTTCAGAAATAGAA
AAGGATCTCCAGTTTCAATGGAGTAAAGACGATATAGATTGTTCCAATAA
TGGGATTTTTAATTCTACTAAAAACAAAAATTGTTTTAATTTAACAAAAT
TGAAAGCTGAAATAACCGATTCCGGGGTTTACAAGTTTGAAGGAATGGTG
GATGGGAAACTTTTGGAATTGGTTCATTTTACCGTTCAAGTCAATCCAAT
TCAAAGTATTTTAACAACTGATGAATCGCGATTGAAATTAATTTGCGAAG
ACAACGAAATTATACTTTCTGATTCGAAGCCTTTGATAATTTCCGTTGAA
GTATTGAATTGGAAACAAGGAGTCATACAATGGCTCAGAAATGATATGCC
TTTTGGAGACCCTTGCGTTTTAGATAATCCGTTTATAGATTTGTATATAG
AGTCTCCTCAAGTCAACGAACATAGCGGCTTATATAAATGTATTGTAACG
AATGAAAAATCAGAAACTGAATTTGTAGAAATAACAGTAAAATTTAAAGA
CGAAAAAGTTGTTTCTCCGATTTTAGGTGAGCTTCTATCATGTACAGTCG
AAGAAGTCAACACAATAGAAGATGAAAAAATTGAACTCTCTGTTGAATCA
AGAGTACCAACGAAGTCAATAGATTCTGCAGTATGGTTAAAAGACGAAAA
ACTACTGAATGAAACCGATCCCCGGTTGACGATAATAATGCAACCGTTCT
GTTATAATTTAATTTTAAGAGATGTAAAAATGACAGATGCTGGAATGTAC
TCTTTGAAGATCAATGAGAGTTCTGTCGACATTTTAGTGAAGGTCAGACC
AAAGCCTATCAGAAAACAAACCAAGGAAATTTTTAAGAATCTCAAAATTC
CACAGATTAAAAAACCACTTCAAGATATTTTCATAAGAAATGAACCTGAA
ACGGTAAAATTCGAATTCGAGGTCGAAGAAAGCGGAGCAAAGAAAGCCAT
TTGGTTCTTTGAGAATGAAGAAATTGACGCGGAAAATATGGAGTTTATTC
AATGGTCCTGTGATAATTATTTTGCACTGACAATACCGGCTGCTGGAGAA
AAGCACTGTGGAAAGTATACTATTCAAGTTGCCAATGATATGGGTTGCGT
CAGAAGTGATGGACGTTTGTCGTTAATGCTCCGAAGTGAAATCTCAGAGC
AAATGATGGAATCCTGTTGTATTGCTCCATTATTTACAAAAAAGCTGAAA
GACATAGAAATATTATCAAAGGAAAATATTCGACTCAACTGTAGAATGAT
GTGTGATCCTAAACCGAAAATTTTATGGACAAAAGATGGAGAAACTCTCG
ATTCTAAATGTCTAAATAGAAGAGTCAAAATTTTGGATGAATTCCCGAAT
TTTACTTTGATCATAACTGAAGCAGAAGTTGAAGATTCCGGTCGTTACTG
TTGTTTGGGCACCAATTTTCTAGGATATGATACTACTGAAGCCGTGATCA
TCGTTACAGATTCCGAACCAAAAGAATCTGATTCTTCAAGAATTATTGTG
AAACCTTTGTGCGCTCCTGTTTTAACTGCAGAATATTCAAAAGGCGCCGA
TGTCATTTTATCGTGGACCAGTGTAGCAACAACGGATACCCTGAATATCA
TCTACAATATTGAAAAGCAGAAATCATTGACATCAACAAACTGGAAGAAA
ATCATGAAAAACCTTACAGAGACCACCTACTCACTGTCATCTTCGTGTTT
ACCTCCACAGGAATCTCATTTACTTCGATGTGTTGCCATAAGTGAATATG
GGTTTGAAACTGTATCAAATATTATTGAAATTCCTATTCGAGCAAATTCC
CCAATTTTACCTCCTGATAAACCAACCATCATTTTCAAAGATGCTACTTG
TGTAAAGATTTCATGGATGAGAGGAAAATGCAAGAATCTTACTCCGGAAG
AAAGTATTGGGAAAATAATGTATAGTCTAGAAATGAAAGATAATCCTAAA
AGTAGTTGGCAAATCGTCAGCAATGATCTAGTTGACAATGAATATTCTTT
ATCCCTAGAACCGGGAGTTTCATATATGTTCAGAGTAATCGCATTTAATG
ATTTCGGCATCAGTGAACCAAGTCAGAGTTTAATATCCAGAATTGACAGG
TTAAAGTTAGTTCCTGATTTTTCCGTAGATCCGCCATGGCTTCATCTAAA
GGGTCAACCATGCTTAAAATGGCGAGCGGCAACTGTGCCAGAATTCTGTG
ACTCTTGTGTCAGTGGGATTTTGCCTGATTATAAAGTTGAGTATCGAAAT
GGGAGATTGTCACCATGGAAAATCTATCAAGAAAATATAATGCAAAATGA
AACATATTTAACGCAGAAAATTATTGACGACGCTCAAGAGTTTAGAGTAA
GTTGTCGGAATAAATTTGGACAAAATGGACCTACAAGGTCCTATCGACTT
