noggin-like protein 3

Overview
Namenoggin-like protein 3 (ACO06228.1)
Smed IDSMED30005036
Length (bp)1240
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of noggin-like protein 3 (SMED30005036) t-SNE clustered cells

Violin plots show distribution of expression levels for noggin-like protein 3 (SMED30005036) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of noggin-like protein 3 (SMED30005036) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for noggin-like protein 3 (SMED30005036) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005036

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30005036SMESG000034700.1 SMESG000007613.1 dd_Smed_v4_10386_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005036SMESG000034700.1 SMESG000007613.1 FJ471485.1smed_ncbi_20200123PMID:19174194
Molina et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30005036SMESG000034700.1 SMESG000007613.1 FJ471485smed_ncbi_20200123PMID:19174194
Molina et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of noggin-like protein 3 vs. Ensembl Human
Match: NOG (noggin [Source:HGNC Symbol;Acc:HGNC:7866])

HSP 1 Score: 67.3958 bits (163), Expect = 3.317e-12
Identity = 31/77 (40.26%), Postives = 45/77 (58.44%), Query Frame = 2
Query:  317 NGFKINISKTILTSIQQWLIEESKCQVEYHWQELNETYWPRWVKKGLCVNIKSCSWPPGMNCSPNSYRKLSLLQWIC 547
             G K  +SK +   +Q WL  ++ C V Y W +L   +WPR+VK G C + +SCS P GM C P+    L++L+W C
Sbjct:  131 QGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRC 207          
BLAST of noggin-like protein 3 vs. Ensembl Zebrafish
Match: nog2 (noggin 2 [Source:NCBI gene;Acc:30185])

HSP 1 Score: 73.559 bits (179), Expect = 1.080e-14
Identity = 47/158 (29.75%), Postives = 78/158 (49.37%), Query Frame = 2
Query:   98 SHYYEVPSYLHFPNITHNTRR-------ILQQIIHNGILVDNWISITKPHQLYQSSNEPENVSKRMRFLVKMKNITLIDKN-GFKINISKTILTSIQQWLIEESKCQVEYHWQELNETYWPRWVKKGLCVNIKSCSWPPGMNCSPNSYRKLSLLQWIC 547
            S    VP  +  P+  H+ R        +L+++  N     N++SI  P QL  +S  PE    R+    ++K + L +   G ++ + K       QWL   + C V Y W++L   +WPR++K+G C + +SCS+P GM+C P      + L+W C
Sbjct:   34 SEGLPVPDLIENPDPEHDPREQDLSEKTLLKKLGSN--FDANFMSIHLPAQL-NASAPPE--LPRLPMPAELKKLDLTETPYGRRVKVGKKARRKFLQWLWMYTHCPVLYTWKDLGLRFWPRYIKEGNCFSERSCSFPEGMSCKPVKAVTKTFLRWYC 186          
BLAST of noggin-like protein 3 vs. Ensembl Zebrafish
Match: nog3 (noggin 3 [Source:NCBI gene;Acc:30173])

HSP 1 Score: 69.707 bits (169), Expect = 3.272e-13
Identity = 41/123 (33.33%), Postives = 65/123 (52.85%), Query Frame = 2
Query:  200 NWISITKP---HQLYQSSNEPENVSKRMRFLV--KMKNITLIDKNGFKINISKTILTSIQQWLIEESKCQVEYHWQELNETYWPRWVKKGLCVNIKSCSWPPGMNCSPNSYRKLSLLQWICAE 553
            N++SI  P   H      NE E + +R   ++  ++K +    ++G K   SK +   +Q WL   + C V + WQ+L   +WPR++K G C N +SCS P GM C P     L++L+W C +
Sbjct:   75 NFMSINPPEDKHAGQDELNESELMKQRPNGIMPKEIKAMEFDIQHGKKHKPSKKLRRRLQLWLWSYTFCPVVHTWQDLGNRFWPRYLKVGSCYNKRSCSVPEGMVCKPAKSSHLTVLRWRCVQ 197          
BLAST of noggin-like protein 3 vs. Ensembl Zebrafish
Match: nog3 (noggin 3 [Source:NCBI gene;Acc:30173])

HSP 1 Score: 69.707 bits (169), Expect = 3.335e-13
Identity = 41/123 (33.33%), Postives = 65/123 (52.85%), Query Frame = 2
Query:  200 NWISITKP---HQLYQSSNEPENVSKRMRFLV--KMKNITLIDKNGFKINISKTILTSIQQWLIEESKCQVEYHWQELNETYWPRWVKKGLCVNIKSCSWPPGMNCSPNSYRKLSLLQWICAE 553
            N++SI  P   H      NE E + +R   ++  ++K +    ++G K   SK +   +Q WL   + C V + WQ+L   +WPR++K G C N +SCS P GM C P     L++L+W C +
Sbjct:   75 NFMSINPPEDKHAGQDELNESELMKQRPNGIMPKEIKAMEFDIQHGKKHKPSKKLRRRLQLWLWSYTFCPVVHTWQDLGNRFWPRYLKVGSCYNKRSCSVPEGMVCKPAKSSHLTVLRWRCVQ 197          
BLAST of noggin-like protein 3 vs. Ensembl Zebrafish
Match: nog3 (noggin 3 [Source:NCBI gene;Acc:30173])

HSP 1 Score: 69.707 bits (169), Expect = 3.335e-13
Identity = 41/123 (33.33%), Postives = 65/123 (52.85%), Query Frame = 2
Query:  200 NWISITKP---HQLYQSSNEPENVSKRMRFLV--KMKNITLIDKNGFKINISKTILTSIQQWLIEESKCQVEYHWQELNETYWPRWVKKGLCVNIKSCSWPPGMNCSPNSYRKLSLLQWICAE 553
            N++SI  P   H      NE E + +R   ++  ++K +    ++G K   SK +   +Q WL   + C V + WQ+L   +WPR++K G C N +SCS P GM C P     L++L+W C +
Sbjct:   75 NFMSINPPEDKHAGQDELNESELMKQRPNGIMPKEIKAMEFDIQHGKKHKPSKKLRRRLQLWLWSYTFCPVVHTWQDLGNRFWPRYLKVGSCYNKRSCSVPEGMVCKPAKSSHLTVLRWRCVQ 197          
BLAST of noggin-like protein 3 vs. Ensembl Zebrafish
Match: nog1 (noggin 1 [Source:NCBI gene;Acc:30174])

