Metabotropic glutamate receptor

Overview
NameMetabotropic glutamate receptor
Smed IDSMED30005030
Length (bp)2907
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005030

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30005030SMESG000022915.1 GCR106smed_ncbi_20200123PMID:27163480
Saberi et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
cement glandSMED30005030SMESG000022915.1 GCR106smed_ncbi_20200123PMID:27163480
Saberi et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Metabotropic glutamate receptor vs. Ensembl Human
Match: GRM8 (glutamate metabotropic receptor 8 [Source:HGNC Symbol;Acc:HGNC:4600])

HSP 1 Score: 520.005 bits (1338), Expect = 1.882e-169
Identity = 310/846 (36.64%), Postives = 471/846 (55.67%), Query Frame = 3
Query:  129 IDGDIFLGGLMMVHLRSEEMV-CGVIAAEGGIQALEVMVYTINRVN-EMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIK---QSSKLQTKSNCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKD-NRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEI-EGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITF----DGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFI-FVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDP---------VTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAI---MVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGLR 2594
            +DGDI LGGL  VH + E  V CG +  E GI  LE M+Y I+++N +  +L +I LG  I D C RDTY LEQ++ F++   +      K    +  I +    I+GVIGA++S  SI VA++L+LF IPQIS+ ST+P LS+  R+ FF R +P D++Q Q M++I+  L W YVS +  + NYG    +A  ++ ++   +CIA S+ +PR+ +     E++  + RL       +   A  VI+F ++ ++   + A K+ N +  F W+GSD W G ++A         +++EI EGA+ I P   ++ GF+ YF + T + N+ N WF EFWE+ F CKL   S    N+    C    ++++D+  +  E ++QFV DAV + A AL  M   +C   I    C  M    G+ LL  ++ + F   +G     TP+TF    D   RY I  + +  N    +  IG++TNQ L +    +++       P S C+  C   +RKK   G+  CW C +C+ Y  ++     CE CPL Q P+ NRT C  +  I L    P ++ + +F  I  IIA T   + FV Y  TPIV+AS RELS++LL GI LC+ ++ ++   P  ++CSF++  +G      Y+ALL K NRI RIF +G+K     + IS  SQ+ I   ++S+Q  +LG  ++FV   P          T  P +    L CD I   SL+  + + ++L++ CTVYA  TR +PE FNE+K IGFTMY+TC++WL FIP +  TA     ++++  TL VS+++SA V+L  L+ PKVY I+F P+QNV+K  R
Sbjct:   42 VDGDIILGGLFPVHAKGERGVPCGELKKEKGIHRLEAMLYAIDQINKDPDLLSNITLGVRILDTCSRDTYALEQSLTFVQALIEKDASDVKCANGDPPIFTKPDKISGVIGAAASSVSIMVANILRLFKIPQISYASTAPELSDNTRYDFFSRVVPPDSYQAQAMVDIVTALGWNYVSTLASEGNYGESGVEAFTQISREIGGVCIAQSQKIPREPRPG---EFEKIIKRL------LETPNARAVIMFANEDDIRRILEAAKKLNQSGHFLWIGSDSW-GSKIA------PVYQQEEIAEGAVTILPKRASIDGFDRYFRSRTLANNRRNVWFAEFWEENFGCKL--GSHGKRNSHIKKCTGLERIARDS-SYEQEGKVQFVIDAVYSMAYALHNMHKDLCPGYI--GLCPRMSTIDGKELLGYIRAVNFNGSAG-----TPVTFNENGDAPGRYDIFQY-QITNKSTEYKVIGHWTNQ-LHLKVEDMQWAHREHTHPASVCSLPCKPGERKKTVKGVPCCWHCERCEGYN-YQVDELSCELCPLDQRPNMNRTGCQLIPIIKLEWHSPWAV-VPVFVAILGIIATTFVIVTFVRYNDTPIVRASGRELSYVLLTGIFLCYSITFLMIAAPDTIICSFRRVFLGLGMCFSYAALLTKTNRIHRIFEQGKKSVTAPKFISPASQLVITFSLISVQ--LLGVFVWFVVDPPHIIIDYGEQRTLDPEKARGVLKCD-ISDLSLICSLGYSILLMVTCTVYAIKTRGVPETFNEAKPIGFTMYTTCIIWLAFIPIFFGTAQSAEKMYIQTTTLTVSMSLSASVSLGMLYMPKVYIIIFHPEQNVQKRKR 854          
BLAST of Metabotropic glutamate receptor vs. Ensembl Human
Match: GRM8 (glutamate metabotropic receptor 8 [Source:HGNC Symbol;Acc:HGNC:4600])

HSP 1 Score: 519.62 bits (1337), Expect = 2.676e-169
Identity = 310/846 (36.64%), Postives = 471/846 (55.67%), Query Frame = 3
Query:  129 IDGDIFLGGLMMVHLRSEEMV-CGVIAAEGGIQALEVMVYTINRVN-EMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIK---QSSKLQTKSNCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKD-NRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEI-EGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITF----DGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFI-FVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDP---------VTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAI---MVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGLR 2594
            +DGDI LGGL  VH + E  V CG +  E GI  LE M+Y I+++N +  +L +I LG  I D C RDTY LEQ++ F++   +      K    +  I +    I+GVIGA++S  SI VA++L+LF IPQIS+ ST+P LS+  R+ FF R +P D++Q Q M++I+  L W YVS +  + NYG    +A  ++ ++   +CIA S+ +PR+ +     E++  + RL       +   A  VI+F ++ ++   + A K+ N +  F W+GSD W G ++A         +++EI EGA+ I P   ++ GF+ YF + T + N+ N WF EFWE+ F CKL   S    N+    C    ++++D+  +  E ++QFV DAV + A AL  M   +C   I    C  M    G+ LL  ++ + F   +G     TP+TF    D   RY I  + +  N    +  IG++TNQ L +    +++       P S C+  C   +RKK   G+  CW C +C+ Y  ++     CE CPL Q P+ NRT C  +  I L    P ++ + +F  I  IIA T   + FV Y  TPIV+AS RELS++LL GI LC+ ++ ++   P  ++CSF++  +G      Y+ALL K NRI RIF +G+K     + IS  SQ+ I   ++S+Q  +LG  ++FV   P          T  P +    L CD I   SL+  + + ++L++ CTVYA  TR +PE FNE+K IGFTMY+TC++WL FIP +  TA     ++++  TL VS+++SA V+L  L+ PKVY I+F P+QNV+K  R
Sbjct:   42 VDGDIILGGLFPVHAKGERGVPCGELKKEKGIHRLEAMLYAIDQINKDPDLLSNITLGVRILDTCSRDTYALEQSLTFVQALIEKDASDVKCANGDPPIFTKPDKISGVIGAAASSVSIMVANILRLFKIPQISYASTAPELSDNTRYDFFSRVVPPDSYQAQAMVDIVTALGWNYVSTLASEGNYGESGVEAFTQISREIGGVCIAQSQKIPREPRPG---EFEKIIKRL------LETPNARAVIMFANEDDIRRILEAAKKLNQSGHFLWIGSDSW-GSKIA------PVYQQEEIAEGAVTILPKRASIDGFDRYFRSRTLANNRRNVWFAEFWEENFGCKL--GSHGKRNSHIKKCTGLERIARDS-SYEQEGKVQFVIDAVYSMAYALHNMHKDLCPGYI--GLCPRMSTIDGKELLGYIRAVNFNGSAG-----TPVTFNENGDAPGRYDIFQY-QITNKSTEYKVIGHWTNQ-LHLKVEDMQWAHREHTHPASVCSLPCKPGERKKTVKGVPCCWHCERCEGYN-YQVDELSCELCPLDQRPNMNRTGCQLIPIIKLEWHSPWAV-VPVFVAILGIIATTFVIVTFVRYNDTPIVRASGRELSYVLLTGIFLCYSITFLMIAAPDTIICSFRRVFLGLGMCFSYAALLTKTNRIHRIFEQGKKSVTAPKFISPASQLVITFSLISVQ--LLGVFVWFVVDPPHIIIDYGEQRTLDPEKARGVLKCD-ISDLSLICSLGYSILLMVTCTVYAIKTRGVPETFNEAKPIGFTMYTTCIIWLAFIPIFFGTAQSAEKMYIQTTTLTVSMSLSASVSLGMLYMPKVYIIIFHPEQNVQKRKR 854          
BLAST of Metabotropic glutamate receptor vs. Ensembl Human
Match: GRM8 (glutamate metabotropic receptor 8 [Source:HGNC Symbol;Acc:HGNC:4600])

