AP complex subunit sigma

Overview
NameAP complex subunit sigma
Smed IDSMED30005038
Length (bp)996
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of AP complex subunit sigma (SMED30005038) t-SNE clustered cells

Violin plots show distribution of expression levels for AP complex subunit sigma (SMED30005038) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of AP complex subunit sigma (SMED30005038) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for AP complex subunit sigma (SMED30005038) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005038

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
anterior region of the whole animalSMED30005038h1SMcG0012706 dd_Smed_v4_9393_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30005038h1SMcG0012706 dd_Smed_v4_9393_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30005038h1SMcG0012706 dd_Smed_v4_9393_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005038h1SMcG0012706 dd_Smed_v4_9393_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30005038h1SMcG0012706 dd_Smed_v4_9393_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of AP complex subunit sigma vs. Ensembl Human
Match: AP1S2 (adaptor related protein complex 1 subunit sigma 2 [Source:HGNC Symbol;Acc:HGNC:560])

HSP 1 Score: 239.58 bits (610), Expect = 5.358e-79
Identity = 111/141 (78.72%), Postives = 127/141 (90.07%), Query Frame = 2
Query:   20 MQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            MQFMLLFSRQGKLRLQKWY    DK KKKI R+L+  +LARKPKMCSFLEW+D+KIV+KRYASLYFCCA++  +NELI+LE+IHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFL+GG+VQET+KK VLKAI   D++Q
Sbjct:    1 MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQ 141          
BLAST of AP complex subunit sigma vs. Ensembl Human
Match: AP1S2 (adaptor related protein complex 1 subunit sigma 2 [Source:HGNC Symbol;Acc:HGNC:560])

HSP 1 Score: 239.195 bits (609), Expect = 5.959e-79
Identity = 111/141 (78.72%), Postives = 127/141 (90.07%), Query Frame = 2
Query:   20 MQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            MQFMLLFSRQGKLRLQKWY    DK KKKI R+L+  +LARKPKMCSFLEW+D+KIV+KRYASLYFCCA++  +NELI+LE+IHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFL+GG+VQET+KK VLKAI   D++Q
Sbjct:    1 MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQ 141          
BLAST of AP complex subunit sigma vs. Ensembl Human
Match: AP1S2 (adaptor related protein complex 1 subunit sigma 2 [Source:HGNC Symbol;Acc:HGNC:560])

HSP 1 Score: 239.195 bits (609), Expect = 8.283e-79
Identity = 111/141 (78.72%), Postives = 127/141 (90.07%), Query Frame = 2
Query:   20 MQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            MQFMLLFSRQGKLRLQKWY    DK KKKI R+L+  +LARKPKMCSFLEW+D+KIV+KRYASLYFCCA++  +NELI+LE+IHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFL+GG+VQET+KK VLKAI   D++Q
Sbjct:    1 MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQ 141          
BLAST of AP complex subunit sigma vs. Ensembl Human
Match: AP1S2 (adaptor related protein complex 1 subunit sigma 2 [Source:HGNC Symbol;Acc:HGNC:560])

HSP 1 Score: 238.424 bits (607), Expect = 8.748e-79
Identity = 111/141 (78.72%), Postives = 127/141 (90.07%), Query Frame = 2
Query:   20 MQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            MQFMLLFSRQGKLRLQKWY    DK KKKI R+L+  +LARKPKMCSFLEW+D+KIV+KRYASLYFCCA++  +NELI+LE+IHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFL+GG+VQET+KK VLKAI   D++Q
Sbjct:    1 MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQ 141          
BLAST of AP complex subunit sigma vs. Ensembl Human
Match: AP1S2 (adaptor related protein complex 1 subunit sigma 2 [Source:HGNC Symbol;Acc:HGNC:560])

HSP 1 Score: 238.424 bits (607), Expect = 8.748e-79
Identity = 111/141 (78.72%), Postives = 127/141 (90.07%), Query Frame = 2
Query:   20 MQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            MQFMLLFSRQGKLRLQKWY    DK KKKI R+L+  +LARKPKMCSFLEW+D+KIV+KRYASLYFCCA++  +NELI+LE+IHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFL+GG+VQET+KK VLKAI   D++Q
Sbjct:    1 MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQ 141          
BLAST of AP complex subunit sigma vs. Ensembl Celegans
Match: aps-1 (AP complex subunit sigma [Source:UniProtKB/TrEMBL;Acc:O16369])

HSP 1 Score: 253.447 bits (646), Expect = 6.692e-85
Identity = 117/142 (82.39%), Postives = 136/142 (95.77%), Query Frame = 2
Query:   17 MMQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            MMQ+MLLFSRQGKLRLQKWYT+YPDK KKKI R+LI QILARKPKMC+FLE+KD+K+V+KRYASLYFCCA+++ +NELI+LEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFL+ G++QET+KK VLKAI+AQD+IQ
Sbjct:    1 MMQYMLLFSRQGKLRLQKWYTAYPDKQKKKICRELITQILARKPKMCAFLEYKDLKVVYKRYASLYFCCAIEQNDNELITLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLAGEIQETSKKQVLKAIAAQDLIQ 142          
BLAST of AP complex subunit sigma vs. Ensembl Celegans
Match: aps-2 (AP complex subunit sigma [Source:UniProtKB/TrEMBL;Acc:Q19123])

HSP 1 Score: 137.502 bits (345), Expect = 6.156e-40
Identity = 61/135 (45.19%), Postives = 96/135 (71.11%), Query Frame = 2
Query:   17 MMQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAI 421
            M++F+L+ +R GK RL KWY  + D  K+K+  ++ A +  R  K  +F+E+++ KIV++RYA LYFC  VD T+N L  LE IH +VE+L++YF +VCELD++FNF K Y ++DE  + G+++ET++  VLK +
Sbjct:    1 MIRFILIQNRAGKTRLAKWYMHFDDDEKQKLIEEVHACVTVRDAKHTNFVEFRNFKIVYRRYAGLYFCICVDITDNNLYYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQL 135          
BLAST of AP complex subunit sigma vs. Ensembl Celegans
Match: aps-3 (AdaPtin, Small chain (Clathrin associated complex) [Source:UniProtKB/TrEMBL;Acc:Q8T874])

HSP 1 Score: 114.775 bits (286), Expect = 1.438e-30
Identity = 57/148 (38.51%), Postives = 94/148 (63.51%), Query Frame = 2
Query:   17 MMQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEW------KDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            M++ +L+ +  GK RL K+Y  YP++ +++I R+    +  R   +C+FLE        D +++++ YA+LYF   VD +E+EL  L++I  +VE LD+ F +VCELD+IF+ ++ + IL E ++GG V ETN   +L+ I  QD IQ
Sbjct:    1 MIKAILVINNHGKPRLLKFYQHYPEEKQQQIVRETFQLVSKRDDNVCNFLEGGTLIDGNDYRLIYRHYATLYFIFCVDSSESELGILDLIQVFVETLDRCFENVCELDLIFHVDRVHHILGEIVMGGMVLETNMNEILQRIQEQDKIQ 148          
BLAST of AP complex subunit sigma vs. Ensembl Fly
Match: AP-1sigma (gene:FBgn0039132 transcript:FBtr0305039)

HSP 1 Score: 249.98 bits (637), Expect = 1.576e-83
Identity = 115/142 (80.99%), Postives = 133/142 (93.66%), Query Frame = 2
Query:   17 MMQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            MM FMLLFSRQGKLRLQKWY +YPDKVKKKI R+L+  ILARKPKMCSFLEWKD KIV+KRYASLYFCCA+++ +NEL++LE+IHRYVELLDKYFGSVCELDIIFNFEKAYFILDE LIGG++QET+KK VLKAI++QD++Q
Sbjct:    1 MMLFMLLFSRQGKLRLQKWYMAYPDKVKKKITRELVTTILARKPKMCSFLEWKDCKIVYKRYASLYFCCAIEQNDNELLTLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDELLIGGEIQETSKKNVLKAIASQDLLQ 142          
BLAST of AP complex subunit sigma vs. Ensembl Fly
Match: AP-1sigma (gene:FBgn0039132 transcript:FBtr0305040)