CAGGCTAATATTGTTGGAAAGACTTCTTTCCGTTCTCCGTCTGTAGAAAA
AGTAAAAACTATAATAAAGTATGATCAATTAAAACAAGCTGAAATTGAAT
CAATTTCAAAGGACGGATTAAGTTTAAAATGGTCACAATGGGTGCCAGAT
CAAATAAATAAATATATTATTCAAAGAAAAAATTCATTTTCTCAAGACTG
GGAACAGATCCATTCAACAATATTTGGGGAAAATTGTTTTGTTGAGATGA
TTTTGTCAGAAAATTTTTCCCGTCAACTTAGAATTCTTTCATTGGACGAC
AACAAAACAGAACTGCACGACGGTTACAACATCCTTTATATCCCAAGCAA
AGACGAATGCATTCCGACAATTCCTGAAAATCTTCAAGTAAATGATTTAA
CGAATTACCATGAGATATTTTGGTCCGAGTCTAAATCTATTGAAATAGTC
GACTCCCCAATTACTTACTCTTTACAAAGCAAAGTTAACAATCAGTTCTG
GTTCACAATAACGGAAAAACTGGATAAATGTTTCTATACCAATACAAGAA
TTGACAAATACGGTGTCACAGGATACAGAGTTTTGGCTAGGAATTCTATC
GGTTCCAGTCCGTTCAGTATGGAGGTATTTACAAAATCTCTAATTAACAT
ACTGTCCAATGAGCAAATTATCAAATCCCTACGATATTTTGTTATAAATC
CACGAGAAATCGAAATAAAATGGCATCTCTGTGAGTCAATCTTTGACAGT
GGAATAACTACGGAAGATTTGAGTTTCCAAATCGAAAAGAAAACCGTCAA
AGAAGGTTCCGATTGGGTACCGATTTCGAATATTGTTGAAAGGAATTCAA
TTTTGATTTCAATAACATTTGAAGACGAAAATCTGTTTCGAATTCAACCG
TTTTACCGAGATGAGAAGCTTTCCGCTAGCCGAATTTTTAGAATGTATGT
TTCTAAAGATTTACTGGTCCCTGACATGTCATTCACTAGACCGAATCTTG
TCATTGATTCAGTCACAAGTTGTGCCATAGAATGGCCAGAGCCCGAATTA
CAATCCGGTTTTTCCCCAGATGGAATTGAAATTTGTGTTCCTTCTGTGTT
ATTAGTTGATTTGCAATATGAAATCCAATTTGTTGTAGTCGATCCAATTG
TTGGTTCTAAAATTCGTGGGAAAGACGTAAAAAATTTACAATGGAAACCT
TTACAGGAAGACCTCGAAGAAAACACATTTAACTGGGAAAATCCAGACCC
AACTCAAGAATATTTATTTAGAATTGTGGCGAAGAATCAATTTGGAAGTG
GCTTACCTTCTCAAATTGTAAAATTGCATCCCCAAATAATAATTCCTGAT
TTTAGCTTCATCCGTTTAACTATCGACGACACAGTAATCCCAGGATCAAA
TGGAGAGAGAGAAATAACTCTTTCATGGTCACCTCCGAGAATTTCTCCTG
ATCTTTATATTCCTTTTACAGTTGATGTAGAATGTCGACCAGTAAATTAT
TCTTATTCTGATGAAGAGGGATGGAGTGTTTTCAAAACCAATATAAAAAA
GAACCGTGTTGACATTGCTGATCTAGATCCTAATATAAATTATCAACTTC
GAATTGTTCCAGTTACTGATTTTGGAATTGGAAAACCTTCGATGGTTATT
AAAAAAATTCGGCGTTCTGATAACCTGAATTCACCAACCACCGAGAAAGC
AATGATGTTGCAAGAAAAACACTGTCTTGCTGTCCCCATGTTTTGCTGCT
TATCTCAAAAAGCCGAGTTGAAATTCACAAAATTGATGGAATATAAATTA
GACAAAATCACATGGACTTTTAATAATGCAAAAGTAGACGTGAATGACGA
AAGATATAAGATATTCTCAGCGGAAACATATGGCATTTATTTCATAATTA
AAAATCTGGAAGAAGACGATTTTGGTGAATATTGCGCACTGGATGAAGTT
CAAGATCCAATTCAGTCATTTATTCTAATAAAATCAGACGCTCCAACCAT
TCTCAACTGTCTGCCAAATTGGAGTTTAACTCTTCATGAAAATTTCAGTA
TTTCAGTTCAAATTGATGCTCAACCACCTCCCGAAGTTGTCTGGAGGAGA
AATTGGAAGAAAATATTTTCCAGCTACAGAACCGTTATTACCGAAGATAA
AGAACAAGGAACTTATTCACTTCTTATTTCGAAATGTATTTTATCAGATG
GTGGAGAATACAGCATCAGAGCAGAAAATGCAATAGGATTCGCTGAAGTA
AAATTTAATTTGAGAGTCGATGCTCATCCGGAAAAGAAATCTGTACAAAT
TAATATTGGGGATGTCAATGACCGGTACTACACAATGAAGAAGTTAGCAA
AAGGATCATACAGTCGATGTCAAATTGTGATCGAAAAATCCACACAAATT