HSP 1 Score: 519.62 bits (1337), Expect = 2.676e-169
Identity = 310/846 (36.64%), Postives = 471/846 (55.67%), Query Frame = 3
Query:  129 IDGDIFLGGLMMVHLRSEEMV-CGVIAAEGGIQALEVMVYTINRVN-EMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIK---QSSKLQTKSNCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKD-NRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEI-EGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITF----DGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFI-FVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDP---------VTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAI---MVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGLR 2594
            +DGDI LGGL  VH + E  V CG +  E GI  LE M+Y I+++N +  +L +I LG  I D C RDTY LEQ++ F++   +      K    +  I +    I+GVIGA++S  SI VA++L+LF IPQIS+ ST+P LS+  R+ FF R +P D++Q Q M++I+  L W YVS +  + NYG    +A  ++ ++   +CIA S+ +PR+ +     E++  + RL       +   A  VI+F ++ ++   + A K+ N +  F W+GSD W G ++A         +++EI EGA+ I P   ++ GF+ YF + T + N+ N WF EFWE+ F CKL   S    N+    C    ++++D+  +  E ++QFV DAV + A AL  M   +C   I    C  M    G+ LL  ++ + F   +G     TP+TF    D   RY I  + +  N    +  IG++TNQ L +    +++       P S C+  C   +RKK   G+  CW C +C+ Y  ++     CE CPL Q P+ NRT C  +  I L    P ++ + +F  I  IIA T   + FV Y  TPIV+AS RELS++LL GI LC+ ++ ++   P  ++CSF++  +G      Y+ALL K NRI RIF +G+K     + IS  SQ+ I   ++S+Q  +LG  ++FV   P          T  P +    L CD I   SL+  + + ++L++ CTVYA  TR +PE FNE+K IGFTMY+TC++WL FIP +  TA     ++++  TL VS+++SA V+L  L+ PKVY I+F P+QNV+K  R
Sbjct:   42 VDGDIILGGLFPVHAKGERGVPCGELKKEKGIHRLEAMLYAIDQINKDPDLLSNITLGVRILDTCSRDTYALEQSLTFVQALIEKDASDVKCANGDPPIFTKPDKISGVIGAAASSVSIMVANILRLFKIPQISYASTAPELSDNTRYDFFSRVVPPDSYQAQAMVDIVTALGWNYVSTLASEGNYGESGVEAFTQISREIGGVCIAQSQKIPREPRPG---EFEKIIKRL------LETPNARAVIMFANEDDIRRILEAAKKLNQSGHFLWIGSDSW-GSKIA------PVYQQEEIAEGAVTILPKRASIDGFDRYFRSRTLANNRRNVWFAEFWEENFGCKL--GSHGKRNSHIKKCTGLERIARDS-SYEQEGKVQFVIDAVYSMAYALHNMHKDLCPGYI--GLCPRMSTIDGKELLGYIRAVNFNGSAG-----TPVTFNENGDAPGRYDIFQY-QITNKSTEYKVIGHWTNQ-LHLKVEDMQWAHREHTHPASVCSLPCKPGERKKTVKGVPCCWHCERCEGYN-YQVDELSCELCPLDQRPNMNRTGCQLIPIIKLEWHSPWAV-VPVFVAILGIIATTFVIVTFVRYNDTPIVRASGRELSYVLLTGIFLCYSITFLMIAAPDTIICSFRRVFLGLGMCFSYAALLTKTNRIHRIFEQGKKSVTAPKFISPASQLVITFSLISVQ--LLGVFVWFVVDPPHIIIDYGEQRTLDPEKARGVLKCD-ISDLSLICSLGYSILLMVTCTVYAIKTRGVPETFNEAKPIGFTMYTTCIIWLAFIPIFFGTAQSAEKMYIQTTTLTVSMSLSASVSLGMLYMPKVYIIIFHPEQNVQKRKR 854          
BLAST of Metabotropic glutamate receptor vs. Ensembl Human
Match: GRM7 (glutamate metabotropic receptor 7 [Source:HGNC Symbol;Acc:HGNC:4599])

HSP 1 Score: 518.85 bits (1335), Expect = 4.603e-169
Identity = 300/845 (35.50%), Postives = 458/845 (54.20%), Query Frame = 3
Query:  129 IDGDIFLGGLMMVHLRSEEMV-CGVIAAEGGIQALEVMVYTINRVN-EMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIK---QSSKLQTKSNCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKD-NRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTF-DGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITF----DGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDP---------VTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAI---MVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGLR 2594
            I+GD+ LGGL  VH +    V CG I  E GI  LE M+Y ++++N +  +L ++ LGA I D C RDTY LEQ++ F++   Q      +    E  +      + GVIGAS S  SI VA++L+LF IPQIS+ ST+P LS+  R+ FF R +P D+ Q Q M++I+K L W YVS +  + +YG +  ++  ++ K+   +CIA S  +P        +E KD+ +   + +K   D   +  V+IF +D+++   + A K  +    F W+GSD W  +     +       E   EGAI I+P   TV GF+ YF + T   N+ N WF E+WE+ F CKL   S +   +    C    ++ KD+  +  E ++QFV DAV A A AL  M   +CA    +  C  M Q  G+ LL+ ++ + F   +G     TP+ F    D   RY I  +         +  IG +T++ L+++   +++      IP S CT  C   QRKK   G   CW C  C  Y+ ++     C+ CP  Q P++NRT C  +  I L    P ++  +  + + +I  +     F+ Y  TPIV+AS RELS++LL GI LC++++ ++   P   +CSF++  +G    + Y+ALL K NRI RIF +G+K     RLIS  SQ+ I + ++S+Q  +LG  ++F    P          T +P +    L CD I    ++  + + ++L++ CTVYA  TR +PE FNE+K IGFTMY+TC+VWL FIP +  TA     ++++  TL +S+N+SA VAL  L+ PKVY I+F P+ NV+K  R
Sbjct:   45 IEGDVTLGGLFPVHAKGPSGVPCGDIKRENGIHRLEAMLYALDQINSDPNLLPNVTLGARILDTCSRDTYALEQSLTFVQALIQKDTSDVRCTNGEPPVFVKPEKVVGVIGASGSSVSIMVANILRLFQIPQISYASTAPELSDDRRYDFFSRVVPPDSFQAQAMVDIVKALGWNYVSTLASEGSYGEKGVESFTQISKEAGGLCIAQSVRIP--------QERKDRTIDFDRIIKQLLDTPNSRAVVIFANDEDIKQILAAAKRADQVGHFLWVGSDSWGSKINPLHQ------HEDIAEGAITIQPKRATVEGFDAYFTSRTLENNRRNVWFAEYWEENFNCKL-TISGSKKEDTDRKCTGQERIGKDS-NYEQEGKVQFVIDAVYAMAHALHHMNKDLCAD--YRGVCPEMEQAGGKKLLKYIRNVNFNGSAG-----TPVMFNKNGDAPGRYDIFQYQTTNTSNPGYRLIGQWTDE-LQLNIEDMQWGKGVREIPASVCTLPCKPGQRKKTQKGTPCCWTCEPCDGYQ-YQFDEMTCQHCPYDQRPNENRTGCQDIPIIKLEWHSPWAVIPVFLAMLGIIATIFVMATFIRYNDTPIVRASGRELSYVLLTGIFLCYIITFLMIAKPDVAVCSFRRVFLGLGMCISYAALLTKTNRIYRIFEQGKKSVTAPRLISPTSQLAITSSLISVQ--LLGVFIWFGVDPPNIIIDYDEHKTMNPEQARGVLKCD-ITDLQIICSLGYSILLMVTCTVYAIKTRGVPENFNEAKPIGFTMYTTCIVWLAFIPIFFGTAQSAEKLYIQTTTLTISMNLSASVALGMLYMPKVYIIIFHPELNVQKRKR 861          
BLAST of Metabotropic glutamate receptor vs. Ensembl Human
Match: GRM7 (glutamate metabotropic receptor 7 [Source:HGNC Symbol;Acc:HGNC:4599])