HSP 1 Score: 249.98 bits (637), Expect = 1.576e-83
Identity = 115/142 (80.99%), Postives = 133/142 (93.66%), Query Frame = 2
Query:   17 MMQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            MM FMLLFSRQGKLRLQKWY +YPDKVKKKI R+L+  ILARKPKMCSFLEWKD KIV+KRYASLYFCCA+++ +NEL++LE+IHRYVELLDKYFGSVCELDIIFNFEKAYFILDE LIGG++QET+KK VLKAI++QD++Q
Sbjct:    1 MMLFMLLFSRQGKLRLQKWYMAYPDKVKKKITRELVTTILARKPKMCSFLEWKDCKIVYKRYASLYFCCAIEQNDNELLTLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDELLIGGEIQETSKKNVLKAIASQDLLQ 142          
BLAST of AP complex subunit sigma vs. Ensembl Fly
Match: AP-1sigma (gene:FBgn0039132 transcript:FBtr0335244)

HSP 1 Score: 249.98 bits (637), Expect = 1.807e-83
Identity = 115/142 (80.99%), Postives = 133/142 (93.66%), Query Frame = 2
Query:   17 MMQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            MM FMLLFSRQGKLRLQKWY +YPDKVKKKI R+L+  ILARKPKMCSFLEWKD KIV+KRYASLYFCCA+++ +NEL++LE+IHRYVELLDKYFGSVCELDIIFNFEKAYFILDE LIGG++QET+KK VLKAI++QD++Q
Sbjct:    1 MMLFMLLFSRQGKLRLQKWYMAYPDKVKKKITRELVTTILARKPKMCSFLEWKDCKIVYKRYASLYFCCAIEQNDNELLTLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDELLIGGEIQETSKKNVLKAIASQDLLQ 142          
BLAST of AP complex subunit sigma vs. Ensembl Fly
Match: AP-1sigma (gene:FBgn0039132 transcript:FBtr0084496)

HSP 1 Score: 249.21 bits (635), Expect = 3.201e-83
Identity = 115/142 (80.99%), Postives = 133/142 (93.66%), Query Frame = 2
Query:   17 MMQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            MM FMLLFSRQGKLRLQKWY +YPDKVKKKI R+L+  ILARKPKMCSFLEWKD KIV+KRYASLYFCCA+++ +NEL++LE+IHRYVELLDKYFGSVCELDIIFNFEKAYFILDE LIGG++QET+KK VLKAI++QD++Q
Sbjct:    1 MMLFMLLFSRQGKLRLQKWYMAYPDKVKKKITRELVTTILARKPKMCSFLEWKDCKIVYKRYASLYFCCAIEQNDNELLTLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDELLIGGEIQETSKKNVLKAIASQDLLQ 142          
BLAST of AP complex subunit sigma vs. Ensembl Fly
Match: AP-2sigma (gene:FBgn0043012 transcript:FBtr0084103)

HSP 1 Score: 137.117 bits (344), Expect = 1.211e-39
Identity = 60/135 (44.44%), Postives = 96/135 (71.11%), Query Frame = 2
Query:   17 MMQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAI 421
            M++F+L+ +R GK RL KWY ++ D  K+K+  ++ A +  R  K  +F+E+++ KIV++RYA LYFC  VD  +N L  LE IH +VE+L++YF +VCELD++FNF K Y ++DE  + G+++ET++  VLK +
Sbjct:    1 MIRFILIQNRAGKTRLAKWYMNFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIVYRRYAGLYFCICVDVNDNNLCYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYSVVDEMFLAGEIRETSQTKVLKQL 135          
BLAST of AP complex subunit sigma vs. Ensembl Zebrafish
Match: ap1s2 (adaptor related protein complex 1 subunit sigma 2 [Source:ZFIN;Acc:ZDB-GENE-030131-5448])

HSP 1 Score: 236.884 bits (603), Expect = 3.982e-78
Identity = 110/141 (78.01%), Postives = 126/141 (89.36%), Query Frame = 2
Query:   20 MQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            MQFMLLFSRQGKLRLQKWY    D  KKKI+R++I  +LARKPKMCSFLEW+D+KIV+KRYASLYFCCAV+  ENELI+LE+IHRYVELLDKYFGSVCELDIIFNFEKAY+ILDEF++GG+ QET+KK VLKAI   DM+Q
Sbjct:    1 MQFMLLFSRQGKLRLQKWYVPLSDTQKKKISREVIQMVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAVEDQENELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYYILDEFILGGEAQETSKKNVLKAIEQADMLQ 141          
BLAST of AP complex subunit sigma vs. Ensembl Zebrafish
Match: ap1s2 (adaptor related protein complex 1 subunit sigma 2 [Source:ZFIN;Acc:ZDB-GENE-030131-5448])

HSP 1 Score: 236.884 bits (603), Expect = 3.982e-78
Identity = 110/141 (78.01%), Postives = 126/141 (89.36%), Query Frame = 2
Query:   20 MQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            MQFMLLFSRQGKLRLQKWY    D  KKKI+R++I  +LARKPKMCSFLEW+D+KIV+KRYASLYFCCAV+  ENELI+LE+IHRYVELLDKYFGSVCELDIIFNFEKAY+ILDEF++GG+ QET+KK VLKAI   DM+Q
Sbjct:    1 MQFMLLFSRQGKLRLQKWYVPLSDTQKKKISREVIQMVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAVEDQENELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYYILDEFILGGEAQETSKKNVLKAIEQADMLQ 141          
BLAST of AP complex subunit sigma vs. Ensembl Zebrafish
Match: ap1s2 (adaptor related protein complex 1 subunit sigma 2 [Source:ZFIN;Acc:ZDB-GENE-030131-5448])

HSP 1 Score: 236.884 bits (603), Expect = 3.982e-78
Identity = 110/141 (78.01%), Postives = 126/141 (89.36%), Query Frame = 2
Query:   20 MQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            MQFMLLFSRQGKLRLQKWY    D  KKKI+R++I  +LARKPKMCSFLEW+D+KIV+KRYASLYFCCAV+  ENELI+LE+IHRYVELLDKYFGSVCELDIIFNFEKAY+ILDEF++GG+ QET+KK VLKAI   DM+Q
Sbjct:    1 MQFMLLFSRQGKLRLQKWYVPLSDTQKKKISREVIQMVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAVEDQENELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYYILDEFILGGEAQETSKKNVLKAIEQADMLQ 141          
BLAST of AP complex subunit sigma vs. Ensembl Zebrafish
Match: ap1s2 (adaptor related protein complex 1 subunit sigma 2 [Source:ZFIN;Acc:ZDB-GENE-030131-5448])

HSP 1 Score: 236.884 bits (603), Expect = 3.982e-78
Identity = 110/141 (78.01%), Postives = 126/141 (89.36%), Query Frame = 2
Query:   20 MQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            MQFMLLFSRQGKLRLQKWY    D  KKKI+R++I  +LARKPKMCSFLEW+D+KIV+KRYASLYFCCAV+  ENELI+LE+IHRYVELLDKYFGSVCELDIIFNFEKAY+ILDEF++GG+ QET+KK VLKAI   DM+Q
Sbjct:    1 MQFMLLFSRQGKLRLQKWYVPLSDTQKKKISREVIQMVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAVEDQENELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYYILDEFILGGEAQETSKKNVLKAIEQADMLQ 141          
BLAST of AP complex subunit sigma vs. Ensembl Zebrafish
Match: ap1s1 (adaptor related protein complex 1 subunit sigma 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1119])

HSP 1 Score: 234.958 bits (598), Expect = 1.850e-77
Identity = 108/142 (76.06%), Postives = 130/142 (91.55%), Query Frame = 2
Query:   17 MMQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            MM+FMLLFSRQGKLRLQKWYT+  ++ KKK+ R+L+  +LARKPKMCSFLEW+D+KIV+KRYASLYFCCAV+  +NELI+LEVIHR+VELLDKYFGSVCELDIIFNFEKAYFILDEFL+GG++Q+T+KK VLKAI   D++Q
Sbjct:    1 MMRFMLLFSRQGKLRLQKWYTATAERDKKKMVRELMQVVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAVEEQDNELITLEVIHRFVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGEIQDTSKKSVLKAIEQADLLQ 142          
BLAST of AP complex subunit sigma vs. Ensembl Xenopus
Match: tbkbp1 (TBK1 binding protein 1 [Source:Xenbase;Acc:XB-GENE-962068])