HSP 1 Score: 63.929 bits (154), Expect = 2.332e-11
Identity = 38/125 (30.40%), Postives = 57/125 (45.60%), Query Frame = 2
Query:  185 GILVDNWISITKPHQLYQSSNEPENVSKRMRFLVKM----KNITLIDKNGFKINISKTILTSIQQWLIEESKCQVEYHWQELNETYWPRWVKKGLCVNIKSCSWPPGMNCSPNSYRKLSLLQWIC 547
            G     ++S+  P   Y  + + +    ++     M    KN+      G K   SK +   +Q WL   S C V Y W +L   +WPR+V+ G C   +SCS P GM C P     ++LL+W C
Sbjct:   64 GDFDSRFLSVGPPQDRYAGNEDLDEQELQLNLAGMMPKDIKNLDFDAPWGKKRKASKKLKRRLQMWLWSYSFCPVLYAWNDLGSRFWPRFVRAGSCYTKRSCSVPEGMVCKPAKSTHITLLRWRC 188          
BLAST of noggin-like protein 3 vs. Ensembl Xenopus
Match: nog4 (noggin 4 [Source:NCBI gene;Acc:733455])

HSP 1 Score: 65.4698 bits (158), Expect = 1.673e-11
Identity = 28/76 (36.84%), Postives = 40/76 (52.63%), Query Frame = 2
Query:  323 FKINISKTILTSIQQWLIEESKCQVEYHWQELNETYWPRWVKKGLCVNI-KSCSWPPGMNCSPNSYRKLSLLQWIC 547
               N S  +   I+QWL++ + CQ+   W +L   +WPRWV+   C     +CSWPPGM C      ++ LL W C
Sbjct:  139 LSANSSLHVQNEIRQWLVQRASCQLTSTWVDLGTVFWPRWVRHTDCDGANTACSWPPGMACRQAQLTQIKLLAWHC 214          
BLAST of noggin-like protein 3 vs. Ensembl Xenopus
Match: acad10 (acyl-CoA dehydrogenase family member 10 [Source:Xenbase;Acc:XB-GENE-967980])

HSP 1 Score: 64.6994 bits (156), Expect = 1.940e-11
Identity = 36/118 (30.51%), Postives = 63/118 (53.39%), Query Frame = 2
Query:  200 NWISITKPHQLYQSSNEPENVSKRMRFL-VKMKNITLIDKN-GFKINISKTILTSIQQWLIEESKCQVEYHWQELNETYWPRWVKKGLCVNIKSCSWPPGMNCSPNSYRKLSLLQWIC 547
            N++S+  P+ +  S+ +     K +  + +++K + L +   G +I + K       QWL   + C V Y W++L   +WPR++K+G C + KSCS+P GM C P      + L+W C
Sbjct:   75 NFMSVVLPNSVNMSTQDSLTKMKTLGSVPLELKKLDLSETPYGGRIRMGKKARRKFLQWLWAYTYCPVMYTWKDLGVRFWPRFIKEGHCFSEKSCSFPEGMYCKPIKSVTKTFLRWYC 192          
BLAST of noggin-like protein 3 vs. Ensembl Xenopus
Match: nog (noggin [Source:NCBI gene;Acc:493191])

HSP 1 Score: 63.5438 bits (153), Expect = 5.102e-11
Identity = 30/77 (38.96%), Postives = 43/77 (55.84%), Query Frame = 2
Query:  317 NGFKINISKTILTSIQQWLIEESKCQVEYHWQELNETYWPRWVKKGLCVNIKSCSWPPGMNCSPNSYRKLSLLQWIC 547
             G K  +SK +   +Q WL  ++ C V Y W +L   +WPR+VK G C + +SCS P GM C       L++L+W C
Sbjct:  121 QGKKHRLSKKLRRKLQMWLWSQTFCPVLYTWNDLGTRFWPRYVKVGSCYSKRSCSVPEGMVCKAAKSMHLTILRWRC 197          
BLAST of noggin-like protein 3 vs. Ensembl Mouse
Match: Nog (noggin [Source:MGI Symbol;Acc:MGI:104327])

HSP 1 Score: 67.3958 bits (163), Expect = 2.172e-12
Identity = 31/77 (40.26%), Postives = 45/77 (58.44%), Query Frame = 2
Query:  317 NGFKINISKTILTSIQQWLIEESKCQVEYHWQELNETYWPRWVKKGLCVNIKSCSWPPGMNCSPNSYRKLSLLQWIC 547
             G K  +SK +   +Q WL  ++ C V Y W +L   +WPR+VK G C + +SCS P GM C P+    L++L+W C
Sbjct:  131 QGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRC 207          
BLAST of noggin-like protein 3 vs. UniProt/SwissProt
Match: sp|Q9W740|NOGG2_DANRE (Noggin-2 OS=Danio rerio OX=7955 GN=nog2 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 8.155e-14
Identity = 47/158 (29.75%), Postives = 78/158 (49.37%), Query Frame = 2
Query:   98 SHYYEVPSYLHFPNITHNTRR-------ILQQIIHNGILVDNWISITKPHQLYQSSNEPENVSKRMRFLVKMKNITLIDKN-GFKINISKTILTSIQQWLIEESKCQVEYHWQELNETYWPRWVKKGLCVNIKSCSWPPGMNCSPNSYRKLSLLQWIC 547
            S    VP  +  P+  H+ R        +L+++  N     N++SI  P QL  +S  PE    R+    ++K + L +   G ++ + K       QWL   + C V Y W++L   +WPR++K+G C + +SCS+P GM+C P      + L+W C
Sbjct:   34 SEGLPVPDLIENPDPEHDPREQDLSEKTLLKKLGSN--FDANFMSIHLPAQL-NASAPPE--LPRLPMPAELKKLDLTETPYGRRVKVGKKARRKFLQWLWMYTHCPVLYTWKDLGLRFWPRYIKEGNCFSERSCSFPEGMSCKPVKAVTKTFLRWYC 186          
BLAST of noggin-like protein 3 vs. UniProt/SwissProt
Match: sp|Q9YHV3|NOGG3_DANRE (Noggin-3 OS=Danio rerio OX=7955 GN=nog3 PE=1 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 3.286e-12
Identity = 41/123 (33.33%), Postives = 65/123 (52.85%), Query Frame = 2
Query:  200 NWISITKP---HQLYQSSNEPENVSKRMRFLV--KMKNITLIDKNGFKINISKTILTSIQQWLIEESKCQVEYHWQELNETYWPRWVKKGLCVNIKSCSWPPGMNCSPNSYRKLSLLQWICAE 553
            N++SI  P   H      NE E + +R   ++  ++K +    ++G K   SK +   +Q WL   + C V + WQ+L   +WPR++K G C N +SCS P GM C P     L++L+W C +
Sbjct:   75 NFMSINPPEDKHAGQDELNESELMKQRPNGIMPKEIKAMEFDIQHGKKHKPSKKLRRRLQLWLWSYTFCPVVHTWQDLGNRFWPRYLKVGSCYNKRSCSVPEGMVCKPPKSSHLTVLRWRCVQ 197          
BLAST of noggin-like protein 3 vs. UniProt/SwissProt
Match: sp|P97466|NOGG_MOUSE (Noggin OS=Mus musculus OX=10090 GN=Nog PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 1.519e-11
Identity = 31/77 (40.26%), Postives = 45/77 (58.44%), Query Frame = 2
Query:  317 NGFKINISKTILTSIQQWLIEESKCQVEYHWQELNETYWPRWVKKGLCVNIKSCSWPPGMNCSPNSYRKLSLLQWIC 547
             G K  +SK +   +Q WL  ++ C V Y W +L   +WPR+VK G C + +SCS P GM C P+    L++L+W C
Sbjct:  131 QGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRC 207          
BLAST of noggin-like protein 3 vs. UniProt/SwissProt
Match: sp|Q13253|NOGG_HUMAN (Noggin OS=Homo sapiens OX=9606 GN=NOG PE=1 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 1.593e-11
Identity = 31/77 (40.26%), Postives = 45/77 (58.44%), Query Frame = 2
Query:  317 NGFKINISKTILTSIQQWLIEESKCQVEYHWQELNETYWPRWVKKGLCVNIKSCSWPPGMNCSPNSYRKLSLLQWIC 547
             G K  +SK +   +Q WL  ++ C V Y W +L   +WPR+VK G C + +SCS P GM C P+    L++L+W C
Sbjct:  131 QGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRC 207          
BLAST of noggin-like protein 3 vs. UniProt/SwissProt
Match: sp|O93525|NOGG_CHICK (Noggin OS=Gallus gallus OX=9031 GN=NOG PE=2 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 2.436e-11
Identity = 33/89 (37.08%), Postives = 50/89 (56.18%), Query Frame = 2
Query:  287 KMKNITLID--KNGFKINISKTILTSIQQWLIEESKCQVEYHWQELNETYWPRWVKKGLCVNIKSCSWPPGMNCSPNSYRKLSLLQWIC 547
            ++K +   D  + G K  +SK +   +Q WL  ++ C V Y W +L   +WPR+VK G C + +SCS P GM C P     L++L+W C
Sbjct:  110 EIKGLEFYDGLQPGKKHRLSKKLRRKLQMWLWSQTFCPVLYTWNDLGSRFWPRYVKVGSCYSKRSCSVPEGMVCKPAKSVHLTILRWRC 198          
BLAST of noggin-like protein 3 vs. TrEMBL
Match: C1JAC3 (Noggin-like protein 3 OS=Schmidtea mediterranea OX=79327 GN=nlg3 PE=2 SV=1)