GAGTTTATTGGGAAATTTTTTGAAATCAACAATATGGGGATCGGAAGATC
TGAATTCCAGTGCATTCAAAATATCAGTCACAGAAATATTGTGGAAATAT
TTGATGCCATTGCTATGCCAGATCAGTATTTGGTTTTGATCTATGAGAAA
TTGCAAGGATTATCACTAGCCGAATACATTACTCAATTGAGCCACTGGTG
TGAATCCCAAGTGCGCATCATAATCCACCAGCTCATCCAAGCAGTTTCAT
ACTTGCATGAACATCGAGTATGTCATTTGGATATCAAACCAGAAAACATT
ATAATGACTGGCAAATATAACGAAATTCTTAAATTGTGTGGATTTTCAAA
TGCAGTTCCAAAAGAAGATTTTGGAAGCAGAAGGCACATGGGCTTGACTT
CGCCTTTCAGCGCTCCAGAATTATTGAAAGGTGAACCTATACAATTTAAT
TCTGATATGTGGTCGATTGGGATTTTAACTTTTCTGTGTCTTCATGGTCA
TTTGAAAGTGAATTTCGAAGGTGATCAATTGTATAATGAAGACTCAAATG
ATGCAATTAGCAACTCAGCTTGCGTTTTCATAAGGAAATGCCTTTTATTA
AAAACTGGAGAACGTCTTACGTCTTCGGACAGTTTAAGCCACGAGTGGTT
TATTAAGCCCGGAAATAACCTAAATGCCGCTCTGGATTATATAATTGACC
AAATTGTCAAATTGATGACATATCCTGAAGAAATGGTTCCAAATTTTCCA
AGTGATATGAAAAATGCAATTGAAACACTACTGATTGATTCTCGGCCGAA
AGTAATTTTCAACAGTTCATTATCCAATCCTGAGGGGTCCGTAAGCCCCC
CTATTAGCCAGCTGTCTTCTCGCGCTTCTTCATCCTCTAGAGATGGAATT
AACTATGAAAGATGCGACACGCCAAATGACAATTCATCAGAAGAAGTCAA
ATCAGATAGAAGTGAAACATTTCCAAGCGCCGATAGGCTTTCCGTTTCCA
ATACAACAAAGGAACTTTTATTTACTGTTCCATTGAAAGATCAAACATTT
AAATCCGATTCAACAGCTGGCAAAATAACTGTCACACTTACCTGTCAACT
TTCTTTACTTGGCAGTGAACCGATCAGCATTTCGTGGTATAAAAATCAAG
AATTACTTACTGATGATTCAAGAATAAAATTGGAAGTTATCAAAGGAGGA
TTTTTATCATGCACAATTTTAAATGCAACTGAAACCGATGTTGGCATATT
CAGATGCATTGCTCGATGTCATTCTTTAAGAACTGAAACAAGTGCCAGAC
TAGTACTCGGAGACGTACCACCACAACCGGAACAGCTATCGGTATATTAT
ACAAATCAAGAAGAAGTGTTATTAAAATGGTCTCCCTATCTTTCGGCTAT
TGATGACGTTATTTACAGAATAGATATTAGAACTATTGATTCAAGAAATA
AAATCCGAAATTGGAAAACAATTGGCTACAGTGTCGACAACAGATATTTG
CTGGAAAATCTCGACCGAACTCAGCAGTATATTGCTAGGATTATTGCTCA
GAACAAATACGGATACAGTCCCTACAGTATCGCTACTTCTGTCTTTCAAA
ACAAAATTAGAAATATCCATAGTTTAAAACAAGCTCTCATTTTCAATCGA
AAATGGATGTTGACATCTCGACAATCAAACCATTTCAATGATTTGCACGA
TTTAATTAAAGATATTTCCTCAGATGATATCAGGATGAATGTAATTAGGG
AACATTATTCTACACTTTCACAAAAATCAAGTGGGTTCGCTGTACTTAAA
TTGAAGAATACCAATGTCAATTTTCCAGAATATATTGTTCAAAGAACATT
TAAAATGGAAGATATATGCCCTGCTTTTGATCTTTGTGTTCGAATAAAAT
ATTATCATTTCCCAATATTATTTGGTGAAATCTGTGACTCTTCACTCGGA
AATCGAATAACATTCGAAGAATTTGTTCCGGGTGGAAACCTTTTGTCAGT
TCTCATGGCCAGATCGGTTTATTCTGAATTCACAGTTGTGACTATCATTC
GACAGCTTCTGGGAACGATACAGTTTCTTCATTCAAACAATGTCGTTCAT
GGAAACATTGAACCTACGAAAATTCTTATTTCTCGACGAACCAATCAATC
GTTTGATATAAAATTAATTGGACTAGAAAATTGTCAATTTGTTGGAACGG
TGAAAGAACAGGAATCTCTTACTACTCACAAACCATCAATTTTTAAAGCA
CCTGAATATCGATATGAAAGCATCACACGATATGAAAGTGATATTTGGAG
TTTAGGCATTTTATCCTTTTTATTATTAGCAACACAGTTGCCAGCCATTG
AAGATGCATGTTCAGATTCTGATGTTCATTGCTGTGTAAAGAATACGAAC