HSP 1 Score: 237.654 bits (605), Expect = 2.464e-78
Identity = 111/141 (78.72%), Postives = 127/141 (90.07%), Query Frame = 2
Query:   20 MQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            MQFMLLFSRQGKLRLQKWY    DK KKKI R+L+  +LARKPKMCSFLEW+D+KIV+KRYASLYFCCA++  +NELI+LE+IHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFL+GG+VQET+KK VLKAI   D++Q
Sbjct:    7 MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQ 147          
BLAST of AP complex subunit sigma vs. Ensembl Xenopus
Match: tbkbp1 (TBK1 binding protein 1 [Source:Xenbase;Acc:XB-GENE-962068])

HSP 1 Score: 234.572 bits (597), Expect = 3.763e-77
Identity = 111/142 (78.17%), Postives = 127/142 (89.44%), Query Frame = 2
Query:   20 MQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKR-YASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            MQFMLLFSRQGKLRLQKWY    DK KKKI R+L+  +LARKPKMCSFLEW+D+KIV+KR YASLYFCCA++  +NELI+LE+IHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFL+GG+VQET+KK VLKAI   D++Q
Sbjct:    1 MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRLYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQ 142          
BLAST of AP complex subunit sigma vs. Ensembl Xenopus
Match: tbkbp1 (TBK1 binding protein 1 [Source:Xenbase;Acc:XB-GENE-962068])

HSP 1 Score: 234.187 bits (596), Expect = 4.386e-77
Identity = 111/142 (78.17%), Postives = 127/142 (89.44%), Query Frame = 2
Query:   20 MQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKR-YASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            MQFMLLFSRQGKLRLQKWY    DK KKKI R+L+  +LARKPKMCSFLEW+D+KIV+KR YASLYFCCA++  +NELI+LE+IHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFL+GG+VQET+KK VLKAI   D++Q
Sbjct:    1 MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRLYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQ 142          
BLAST of AP complex subunit sigma vs. Ensembl Xenopus
Match: plekha3 (pleckstrin homology domain containing A3 [Source:Xenbase;Acc:XB-GENE-961095])

HSP 1 Score: 231.491 bits (589), Expect = 6.896e-76
Identity = 106/141 (75.18%), Postives = 127/141 (90.07%), Query Frame = 2
Query:   20 MQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            M+FMLLFSRQGKLRLQKWY +  ++ KKK+ RDL+  +L+RKPKMCSFLEWKD K+V+KRYASLYFCCAV+  +NEL++LE+IHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFL+GG++Q+T+KK VLKAI   DM+Q
Sbjct:    1 MRFMLLFSRQGKLRLQKWYVAISERDKKKLVRDLMQTVLSRKPKMCSFLEWKDFKVVYKRYASLYFCCAVEDQDNELLTLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGEIQDTSKKSVLKAIEQSDMLQ 141          
BLAST of AP complex subunit sigma vs. Ensembl Xenopus
Match: plekha3 (pleckstrin homology domain containing A3 [Source:Xenbase;Acc:XB-GENE-961095])

HSP 1 Score: 230.72 bits (587), Expect = 1.024e-75
Identity = 106/141 (75.18%), Postives = 127/141 (90.07%), Query Frame = 2
Query:   20 MQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            M+FMLLFSRQGKLRLQKWY +  ++ KKK+ RDL+  +L+RKPKMCSFLEWKD K+V+KRYASLYFCCAV+  +NEL++LE+IHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFL+GG++Q+T+KK VLKAI   DM+Q
Sbjct:    1 MRFMLLFSRQGKLRLQKWYVAISERDKKKLVRDLMQTVLSRKPKMCSFLEWKDFKVVYKRYASLYFCCAVEDQDNELLTLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGEIQDTSKKSVLKAIEQSDMLQ 141          
BLAST of AP complex subunit sigma vs. Ensembl Mouse
Match: Ap1s2 (adaptor-related protein complex 1, sigma 2 subunit [Source:MGI Symbol;Acc:MGI:1889383])

HSP 1 Score: 239.58 bits (610), Expect = 3.679e-79
Identity = 111/141 (78.72%), Postives = 127/141 (90.07%), Query Frame = 2
Query:   20 MQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            MQFMLLFSRQGKLRLQKWY    DK KKKI R+L+  +LARKPKMCSFLEW+D+KIV+KRYASLYFCCA++  +NELI+LE+IHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFL+GG+VQET+KK VLKAI   D++Q
Sbjct:    1 MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQ 141          
BLAST of AP complex subunit sigma vs. Ensembl Mouse
Match: Ap1s2 (adaptor-related protein complex 1, sigma 2 subunit [Source:MGI Symbol;Acc:MGI:1889383])

HSP 1 Score: 239.195 bits (609), Expect = 4.091e-79
Identity = 111/141 (78.72%), Postives = 127/141 (90.07%), Query Frame = 2
Query:   20 MQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            MQFMLLFSRQGKLRLQKWY    DK KKKI R+L+  +LARKPKMCSFLEW+D+KIV+KRYASLYFCCA++  +NELI+LE+IHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFL+GG+VQET+KK VLKAI   D++Q
Sbjct:    1 MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQ 141          
BLAST of AP complex subunit sigma vs. Ensembl Mouse
Match: Ap1s2 (adaptor-related protein complex 1, sigma 2 subunit [Source:MGI Symbol;Acc:MGI:1889383])

HSP 1 Score: 238.81 bits (608), Expect = 6.204e-79
Identity = 111/141 (78.72%), Postives = 127/141 (90.07%), Query Frame = 2
Query:   20 MQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            MQFMLLFSRQGKLRLQKWY    DK KKKI R+L+  +LARKPKMCSFLEW+D+KIV+KRYASLYFCCA++  +NELI+LE+IHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFL+GG+VQET+KK VLKAI   D++Q
Sbjct:    1 MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQ 141          
BLAST of AP complex subunit sigma vs. Ensembl Mouse
Match: Ap1s1 (adaptor protein complex AP-1, sigma 1 [Source:MGI Symbol;Acc:MGI:1098244])

HSP 1 Score: 231.876 bits (590), Expect = 2.323e-76
Identity = 107/142 (75.35%), Postives = 128/142 (90.14%), Query Frame = 2
Query:   17 MMQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            MM+FMLLFSRQGKLRLQKWY +  DK +KK+ R+L+  +LARKPKMCSFLEW+D+K+V+KRYASLYFCCA++  +NELI+LE+IHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFL+GG VQ+T+KK VLKAI   D++Q
Sbjct:    1 MMRFMLLFSRQGKLRLQKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGDVQDTSKKSVLKAIEQADLLQ 142          
BLAST of AP complex subunit sigma vs. Ensembl Mouse
Match: Ap1s1 (adaptor protein complex AP-1, sigma 1 [Source:MGI Symbol;Acc:MGI:1098244])

HSP 1 Score: 232.261 bits (591), Expect = 2.873e-76
Identity = 107/142 (75.35%), Postives = 128/142 (90.14%), Query Frame = 2
Query:   17 MMQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            MM+FMLLFSRQGKLRLQKWY +  DK +KK+ R+L+  +LARKPKMCSFLEW+D+K+V+KRYASLYFCCA++  +NELI+LE+IHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFL+GG VQ+T+KK VLKAI   D++Q
Sbjct:    1 MMRFMLLFSRQGKLRLQKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGDVQDTSKKSVLKAIEQADLLQ 142          
BLAST of AP complex subunit sigma vs. UniProt/SwissProt
Match: sp|Q9DB50|AP1S2_MOUSE (AP-1 complex subunit sigma-2 OS=Mus musculus OX=10090 GN=Ap1s2 PE=1 SV=1)

HSP 1 Score: 239.58 bits (610), Expect = 2.573e-78
Identity = 111/141 (78.72%), Postives = 127/141 (90.07%), Query Frame = 2
Query:   20 MQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            MQFMLLFSRQGKLRLQKWY    DK KKKI R+L+  +LARKPKMCSFLEW+D+KIV+KRYASLYFCCA++  +NELI+LE+IHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFL+GG+VQET+KK VLKAI   D++Q
Sbjct:    1 MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQ 141          
BLAST of AP complex subunit sigma vs. UniProt/SwissProt
Match: sp|Q3ZBS3|AP1S2_BOVIN (AP-1 complex subunit sigma-2 OS=Bos taurus OX=9913 GN=AP1S2 PE=2 SV=1)