HSP 1 Score: 478.404 bits (1230), Expect = 4.864e-167
Identity = 272/274 (99.27%), Postives = 274/274 (100.00%), Query Frame = 2
Query:    2 MNLQIIFFLFLKFCNIKFTTEGKSKNKDFRKFSHYYEVPSYLHFPNITHNTRRILQQIIHNGILVDNWISITKPHQLYQSSNEPENVSKRMRFLVKMKNITLIDKNGFKINISKTILTSIQQWLIEESKCQVEYHWQELNETYWPRWVKKGLCVNIKSCSWPPGMNCSPNSYRKLSLLQWICAEXXXXXXXXXXXXXXXXXXXXXXXXQXXXXXXXXXXXXRWLRLPRKLEESQSNAIKIRLRLFKLSLYTEGFYCKWREVHYRVIQTCSCNCS 823
            MNLQIIFFLFLKFCNIKFTTEGKSKNKDFRKFSHYYEVPSYLHFPNITHNTRRILQQIIHNGILVDNWISITKPHQLYQSSNEPENVSKRMRFLVKMKNITLIDKNGFKINISKTILTSIQQWLIEESKCQVEYHWQELNETYWPRWVKKGLCVNIKSCSWPPGM+CSPNSYRKLSLLQWICAEDKSK+KYKDDKLLIKIARKIRRKRQNISNNSKFKSKKRWLRLPRKLEESQSNAIKIRLRLFKLSLYTEGFYCKWREVHYRVIQTCSCNCS
Sbjct:    1 MNLQIIFFLFLKFCNIKFTTEGKSKNKDFRKFSHYYEVPSYLHFPNITHNTRRILQQIIHNGILVDNWISITKPHQLYQSSNEPENVSKRMRFLVKMKNITLIDKNGFKINISKTILTSIQQWLIEESKCQVEYHWQELNETYWPRWVKKGLCVNIKSCSWPPGMSCSPNSYRKLSLLQWICAEDKSKEKYKDDKLLIKIARKIRRKRQNISNNSKFKSKKRWLRLPRKLEESQSNAIKIRLRLFKLSLYTEGFYCKWREVHYRVIQTCSCNCS 274          
BLAST of noggin-like protein 3 vs. TrEMBL
Match: C1JAC2 (Noggin-like protein 2 OS=Schmidtea mediterranea OX=79327 GN=nlg2 PE=2 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 6.318e-50
Identity = 110/254 (43.31%), Postives = 159/254 (62.60%), Query Frame = 2
Query:   62 EGKSKNKDFRKFSHYYEVPSYLHF-PNITHNTRRILQQIIHNGILVDNWISITKPHQLYQSSNEPENVSKRMRFLVKMKNITLIDKNGFKINISKTILTSIQQWLIEESKCQVEYHWQELNETYWPRWVKKGLCVNIKSCSWPPGMNCSPNSYRKLSLLQWICAEXXXXXXXXXXXXXXXXXXXXXXXXQXXXXXXXXXXXXRWLRLPRKLEESQSNAIKIRLRLFKLSLYTEGFYCKWREVHYRVIQTCSCNC 820
            E +S N       + Y++P    F PN+T N  + L+QI+    L D+WIS   P Q+Y   N  + V  R++FLVKMKN T  D+ G K+ +S  ++ S ++WL +ES C ++Y W EL+ ++WPRWVKKG+CV++ SCSWPPGMNC     +KL+LLQW C  D  K KYK D + ++  ++IR KRQN  +  +  S KR  R  RK+  S+S  +K + R+ KL  + + FYCKW++V Y+VI+ CSC C
Sbjct:   35 ETESSNVIIVPVRNSYQLPRTNKFYPNVTQNIAKTLRQILDQEQLFDDWISSRIPKQIYIPFNGTKQVDVRIQFLVKMKNYTFKDRKGNKLYLSPNVVDSFRRWLEQESSCPMDYIWTELDPSFWPRWVKKGICVSVVSCSWPPGMNCKSKHKKKLTLLQWNCEIDPDKSKYKADTMQMRSIKRIRVKRQNKLHKRRNTSSKR--RGVRKVMTSKSKELKNKKRILKLREHIDDFYCKWKKVTYQVIEFCSCYC 286          
BLAST of noggin-like protein 3 vs. TrEMBL
Match: C1JAC5 (Noggin-like protein 5 OS=Schmidtea mediterranea OX=79327 GN=nlg5 PE=2 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 2.474e-45
Identity = 94/240 (39.17%), Postives = 143/240 (59.58%), Query Frame = 2
Query:  101 HYYEVPSYLHFPNITHNTRRILQQIIHNGILVDNWISITKPHQLYQSSNEPENVSKRMRFLVKMKNITLIDKNGFKINISKTILTSIQQWLIEESKCQVEYHWQELNETYWPRWVKKGLCVNIKSCSWPPGMNCSPNSYRKLSLLQWICAEXXXXXXXXXXXXXXXXXXXXXXXXQXXXXXXXXXXXXRWLRLPRKLEESQSNAIKIRLRLFKLSLYTEGFYCKWREVHYRVIQTCSCNC 820
            ++ E+      PN++ +  + L++I+ +  L DNW+++TKP ++Y   N    +  R+R L+KMKN    +K G K+N++  IL SI+ WL EES CQ+EY W EL  ++WPRW+KKGLCV++ SCSWPPGM+C     + L LLQ+ C ED  K KY  D+  ++  R  R+KRQ    N K    +      R++   +   ++ ++ +F L  Y  GFYCKW +  Y V + CSC+C
Sbjct:   67 NFNEIIVTNFIPNLSPSIDKKLKKILDSDHLFDNWLALTKPAEIYIPLNGTNKIDSRLRNLIKMKNFVFKNKRGEKMNLTSDILDSIKLWLEEESSCQMEYIWHELEPSFWPRWIKKGLCVSLTSCSWPPGMSCKAKKTKNLDLLQFRCEEDPKKIKYDADERAMQQLRLTRQKRQYKIYNRKRGVFQGRSNNSRRVVTKREKEVRTKMLIFSLREYMNGFYCKWVKTLYYVNELCSCSC 306          
BLAST of noggin-like protein 3 vs. TrEMBL
Match: T1D134 (Nlg1 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 2.291e-35
Identity = 83/237 (35.02%), Postives = 145/237 (61.18%), Query Frame = 2
Query:  125 LHFPNITHNTRRILQQIIHNGILVD-NWISITKPHQLYQSSNEPENVSKRMRFLVKMKNITLIDKNGFKINISKTILTSIQQWLIEESKCQVEYHWQELNETYWPRWVKKGLCVNIKSCSWPPGMNCSPNSYRKLSLLQWICAEXXXXXX---XXXXXXXXXXXXXXXXXXQXXXXXXXXXXXXRWLRLPRKLEESQSNAIKIRLR-LFKLSLYTEGFYCKWREVHYRVIQTCSCNC 820
             H  + ++NT+ +  + I  G   D  W+SI +P ++++S+N  +  S+ +  L   KN TL+D+ G ++ I K I T+I++W++E++ C+VEY W++L+  +WP W+K G+C + +SCSWPPGM+C   S++K  +L+WIC  D    K   +++  L ++ +R + RKR++    S    ++R L  P + +  +    K RLR  +K S Y +GF+C+W  V Y V++TC C+C
Sbjct:   38 FHPDDNSYNTKHL--KAIMGGKNYDVTWMSINRPPKIFESANFSKPPSRNLLMLSNFKNYTLVDEVGNEMKIPKNISTAIRRWIVEQASCRVEYVWKKLDALHWPSWIKHGICSSKESCSWPPGMSCRNESHKKFKILKWICNSDPFAHKWNEFREKFLQLRKSRLLNRKRRHNLKKSNLVKQRRGLNFPNRSKRDE----KKRLRYAYKTSKYVQGFFCQWEPVDYSVVETCMCSC 268          
BLAST of noggin-like protein 3 vs. TrEMBL
Match: Q8MY69 (Noggin like protein OS=Dugesia japonica OX=6161 GN=Djnlg PE=2 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 5.751e-32
Identity = 73/232 (31.47%), Postives = 136/232 (58.62%), Query Frame = 2
Query:  128 HFPNITHNTRRILQQIIHNGILVDNWISITKPHQLYQSSNEPENVSKRMRFLVKMKNITLIDKNGFKINISKTILTSIQQWLIEESKCQVEYHWQELNETYWPRWVKKGLCVNIKSCSWPPGMNCSPNSYRKLSLLQWIC-AEXXXXXXXXXXXXXXXXXXXXXXXXQXXXXXXXXXXXXRWLRLPRKLEESQSNAIKIRLRLFKLSLYTEGFYCKWREVHYRVIQTCSCNC 820
            H P       ++LQ+I+       +W+SI  P ++Y+ +N     +K +  L+  KN+TL D+NG  IN SK + ++I++W+++++ C+++Y W+ L++T+WP ++K G+C + +SCSWPPGMNC PN  + L +L+W C ++   K   +  + +    RK R +R  I  +   K K   +  P++++        ++  L++ S Y  G+ C+W+ + Y V Q+C+C+C
Sbjct:   44 HVPGENALNVKLLQKILGKRNYDFSWMSINTPSKIYEPANIDIPNNKLLDVLLSFKNLTLTDENGQLINTSKNLESAIRRWMVQQAACKIDYLWKRLDDTHWPSFIKHGVCNSRESCSWPPGMNCRPNDQKLLKILKWTCISDPLGKRWNEFRESIFADKRKRRLRRHKIKRHLSQKRKTNKVIRPKRMKR------LVKRYLYRTSKYVSGYLCQWKPIDYTVHQSCTCSC 269          
BLAST of noggin-like protein 3 vs. Ensembl Cavefish
Match: nog3 (noggin 3 [Source:NCBI gene;Acc:30173])