HSP 1 Score: 518.464 bits (1334), Expect = 5.684e-169
Identity = 300/845 (35.50%), Postives = 458/845 (54.20%), Query Frame = 3
Query:  129 IDGDIFLGGLMMVHLRSEEMV-CGVIAAEGGIQALEVMVYTINRVN-EMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIK---QSSKLQTKSNCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKD-NRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTF-DGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITF----DGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDP---------VTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAI---MVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGLR 2594
            I+GD+ LGGL  VH +    V CG I  E GI  LE M+Y ++++N +  +L ++ LGA I D C RDTY LEQ++ F++   Q      +    E  +      + GVIGAS S  SI VA++L+LF IPQIS+ ST+P LS+  R+ FF R +P D+ Q Q M++I+K L W YVS +  + +YG +  ++  ++ K+   +CIA S  +P        +E KD+ +   + +K   D   +  V+IF +D+++   + A K  +    F W+GSD W  +     +       E   EGAI I+P   TV GF+ YF + T   N+ N WF E+WE+ F CKL   S +   +    C    ++ KD+  +  E ++QFV DAV A A AL  M   +CA    +  C  M Q  G+ LL+ ++ + F   +G     TP+ F    D   RY I  +         +  IG +T++ L+++   +++      IP S CT  C   QRKK   G   CW C  C  Y+ ++     C+ CP  Q P++NRT C  +  I L    P ++  +  + + +I  +     F+ Y  TPIV+AS RELS++LL GI LC++++ ++   P   +CSF++  +G    + Y+ALL K NRI RIF +G+K     RLIS  SQ+ I + ++S+Q  +LG  ++F    P          T +P +    L CD I    ++  + + ++L++ CTVYA  TR +PE FNE+K IGFTMY+TC+VWL FIP +  TA     ++++  TL +S+N+SA VAL  L+ PKVY I+F P+ NV+K  R
Sbjct:   45 IEGDVTLGGLFPVHAKGPSGVPCGDIKRENGIHRLEAMLYALDQINSDPNLLPNVTLGARILDTCSRDTYALEQSLTFVQALIQKDTSDVRCTNGEPPVFVKPEKVVGVIGASGSSVSIMVANILRLFQIPQISYASTAPELSDDRRYDFFSRVVPPDSFQAQAMVDIVKALGWNYVSTLASEGSYGEKGVESFTQISKEAGGLCIAQSVRIP--------QERKDRTIDFDRIIKQLLDTPNSRAVVIFANDEDIKQILAAAKRADQVGHFLWVGSDSWGSKINPLHQ------HEDIAEGAITIQPKRATVEGFDAYFTSRTLENNRRNVWFAEYWEENFNCKL-TISGSKKEDTDRKCTGQERIGKDS-NYEQEGKVQFVIDAVYAMAHALHHMNKDLCAD--YRGVCPEMEQAGGKKLLKYIRNVNFNGSAG-----TPVMFNKNGDAPGRYDIFQYQTTNTSNPGYRLIGQWTDE-LQLNIEDMQWGKGVREIPASVCTLPCKPGQRKKTQKGTPCCWTCEPCDGYQ-YQFDEMTCQHCPYDQRPNENRTGCQDIPIIKLEWHSPWAVIPVFLAMLGIIATIFVMATFIRYNDTPIVRASGRELSYVLLTGIFLCYIITFLMIAKPDVAVCSFRRVFLGLGMCISYAALLTKTNRIYRIFEQGKKSVTAPRLISPTSQLAITSSLISVQ--LLGVFIWFGVDPPNIIIDYDEHKTMNPEQARGVLKCD-ITDLQIICSLGYSILLMVTCTVYAIKTRGVPENFNEAKPIGFTMYTTCIVWLAFIPIFFGTAQSAEKLYIQTTTLTISMNLSASVALGMLYMPKVYIIIFHPELNVQKRKR 861          
BLAST of Metabotropic glutamate receptor vs. Ensembl Celegans
Match: mgl-1 (Probable metabotropic glutamate receptor mgl-1 [Source:UniProtKB/Swiss-Prot;Acc:Q09630])

HSP 1 Score: 454.136 bits (1167), Expect = 1.946e-144
Identity = 293/873 (33.56%), Postives = 458/873 (52.46%), Query Frame = 3
Query:  105 PFKNQVALIDGDIFLGGLMMVHLRS--EEMVCGVIAAEGGIQALEVMVYTINRVN-EMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIKQ--SSKLQTKSNCNEA-----KIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKDNRICIATSEILPRDSKLASVKE-YKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEH-NLTHSFN----WLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTN--KHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRI------------LQKIKFTSLSGLEMEFTPITFDGLPRYRILNFIKAA-----------NGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLC--LRLQQI-YLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDP--VTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRK 2585
            P K +   I GDI +GG+  VH +S   +  CG IA   G+  +E M+Y ++++N +   L   KLGA I D C    Y L Q++DF++    S   +   C +      K  S  + +  V+G S S  S+ +A+LL+LF I Q+S  ST+  LS+KNRF +F RT+PSD +Q   M+EI  + +W YVS++Y    YG     A ++  +   ICIA  E      ++ + KE + + +  L + L+    VGAT V++F   + + D +    E   LT        WL S+ W      Y  G          +GAI +   S+ V  FE YF++L P T   + N W  E W+  ++C+     DTP  +    C E++K S +    + ++++QFV DAV A A  L+ MK  +C  +  +N  IS    + E    +            L K+ FT + G    F+P   DG   Y IL +   +           +    +VEIG+++   L I    L +  D +  P+S C+  C    RK+L      CW C KC++YE   N  T C  C  G +P ++R  C  L L Q+ Y+      S+   I +   +I  L    ++V Y +TP+VKAS RELS+ILL+ +I+C+ ++ VL + P+ ++C+ ++ GIGF+FS  YSA+ VK NRI RIF    +  Q+ R IS  SQ+ + A +  +Q+I  G+L++     P    H+P+R++  L C+ +  +  +  + +   LI++CT YA  TR +PE FNE+K IGF+MY+TCVVWL +I  +  T     ++ ++LC+SI++SA VAL+C+F PK++ ILF+  +NVRK
Sbjct:   30 PPKVRQIRIPGDILIGGVFPVHSKSLNGDEPCGEIAETRGVHRVEAMLYALDQINSQNDFLRGYKLGALILDSCSNPAYALNQSLDFVRDMIGSSEASDYVCLDGSDPNLKKQSQKKNVAAVVGGSYSSVSVQLANLLRLFRIAQVSPASTNADLSDKNRFEYFARTVPSDDYQAMAMVEIAVKFKWSYVSLVYSADEYGELGADAFKKEARKKGICIALEE------RIQNKKESFTESINNLVQKLQPEKNVGATVVVLFVGTEYIPDILRYTAERMKLTSGAKKRIIWLASESWDRNNDKYTAG----DNRLAAQGAIVLMLASQKVPSFEEYFMSLHPGTEAFERNKWLRELWQVKYKCEF----DTPPGSTASRC-EDIKQSTEG--FNADDKVQFVIDAVYAIAHGLQSMKQAICPDDAIENHWISRYSKQPEICHAMQNIDGSDFYQNYLLKVNFTDIVGKRFRFSP-QGDGPASYTILTYKPKSMDKKRRMTDDESSPSDYVEIGHWSENNLTIYEKNLWWDPDHT--PVSVCSLPCKIGFRKQLIKDEQCCWACSKCEDYEYLIN-ETHCVGCEQGWWPTKDRKGCFDLSLSQLKYMRWRSMYSLVPTILAVFGIIATLFVIVVYVIYNETPVVKASGRELSYILLISMIMCYCMTFVLLSKPSAIVCAIKRTGIGFAFSCLYSAMFVKTNRIFRIF--STRSAQRPRFISPISQVVMTAMLAGVQLI--GSLIWLSVVPPGWRHHYPTRDQVVLTCN-VPDHHFLYSLAYDGFLIVLCTTYAVKTRKVPENFNETKFIGFSMYTTCVVWLSWIFFFFGTGSDFQIQTSSLCISISMSANVALACIFSPKLWIILFEKHKNVRK 876          
BLAST of Metabotropic glutamate receptor vs. Ensembl Celegans
Match: mgl-1 (Probable metabotropic glutamate receptor mgl-1 [Source:UniProtKB/Swiss-Prot;Acc:Q09630])