HSP 1 Score: 239.58 bits (610), Expect = 2.573e-78
Identity = 111/141 (78.72%), Postives = 127/141 (90.07%), Query Frame = 2
Query:   20 MQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            MQFMLLFSRQGKLRLQKWY    DK KKKI R+L+  +LARKPKMCSFLEW+D+KIV+KRYASLYFCCA++  +NELI+LE+IHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFL+GG+VQET+KK VLKAI   D++Q
Sbjct:    1 MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQ 141          
BLAST of AP complex subunit sigma vs. UniProt/SwissProt
Match: sp|P56377|AP1S2_HUMAN (AP-1 complex subunit sigma-2 OS=Homo sapiens OX=9606 GN=AP1S2 PE=1 SV=1)

HSP 1 Score: 239.195 bits (609), Expect = 2.862e-78
Identity = 111/141 (78.72%), Postives = 127/141 (90.07%), Query Frame = 2
Query:   20 MQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            MQFMLLFSRQGKLRLQKWY    DK KKKI R+L+  +LARKPKMCSFLEW+D+KIV+KRYASLYFCCA++  +NELI+LE+IHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFL+GG+VQET+KK VLKAI   D++Q
Sbjct:    1 MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQ 141          
BLAST of AP complex subunit sigma vs. UniProt/SwissProt
Match: sp|P61967|AP1S1_MOUSE (AP-1 complex subunit sigma-1A OS=Mus musculus OX=10090 GN=Ap1s1 PE=1 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 2.009e-75
Identity = 107/142 (75.35%), Postives = 128/142 (90.14%), Query Frame = 2
Query:   17 MMQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            MM+FMLLFSRQGKLRLQKWY +  DK +KK+ R+L+  +LARKPKMCSFLEW+D+K+V+KRYASLYFCCA++  +NELI+LE+IHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFL+GG VQ+T+KK VLKAI   D++Q
Sbjct:    1 MMRFMLLFSRQGKLRLQKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGDVQDTSKKSVLKAIEQADLLQ 142          
BLAST of AP complex subunit sigma vs. UniProt/SwissProt
Match: sp|P61966|AP1S1_HUMAN (AP-1 complex subunit sigma-1A OS=Homo sapiens OX=9606 GN=AP1S1 PE=1 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 2.009e-75
Identity = 107/142 (75.35%), Postives = 128/142 (90.14%), Query Frame = 2
Query:   17 MMQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            MM+FMLLFSRQGKLRLQKWY +  DK +KK+ R+L+  +LARKPKMCSFLEW+D+K+V+KRYASLYFCCA++  +NELI+LE+IHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFL+GG VQ+T+KK VLKAI   D++Q
Sbjct:    1 MMRFMLLFSRQGKLRLQKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGDVQDTSKKSVLKAIEQADLLQ 142          
BLAST of AP complex subunit sigma vs. TrEMBL
Match: A0A2C9M9V4 (AP complex subunit sigma OS=Biomphalaria glabrata OX=6526 GN=106065610 PE=3 SV=1)

HSP 1 Score: 255.373 bits (651), Expect = 4.458e-82
Identity = 117/142 (82.39%), Postives = 136/142 (95.77%), Query Frame = 2
Query:   17 MMQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            MMQFMLLFSRQGKLRLQKW+T+YPD+ KKKI R+LIA +LARKPKMCSFLEWKD+KIV+KRYASLYFCCA++  +NEL++LEVIHRYVELLDKYFGSVCELDIIFNFEKAYF+LDEFL+GG+VQET+KK VLKAI+AQD++Q
Sbjct:    1 MMQFMLLFSRQGKLRLQKWFTAYPDRTKKKITRELIALVLARKPKMCSFLEWKDLKIVYKRYASLYFCCAIENDDNELLTLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFMLDEFLLGGEVQETSKKNVLKAIAAQDLLQ 142          
BLAST of AP complex subunit sigma vs. TrEMBL
Match: A0A2C9M9V9 (AP complex subunit sigma OS=Biomphalaria glabrata OX=6526 GN=106065610 PE=3 SV=1)

HSP 1 Score: 254.988 bits (650), Expect = 4.692e-82
Identity = 117/142 (82.39%), Postives = 136/142 (95.77%), Query Frame = 2
Query:   17 MMQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            MMQFMLLFSRQGKLRLQKW+T+YPD+ KKKI R+LIA +LARKPKMCSFLEWKD+KIV+KRYASLYFCCA++  +NEL++LEVIHRYVELLDKYFGSVCELDIIFNFEKAYF+LDEFL+GG+VQET+KK VLKAI+AQD++Q
Sbjct:    1 MMQFMLLFSRQGKLRLQKWFTAYPDRTKKKITRELIALVLARKPKMCSFLEWKDLKIVYKRYASLYFCCAIENDDNELLTLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFMLDEFLLGGEVQETSKKNVLKAIAAQDLLQ 142          
BLAST of AP complex subunit sigma vs. TrEMBL
Match: A0A2C9M9V0 (AP complex subunit sigma OS=Biomphalaria glabrata OX=6526 GN=106065610 PE=3 SV=1)

HSP 1 Score: 254.988 bits (650), Expect = 5.912e-82
Identity = 117/142 (82.39%), Postives = 136/142 (95.77%), Query Frame = 2
Query:   17 MMQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            MMQFMLLFSRQGKLRLQKW+T+YPD+ KKKI R+LIA +LARKPKMCSFLEWKD+KIV+KRYASLYFCCA++  +NEL++LEVIHRYVELLDKYFGSVCELDIIFNFEKAYF+LDEFL+GG+VQET+KK VLKAI+AQD++Q
Sbjct:    1 MMQFMLLFSRQGKLRLQKWFTAYPDRTKKKITRELIALVLARKPKMCSFLEWKDLKIVYKRYASLYFCCAIENDDNELLTLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFMLDEFLLGGEVQETSKKNVLKAIAAQDLLQ 142          
BLAST of AP complex subunit sigma vs. TrEMBL
Match: A0A3P7M6W9 (AP complex subunit sigma OS=Cylicostephanus goldi OX=71465 GN=CGOC_LOCUS9130 PE=3 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 7.048e-82
Identity = 119/142 (83.80%), Postives = 136/142 (95.77%), Query Frame = 2
Query:   17 MMQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            MMQFMLLFSRQGKLRLQKWYT+Y DK+KKKI R+LI QILARKPKMC+FLE+KD+KIV+KRYASLYFCCA+++T+NELI LEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFL+ G++QET+KK VLKAI+AQD+IQ
Sbjct:    1 MMQFMLLFSRQGKLRLQKWYTAYQDKMKKKICRELITQILARKPKMCAFLEYKDLKIVYKRYASLYFCCAIEQTDNELICLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLAGEIQETSKKQVLKAIAAQDLIQ 142          
BLAST of AP complex subunit sigma vs. TrEMBL
Match: G0MXN1 (AP complex subunit sigma OS=Caenorhabditis brenneri OX=135651 GN=Cbn-aps-1 PE=3 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 7.124e-82
Identity = 118/142 (83.10%), Postives = 136/142 (95.77%), Query Frame = 2
Query:   17 MMQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            MMQ+MLLFSRQGKLRLQKWYT+YPDK KKKI R+LI QILARKPKMC+FLE+KDMK+V+KRYASLYFCCA+++ +NELI+LEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFL+ G++QET+KK VLKAI+AQD+IQ
Sbjct:    1 MMQYMLLFSRQGKLRLQKWYTAYPDKQKKKICRELITQILARKPKMCAFLEYKDMKVVYKRYASLYFCCAIEQNDNELITLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLAGEIQETSKKQVLKAIAAQDLIQ 142          
BLAST of AP complex subunit sigma vs. Ensembl Cavefish
Match: AP1S2 (AP-1 complex subunit sigma-2 [Source:NCBI gene;Acc:103030203])