HSP 1 Score: 68.5514 bits (166), Expect = 4.065e-13
Identity = 32/70 (45.71%), Postives = 42/70 (60.00%), Query Frame = 2
Query:  338 SKTILTSIQQWLIEESKCQVEYHWQELNETYWPRWVKKGLCVNIKSCSWPPGMNCSPNSYRKLSLLQWIC 547
            SK +   +Q WL   + C V Y WQ+L   +WPR+VK G C + +SCS P GM CSP     L+LL+W C
Sbjct:  103 SKKMRRRLQLWLWSYTFCPVVYAWQDLGSRFWPRYVKVGSCASKRSCSVPEGMVCSPAKSAHLTLLRWYC 172          
BLAST of noggin-like protein 3 vs. Ensembl Cavefish
Match: ENSAMXT00000051007.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000650.1:142689:143405:-1 gene:ENSAMXG00000039724.1 transcript:ENSAMXT00000051007.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.7658 bits (138), Expect = 2.490e-9
Identity = 24/58 (41.38%), Postives = 35/58 (60.34%), Query Frame = 2
Query:  377 EESKCQVEYHWQELNETYWPRWVKKGLCVNIKSCSWPPGMNCSPNSYRKLSLLQWICA 550
            E + C V   W +L   +WPR+V+ G C   +SCS P GM C+P +   ++LL+W CA
Sbjct:  125 ERALCPVVQTWSDLGARFWPRYVRMGSCSRERSCSVPAGMLCTPAASTHVTLLRWRCA 182          
BLAST of noggin-like protein 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009391.1 (pep scaffold:Pmarinus_7.0:GL476782:173121:173762:-1 gene:ENSPMAG00000008500.1 transcript:ENSPMAT00000009391.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.9518 bits (193), Expect = 1.842e-17
Identity = 43/166 (25.90%), Postives = 76/166 (45.78%), Query Frame = 2
Query:   92 KFSHYYEVPSYLHFPNITHNTRRILQQIIHN--GILVDN-WISITKPHQ---------LYQSSNEPENVSKRMRFLVKMKNITLIDKNGFKINISKTILTSIQQWLIEESKCQVEYHWQELNETYWPRWVKKGLC--VNIKSCSWPPGMNCSPNSYRKLSLLQWIC 547
             FS  Y   +YL+FP      R +    +HN  G   D  W+S+ +P           L   S+      +++    +  N T++  +G  +  ++     + +WL+++++C V   W +L   +WPRWV++  C       CSWP GM+C+P     + +L W C
Sbjct:   10 AFSFPYREDNYLYFPK----QRDLKSARLHNILGSSFDPFWMSVKRPSSSSTTGDIGALATRSSAVTAAGRKLHAAARALNFTVLTDSGAAVAATEATAAFMTRWLLQKAECGVASSWHDLGSVFWPRWVRRSHCEESGGGGCSWPAGMSCAPAQSTHIKILAWHC 171          
BLAST of noggin-like protein 3 vs. Ensembl Sea Lamprey
Match: nog3 (noggin 3 [Source:NCBI gene;Acc:30173])