HSP 1 Score: 454.521 bits (1168), Expect = 2.059e-144
Identity = 293/873 (33.56%), Postives = 458/873 (52.46%), Query Frame = 3
Query:  105 PFKNQVALIDGDIFLGGLMMVHLRS--EEMVCGVIAAEGGIQALEVMVYTINRVN-EMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIKQ--SSKLQTKSNCNEA-----KIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKDNRICIATSEILPRDSKLASVKE-YKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEH-NLTHSFN----WLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTN--KHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRI------------LQKIKFTSLSGLEMEFTPITFDGLPRYRILNFIKAA-----------NGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLC--LRLQQI-YLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDP--VTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRK 2585
            P K +   I GDI +GG+  VH +S   +  CG IA   G+  +E M+Y ++++N +   L   KLGA I D C    Y L Q++DF++    S   +   C +      K  S  + +  V+G S S  S+ +A+LL+LF I Q+S  ST+  LS+KNRF +F RT+PSD +Q   M+EI  + +W YVS++Y    YG     A ++  +   ICIA  E      ++ + KE + + +  L + L+    VGAT V++F   + + D +    E   LT        WL S+ W      Y  G          +GAI +   S+ V  FE YF++L P T   + N W  E W+  ++C+     DTP  +    C E++K S +    + ++++QFV DAV A A  L+ MK  +C  +  +N  IS    + E    +            L K+ FT + G    F+P   DG   Y IL +   +           +    +VEIG+++   L I    L +  D +  P+S C+  C    RK+L      CW C KC++YE   N  T C  C  G +P ++R  C  L L Q+ Y+      S+   I +   +I  L    ++V Y +TP+VKAS RELS+ILL+ +I+C+ ++ VL + P+ ++C+ ++ GIGF+FS  YSA+ VK NRI RIF    +  Q+ R IS  SQ+ + A +  +Q+I  G+L++     P    H+P+R++  L C+ +  +  +  + +   LI++CT YA  TR +PE FNE+K IGF+MY+TCVVWL +I  +  T     ++ ++LC+SI++SA VAL+C+F PK++ ILF+  +NVRK
Sbjct:   41 PPKVRQIRIPGDILIGGVFPVHSKSLNGDEPCGEIAETRGVHRVEAMLYALDQINSQNDFLRGYKLGALILDSCSNPAYALNQSLDFVRDMIGSSEASDYVCLDGSDPNLKKQSQKKNVAAVVGGSYSSVSVQLANLLRLFRIAQVSPASTNADLSDKNRFEYFARTVPSDDYQAMAMVEIAVKFKWSYVSLVYSADEYGELGADAFKKEARKKGICIALEE------RIQNKKESFTESINNLVQKLQPEKNVGATVVVLFVGTEYIPDILRYTAERMKLTSGAKKRIIWLASESWDRNNDKYTAG----DNRLAAQGAIVLMLASQKVPSFEEYFMSLHPGTEAFERNKWLRELWQVKYKCEF----DTPPGSTASRC-EDIKQSTEG--FNADDKVQFVIDAVYAIAHGLQSMKQAICPDDAIENHWISRYSKQPEICHAMQNIDGSDFYQNYLLKVNFTDIVGKRFRFSP-QGDGPASYTILTYKPKSMDKKRRMTDDESSPSDYVEIGHWSENNLTIYEKNLWWDPDHT--PVSVCSLPCKIGFRKQLIKDEQCCWACSKCEDYEYLIN-ETHCVGCEQGWWPTKDRKGCFDLSLSQLKYMRWRSMYSLVPTILAVFGIIATLFVIVVYVIYNETPVVKASGRELSYILLISMIMCYCMTFVLLSKPSAIVCAIKRTGIGFAFSCLYSAMFVKTNRIFRIF--STRSAQRPRFISPISQVVMTAMLAGVQLI--GSLIWLSVVPPGWRHHYPTRDQVVLTCN-VPDHHFLYSLAYDGFLIVLCTTYAVKTRKVPENFNETKFIGFSMYTTCVVWLSWIFFFFGTGSDFQIQTSSLCISISMSANVALACIFSPKLWIILFEKHKNVRK 887          
BLAST of Metabotropic glutamate receptor vs. Ensembl Celegans
Match: mgl-1 (Probable metabotropic glutamate receptor mgl-1 [Source:UniProtKB/Swiss-Prot;Acc:Q09630])

HSP 1 Score: 454.521 bits (1168), Expect = 2.391e-144
Identity = 293/873 (33.56%), Postives = 458/873 (52.46%), Query Frame = 3
Query:  105 PFKNQVALIDGDIFLGGLMMVHLRS--EEMVCGVIAAEGGIQALEVMVYTINRVN-EMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIKQ--SSKLQTKSNCNEA-----KIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKDNRICIATSEILPRDSKLASVKE-YKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEH-NLTHSFN----WLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTN--KHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRI------------LQKIKFTSLSGLEMEFTPITFDGLPRYRILNFIKAA-----------NGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLC--LRLQQI-YLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDP--VTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRK 2585
            P K +   I GDI +GG+  VH +S   +  CG IA   G+  +E M+Y ++++N +   L   KLGA I D C    Y L Q++DF++    S   +   C +      K  S  + +  V+G S S  S+ +A+LL+LF I Q+S  ST+  LS+KNRF +F RT+PSD +Q   M+EI  + +W YVS++Y    YG     A ++  +   ICIA  E      ++ + KE + + +  L + L+    VGAT V++F   + + D +    E   LT        WL S+ W      Y  G          +GAI +   S+ V  FE YF++L P T   + N W  E W+  ++C+     DTP  +    C E++K S +    + ++++QFV DAV A A  L+ MK  +C  +  +N  IS    + E    +            L K+ FT + G    F+P   DG   Y IL +   +           +    +VEIG+++   L I    L +  D +  P+S C+  C    RK+L      CW C KC++YE   N  T C  C  G +P ++R  C  L L Q+ Y+      S+   I +   +I  L    ++V Y +TP+VKAS RELS+ILL+ +I+C+ ++ VL + P+ ++C+ ++ GIGF+FS  YSA+ VK NRI RIF    +  Q+ R IS  SQ+ + A +  +Q+I  G+L++     P    H+P+R++  L C+ +  +  +  + +   LI++CT YA  TR +PE FNE+K IGF+MY+TCVVWL +I  +  T     ++ ++LC+SI++SA VAL+C+F PK++ ILF+  +NVRK
Sbjct:   44 PPKVRQIRIPGDILIGGVFPVHSKSLNGDEPCGEIAETRGVHRVEAMLYALDQINSQNDFLRGYKLGALILDSCSNPAYALNQSLDFVRDMIGSSEASDYVCLDGSDPNLKKQSQKKNVAAVVGGSYSSVSVQLANLLRLFRIAQVSPASTNADLSDKNRFEYFARTVPSDDYQAMAMVEIAVKFKWSYVSLVYSADEYGELGADAFKKEARKKGICIALEE------RIQNKKESFTESINNLVQKLQPEKNVGATVVVLFVGTEYIPDILRYTAERMKLTSGAKKRIIWLASESWDRNNDKYTAG----DNRLAAQGAIVLMLASQKVPSFEEYFMSLHPGTEAFERNKWLRELWQVKYKCEF----DTPPGSTASRC-EDIKQSTEG--FNADDKVQFVIDAVYAIAHGLQSMKQAICPDDAIENHWISRYSKQPEICHAMQNIDGSDFYQNYLLKVNFTDIVGKRFRFSP-QGDGPASYTILTYKPKSMDKKRRMTDDESSPSDYVEIGHWSENNLTIYEKNLWWDPDHT--PVSVCSLPCKIGFRKQLIKDEQCCWACSKCEDYEYLIN-ETHCVGCEQGWWPTKDRKGCFDLSLSQLKYMRWRSMYSLVPTILAVFGIIATLFVIVVYVIYNETPVVKASGRELSYILLISMIMCYCMTFVLLSKPSAIVCAIKRTGIGFAFSCLYSAMFVKTNRIFRIF--STRSAQRPRFISPISQVVMTAMLAGVQLI--GSLIWLSVVPPGWRHHYPTRDQVVLTCN-VPDHHFLYSLAYDGFLIVLCTTYAVKTRKVPENFNETKFIGFSMYTTCVVWLSWIFFFFGTGSDFQIQTSSLCISISMSANVALACIFSPKLWIILFEKHKNVRK 890          
BLAST of Metabotropic glutamate receptor vs. Ensembl Celegans
Match: mgl-1 (Probable metabotropic glutamate receptor mgl-1 [Source:UniProtKB/Swiss-Prot;Acc:Q09630])