HSP 1 Score: 238.039 bits (606), Expect = 1.164e-78
Identity = 110/141 (78.01%), Postives = 126/141 (89.36%), Query Frame = 2
Query:   20 MQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            MQFMLLFSRQGKLRLQKWY    DK KKKI R+L+  +LARKPKMCSFLEW+D+KIV+KRYASLYFCCA++  +NELI+LE+IHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFL+GG+ QET+KK VLKAI   D++Q
Sbjct:    1 MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEAQETSKKNVLKAIEQADLLQ 141          
BLAST of AP complex subunit sigma vs. Ensembl Cavefish
Match: AP1S2 (AP-1 complex subunit sigma-2 [Source:NCBI gene;Acc:103030203])

HSP 1 Score: 236.498 bits (602), Expect = 3.810e-78
Identity = 110/141 (78.01%), Postives = 126/141 (89.36%), Query Frame = 2
Query:   20 MQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            MQFMLLFSRQGKLRLQKWY    DK KKKI R+L+  +LARKPKMCSFLEW+D+KIV+KRYASLYFCCA++  +NELI+LE+IHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFL+GG+ QET+KK VLKAI   D++Q
Sbjct:    1 MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEAQETSKKNVLKAIEQADLLQ 141          
BLAST of AP complex subunit sigma vs. Ensembl Cavefish
Match: ap1s1 (AP-1 complex subunit sigma-1A [Source:NCBI gene;Acc:103041452])

HSP 1 Score: 232.646 bits (592), Expect = 1.173e-76
Identity = 107/141 (75.89%), Postives = 129/141 (91.49%), Query Frame = 2
Query:   20 MQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            M+FMLLFSRQGKLRLQKWYT+  ++ KKK+ R+L+  +LARKPKMCSFLEW+D+KIV+KRYASLYFCCAV+  +NELI+LEVIHR+VELLDKYFGSVCELDIIFNFEKAYFILDEFL+GG++Q+T+KK VLKAI   D++Q
Sbjct:    1 MRFMLLFSRQGKLRLQKWYTATAERDKKKMVRELMQVVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAVEEQDNELITLEVIHRFVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGEIQDTSKKSVLKAIEQADLLQ 141          
BLAST of AP complex subunit sigma vs. Ensembl Cavefish
Match: ENSAMXT00000055261.1 (AP-1 complex subunit sigma-2-like [Source:NCBI gene;Acc:103023733])

HSP 1 Score: 220.705 bits (561), Expect = 6.071e-72
Identity = 98/142 (69.01%), Postives = 124/142 (87.32%), Query Frame = 2
Query:   17 MMQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            MM+F+LLFSRQGKLRLQKW+    ++ KKKI RD+   +LARKP+ C+FL W+D+KIV+KRYASLYFCC ++  +NEL++LEV+HRYVELLDKYFGSVCELDIIFNFEKAYFILDEFL+GG++QET+K+ + K+I A DM+Q
Sbjct:    1 MMRFLLLFSRQGKLRLQKWFLPMTEREKKKIIRDMTTMVLARKPRTCNFLHWRDLKIVYKRYASLYFCCGLEDQDNELLALEVLHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGEIQETSKQSIAKSIEASDMLQ 142          
BLAST of AP complex subunit sigma vs. Ensembl Cavefish
Match: ENSAMXT00000046966.1 (pep primary_assembly:Astyanax_mexicanus-2.0:5:15033972:15038356:1 gene:ENSAMXG00000031582.1 transcript:ENSAMXT00000046966.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 219.164 bits (557), Expect = 2.169e-71
Identity = 100/132 (75.76%), Postives = 119/132 (90.15%), Query Frame = 2
Query:   47 QGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            +GKLRLQKWY +  D  KKKI+R++I  +LARKPKMCSFLEW+D+KIV+KRYASLYFCCAV+  ENELI+LE+IHRYVELLDKYFGSVCELDIIFNFEKAY+ILDEF++GG+ QET+KK+VLKAI   DM+Q
Sbjct:   10 RGKLRLQKWYVALSDTQKKKISREVIQMVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAVEDQENELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYYILDEFILGGEAQETSKKIVLKAIEQADMLQ 141          
BLAST of AP complex subunit sigma vs. Ensembl Sea Lamprey
Match: ap2s1 (adaptor related protein complex 2 subunit sigma 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2174])

HSP 1 Score: 136.732 bits (343), Expect = 3.571e-40
Identity = 60/135 (44.44%), Postives = 95/135 (70.37%), Query Frame = 2
Query:   17 MMQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAI 421
            M++F+L+ +R GK RL KWY  + D  K+K+  ++ A +  R  K  +F+E+++ KIV++RYA LYFC  VD  +N L  LE IH +VE+L++YF +VCELD++FNF K Y ++DE  + G+++ET++  VLK +
Sbjct:    1 MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIVYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQL 135          
BLAST of AP complex subunit sigma vs. Ensembl Sea Lamprey
Match: ap3s2 (adaptor related protein complex 3 subunit sigma 2 [Source:ZFIN;Acc:ZDB-GENE-040718-274])

HSP 1 Score: 111.309 bits (277), Expect = 8.002e-30
Identity = 58/148 (39.19%), Postives = 95/148 (64.19%), Query Frame = 2
Query:   17 MMQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEW------KDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            M++ +L+F+  GK RL K+Y  Y D ++++I R+    +  R   +C+FLE        D K++++ YA+LYF   VD  E+EL  L++I  +VE LDK F +VCELD+IF+ +K ++IL+E ++GG V ETN   ++  I AQ+ ++
Sbjct:    1 MIKAILVFNNHGKPRLSKFYKFYED-MQQQIIRETFHLVSKRDDNVCNFLEGGTLIGGSDYKLIYRHYATLYFVFCVDSCESELGILDLIQVFVETLDKCFENVCELDLIFHVDKVHYILNEMVMGGMVLETNMNEIVNQIEAQNKLE 147          
BLAST of AP complex subunit sigma vs. Ensembl Yeast
Match: APS1 (Small subunit of the clathrin-associated adaptor complex AP-1; AP-1 is involved in protein sorting at the trans-Golgi network; homolog of the sigma subunit of the mammalian clathrin AP-1 complex [Source:SGD;Acc:S000004160])

HSP 1 Score: 160.999 bits (406), Expect = 1.808e-49
Identity = 74/143 (51.75%), Postives = 106/143 (74.13%), Query Frame = 2
Query:   20 MQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDR-TENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLI-GGQVQETNKKMVLKAISAQDMIQ 442
            ++++LL SRQGK+RL+KWYT+     K KI +DL   ILARKPKMC+ +E+ D K+V+KRYASLYF   +    +NEL++LE+IHR+VE +D YFG+VCELDIIFNF K Y IL+E ++  G + E+++K VL  ++  D ++
Sbjct:    4 LKYLLLVSRQGKIRLKKWYTAMSAGEKAKIVKDLTPTILARKPKMCNIIEYNDHKVVYKRYASLYFIVGMTPDVDNELLTLEIIHRFVETMDTYFGNVCELDIIFNFSKVYDILNEMIMCDGSIAESSRKEVLHHVTVMDTME 146          
BLAST of AP complex subunit sigma vs. Ensembl Yeast
Match: APS2 (Small subunit of the clathrin-associated adaptor complex AP-2; AP-2 is involved in protein sorting at the plasma membrane; related to the sigma subunit of the mammalian plasma membrane clathrin-associated protein (AP-2) complex [Source:SGD;Acc:S000003819])

HSP 1 Score: 119.013 bits (297), Expect = 1.811e-33
Identity = 64/144 (44.44%), Postives = 97/144 (67.36%), Query Frame = 2
Query:   20 MQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQIL----ARKPKMCS-FLEWKD-MKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQD 433
            +QF+L F++QG +RL +W+  +    ++  ++D IAQI     +R  K  S F+E+ D  K++++RYA LYF   VD  ++E I L  IH +VE+LD +FG+VCELDI+FNF K Y I+DE  IGG++QE +K M+L+ +S  D
Sbjct:    3 VQFILCFNKQGVVRLVRWFDVHSSDPQR--SQDAIAQIYRLISSRDHKHQSNFVEFSDSTKLIYRRYAGLYFVMGVDLLDDEPIYLCHIHLFVEVLDAFFGNVCELDIVFNFYKVYMIMDEMFIGGEIQEISKDMLLERLSILD 144          
BLAST of AP complex subunit sigma vs. Ensembl Yeast
Match: APS3 (Small subunit of the clathrin-associated adaptor complex AP-3; involved in vacuolar protein sorting; related to the sigma subunit of the mammalian clathrin AP-3 complex; suppressor of loss of casein kinase 1 function; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000003561])