ACACTATTGTTACCTGTGCCCCACACTCATTTTCGAGCCCCAAAACTTTC
AATGTTACATAGATTTTCTAAATCTTCGAGAAAATTTGTGCATAATTCAT
TGAAGAAATCTCCAAATGATCGTGGCAATGCAGATTATTGGCTAGCTCAT
TCATGGTTTAAACAAGATCCCCAGACTATTTATGAAATGGAACATCAAAC
AATTTCGTCTACCCCTTTAGTTGACTTTGTAAACGCAAATTTGTGATAAA
GAAAACAAATCCAAGAACTATATGAAAACATTTATTTTATTTGTTTGACA
ATTACTACTTTAGTAAACGCCTAAATATAATGTAGTTTTGAATTAGTAAG
CAATGTCAGGTTTAAATATTTGGAGAAGCCCAC
back to top

protein sequence of SMED30005039-orf-1

>SMED30005039-orf-1 ID=SMED30005039-orf-1|Name=SMED30005039-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=4095bp
MIFQLLWSLIGIFSILGYLFLWLQQRLERDNAILSKPRSSNLSDEEYLNN
LIINSPSVSSISQKNDSSVDPEFITTDLDDDNEAVENLDTSQYSDVTDLD
ELEDTNMSDSLERNKLHYERSFDATIEDVASDFQSNDDLLSFIKTCKPIP
GTKYYANCTIKCKENSELIKTTEGSAVSIEDADNLDYWISFSDDLPIPLS
IVPRCCLSNSPNAENPDSESRKRNPRESFREDILQISNKNQESTMKRKYA
LADLIECDREYCATLKLIKDILKSLDKTENEFGVEIDSLFEEVCKLIVEL
VEFHENLILPELSSCVMIPIRVANILKNQKLQFYRYSEFQSQWKKLKILL
DISKKKYIFVKNVNTIEKSKFSVLSFNDLMLKVENKLPQYNLFLFDIIRY
TGRIDGEVNDLQKAITVFQKIRRRNQEKVYLSKLIEKTNINISNERFIRV
TNQVMISETQIMSKSYENLQFIREEMCSLILLKNYLLCVSDLSQPTDRKI
MNLDYTKIYTKENYERQNELIIWSKMNKLEFRIFILYFPNKVSKLGWLRD
LTKRLKKKGIDEIFVSSTEYDIQYKQYLGKNQRLVATEMESIGLESASLE
NECSSISDQIEDLTSMADSITDVRFESAILDMPSSMTSGSYKTAPETFKS
TMDKASRPISGISQDSVSTLDGVRTPFSDEELIKSVLIISEIEEINISEG
SDFVWSLKLVNFDPILHDIVWSLVGKTLDLTSQNSSIKIEEQNNKVYECQ
LKRQKLTKLESGQLSCKIIDKINGSLIVSKIVNVFISPPCISTELSCELT
EVTVLENNPITFQLISGTNCLKNSFLNHITWYKDNERLVKEEGRIKTFIN
SSNNKISLIIEKASISDAGIYTISCAPNSEIFIKNVSNISILLLVERQKK
TIYKTASLENQPIIEDSHTHAISPLKELVNIGNTFDGSDLYSNAVSSTTQ
LSEYDSRQLVGYFECEIEEIDLKIGELLSLQIKPISIPLSTLNLGSWYLN
SKKLNLTELNGNEDISESQVSINIPGIVKDFSGVLQFRIETPMKIYSPEV
VIKIRVGNLKSKPNGYFFTNLKQIETISGENLHVQFKAYNIVLDTLKKGS
WFVNNELLDFKKWNGSVNVSESQVEINFPKSTNELSGIWQFRIDKPMKLF
SPEISVNVLAKEVAPLSTGFLDCEIEEIDLKIGETLSLTLNAKDIPIMTL
KNGGWFLNSEPIHAVKFRGNEVIEENKVKIVIPNVTKEFSGLLQYRIVKP
VELYSPEIIIKIRGSLIKQTPKIEEEKFESNLILELHNVSLNISENERIL
LEAKIISGNINSYKTPPQWFWNDEAVKNINCKKDFTSNLAQLEIAHCQLS
DSGQYKICFNPLEASKCGKVTGLFLVSIAPIKKNLKPIDSNIETCPGESV
TLCVDVEGFSKKDIKWKVLEDDLKQDKILQEKRITQKFNNNLSFLLIDSV
KLEDSGTYICQGFTNKELISECKITLNVVDNISDTLQCQVKFEKDKYSIE
INQDVTMRALIECTSTHYSVSWFFNGEILEMKSDILSDIKNNGKIAELKI
QNCNESHRGIYECMIENKDGNSSTARTELNVENIQIDCLNSVTKNIEITE
GNELNLEVVSEIEKDLQFQWSKDDIDCSNNGIFNSTKNKNCFNLTKLKAE
ITDSGVYKFEGMVDGKLLELVHFTVQVNPIQSILTTDESRLKLICEDNEI
ILSDSKPLIISVEVLNWKQGVIQWLRNDMPFGDPCVLDNPFIDLYIESPQ
VNEHSGLYKCIVTNEKSETEFVEITVKFKDEKVVSPILGELLSCTVEEVN
TIEDEKIELSVESRVPTKSIDSAVWLKDEKLLNETDPRLTIIMQPFCYNL