HSP 1 Score: 428.328 bits (1100), Expect = 1.942e-135
Identity = 275/827 (33.25%), Postives = 432/827 (52.24%), Query Frame = 3
Query:  237 MVYTINRVN-EMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIKQ--SSKLQTKSNCNEA-----KIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKDNRICIATSEILPRDSKLASVKE-YKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEH-NLTHSFN----WLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTN--KHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRI------------LQKIKFTSLSGLEMEFTPITFDGLPRYRILNFIKAA-----------NGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRL---QQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDP--VTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRK 2585
            M+Y ++++N +   L   KLGA I D C    Y L Q++DF++    S   +   C +      K  S  + +  V+G S S  S+ +A+LL+LF I Q+S  ST+  LS+KNRF +F RT+PSD +Q   M+EI  + +W YVS++Y    YG     A ++  +   ICIA  E      ++ + KE + + +  L + L+    VGAT V++F   + + D +    E   LT        WL S+ W      Y  G          +GAI +   S+ V  FE YF++L P T   + N W  E W+  ++C+     DTP  +    C E++K S +    + ++++QFV DAV A A  L+ MK  +C  +  +N  IS    + E    +            L K+ FT + G    F+P   DG   Y IL +   +           +    +VEIG+++   L I    L +  D +  P+S C+  C    RK+L      CW C KC++YE   N  T C  C  G +P ++R  C  L   Q  Y+      S+   I +   +I  L    ++V Y +TP+VKAS RELS+ILL+ +I+C+ ++ VL + P+ ++C+ ++ GIGF+FS  YSA+ VK NRI RIF    +  Q+ R IS  SQ+ + A +  +Q+I  G+L++     P    H+P+R++  L C+ +  +  +  + +   LI++CT YA  TR +PE FNE+K IGF+MY+TCVVWL +I  +  T     ++ ++LC+SI++SA VAL+C+F PK++ ILF+  +NVRK
Sbjct:    1 MLYALDQINSQNDFLRGYKLGALILDSCSNPAYALNQSLDFVRDMIGSSEASDYVCLDGSDPNLKKQSQKKNVAAVVGGSYSSVSVQLANLLRLFRIAQVSPASTNADLSDKNRFEYFARTVPSDDYQAMAMVEIAVKFKWSYVSLVYSADEYGELGADAFKKEARKKGICIALEE------RIQNKKESFTESINNLVQKLQPEKNVGATVVVLFVGTEYIPDILRYTAERMKLTSGAKKRIIWLASESWDRNNDKYTAG----DNRLAAQGAIVLMLASQKVPSFEEYFMSLHPGTEAFERNKWLRELWQVKYKCEF----DTPPGSTASRC-EDIKQSTEG--FNADDKVQFVIDAVYAIAHGLQSMKQAICPDDAIENHWISRYSKQPEICHAMQNIDGSDFYQNYLLKVNFTDIVGKRFRFSP-QGDGPASYTILTYKPKSMDKKRRMTDDESSPSDYVEIGHWSENNLTIYEKNLWWDPDHT--PVSVCSLPCKIGFRKQLIKDEQCCWACSKCEDYEYLIN-ETHCVGCEQGWWPTKDRKGCFDLSLSQLKYMRWRSMYSLVPTILAVFGIIATLFVIVVYVIYNETPVVKASGRELSYILLISMIMCYCMTFVLLSKPSAIVCAIKRTGIGFAFSCLYSAMFVKTNRIFRIF--STRSAQRPRFISPISQVVMTAMLAGVQLI--GSLIWLSVVPPGWRHHYPTRDQVVLTCN-VPDHHFLYSLAYDGFLIVLCTTYAVKTRKVPENFNETKFIGFSMYTTCVVWLSWIFFFFGTGSDFQIQTSSLCISISMSANVALACIFSPKLWIILFEKHKNVRK 801          
BLAST of Metabotropic glutamate receptor vs. Ensembl Celegans
Match: mgl-1 (Probable metabotropic glutamate receptor mgl-1 [Source:UniProtKB/Swiss-Prot;Acc:Q09630])

HSP 1 Score: 428.328 bits (1100), Expect = 1.942e-135
Identity = 275/827 (33.25%), Postives = 432/827 (52.24%), Query Frame = 3
Query:  237 MVYTINRVN-EMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIKQ--SSKLQTKSNCNEA-----KIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKDNRICIATSEILPRDSKLASVKE-YKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEH-NLTHSFN----WLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTN--KHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRI------------LQKIKFTSLSGLEMEFTPITFDGLPRYRILNFIKAA-----------NGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRL---QQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDP--VTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRK 2585
            M+Y ++++N +   L   KLGA I D C    Y L Q++DF++    S   +   C +      K  S  + +  V+G S S  S+ +A+LL+LF I Q+S  ST+  LS+KNRF +F RT+PSD +Q   M+EI  + +W YVS++Y    YG     A ++  +   ICIA  E      ++ + KE + + +  L + L+    VGAT V++F   + + D +    E   LT        WL S+ W      Y  G          +GAI +   S+ V  FE YF++L P T   + N W  E W+  ++C+     DTP  +    C E++K S +    + ++++QFV DAV A A  L+ MK  +C  +  +N  IS    + E    +            L K+ FT + G    F+P   DG   Y IL +   +           +    +VEIG+++   L I    L +  D +  P+S C+  C    RK+L      CW C KC++YE   N  T C  C  G +P ++R  C  L   Q  Y+      S+   I +   +I  L    ++V Y +TP+VKAS RELS+ILL+ +I+C+ ++ VL + P+ ++C+ ++ GIGF+FS  YSA+ VK NRI RIF    +  Q+ R IS  SQ+ + A +  +Q+I  G+L++     P    H+P+R++  L C+ +  +  +  + +   LI++CT YA  TR +PE FNE+K IGF+MY+TCVVWL +I  +  T     ++ ++LC+SI++SA VAL+C+F PK++ ILF+  +NVRK
Sbjct:    1 MLYALDQINSQNDFLRGYKLGALILDSCSNPAYALNQSLDFVRDMIGSSEASDYVCLDGSDPNLKKQSQKKNVAAVVGGSYSSVSVQLANLLRLFRIAQVSPASTNADLSDKNRFEYFARTVPSDDYQAMAMVEIAVKFKWSYVSLVYSADEYGELGADAFKKEARKKGICIALEE------RIQNKKESFTESINNLVQKLQPEKNVGATVVVLFVGTEYIPDILRYTAERMKLTSGAKKRIIWLASESWDRNNDKYTAG----DNRLAAQGAIVLMLASQKVPSFEEYFMSLHPGTEAFERNKWLRELWQVKYKCEF----DTPPGSTASRC-EDIKQSTEG--FNADDKVQFVIDAVYAIAHGLQSMKQAICPDDAIENHWISRYSKQPEICHAMQNIDGSDFYQNYLLKVNFTDIVGKRFRFSP-QGDGPASYTILTYKPKSMDKKRRMTDDESSPSDYVEIGHWSENNLTIYEKNLWWDPDHT--PVSVCSLPCKIGFRKQLIKDEQCCWACSKCEDYEYLIN-ETHCVGCEQGWWPTKDRKGCFDLSLSQLKYMRWRSMYSLVPTILAVFGIIATLFVIVVYVIYNETPVVKASGRELSYILLISMIMCYCMTFVLLSKPSAIVCAIKRTGIGFAFSCLYSAMFVKTNRIFRIF--STRSAQRPRFISPISQVVMTAMLAGVQLI--GSLIWLSVVPPGWRHHYPTRDQVVLTCN-VPDHHFLYSLAYDGFLIVLCTTYAVKTRKVPENFNETKFIGFSMYTTCVVWLSWIFFFFGTGSDFQIQTSSLCISISMSANVALACIFSPKLWIILFEKHKNVRK 801          
BLAST of Metabotropic glutamate receptor vs. Ensembl Fly
Match: mtt (gene:FBgn0050361 transcript:FBtr0330608)