HSP 1 Score: 72.7886 bits (177), Expect = 4.018e-15
Identity = 35/77 (45.45%), Postives = 46/77 (59.74%), Query Frame = 2
Query:  317 NGFKINISKTILTSIQQWLIEESKCQVEYHWQELNETYWPRWVKKGLCVNIKSCSWPPGMNCSPNSYRKLSLLQWIC 547
            +G KI I K     I QWL   + C V Y W++L E +WPR+VK+G C N +SCS+P GM C P      +LL+W C
Sbjct:  119 HGQKIKIGKRARRKILQWLWSYTFCPVLYTWKDLGERFWPRFVKEGSCYNGRSCSFPEGMACKPFKSASKTLLRWHC 195          
BLAST of noggin-like protein 3 vs. Ensembl Sea Lamprey
Match: nog2 (noggin 2 [Source:NCBI gene;Acc:30185])

HSP 1 Score: 68.5514 bits (166), Expect = 1.548e-13
Identity = 30/76 (39.47%), Postives = 43/76 (56.58%), Query Frame = 2
Query:  320 GFKINISKTILTSIQQWLIEESKCQVEYHWQELNETYWPRWVKKGLCVNIKSCSWPPGMNCSPNSYRKLSLLQWIC 547
            G K+ + K       QWL   + C V Y W+ELN  +WPR++K+G C + +SCS P GM C P  +   + L+W C
Sbjct:  131 GQKLKLGKRARRKFLQWLWAHTACPVVYSWKELNVRFWPRYIKEGSCYSARSCSVPEGMVCKPVKFSNKTFLRWHC 206          
BLAST of noggin-like protein 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011420.1 (pep scaffold:Pmarinus_7.0:GL487123:1955:2662:1 gene:ENSPMAG00000010393.1 transcript:ENSPMAT00000011420.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.151 bits (139), Expect = 4.785e-10
Identity = 25/80 (31.25%), Postives = 44/80 (55.00%), Query Frame = 2
Query:  311 DKNGFKIN-ISKTILTSIQQWLIEESKCQVEYHWQELNETYWPRWVKKGLCVNIKSCSWPPGMNCSPNSYRKLSLLQWIC 547
            D  G +   + +     +Q +L   ++C V Y W++L   +WPR+V++G C + +SCS P GM+C        ++L+W C
Sbjct:  130 DPRGSRAGALGRKARRKMQLFLWAYTQCPVAYAWKDLGGRFWPRYVREGSCQSGRSCSIPAGMSCKAQRSTSKAILRWYC 209          
BLAST of noggin-like protein 3 vs. Ensembl Nematostella
Match: EDO36952 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SH36])

HSP 1 Score: 53.1434 bits (126), Expect = 5.445e-9
Identity = 25/76 (32.89%), Postives = 39/76 (51.32%), Query Frame = 2
Query:  320 GFKINISKTILTSIQQWLIEESKCQVEYHWQELNETYWPRWVKKGLCVNIKSCSWPPGMNCSPNSYRKLSLLQWIC 547
            G   N+       +Q WL E S C V   W++  +  WPR+   G C    +CS+P GM C  +  ++++LL+W C
Sbjct:   15 GEGRNLGPKASRKLQLWLWELSSCPVYQKWKDQGQLIWPRYRNIGRCSRKSTCSYPGGMKCKRSKTKRVALLRWFC 90          
BLAST of noggin-like protein 3 vs. Ensembl Nematostella
Match: EDO36981 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SH37])

HSP 1 Score: 52.7582 bits (125), Expect = 8.349e-9
Identity = 23/73 (31.51%), Postives = 42/73 (57.53%), Query Frame = 2
Query:  335 ISKTILTSIQQWLIEESKCQVEYHWQELNETYWPRWVKKGLCVNIKSCSWPPGMNCSPNSYRKLSLLQWICAE 553
            +S+ +   +  WL++   C V Y W+++   +WPR+VK+  C + K CS  P   C P++ R  ++L+W C +
Sbjct:    1 LSREMERFMMGWLLQRENCPVVYSWRDMGPHFWPRFVKRATCKS-KQCSIDPSTQCEPSNSRYFNILRWHCMD 72          
BLAST of noggin-like protein 3 vs. Ensembl Medaka
Match: nog1 (noggin 1 [Source:NCBI gene;Acc:30174])