ILRDVKMTDAGMYSLKINESSVDILVKVRPKPIRKQTKEIFKNLKIPQIK
KPLQDIFIRNEPETVKFEFEVEESGAKKAIWFFENEEIDAENMEFIQWSC
DNYFALTIPAAGEKHCGKYTIQVANDMGCVRSDGRLSLMLRSEISEQMME
SCCIAPLFTKKLKDIEILSKENIRLNCRMMCDPKPKILWTKDGETLDSKC
LNRRVKILDEFPNFTLIITEAEVEDSGRYCCLGTNFLGYDTTEAVIIVTD
SEPKESDSSRIIVKPLCAPVLTAEYSKGADVILSWTSVATTDTLNIIYNI
EKQKSLTSTNWKKIMKNLTETTYSLSSSCLPPQESHLLRCVAISEYGFET
VSNIIEIPIRANSPILPPDKPTIIFKDATCVKISWMRGKCKNLTPEESIG
KIMYSLEMKDNPKSSWQIVSNDLVDNEYSLSLEPGVSYMFRVIAFNDFGI
SEPSQSLISRIDRLKLVPDFSVDPPWLHLKGQPCLKWRAATVPEFCDSCV
SGILPDYKVEYRNGRLSPWKIYQENIMQNETYLTQKIIDDAQEFRVSCRN
KFGQNGPTRSYRLQANIVGKTSFRSPSVEKVKTIIKYDQLKQAEIESISK
DGLSLKWSQWVPDQINKYIIQRKNSFSQDWEQIHSTIFGENCFVEMILSE
NFSRQLRILSLDDNKTELHDGYNILYIPSKDECIPTIPENLQVNDLTNYH
EIFWSESKSIEIVDSPITYSLQSKVNNQFWFTITEKLDKCFYTNTRIDKY
GVTGYRVLARNSIGSSPFSMEVFTKSLINILSNEQIIKSLRYFVINPREI
EIKWHLCESIFDSGITTEDLSFQIEKKTVKEGSDWVPISNIVERNSILIS
ITFEDENLFRIQPFYRDEKLSASRIFRMYVSKDLLVPDMSFTRPNLVIDS
VTSCAIEWPEPELQSGFSPDGIEICVPSVLLVDLQYEIQFVVVDPIVGSK
IRGKDVKNLQWKPLQEDLEENTFNWENPDPTQEYLFRIVAKNQFGSGLPS
QIVKLHPQIIIPDFSFIRLTIDDTVIPGSNGEREITLSWSPPRISPDLYI
PFTVDVECRPVNYSYSDEEGWSVFKTNIKKNRVDIADLDPNINYQLRIVP
VTDFGIGKPSMVIKKIRRSDNLNSPTTEKAMMLQEKHCLAVPMFCCLSQK
AELKFTKLMEYKLDKITWTFNNAKVDVNDERYKIFSAETYGIYFIIKNLE
EDDFGEYCALDEVQDPIQSFILIKSDAPTILNCLPNWSLTLHENFSISVQ
IDAQPPPEVVWRRNWKKIFSSYRTVITEDKEQGTYSLLISKCILSDGGEY
SIRAENAIGFAEVKFNLRVDAHPEKKSVQINIGDVNDRYYTMKKLAKGSY
SRCQIVIEKSTQIEFIGKFFEINNMGIGRSEFQCIQNISHRNIVEIFDAI
AMPDQYLVLIYEKLQGLSLAEYITQLSHWCESQVRIIIHQLIQAVSYLHE
HRVCHLDIKPENIIMTGKYNEILKLCGFSNAVPKEDFGSRRHMGLTSPFS
APELLKGEPIQFNSDMWSIGILTFLCLHGHLKVNFEGDQLYNEDSNDAIS
NSACVFIRKCLLLKTGERLTSSDSLSHEWFIKPGNNLNAALDYIIDQIVK
LMTYPEEMVPNFPSDMKNAIETLLIDSRPKVIFNSSLSNPEGSVSPPISQ
LSSRASSSSRDGINYERCDTPNDNSSEEVKSDRSETFPSADRLSVSNTTK
ELLFTVPLKDQTFKSDSTAGKITVTLTCQLSLLGSEPISISWYKNQELLT
DDSRIKLEVIKGGFLSCTILNATETDVGIFRCIARCHSLRTETSARLVLG
DVPPQPEQLSVYYTNQEEVLLKWSPYLSAIDDVIYRIDIRTIDSRNKIRN
WKTIGYSVDNRYLLENLDRTQQYIARIIAQNKYGYSPYSIATSVFQNKIR
NIHSLKQALIFNRKWMLTSRQSNHFNDLHDLIKDISSDDIRMNVIREHYS
TLSQKSSGFAVLKLKNTNVNFPEYIVQRTFKMEDICPAFDLCVRIKYYHF
PILFGEICDSSLGNRITFEEFVPGGNLLSVLMARSVYSEFTVVTIIRQLL
GTIQFLHSNNVVHGNIEPTKILISRRTNQSFDIKLIGLENCQFVGTVKEQ
ESLTTHKPSIFKAPEYRYESITRYESDIWSLGILSFLLLATQLPAIEDAC
SDSDVHCCVKNTNTLLLPVPHTHFRAPKLSMLHRFSKSSRKFVHNSLKKS
PNDRGNADYWLAHSWFKQDPQTIYEMEHQTISSTPLVDFVNANL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000106ciliated epithelial cell
PLANA:0000140anterior region of the whole animal
PLANA:0000428musculature system