HSP 1 Score: 73.9442 bits (180), Expect = 3.255e-16
Identity = 48/154 (31.17%), Postives = 86/154 (55.84%), Query Frame = 2
Query:   17 MMQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPK--MCSFLEWKD-----------------MKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAI 421
            M+  +L+F+++ + RL K+YT   D  K+K+  + + ++++++      SFL                     ++I++K YA+LYF   VD  E+EL  L++I  +VE LD+ F  V ELD+IFN++    +L+E + GG V ETN   ++ ++
Sbjct:    1 MIHAVLIFNKKCQPRLVKFYTPV-DLPKQKLLLEQVYELISQRNSDFQSSFLVTPPSLLLSNENNNDEVNNEDIQIIYKNYATLYFTFIVDDQESELAILDLIQTFVESLDRCFTEVNELDLIFNWQTLESVLEEIVQGGMVIETNVNRIVASV 153          
BLAST of AP complex subunit sigma vs. Ensembl Yeast
Match: YLR171W_mRNA (Dubious open reading frame; unlikely to encode a functional protein, based on available experimental and comparative sequence data [Source:SGD;Acc:S000004161])

HSP 1 Score: 55.4546 bits (132), Expect = 3.269e-10
Identity = 45/106 (42.45%), Postives = 55/106 (51.89%), Query Frame = -1
Query:   16 ISNSHTLPKYLSNNSTYLCITSKDINSFSVLSTAQQ-K*RLAYLLNTIFISFHSKNEHIFGFLARICAIKSLAIFFLTLSGYDVYHFCSRSLPC--RLNNSINCII 324
            +S+S TLPKY+S  ST   I SK  +S S        K RLAY L T   S +S   HI GFLA I  +KS  IF  + +   VYHF +   PC    N   NC+I
Sbjct:    1 MSSSQTLPKYVSIVSTNRWIISKVSSSLSTSGVIPTIKYRLAYRLYTTLWSLYSMMLHILGFLANIVGVKSFTIFAFSPADIAVYHFFNLIFPCLETSNKYFNCVI 106          
BLAST of AP complex subunit sigma vs. Ensembl Nematostella
Match: EDO45252 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTE2])

HSP 1 Score: 231.876 bits (590), Expect = 8.743e-77
Identity = 107/139 (76.98%), Postives = 125/139 (89.93%), Query Frame = 2
Query:   26 FMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            FMLLFSRQGK+RLQKWYT+   K KKKI RDL+  +L+RKPKMCSFLE+KDMK+ +KRYASLYFC  ++  +NEL++LEVIHRYVELLDKYFGSVCELDIIFNFEKAYF+LDE LIGG+VQET+KK VLKAISAQD++Q
Sbjct:    2 FMLLFSRQGKIRLQKWYTAISQKEKKKITRDLVTTVLSRKPKMCSFLEYKDMKVCYKRYASLYFCVGIENDDNELLTLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFMLDELLIGGEVQETSKKNVLKAISAQDLLQ 140          
BLAST of AP complex subunit sigma vs. Ensembl Nematostella
Match: EDO38137 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDU6])

HSP 1 Score: 137.117 bits (344), Expect = 5.525e-40
Identity = 64/141 (45.39%), Postives = 97/141 (68.79%), Query Frame = 2
Query:   17 MMQFMLLFSRQGKLRLQKWY--TSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQD 433
            M++F+L+ ++QG  RL ++Y  T   D+V   +  ++I + LAR    CSF+E+++ K V++RYASLYF   +D TENEL  +E IH +VE+LD+YF SVCELDI+FN +K + +LDE ++ G + ETNK  VL  ++  D
Sbjct:    1 MLKFILIVNKQGHTRLSQYYEYTKIEDRVS--LEAEIIRKCLARSENQCSFIEYQNFKAVYRRYASLYFIIGIDSTENELGIMEFIHNFVEILDRYFDSVCELDIMFNIDKVHMLLDEMVMNGHIVETNKNRVLAPVTELD 139          
BLAST of AP complex subunit sigma vs. Ensembl Nematostella
Match: EDO42183 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S269])

HSP 1 Score: 133.265 bits (334), Expect = 1.703e-38
Identity = 58/135 (42.96%), Postives = 97/135 (71.85%), Query Frame = 2
Query:   20 MQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAIS 424
            ++F+L+ +R GK RL KWY ++ D  K+K+  ++ A +  R  K  +F+E+++ KIV++RYA LYFC  VD ++N L  LE IH +VE+L+++F +VCELD++FNF K Y ++DE  + G+++ET++  VLK ++
Sbjct:    2 IRFILIQNRAGKTRLAKWYMNFDDDEKQKLIEEVHALVTVRDAKHTNFVEFRNFKIVYRRYAGLYFCFCVDVSDNNLYYLEAIHNFVEVLNEFFHNVCELDLVFNFYKVYSVVDEMFLAGELRETSQSKVLKQLN 136          
BLAST of AP complex subunit sigma vs. Ensembl Nematostella
Match: EDO42407 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1Q2])

HSP 1 Score: 115.161 bits (287), Expect = 5.894e-31
Identity = 66/185 (35.68%), Postives = 107/185 (57.84%), Query Frame = 2
Query:   17 MMQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWK------DMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQXXXXXXXXXXXXXGLMSKSSQ*ITIVCNYLTVLSRLS 553
            M++ +L+F+  GK RL K+Y  Y + ++++I ++    +  R   +C+FLE        D K+V++ YA+LYF   VD +E+EL  L++I  +VE LDK F +VCELD+IF+ +K + IL E ++GG V ETN   +L  I AQ+ ++           E G+ +   + ++ V NY   L  LS
Sbjct:    1 MIKGILIFNNHGKPRLTKFYQHYSEDMQQQIIKETFHLVSRRDDNVCNFLEGGSLIGGADFKLVYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHMDKVHHILAEIVMGGMVLETNMSEILTHIEAQNKLE---------KSEAGISAAPQKAMSAVRNYSPNLQNLS 176          
BLAST of AP complex subunit sigma vs. Ensembl Medaka
Match: AP1S2 (AP-1 complex subunit sigma-2 [Source:NCBI gene;Acc:101157435])

HSP 1 Score: 239.965 bits (611), Expect = 1.852e-79
Identity = 112/141 (79.43%), Postives = 127/141 (90.07%), Query Frame = 2
Query:   20 MQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            MQFMLLFSRQGKLRLQKWY    DK +KKI+RDL+  ILARKPKMCSFLEW+D+KIV+KRYASLYFCCAV+  +NELI+LE+IHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFL+GG+ QET+KK VLKAI   D++Q
Sbjct:    1 MQFMLLFSRQGKLRLQKWYVPLSDKERKKISRDLVQTILARKPKMCSFLEWRDLKIVYKRYASLYFCCAVEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEAQETSKKNVLKAIEQADLLQ 141          
BLAST of AP complex subunit sigma vs. Ensembl Medaka
Match: zgc:162858 (AP-1 complex subunit sigma-2 [Source:NCBI gene;Acc:101174095])

HSP 1 Score: 237.654 bits (605), Expect = 1.782e-78
Identity = 110/141 (78.01%), Postives = 126/141 (89.36%), Query Frame = 2
Query:   20 MQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            MQFMLLFSRQGKLRLQKWY    DK KKKI R+L+  +LARKPKMCSFLEW+D+KIV+KRYASLYFCCA++  +NELI+LE+IHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFL+GG+ QET+KK VLKAI   D++Q
Sbjct:    1 MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEAQETSKKNVLKAIEQADLLQ 141          
BLAST of AP complex subunit sigma vs. Ensembl Medaka
Match: zgc:162858 (AP-1 complex subunit sigma-2 [Source:NCBI gene;Acc:101174095])