HSP 1 Score: 69.3218 bits (168), Expect = 3.458e-13
Identity = 41/127 (32.28%), Postives = 69/127 (54.33%), Query Frame = 2
Query:  185 GILVDNWISITKPHQLYQSSN-EPENVSKRMRFLVKMKNITLID---KNGFKINISKTILTSIQQWLIEESKCQVEYHWQELNETYWPRWVKKGLCVNIKSCSWPPGMNCSPNSYRKLSLLQWICAE 553
            G     ++S++ P ++  ++N E ++ + +    +  K I  +D   ++G K   SK +   +QQWL   S C V Y W +L   +WPR+V+ G C++ +SCS P GM C P S   L+ L+W C +
Sbjct:   75 GDFDSRFLSVSPPVEVKHAANDELDDFALQRAGGIMPKEIRAVDFDLQSGKKHKPSKKLKRRLQQWLWAYSFCPVLYSWTDLGNRFWPRFVRVGSCLSKRSCSVPEGMVCKPASSTHLTTLRWRCVQ 201          
BLAST of noggin-like protein 3 vs. Ensembl Medaka
Match: nog2 (noggin 2 [Source:NCBI gene;Acc:30185])

HSP 1 Score: 67.781 bits (164), Expect = 1.132e-12
Identity = 43/157 (27.39%), Postives = 78/157 (49.68%), Query Frame = 2
Query:   98 SHYYEVPSYLHFPNITHNTR------RILQQIIHNGILVDNWISITKPHQLYQSSNEPENVSKRMRFLVKMKNITLIDKN-GFKINISKTILTSIQQWLIEESKCQVEYHWQELNETYWPRWVKKGLCVNIKSCSWPPGMNCSPNSYRKLSLLQWIC 547
            S +  VP     P+  ++ R      R L++ + +     N++SI+ P Q+  S+++   V  +     ++K + L +   G ++ + K       QWL   + C V Y W++L   +WPR++K+G C + +SCS+P GM+C P        L+W C
Sbjct:   35 SDHLPVPDLREDPDPEYDPREQDLAERTLRKKLGSN-FDPNFMSISSPLQVNLSASD-YQVKLQGPMPNEIKKLDLTETPYGKRVKVGKKARRKFLQWLWTYTHCPVVYTWKDLGVRFWPRYIKEGKCFSERSCSFPEGMSCKPAKSINKIFLRWYC 189          
BLAST of noggin-like protein 3 vs. Planmine SMEST
Match: SMESG000007613.1 (SMESG000007613.1)

HSP 1 Score: 479.559 bits (1233), Expect = 5.395e-171
Identity = 271/274 (98.91%), Postives = 272/274 (99.27%), Query Frame = 2
Query:    2 MNLQIIFFLFLKFCNIKFTTEGKSKNKDFRKFSHYYEVPSYLHFPNITHNTRRILQQIIHNGILVDNWISITKPHQLYQSSNEPENVSKRMRFLVKMKNITLIDKNGFKINISKTILTSIQQWLIEESKCQVEYHWQELNETYWPRWVKKGLCVNIKSCSWPPGMNCSPNSYRKLSLLQWICAEXXXXXXXXXXXXXXXXXXXXXXXXQXXXXXXXXXXXXRWLRLPRKLEESQSNAIKIRLRLFKLSLYTEGFYCKWREVHYRVIQTCSCNCS 823
            MNLQIIFFLFLKFCNIKFTTEGKSKNKDFRKFSHYYEVPSYLHFPNITHNTRRILQQIIHNGILVDNWISITKPHQLYQSSNEPENVSKRMRFLVKMKNITLIDKNGFKINISKTILTSIQQWLIEESKCQVEYHWQELNETYWPRWVKKGLCVNIKSCSWPPGMNCSPNSYRKLSLLQWICAEDK K+KYKDDKLLIKIARKIRRKRQNI NNSKFKSKKRWLRLPRKLEESQSNAIKIRLRLFKLSLYTEGFYCKWREVHYRVIQTCSCNCS
Sbjct:    1 MNLQIIFFLFLKFCNIKFTTEGKSKNKDFRKFSHYYEVPSYLHFPNITHNTRRILQQIIHNGILVDNWISITKPHQLYQSSNEPENVSKRMRFLVKMKNITLIDKNGFKINISKTILTSIQQWLIEESKCQVEYHWQELNETYWPRWVKKGLCVNIKSCSWPPGMNCSPNSYRKLSLLQWICAEDKRKEKYKDDKLLIKIARKIRRKRQNIYNNSKFKSKKRWLRLPRKLEESQSNAIKIRLRLFKLSLYTEGFYCKWREVHYRVIQTCSCNCS 274          
BLAST of noggin-like protein 3 vs. Planmine SMEST
Match: SMESG000034700.1 (SMESG000034700.1)

HSP 1 Score: 383.259 bits (983), Expect = 5.851e-134
Identity = 184/184 (100.00%), Postives = 184/184 (100.00%), Query Frame = 2
Query:    2 MNLQIIFFLFLKFCNIKFTTEGKSKNKDFRKFSHYYEVPSYLHFPNITHNTRRILQQIIHNGILVDNWISITKPHQLYQSSNEPENVSKRMRFLVKMKNITLIDKNGFKINISKTILTSIQQWLIEESKCQVEYHWQELNETYWPRWVKKGLCVNIKSCSWPPGMNCSPNSYRKLSLLQWICAE 553
            MNLQIIFFLFLKFCNIKFTTEGKSKNKDFRKFSHYYEVPSYLHFPNITHNTRRILQQIIHNGILVDNWISITKPHQLYQSSNEPENVSKRMRFLVKMKNITLIDKNGFKINISKTILTSIQQWLIEESKCQVEYHWQELNETYWPRWVKKGLCVNIKSCSWPPGMNCSPNSYRKLSLLQWICAE
Sbjct:    1 MNLQIIFFLFLKFCNIKFTTEGKSKNKDFRKFSHYYEVPSYLHFPNITHNTRRILQQIIHNGILVDNWISITKPHQLYQSSNEPENVSKRMRFLVKMKNITLIDKNGFKINISKTILTSIQQWLIEESKCQVEYHWQELNETYWPRWVKKGLCVNIKSCSWPPGMNCSPNSYRKLSLLQWICAE 184          
BLAST of noggin-like protein 3 vs. Planmine SMEST
Match: SMESG000034689.1 (SMESG000034689.1)