Vocabulary: INTERPRO
TermDefinition
IPR035899DBL_dom_sf
IPR036116FN3_sf
IPR036179Ig-like_dom_sf
IPR014760Serum_albumin_N
IPR003598Ig_sub2
IPR003961FN3_dom
IPR003599Ig_sub
IPR000719Prot_kinase_dom
IPR013783Ig-like_fold
IPR000219DH-domain
IPR013098Ig_I-set
IPR007110Ig-like_dom
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005085guanyl-nucleotide exchange factor activity
GO:0005515protein binding
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0005089Rho guanyl-nucleotide exchange factor activity
GO:0016301kinase activity
Vocabulary: cellular component
TermDefinition
GO:0005615extracellular space
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0035023regulation of Rho protein signal transduction
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 596..616
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 3181..3475
e-value: 1.1E-44
score: 155.0
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 3862..4086
e-value: 2.8E-26
score: 93.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 3493..3542
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 3493..3520
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 3521..3537
NoneNo IPR availablePANTHERPTHR47633FAMILY NOT NAMEDcoord: 1395..1876
coord: 1886..2108
coord: 3044..3434
coord: 1317..1658
coord: 3514..4089
NoneNo IPR availableCDDcd00096Igcoord: 1509..1574
e-value: 1.76139E-7
score: 49.1628
NoneNo IPR availableCDDcd00096Igcoord: 1400..1475
e-value: 9.45728E-5
score: 41.4589
NoneNo IPR availableCDDcd00096Igcoord: 2023..2095
e-value: 7.21011E-12
score: 61.4892
NoneNo IPR availableCDDcd00096Igcoord: 828..872
e-value: 0.00139622
score: 37.9921
NoneNo IPR availableCDDcd00096Igcoord: 3574..3646
e-value: 5.43862E-8
score: 50.3184
NoneNo IPR availableTMHMMTMhelixcoord: 5..24
IPR003598Immunoglobulin subtype 2SMARTSM00408igc2_5coord: 1395..1467
e-value: 7.6E-5
score: 32.1
coord: 1500..1570
e-value: 0.011
score: 25.0
coord: 2018..2088
e-value: 3.8E-7
score: 39.8
coord: 805..882
e-value: 4.3
score: 1.1
coord: 3569..3639
e-value: 0.6
score: 9.3
IPR003961Fibronectin type IIISMARTSM00060FN3_2coord: 3653..3736
e-value: 3.2E-5
score: 33.4
coord: 2868..2957
e-value: 0.0059
score: 25.8
coord: 2738..2847
e-value: 35.0
score: 6.7
coord: 2214..2301
e-value: 7.0E-5
score: 32.2
coord: 2535..2616
e-value: 43.0
score: 6.0
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 2768..2863
score: 8.45
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 2217..2314