HSP 1 Score: 801.971 bits (2070), Expect = 0.000e+0
Identity = 398/833 (47.78%), Postives = 550/833 (66.03%), Query Frame = 3
Query:  102 WPFKNQVALIDGDIFLGGLMMVHLRSEEMVCGVIAAEGGIQALEVMVYTINRVNEMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIKQS-SKLQ-TKSNCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKDNRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITFDGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEI-FKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDPVTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGL 2591
            WP K + A+++GD+ LGGLMMVH R + + CG I  +GGIQALE M++TI+R+N  ++L +I LGA+I DDCD+D+YGLE AVDFIK S S +   + +CN+ ++    + I+GV+GA+SSVTSI VA+LL+LF IPQ+S+FSTSP LSNK RF +F RTIPSD +QV+ M+EI+K++ W YVSIIYE+SNYG +AF+ L+E+   + ICIA  E L +DS +A    Y + V +L    +      A G IIFGSDQEV   M A++  N T SF+W+GSDGWS R       L     E E+EG + ++P +  V GFE YFL+LT   N+ NPWF EFWED F+C+ P S+ TPYNN+T  C    +LS+ N    FE+QLQFVSDAVMAFA AL++M   +C    S   C +M   KG  LL+ L+K++F  LSG E  F     DG  RY I++F ++  G Y WV++G YT  +LR++ T++KF+  S   P S C+  C   Q KK   G   CW C  C  Y+I   +  T C+ C LG  PD ++  C  + +IYL      +IG M FS   +++ L    +FV +  TPIV+AS RELS+ILL GI +C+ V+  L   PT ++C+ Q+FG+GF F++ Y+ALL K NRI RIF+ G++  ++   IS +SQ+ ICA +VS+QI+I G  +    S  + H+P+R +  L+CD  I  S +I   +P+ LI+ICTVYA LTR IPEAFNESKHIGFTMY+TCV+WL F+P Y  TA  V LR+ ++ V+I++SA V ++CLF PK+Y IL +P++NVR+ +
Sbjct:  383 WPVKRE-AIVEGDVILGGLMMVHSREDSITCGPIMPQGGIQALEAMLFTIDRINREQLLPNITLGAHILDDCDKDSYGLEMAVDFIKGSISNIDDAEYHCNKTQVR---KVISGVVGAASSVTSIQVANLLRLFRIPQVSYFSTSPELSNKQRFEYFSRTIPSDHYQVKAMVEIVKRMGWSYVSIIYEESNYGIKAFEELEELLARHNICIAIKEKLVKDSGVAEDIAYDNIVQKLLTKPR------ARGAIIFGSDQEVRQVMRAVRRANATGSFSWIGSDGWSARN------LVSDDYEPEVEGTLSVQPQANPVRGFEEYFLSLTVENNQRNPWFVEFWEDHFQCRYPGSTSTPYNNYTKQCTTKERLSRQNT--DFEDQLQFVSDAVMAFAYALRDMHRDLCGGGPS--LCEAMKPTKGADLLKYLRKVEFEGLSGDEFRFDG-NGDGPARYNIIHFKQSQAGQYHWVKVGEYTEGELRLNMTEVKFKRLSPKPPESVCSLPCLVGQAKKYVEGESCCWHCFNCTTYQIRHPDDETHCKLCKLGTLPDAHKQYCRPIPEIYLRPESAWAIGAMAFSATGILVTLFVMGVFVRHNDTPIVRASGRELSYILLAGIFMCYGVTFALVLKPTNIVCAIQRFGVGFCFTVVYAALLTKTNRIARIFKAGKQSAKRPSFISPKSQLVICACLVSVQILINGVWMVIAPSHAMHHYPTREDNLLVCDSYIDASYMIAFSYPIFLIVICTVYAVLTRKIPEAFNESKHIGFTMYTTCVIWLAFVPLYFGTANHVPLRITSMSVTISLSASVTIACLFSPKLYIILIRPERNVRQSM 1194          

HSP 2 Score: 119.013 bits (297), Expect = 8.790e-27
Identity = 55/115 (47.83%), Postives = 80/115 (69.57%), Query Frame = 3
Query:  102 WPFKNQVALIDGDIFLGGLMMVHLRSEEMVCGVIAAEGGIQALEVMVYTINRVNEMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIKQ-------------SSKLQTKSNCNEAK 407
            WP K+  A+++GD+ LGGLMMVH R + + CG I  +GGIQALE M+YT+++VN+ ++L ++ LGA++ DDCD+DTYGLE AVDFIK               +K + K+ C+E+K
Sbjct:   63 WPVKH-AAVLEGDVILGGLMMVHSREDSITCGPIMPQGGIQALEAMLYTLDQVNKQQLLPNVTLGAHLLDDCDKDTYGLEMAVDFIKAHIQINSEYITVKTEAKAKMKTFCDESK 176          
BLAST of Metabotropic glutamate receptor vs. Ensembl Fly
Match: mtt (gene:FBgn0050361 transcript:FBtr0273325)

HSP 1 Score: 800.816 bits (2067), Expect = 0.000e+0
Identity = 398/833 (47.78%), Postives = 550/833 (66.03%), Query Frame = 3
Query:  102 WPFKNQVALIDGDIFLGGLMMVHLRSEEMVCGVIAAEGGIQALEVMVYTINRVNEMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIKQS-SKLQ-TKSNCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKDNRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITFDGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEI-FKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDPVTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGL 2591
            WP K + A+++GD+ LGGLMMVH R + + CG I  +GGIQALE M++TI+R+N  ++L +I LGA+I DDCD+D+YGLE AVDFIK S S +   + +CN+ ++    + I+GV+GA+SSVTSI VA+LL+LF IPQ+S+FSTSP LSNK RF +F RTIPSD +QV+ M+EI+K++ W YVSIIYE+SNYG +AF+ L+E+   + ICIA  E L +DS +A    Y + V +L    +      A G IIFGSDQEV   M A++  N T SF+W+GSDGWS R       L     E E+EG + ++P +  V GFE YFL+LT   N+ NPWF EFWED F+C+ P S+ TPYNN+T  C    +LS+ N    FE+QLQFVSDAVMAFA AL++M   +C    S   C +M   KG  LL+ L+K++F  LSG E  F     DG  RY I++F ++  G Y WV++G YT  +LR++ T++KF+  S   P S C+  C   Q KK   G   CW C  C  Y+I   +  T C+ C LG  PD ++  C  + +IYL      +IG M FS   +++ L    +FV +  TPIV+AS RELS+ILL GI +C+ V+  L   PT ++C+ Q+FG+GF F++ Y+ALL K NRI RIF+ G++  ++   IS +SQ+ ICA +VS+QI+I G  +    S  + H+P+R +  L+CD  I  S +I   +P+ LI+ICTVYA LTR IPEAFNESKHIGFTMY+TCV+WL F+P Y  TA  V LR+ ++ V+I++SA V ++CLF PK+Y IL +P++NVR+ +
Sbjct:  383 WPVKRE-AIVEGDVILGGLMMVHSREDSITCGPIMPQGGIQALEAMLFTIDRINREQLLPNITLGAHILDDCDKDSYGLEMAVDFIKGSISNIDDAEYHCNKTQVR---KVISGVVGAASSVTSIQVANLLRLFRIPQVSYFSTSPELSNKQRFEYFSRTIPSDHYQVKAMVEIVKRMGWSYVSIIYEESNYGIKAFEELEELLARHNICIAIKEKLVKDSGVAEDIAYDNIVQKLLTKPR------ARGAIIFGSDQEVRQVMRAVRRANATGSFSWIGSDGWSAR------NLVSDDYEPEVEGTLSVQPQANPVRGFEEYFLSLTVENNQRNPWFVEFWEDHFQCRYPGSTSTPYNNYTKQCTTKERLSRQNT--DFEDQLQFVSDAVMAFAYALRDMHRDLCGGGPS--LCEAMKPTKGADLLKYLRKVEFEGLSGDEFRFDG-NGDGPARYNIIHFKQSQAGQYHWVKVGEYTEGELRLNMTEVKFKRLSPKPPESVCSLPCLVGQAKKYVEGESCCWHCFNCTTYQIRHPDDETHCKLCKLGTLPDAHKQYCRPIPEIYLRPESAWAIGAMAFSATGILVTLFVMGVFVRHNDTPIVRASGRELSYILLAGIFMCYGVTFALVLKPTNIVCAIQRFGVGFCFTVVYAALLTKTNRIARIFKAGKQSAKRPSFISPKSQLVICACLVSVQILINGVWMVIAPSHAMHHYPTREDNLLVCDSYIDASYMIAFSYPIFLIVICTVYAVLTRKIPEAFNESKHIGFTMYTTCVIWLAFVPLYFGTANHVPLRITSMSVTISLSASVTIACLFSPKLYIILIRPERNVRQSM 1194          