HSP 1 Score: 179.874 bits (455), Expect = 1.757e-53
Identity = 110/254 (43.31%), Postives = 159/254 (62.60%), Query Frame = 2
Query:   62 EGKSKNKDFRKFSHYYEVPSYLHF-PNITHNTRRILQQIIHNGILVDNWISITKPHQLYQSSNEPENVSKRMRFLVKMKNITLIDKNGFKINISKTILTSIQQWLIEESKCQVEYHWQELNETYWPRWVKKGLCVNIKSCSWPPGMNCSPNSYRKLSLLQWICAEXXXXXXXXXXXXXXXXXXXXXXXXQXXXXXXXXXXXXRWLRLPRKLEESQSNAIKIRLRLFKLSLYTEGFYCKWREVHYRVIQTCSCNC 820
            E +S N       + Y++P    F PN+T N  + L+QI+    L D+WIS   P Q+Y   N  + V  R++FLVKMKN T  D+ G K+ +S  ++ S ++WL +ES C ++Y W EL+ ++WPRWVKKG+CV++ SCSWPPGMNC     +KL+LLQW C  D  K KYK D + ++  ++IR KRQN  +  +  S KR  R  RK+  S+S  +K + R+ KL  + + FYCKW++V Y+VI+ CSC C
Sbjct:   35 ETESSNVIIVPVRNSYQLPRTNKFYPNVTQNIAKTLRQILDQEQLFDDWISSRIPKQIYIPFNGTKQVDVRIQFLVKMKNYTFKDRKGNKLYLSPNVVDSFRRWLEQESSCPMDYIWTELDPSFWPRWVKKGICVSVVSCSWPPGMNCKSKHKKKLTLLQWNCEIDPDKSKYKADTMQMRSIKRIRVKRQNKLHKRRNTSSKR--RGVRKVMTSKSKELKNKKRILKLREHIDDFYCKWKKVTYQVIEFCSCYC 286          
BLAST of noggin-like protein 3 vs. Planmine SMEST
Match: SMESG000034679.1 (SMESG000034679.1)

HSP 1 Score: 179.874 bits (455), Expect = 1.757e-53
Identity = 110/254 (43.31%), Postives = 159/254 (62.60%), Query Frame = 2
Query:   62 EGKSKNKDFRKFSHYYEVPSYLHF-PNITHNTRRILQQIIHNGILVDNWISITKPHQLYQSSNEPENVSKRMRFLVKMKNITLIDKNGFKINISKTILTSIQQWLIEESKCQVEYHWQELNETYWPRWVKKGLCVNIKSCSWPPGMNCSPNSYRKLSLLQWICAEXXXXXXXXXXXXXXXXXXXXXXXXQXXXXXXXXXXXXRWLRLPRKLEESQSNAIKIRLRLFKLSLYTEGFYCKWREVHYRVIQTCSCNC 820
            E +S N       + Y++P    F PN+T N  + L+QI+    L D+WIS   P Q+Y   N  + V  R++FLVKMKN T  D+ G K+ +S  ++ S ++WL +ES C ++Y W EL+ ++WPRWVKKG+CV++ SCSWPPGMNC     +KL+LLQW C  D  K KYK D + ++  ++IR KRQN  +  +  S KR  R  RK+  S+S  +K + R+ KL  + + FYCKW++V Y+VI+ CSC C
Sbjct:   35 ETESSNVIIVPVRNSYQLPRTNKFYPNVTQNIAKTLRQILDQEQLFDDWISSRIPKQIYIPFNGTKQVDVRIQFLVKMKNYTFKDRKGNKLYLSPNVVDSFRRWLEQESSCPMDYIWTELDPSFWPRWVKKGICVSVVSCSWPPGMNCKSKHKKKLTLLQWNCEIDPDKSKYKADTMQMRSIKRIRVKRQNKLHKRRNTSSKR--RGVRKVMTSKSKELKNKKRILKLREHIDDFYCKWKKVTYQVIEFCSCYC 286          
BLAST of noggin-like protein 3 vs. Planmine SMEST
Match: SMESG000007405.1 (SMESG000007405.1)