score: 13.902
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 2870..2971
score: 11.322
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 2118..2214
score: 9.847
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 3655..3750
score: 12.742
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 2537..2629
score: 8.781
IPR003961Fibronectin type IIICDDcd00063FN3coord: 3653..3744
e-value: 3.77688E-8
score: 51.7283
IPR003961Fibronectin type IIICDDcd00063FN3coord: 2217..2306
e-value: 7.08894E-12
score: 62.1287
IPR003961Fibronectin type IIICDDcd00063FN3coord: 2879..2963
e-value: 2.25182E-7
score: 49.4171
IPR003961Fibronectin type IIICDDcd00063FN3coord: 2745..2853
e-value: 0.00694759
score: 36.7055
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 1071..1159
e-value: 200.0
score: 0.2
coord: 1697..1777
e-value: 15.0
score: 9.9
coord: 1593..1676
e-value: 3.9
score: 15.0
coord: 1796..1879
e-value: 47.0
score: 5.7
coord: 1494..1582
e-value: 0.0016
score: 27.7
coord: 3084..3170
e-value: 0.89
score: 18.6
coord: 1389..1479
e-value: 2.3E-5
score: 33.8
coord: 2012..2099
e-value: 2.7E-4
score: 30.3
coord: 799..896
e-value: 0.41
score: 19.7
coord: 1288..1379
e-value: 63.0
score: 4.5
coord: 3563..3649
e-value: 24.0
score: 8.1
coord: 1904..1989
e-value: 190.0
score: 0.3
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 3189..3430
e-value: 4.0E-39
score: 146.0
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 3191..3430
e-value: 3.5E-36
score: 124.9
coord: 3868..4066
e-value: 2.7E-18
score: 66.3
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 3189..3430
score: 27.453
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 3779..4066
score: 19.001
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 3651..3756
e-value: 6.7E-11
score: 44.3
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 2208..2310
e-value: 2.8E-11
score: 45.5
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 3545..3650
e-value: 5.4E-12
score: 47.4
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 2740..2859
e-value: 1.8E-6
score: 30.0
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 1488..1585
e-value: 3.7E-10
score: 41.9
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 1792..1889
e-value: 3.4E-6
score: 28.9
coord: 793..904
e-value: 1.3E-7
score: 33.5
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 1995..2103
e-value: 7.0E-17
score: 63.4
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 2874..2965