HSP 1 Score: 237.654 bits (605), Expect = 3.337e-78
Identity = 110/143 (76.92%), Postives = 127/143 (88.81%), Query Frame = 2
Query:   14 YMMQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            + MQFMLLFSRQGKLRLQKWY    DK KKKI R+L+  +LARKPKMCSFLEW+D+KIV+KRYASLYFCCA++  +NELI+LE+IHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFL+GG+ QET+KK VLKAI   D++Q
Sbjct:   19 FQMQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEAQETSKKNVLKAIEQADLLQ 161          
BLAST of AP complex subunit sigma vs. Ensembl Medaka
Match: zgc:162858 (AP-1 complex subunit sigma-2 [Source:NCBI gene;Acc:101174095])

HSP 1 Score: 238.424 bits (607), Expect = 6.354e-78
Identity = 110/143 (76.92%), Postives = 127/143 (88.81%), Query Frame = 2
Query:   14 YMMQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            + MQFMLLFSRQGKLRLQKWY    DK KKKI R+L+  +LARKPKMCSFLEW+D+KIV+KRYASLYFCCA++  +NELI+LE+IHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFL+GG+ QET+KK VLKAI   D++Q
Sbjct:   19 FQMQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEAQETSKKNVLKAIEQADLLQ 161          
BLAST of AP complex subunit sigma vs. Ensembl Medaka
Match: ap1s1 (adaptor related protein complex 1 subunit sigma 1 [Source:NCBI gene;Acc:101154904])

HSP 1 Score: 234.572 bits (597), Expect = 2.570e-77
Identity = 108/142 (76.06%), Postives = 130/142 (91.55%), Query Frame = 2
Query:   17 MMQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            MM+FMLLFSRQGKLRLQKWYT+  ++ KKK+ R+L+  +LARKPKMCSFLEWKD+KIV+KRYASLYFCCA++  +NELI+LEVIHR+VELLDKYFGSVCELDIIFNFEKAYFILDEFL+GG++Q+T+KK VLKAI   D++Q
Sbjct:    1 MMRFMLLFSRQGKLRLQKWYTATAERDKKKMVRELMQIVLARKPKMCSFLEWKDLKIVYKRYASLYFCCAIEEQDNELITLEVIHRFVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGEIQDTSKKSVLKAIEQADLLQ 142          
BLAST of AP complex subunit sigma vs. Planmine SMEST
Match: SMESG000019676.1 (SMESG000019676.1)

HSP 1 Score: 301.982 bits (772), Expect = 5.212e-104
Identity = 162/162 (100.00%), Postives = 162/162 (100.00%), Query Frame = 2
Query:   20 MQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQXXXXXXXXXXXXXGLMSKSSQ 505
            MQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQEESEDSKSLLEELGLMSKSSQ
Sbjct:    1 MQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQEESEDSKSLLEELGLMSKSSQ 162          
BLAST of AP complex subunit sigma vs. Planmine SMEST
Match: SMESG000019676.1 (SMESG000019676.1)

HSP 1 Score: 290.426 bits (742), Expect = 1.555e-99
Identity = 141/141 (100.00%), Postives = 141/141 (100.00%), Query Frame = 2
Query:   20 MQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            MQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ
Sbjct:    1 MQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 141          
BLAST of AP complex subunit sigma vs. Planmine SMEST
Match: SMESG000019676.1 (SMESG000019676.1)

HSP 1 Score: 284.263 bits (726), Expect = 3.974e-97
Identity = 138/138 (100.00%), Postives = 138/138 (100.00%), Query Frame = 2
Query:   29 MLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            MLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ
Sbjct:    1 MLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 138          
BLAST of AP complex subunit sigma vs. Planmine SMEST
Match: SMESG000063235.1 (SMESG000063235.1)

HSP 1 Score: 242.662 bits (618), Expect = 1.223e-80
Identity = 108/142 (76.06%), Postives = 131/142 (92.25%), Query Frame = 2
Query:   17 MMQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            MMQFMLLFSRQGK+RLQKWY ++ DK +KKI R+L + +L RKPKMC+F+EWKD+KIV++RYASLYFCCAV+R +NEL++LE+IHRYVELLDKYFGSVCELDIIFNFEKAYF+LDEF++ G+VQET+KK VLKA+ AQDMIQ
Sbjct:    1 MMQFMLLFSRQGKVRLQKWYVAHSDKTRKKILRELTSLVLTRKPKMCAFIEWKDLKIVYRRYASLYFCCAVEREDNELVTLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFMLDEFMLAGEVQETSKKNVLKAVDAQDMIQ 142          
BLAST of AP complex subunit sigma vs. Planmine SMEST
Match: SMESG000063235.1 (SMESG000063235.1)