HSP 1 Score: 168.318 bits (425), Expect = 3.021e-49
Identity = 93/230 (40.43%), Postives = 139/230 (60.43%), Query Frame = 2
Query:  131 FPNITHNTRRILQQIIHNGILVDNWISITKPHQLYQSSNEPENVSKRMRFLVKMKNITLIDKNGFKINISKTILTSIQQWLIEESKCQVEYHWQELNETYWPRWVKKGLCVNIKSCSWPPGMNCSPNSYRKLSLLQWICAEXXXXXXXXXXXXXXXXXXXXXXXXQXXXXXXXXXXXXRWLRLPRKLEESQSNAIKIRLRLFKLSLYTEGFYCKWREVHYRVIQTCSCNC 820
             PN++ +  + L++I+ +  L DNW+++TKP ++Y   N    +  R+R L+KMKN    +K G K+N++  IL SI+ WL EES CQ+EY W EL  ++WPRW+KKGLCV++ SCSWPPGM+C     + L LLQ+ C ED  K KY  D+  ++  R  R+KRQ    N K    +      R++   +   ++ ++ +F L  Y  GFYCKW +  Y V + CSC+C
Sbjct:   37 IPNLSPSIDKKLKKILDSDHLFDNWLALTKPAEIYIPLNGTNKIDSRLRNLIKMKNFVFKNKRGEKMNLTSDILDSIKLWLEEESSCQMEYIWHELEPSFWPRWIKKGLCVSLTSCSWPPGMSCKAKKTKNLDLLQFRCEEDPKKIKYDADERAMQQLRLTRQKRQYKIYNRKRGVFQGRSNNSRRVVTKREKEVRTKMLIFSLREYMNGFYCKWVKTLYYVNELCSCSC 266          
The following BLAST results are available for this feature:
BLAST of noggin-like protein 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
NOG3.317e-1240.26noggin [Source:HGNC Symbol;Acc:HGNC:7866][more]
back to top
BLAST of noggin-like protein 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of noggin-like protein 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of noggin-like protein 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nog21.080e-1429.75noggin 2 [Source:NCBI gene;Acc:30185][more]
nog33.272e-1333.33noggin 3 [Source:NCBI gene;Acc:30173][more]
nog33.335e-1333.33noggin 3 [Source:NCBI gene;Acc:30173][more]
nog33.335e-1333.33noggin 3 [Source:NCBI gene;Acc:30173][more]
nog12.332e-1130.40noggin 1 [Source:NCBI gene;Acc:30174][more]
back to top
BLAST of noggin-like protein 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nog41.673e-1136.84noggin 4 [Source:NCBI gene;Acc:733455][more]
acad101.940e-1130.51acyl-CoA dehydrogenase family member 10 [Source:Xe... [more]
nog5.102e-1138.96noggin [Source:NCBI gene;Acc:493191][more]
back to top
BLAST of noggin-like protein 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Nog2.172e-1240.26noggin [Source:MGI Symbol;Acc:MGI:104327][more]
back to top
BLAST of noggin-like protein 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9W740|NOGG2_DANRE8.155e-1429.75Noggin-2 OS=Danio rerio OX=7955 GN=nog2 PE=2 SV=1[more]
sp|Q9YHV3|NOGG3_DANRE3.286e-1233.33Noggin-3 OS=Danio rerio OX=7955 GN=nog3 PE=1 SV=1[more]
sp|P97466|NOGG_MOUSE1.519e-1140.26Noggin OS=Mus musculus OX=10090 GN=Nog PE=2 SV=1[more]
sp|Q13253|NOGG_HUMAN1.593e-1140.26Noggin OS=Homo sapiens OX=9606 GN=NOG PE=1 SV=1[more]
sp|O93525|NOGG_CHICK2.436e-1137.08Noggin OS=Gallus gallus OX=9031 GN=NOG PE=2 SV=1[more]
back to top
BLAST of noggin-like protein 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C1JAC34.864e-16799.27Noggin-like protein 3 OS=Schmidtea mediterranea OX... [more]
C1JAC26.318e-5043.31Noggin-like protein 2 OS=Schmidtea mediterranea OX... [more]
C1JAC52.474e-4539.17Noggin-like protein 5 OS=Schmidtea mediterranea OX... [more]
T1D1342.291e-3535.02Nlg1 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
Q8MY695.751e-3231.47Noggin like protein OS=Dugesia japonica OX=6161 GN... [more]
back to top
BLAST of noggin-like protein 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nog34.065e-1345.71noggin 3 [Source:NCBI gene;Acc:30173][more]
ENSAMXT00000051007.12.490e-941.38pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of noggin-like protein 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000009391.11.842e-1725.90pep scaffold:Pmarinus_7.0:GL476782:173121:173762:-... [more]
nog34.018e-1545.45noggin 3 [Source:NCBI gene;Acc:30173][more]
nog21.548e-1339.47noggin 2 [Source:NCBI gene;Acc:30185][more]
ENSPMAT00000011420.14.785e-1031.25pep scaffold:Pmarinus_7.0:GL487123:1955:2662:1 gen... [more]
back to top
BLAST of noggin-like protein 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of noggin-like protein 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO369525.445e-932.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO369818.349e-931.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of noggin-like protein 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nog13.458e-1332.28noggin 1 [Source:NCBI gene;Acc:30174][more]
nog21.132e-1227.39noggin 2 [Source:NCBI gene;Acc:30185][more]
back to top
BLAST of noggin-like protein 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000007613.15.395e-17198.91SMESG000007613.1[more]
SMESG000034700.15.851e-134100.00SMESG000034700.1[more]
SMESG000034689.11.757e-5343.31SMESG000034689.1[more]
SMESG000034679.11.757e-5343.31SMESG000034679.1[more]
SMESG000007405.13.021e-4940.43SMESG000007405.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30005036
GenBankACO06228.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005036 ID=SMED30005036|Name=noggin-like protein 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1240bp
TATGAATCTTCAAATAATATTTTTCTTATTTCTGAAATTTTGTAACATTA
AATTTACAACTGAAGGTAAATCTAAAAATAAAGATTTTAGAAAATTTTCA
CATTACTATGAAGTGCCTTCCTACCTACACTTTCCAAATATTACACATAA
CACAAGAAGAATTTTGCAACAGATAATTCACAATGGAATCTTAGTTGACA
ATTGGATTTCAATTACCAAACCCCATCAACTCTATCAATCGTCAAATGAA
CCTGAGAATGTTTCTAAACGAATGAGATTTCTAGTAAAAATGAAAAATAT
CACTTTAATTGATAAAAACGGATTCAAAATTAACATTTCAAAAACAATCC
TAACATCAATTCAACAATGGTTAATTGAAGAGTCAAAATGTCAAGTTGAA
TATCACTGGCAAGAACTAAACGAAACCTATTGGCCAAGATGGGTGAAAAA
GGGATTATGCGTAAATATCAAATCTTGTTCGTGGCCTCCGGGTATGAACT
GTAGTCCGAATTCTTACAGAAAACTAAGCTTACTTCAGTGGATATGTGCC
GAAGATAAAAGCAAGGATAAATACAAAGATGACAAATTACTAATCAAAAT
TGCGAGAAAAATTCGCAGAAAAAGGCAAAATATTTCTAATAATTCCAAAT
TCAAATCTAAGAAGCGTTGGCTTCGTTTACCTAGAAAATTGGAAGAAAGC
CAATCCAATGCAATCAAAATCCGACTACGACTTTTCAAATTAAGTCTTTA
CACTGAAGGTTTTTATTGTAAATGGAGGGAAGTCCACTATCGTGTTATTC
AAACTTGTTCATGCAATTGTTCATAAGTGGATCAGACTAATCAACTTTCA
GAATGATTCCGAAGGGATGTGGCGAAGCATCACGCGGAGGGAATAGCTCA
AAATCAACGGGTTGAGGCGCTGGTACGTCGATGTCAGCGAATAAAGCAGA
CGTGGATGAGGCCTAAGGAGGTGGACTCGTGCGGTGTGGCAGATAGTTGT
CACCCGAGCAGGAGGCTATCATCATCAGGAATGTAATTGGCAAAGATATA
GAAGGGACTATCACTACGCCCGAAAATCCACACCCATCCAAAGTAAAGCC
CAAGAGAAATCTGCAGAAAGCTTGGCCTGGTAAGCGCGAGTGAGAACGTC
AGAACAAATTAAAAGCTGCTCGAATGGTTGGGCATATCCTCAAGCCAAAC
GGGATTTGAGTGTCTCAAAACTATGTTATTGACAGAAATT
back to top

protein sequence of SMED30005036-orf-1

>SMED30005036-orf-1 ID=SMED30005036-orf-1|Name=SMED30005036-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=275bp
MNLQIIFFLFLKFCNIKFTTEGKSKNKDFRKFSHYYEVPSYLHFPNITHN
TRRILQQIIHNGILVDNWISITKPHQLYQSSNEPENVSKRMRFLVKMKNI
TLIDKNGFKINISKTILTSIQQWLIEESKCQVEYHWQELNETYWPRWVKK
GLCVNIKSCSWPPGMNCSPNSYRKLSLLQWICAEDKSKDKYKDDKLLIKI
ARKIRRKRQNISNNSKFKSKKRWLRLPRKLEESQSNAIKIRLRLFKLSLY
TEGFYCKWREVHYRVIQTCSCNCS*
back to top
Aliases
The feature 'noggin-like protein 3' has the following synonyms
Synonym
nlg-3
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR029034Cystine-knot_cytokine
Vocabulary: biological process
TermDefinition
GO:0030514negative regulation of BMP signaling pathway
GO:0045596negative regulation of cell differentiation