HSP 2 Score: 119.013 bits (297), Expect = 9.612e-27
Identity = 55/115 (47.83%), Postives = 80/115 (69.57%), Query Frame = 3
Query:  102 WPFKNQVALIDGDIFLGGLMMVHLRSEEMVCGVIAAEGGIQALEVMVYTINRVNEMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIKQ-------------SSKLQTKSNCNEAK 407
            WP K+  A+++GD+ LGGLMMVH R + + CG I  +GGIQALE M+YT+++VN+ ++L ++ LGA++ DDCD+DTYGLE AVDFIK               +K + K+ C+E+K
Sbjct:   63 WPVKH-AAVLEGDVILGGLMMVHSREDSITCGPIMPQGGIQALEAMLYTLDQVNKQQLLPNVTLGAHLLDDCDKDTYGLEMAVDFIKAHIQINSEYITVKTEAKAKMKTFCDESK 176          
BLAST of Metabotropic glutamate receptor vs. Ensembl Fly
Match: mtt (gene:FBgn0050361 transcript:FBtr0273327)

HSP 1 Score: 799.275 bits (2063), Expect = 0.000e+0
Identity = 398/833 (47.78%), Postives = 550/833 (66.03%), Query Frame = 3
Query:  102 WPFKNQVALIDGDIFLGGLMMVHLRSEEMVCGVIAAEGGIQALEVMVYTINRVNEMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIKQS-SKLQ-TKSNCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKDNRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITFDGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEI-FKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDPVTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGL 2591
            WP K + A+++GD+ LGGLMMVH R + + CG I  +GGIQALE M++TI+R+N  ++L +I LGA+I DDCD+D+YGLE AVDFIK S S +   + +CN+ ++    + I+GV+GA+SSVTSI VA+LL+LF IPQ+S+FSTSP LSNK RF +F RTIPSD +QV+ M+EI+K++ W YVSIIYE+SNYG +AF+ L+E+   + ICIA  E L +DS +A    Y + V +L    +      A G IIFGSDQEV   M A++  N T SF+W+GSDGWS R       L     E E+EG + ++P +  V GFE YFL+LT   N+ NPWF EFWED F+C+ P S+ TPYNN+T  C    +LS+ N    FE+QLQFVSDAVMAFA AL++M   +C    S   C +M   KG  LL+ L+K++F  LSG E  F     DG  RY I++F ++  G Y WV++G YT  +LR++ T++KF+  S   P S C+  C   Q KK   G   CW C  C  Y+I   +  T C+ C LG  PD ++  C  + +IYL      +IG M FS   +++ L    +FV +  TPIV+AS RELS+ILL GI +C+ V+  L   PT ++C+ Q+FG+GF F++ Y+ALL K NRI RIF+ G++  ++   IS +SQ+ ICA +VS+QI+I G  +    S  + H+P+R +  L+CD  I  S +I   +P+ LI+ICTVYA LTR IPEAFNESKHIGFTMY+TCV+WL F+P Y  TA  V LR+ ++ V+I++SA V ++CLF PK+Y IL +P++NVR+ +
Sbjct:  216 WPVKRE-AIVEGDVILGGLMMVHSREDSITCGPIMPQGGIQALEAMLFTIDRINREQLLPNITLGAHILDDCDKDSYGLEMAVDFIKGSISNIDDAEYHCNKTQVR---KVISGVVGAASSVTSIQVANLLRLFRIPQVSYFSTSPELSNKQRFEYFSRTIPSDHYQVKAMVEIVKRMGWSYVSIIYEESNYGIKAFEELEELLARHNICIAIKEKLVKDSGVAEDIAYDNIVQKLLTKPR------ARGAIIFGSDQEVRQVMRAVRRANATGSFSWIGSDGWSAR------NLVSDDYEPEVEGTLSVQPQANPVRGFEEYFLSLTVENNQRNPWFVEFWEDHFQCRYPGSTSTPYNNYTKQCTTKERLSRQNT--DFEDQLQFVSDAVMAFAYALRDMHRDLCGGGPS--LCEAMKPTKGADLLKYLRKVEFEGLSGDEFRFDG-NGDGPARYNIIHFKQSQAGQYHWVKVGEYTEGELRLNMTEVKFKRLSPKPPESVCSLPCLVGQAKKYVEGESCCWHCFNCTTYQIRHPDDETHCKLCKLGTLPDAHKQYCRPIPEIYLRPESAWAIGAMAFSATGILVTLFVMGVFVRHNDTPIVRASGRELSYILLAGIFMCYGVTFALVLKPTNIVCAIQRFGVGFCFTVVYAALLTKTNRIARIFKAGKQSAKRPSFISPKSQLVICACLVSVQILINGVWMVIAPSHAMHHYPTREDNLLVCDSYIDASYMIAFSYPIFLIVICTVYAVLTRKIPEAFNESKHIGFTMYTTCVIWLAFVPLYFGTANHVPLRITSMSVTISLSASVTIACLFSPKLYIILIRPERNVRQSM 1027          
BLAST of Metabotropic glutamate receptor vs. Ensembl Fly
Match: mtt (gene:FBgn0050361 transcript:FBtr0273326)