HSP 1 Score: 240.736 bits (613), Expect = 6.966e-80
Identity = 108/142 (76.06%), Postives = 131/142 (92.25%), Query Frame = 2
Query:   17 MMQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPKMCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQ 442
            MMQFMLLFSRQGK+RLQKWY ++ DK +KKI R+L + +L RKPKMC+F+EWKD+KIV++RYASLYFCCAV+R +NEL++LE+IHRYVELLDKYFGSVCELDIIFNFEKAYF+LDEF++ G+VQET+KK VLKA+ AQDMIQ
Sbjct:    1 MMQFMLLFSRQGKVRLQKWYVAHSDKTRKKILRELTSLVLTRKPKMCAFIEWKDLKIVYRRYASLYFCCAVEREDNELVTLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFMLDEFMLAGEVQETSKKNVLKAVDAQDMIQ 142          
The following BLAST results are available for this feature:
BLAST of AP complex subunit sigma vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AP1S25.358e-7978.72adaptor related protein complex 1 subunit sigma 2 ... [more]
AP1S25.959e-7978.72adaptor related protein complex 1 subunit sigma 2 ... [more]
AP1S28.283e-7978.72adaptor related protein complex 1 subunit sigma 2 ... [more]
AP1S28.748e-7978.72adaptor related protein complex 1 subunit sigma 2 ... [more]
AP1S28.748e-7978.72adaptor related protein complex 1 subunit sigma 2 ... [more]
back to top
BLAST of AP complex subunit sigma vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
aps-16.692e-8582.39AP complex subunit sigma [Source:UniProtKB/TrEMBL... [more]
aps-26.156e-4045.19AP complex subunit sigma [Source:UniProtKB/TrEMBL... [more]
aps-31.438e-3038.51AdaPtin, Small chain (Clathrin associated complex)... [more]
back to top
BLAST of AP complex subunit sigma vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AP-1sigma1.576e-8380.99gene:FBgn0039132 transcript:FBtr0305039[more]
AP-1sigma1.576e-8380.99gene:FBgn0039132 transcript:FBtr0305040[more]
AP-1sigma1.807e-8380.99gene:FBgn0039132 transcript:FBtr0335244[more]
AP-1sigma3.201e-8380.99gene:FBgn0039132 transcript:FBtr0084496[more]
AP-2sigma1.211e-3944.44gene:FBgn0043012 transcript:FBtr0084103[more]
back to top
BLAST of AP complex subunit sigma vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ap1s23.982e-7878.01adaptor related protein complex 1 subunit sigma 2 ... [more]
ap1s23.982e-7878.01adaptor related protein complex 1 subunit sigma 2 ... [more]
ap1s23.982e-7878.01adaptor related protein complex 1 subunit sigma 2 ... [more]
ap1s23.982e-7878.01adaptor related protein complex 1 subunit sigma 2 ... [more]
ap1s11.850e-7776.06adaptor related protein complex 1 subunit sigma 1 ... [more]
back to top
BLAST of AP complex subunit sigma vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbkbp12.464e-7878.72TBK1 binding protein 1 [Source:Xenbase;Acc:XB-GENE... [more]
tbkbp13.763e-7778.17TBK1 binding protein 1 [Source:Xenbase;Acc:XB-GENE... [more]
tbkbp14.386e-7778.17TBK1 binding protein 1 [Source:Xenbase;Acc:XB-GENE... [more]
plekha36.896e-7675.18pleckstrin homology domain containing A3 [Source:X... [more]
plekha31.024e-7575.18pleckstrin homology domain containing A3 [Source:X... [more]
back to top
BLAST of AP complex subunit sigma vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ap1s23.679e-7978.72adaptor-related protein complex 1, sigma 2 subunit... [more]
Ap1s24.091e-7978.72adaptor-related protein complex 1, sigma 2 subunit... [more]
Ap1s26.204e-7978.72adaptor-related protein complex 1, sigma 2 subunit... [more]
Ap1s12.323e-7675.35adaptor protein complex AP-1, sigma 1 [Source:MGI ... [more]
Ap1s12.873e-7675.35adaptor protein complex AP-1, sigma 1 [Source:MGI ... [more]
back to top
BLAST of AP complex subunit sigma vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9DB50|AP1S2_MOUSE2.573e-7878.72AP-1 complex subunit sigma-2 OS=Mus musculus OX=10... [more]
sp|Q3ZBS3|AP1S2_BOVIN2.573e-7878.72AP-1 complex subunit sigma-2 OS=Bos taurus OX=9913... [more]
sp|P56377|AP1S2_HUMAN2.862e-7878.72AP-1 complex subunit sigma-2 OS=Homo sapiens OX=96... [more]
sp|P61967|AP1S1_MOUSE2.009e-7575.35AP-1 complex subunit sigma-1A OS=Mus musculus OX=1... [more]
sp|P61966|AP1S1_HUMAN2.009e-7575.35AP-1 complex subunit sigma-1A OS=Homo sapiens OX=9... [more]
back to top
BLAST of AP complex subunit sigma vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9M9V44.458e-8282.39AP complex subunit sigma OS=Biomphalaria glabrata ... [more]
A0A2C9M9V94.692e-8282.39AP complex subunit sigma OS=Biomphalaria glabrata ... [more]
A0A2C9M9V05.912e-8282.39AP complex subunit sigma OS=Biomphalaria glabrata ... [more]
A0A3P7M6W97.048e-8283.80AP complex subunit sigma OS=Cylicostephanus goldi ... [more]
G0MXN17.124e-8283.10AP complex subunit sigma OS=Caenorhabditis brenner... [more]
back to top
BLAST of AP complex subunit sigma vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AP1S21.164e-7878.01AP-1 complex subunit sigma-2 [Source:NCBI gene;Acc... [more]
AP1S23.810e-7878.01AP-1 complex subunit sigma-2 [Source:NCBI gene;Acc... [more]
ap1s11.173e-7675.89AP-1 complex subunit sigma-1A [Source:NCBI gene;Ac... [more]
ENSAMXT00000055261.16.071e-7269.01AP-1 complex subunit sigma-2-like [Source:NCBI gen... [more]
ENSAMXT00000046966.12.169e-7175.76pep primary_assembly:Astyanax_mexicanus-2.0:5:1503... [more]
back to top
BLAST of AP complex subunit sigma vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ap2s13.571e-4044.44adaptor related protein complex 2 subunit sigma 1 ... [more]
ap3s28.002e-3039.19adaptor related protein complex 3 subunit sigma 2 ... [more]
back to top
BLAST of AP complex subunit sigma vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
APS11.808e-4951.75Small subunit of the clathrin-associated adaptor c... [more]
APS21.811e-3344.44Small subunit of the clathrin-associated adaptor c... [more]
APS33.255e-1631.17Small subunit of the clathrin-associated adaptor c... [more]
YLR171W_mRNA3.269e-1042.45Dubious open reading frame; unlikely to encode a f... [more]
back to top
BLAST of AP complex subunit sigma vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO452528.743e-7776.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO381375.525e-4045.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421831.703e-3842.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424075.894e-3135.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of AP complex subunit sigma vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AP1S21.852e-7979.43AP-1 complex subunit sigma-2 [Source:NCBI gene;Acc... [more]
zgc:1628581.782e-7878.01AP-1 complex subunit sigma-2 [Source:NCBI gene;Acc... [more]
zgc:1628583.337e-7876.92AP-1 complex subunit sigma-2 [Source:NCBI gene;Acc... [more]
zgc:1628586.354e-7876.92AP-1 complex subunit sigma-2 [Source:NCBI gene;Acc... [more]
ap1s12.570e-7776.06adaptor related protein complex 1 subunit sigma 1 ... [more]
back to top
BLAST of AP complex subunit sigma vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000019676.15.212e-104100.00SMESG000019676.1[more]
SMESG000019676.11.555e-99100.00SMESG000019676.1[more]
SMESG000019676.13.974e-97100.00SMESG000019676.1[more]
SMESG000063235.11.223e-8076.06SMESG000063235.1[more]
SMESG000063235.16.966e-8076.06SMESG000063235.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005038 ID=SMED30005038|Name=AP complex subunit sigma|organism=Schmidtea mediterranea sexual|type=transcript|length=996bp
TCTATATAAATCTTATATGATGCAATTTATGCTATTATTTAGTCGACAAG
GTAAACTTCGACTGCAAAAATGGTATACGTCATATCCAGATAAAGTTAAA
AAGAAAATCGCTAGGGACTTAATTGCGCAAATTCTTGCAAGAAAACCAAA
AATGTGTTCATTTTTAGAATGGAAAGATATGAAAATTGTATTTAAGAGGT
ACGCAAGTCTTTATTTTTGTTGTGCAGTTGATAGAACAGAAAATGAATTA
ATATCCTTGGAGGTTATACATAGATATGTAGAATTATTGGATAAATATTT
CGGAAGTGTGTGTGAGTTAGATATAATTTTCAATTTTGAAAAAGCATATT
TCATTCTGGATGAATTTCTTATTGGTGGTCAAGTTCAAGAAACGAACAAG
AAAATGGTTCTCAAAGCAATTTCAGCCCAAGATATGATACAAGAGGAATC
TGAAGATAGCAAAAGCCTACTTGAAGAATTGGGATTGATGTCGAAAAGCT
CTCAGTGAATTACTATTGTTTGCAATTATTTAACAGTATTATCGAGGTTG
TCTTTGGGATAGGTTATATATTTATTAAATTATGTAAAGTGTCATTTAAT
CATTGAGTCTTCCTAATTGTATAATTATTCACTATTCAATTTGTGATTAG
ATTTGCTCTGTACAATTTGTGGGATAATATCGTTTAATTTGCTTGTAAAT
GTTTTGTTGATTGGGAATTTTGTTTTTTGTTAGAGGTTGTTTTTATTCAA
TTGGCTTGTTTGATTGATGAATATATACATTTATCTATGCATTTTTTAAT
TGGATCACTTTATTATATTTCCCGTCGGAATAGATAGTTTGGTTCCAATA
AAATAGTTAATTTTATTATTATTTTTATCAACTTATTGTTGTAACTCATT
TGTACGCAGAGCAAGTATAAATTCATCATCATATATACAGTCGTTACCAC
CAGAACTATGTATTTAGGCTACTCCATTTATCCATCTCAATATATA
back to top

protein sequence of SMED30005038-orf-1

>SMED30005038-orf-1 ID=SMED30005038-orf-1|Name=SMED30005038-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=169bp
LYKSYMMQFMLLFSRQGKLRLQKWYTSYPDKVKKKIARDLIAQILARKPK
MCSFLEWKDMKIVFKRYASLYFCCAVDRTENELISLEVIHRYVELLDKYF
GSVCELDIIFNFEKAYFILDEFLIGGQVQETNKKMVLKAISAQDMIQEES
EDSKSLLEELGLMSKSSQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0030117membrane coat
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000028Category 2 cell
PLANA:0000140anterior region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR016635AP_complex_ssu
IPR022775AP_mu_sigma_su
IPR011012Longin-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0015031protein transport
GO:0006810transport
GO:0006886intracellular protein transport
GO:0016192vesicle-mediated transport
Vocabulary: molecular function
TermDefinition
GO:0008565protein transporter activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.30.450.60coord: 1..157
e-value: 1.1E-61
score: 209.1
NoneNo IPR availablePANTHERPTHR11753:SF45AP-1 COMPLEX SUBUNIT SIGMA-2coord: 1..152
NoneNo IPR availableCDDcd14831AP1_sigmacoord: 2..144
e-value: 5.76109E-98
score: 276.747
IPR016635Adaptor protein complex, sigma subunitPIRSFPIRSF015588AP_complex_sigmacoord: 1..151
e-value: 1.7E-66
score: 220.4
IPR016635Adaptor protein complex, sigma subunitPANTHERPTHR11753CLATHRIN COAT ASSEMBLY PROTEINcoord: 1..152
IPR022775AP complex, mu/sigma subunitPFAMPF01217Clat_adaptor_scoord: 1..139
e-value: 9.9E-58
score: 194.1
IPR011012Longin-like domain superfamilySUPERFAMILYSSF64356SNARE-likecoord: 2..139