e-value: 2.0E-8
score: 36.6
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 1382..1485
e-value: 2.4E-10
score: 42.3
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 3073..3180
e-value: 3.4E-15
score: 58.0
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 1893..1988
e-value: 5.8E-8
score: 34.8
IPR035899Dbl homology (DH) domain superfamilyGENE3DG3DSA:1.20.900.10coord: 237..443
e-value: 6.3E-18
score: 67.0
IPR035899Dbl homology (DH) domain superfamilySUPERFAMILYSSF48065DBL homology domain (DH-domain)coord: 239..428
IPR013098Immunoglobulin I-setPFAMPF07679I-setcoord: 1390..1478
e-value: 1.1E-8
score: 35.0
coord: 1498..1581
e-value: 5.0E-7
score: 29.7
coord: 1897..1983
e-value: 1.9E-5
score: 24.6
coord: 3573..3647
e-value: 1.4E-6
score: 28.3
coord: 2006..2097
e-value: 1.8E-13
score: 50.4
coord: 3086..3169
e-value: 1.2E-10
score: 41.3
IPR000219Dbl homology (DH) domainPFAMPF00621RhoGEFcoord: 251..422
e-value: 1.7E-9
score: 38.2
IPR000219Dbl homology (DH) domainPROSITEPS50010DH_2coord: 246..428
score: 15.653
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 3303..3315
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 1380..1470
score: 7.595
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 1480..1582
score: 8.774
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 2006..2099
score: 10.426
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 3557..3648
score: 9.21
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 2254..2408
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 2879..3744
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 2130..2308
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 2795..2865
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 2534..2621
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 3843..4077
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 3181..3451
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 1897..1986
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 1496..1581
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 3554..3657
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 3077..3174
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 1390..1480
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 2006..2100
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 1592..1677
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 1705..1867
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 788..874