HSP 1 Score: 798.89 bits (2062), Expect = 0.000e+0
Identity = 397/833 (47.66%), Postives = 551/833 (66.15%), Query Frame = 3
Query:  102 WPFKNQVALIDGDIFLGGLMMVHLRSEEMVCGVIAAEGGIQALEVMVYTINRVNEMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIKQS-SKLQ-TKSNCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKDNRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITFDGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEI-FKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDPVTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGL 2591
            WP K+  A+++GD+ LGGLMMVH R + + CG I  +GGIQALE M+YT+++VN+ ++L ++ LGA++ DDCD+DTYGLE AVDFIK S S +   + +CN+ ++    + I+GV+GA+SSVTSI VA+LL+LF IPQ+S+FSTSP LSNK RF +F RTIPSD +QV+ M+EI+K++ W YVSIIYE+SNYG +AF+ L+E+   + ICIA  E L +DS +A    Y + V +L    +      A G IIFGSDQEV   M A++  N T SF+W+GSDGWS R       L     E E+EG + ++P +  V GFE YFL+LT   N+ NPWF EFWED F+C+ P S+ TPYNN+T  C    +LS+ N    FE+QLQFVSDAVMAFA AL++M   +C    S   C +M   KG  LL+ L+K++F  LSG E  F     DG  RY I++F ++  G Y WV++G YT  +LR++ T++KF+  S   P S C+  C   Q KK   G   CW C  C  Y+I   +  T C+ C LG  PD ++  C  + +IYL      +IG M FS   +++ L    +FV +  TPIV+AS RELS+ILL GI +C+ V+  L   PT ++C+ Q+FG+GF F++ Y+ALL K NRI RIF+ G++  ++   IS +SQ+ ICA +VS+QI+I G  +    S  + H+P+R +  L+CD  I  S +I   +P+ LI+ICTVYA LTR IPEAFNESKHIGFTMY+TCV+WL F+P Y  TA  V LR+ ++ V+I++SA V ++CLF PK+Y IL +P++NVR+ +
Sbjct:   63 WPVKH-AAVLEGDVILGGLMMVHSREDSITCGPIMPQGGIQALEAMLYTLDQVNKQQLLPNVTLGAHLLDDCDKDTYGLEMAVDFIKGSISNIDDAEYHCNKTQVR---KVISGVVGAASSVTSIQVANLLRLFRIPQVSYFSTSPELSNKQRFEYFSRTIPSDHYQVKAMVEIVKRMGWSYVSIIYEESNYGIKAFEELEELLARHNICIAIKEKLVKDSGVAEDIAYDNIVQKLLTKPR------ARGAIIFGSDQEVRQVMRAVRRANATGSFSWIGSDGWSARN------LVSDDYEPEVEGTLSVQPQANPVRGFEEYFLSLTVENNQRNPWFVEFWEDHFQCRYPGSTSTPYNNYTKQCTTKERLSRQN--TDFEDQLQFVSDAVMAFAYALRDMHRDLCGGGPS--LCEAMKPTKGADLLKYLRKVEFEGLSGDEFRFDG-NGDGPARYNIIHFKQSQAGQYHWVKVGEYTEGELRLNMTEVKFKRLSPKPPESVCSLPCLVGQAKKYVEGESCCWHCFNCTTYQIRHPDDETHCKLCKLGTLPDAHKQYCRPIPEIYLRPESAWAIGAMAFSATGILVTLFVMGVFVRHNDTPIVRASGRELSYILLAGIFMCYGVTFALVLKPTNIVCAIQRFGVGFCFTVVYAALLTKTNRIARIFKAGKQSAKRPSFISPKSQLVICACLVSVQILINGVWMVIAPSHAMHHYPTREDNLLVCDSYIDASYMIAFSYPIFLIVICTVYAVLTRKIPEAFNESKHIGFTMYTTCVIWLAFVPLYFGTANHVPLRITSMSVTISLSASVTIACLFSPKLYIILIRPERNVRQSM 874          
BLAST of Metabotropic glutamate receptor vs. Ensembl Fly
Match: mtt (gene:FBgn0050361 transcript:FBtr0088756)

HSP 1 Score: 528.48 bits (1360), Expect = 8.595e-175
Identity = 259/570 (45.44%), Postives = 361/570 (63.33%), Query Frame = 3
Query:  885 MMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITFDGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEI-FKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDPVTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGL 2591
            M A++  N T SF+W+GSDGWS R       L     E E+EG + ++P +  V GFE YFL+LT   N+ NPWF EFWED F+C+ P S+ TPYNN+T  C    +LS+ N    FE+QLQFVSDAVMAFA AL++M   +C    S   C +M   KG  LL+ L+K++F  LSG E  F     DG  RY I++F ++  G Y WV++G YT  +LR++ T++KF+  S   P S C+  C   Q KK   G   CW C  C  Y+I   +  T C+ C LG  PD ++  C  + +IYL      +IG M FS   +++ L    +FV +  TPIV+AS RELS+ILL GI +C+ V+  L   PT ++C+ Q+FG+GF F++ Y+ALL K NRI RIF+ G++  ++   IS +SQ+ ICA +VS+QI+I G  +    S  + H+P+R +  L+CD  I  S +I   +P+ LI+ICTVYA LTR IPEAFNESKHIGFTMY+TCV+WL F+P Y  TA  V LR+ ++ V+I++SA V ++CLF PK+Y IL +P++NVR+ +
Sbjct:    1 MRAVRRANATGSFSWIGSDGWSARN------LVSDDYEPEVEGTLSVQPQANPVRGFEEYFLSLTVENNQRNPWFVEFWEDHFQCRYPGSTSTPYNNYTKQCTTKERLSRQN--TDFEDQLQFVSDAVMAFAYALRDMHRDLCGGGPS--LCEAMKPTKGADLLKYLRKVEFEGLSGDEFRFDG-NGDGPARYNIIHFKQSQAGQYHWVKVGEYTEGELRLNMTEVKFKRLSPKPPESVCSLPCLVGQAKKYVEGESCCWHCFNCTTYQIRHPDDETHCKLCKLGTLPDAHKQYCRPIPEIYLRPESAWAIGAMAFSATGILVTLFVMGVFVRHNDTPIVRASGRELSYILLAGIFMCYGVTFALVLKPTNIVCAIQRFGVGFCFTVVYAALLTKTNRIARIFKAGKQSAKRPSFISPKSQLVICACLVSVQILINGVWMVIAPSHAMHHYPTREDNLLVCDSYIDASYMIAFSYPIFLIVICTVYAVLTRKIPEAFNESKHIGFTMYTTCVIWLAFVPLYFGTANHVPLRITSMSVTISLSASVTIACLFSPKLYIILIRPERNVRQSM 559          
BLAST of Metabotropic glutamate receptor vs. Ensembl Zebrafish
Match: grm3 (glutamate receptor, metabotropic 3 [Source:ZFIN;Acc:ZDB-GENE-061009-13])

HSP 1 Score: 503.442 bits (1295), Expect = 1.396e-163
Identity = 309/884 (34.95%), Postives = 487/884 (55.09%), Query Frame = 3
Query:  129 IDGDIFLGGLMMVHLRSEEM-VCGVIAAEGGIQALEVMVYTINRVNE-MKILGDIKLGAYIKDDCDRDTYGLEQAVDFIKQS-SKLQ-TKSNCNEAKI----DSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKDNRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLR-ILQKIKFT---SLSGLEMEFTPITF-DGLPRYRILNFIKA-ANGIYSWVEIGNYTNQKLRIDYTKLKF-RGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQ--PQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDPVTHH---PSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGLRINIKNEQNQIDHLDNNSHTQMSYSHMILKDDQLNNIKNSVTS 2720
            IDGD+ LGGL  +H +   M  CG I  + GIQ LE M++ I+++N+ + +L  + LG +I D C RDTY LEQA++F++ S +K+  T+  C +       DS L  I GVIG S S  SI VA+LL+LF IPQIS+ STS  LS+K+R+ +F RT+P D +Q + M EI++   W YVS +  + +YG    +A ++  +   ICIATSE + R S   S  E   + L  K   +          ++F    +  + + A     L  SF W+ SDGW  +    K   F        +GAI +E  +  +  F  YF  LTP  N  NPWF +FWE  F+C L  +S T        CD+ L + K N     E+++ FV +AV A A AL  M+  +CA N ++  C +M    G  L R  L  + F    S +GLE +     + DG+ RY I N+     +  +++V++G +  + L ++   + + RG  + +P S C+  C+ ++ KK+  G   CWIC  C+ YE   +  T C  C  GQ+P  + T C  L + Y+      +IG +  + +  I  L  F +F+ +  TP+VKAS REL +ILL+G+ + +V++ +    P+ ++C+ ++ G+G SF++CYSALL K NRI RIF  G K+   Q+ R IS  SQ+FIC  ++S+Q++++   L  +   P T     P + +  ++   +  +S+++ + + ++L+++CTVYAF TR  PE FNE+K IGFTMY+TC++WL F+P +  T+    ++  T+C+S+++S  V L C+F PKV+ I+F+P++NV    R+N+             SH  +S +H +        I +S TS
Sbjct:   29 IDGDLVLGGLFPIHEKGMGMDECGRINEDRGIQRLEAMLFAIDQINQDVALLPGVVLGVHILDTCSRDTYALEQALEFVRASLTKVDDTEFICPDGSYALQEDSPL-AIAGVIGGSFSSVSIQVANLLRLFQIPQISYASTSAKLSDKSRYDYFARTVPPDFYQAKAMAEILRAFNWTYVSTVASEGDYGETGIEAFEQQARLRNICIATSEKVGRSSAKRSSYEAVVRQLLQKPTARV--------AVLFLRSDDARELIAAAAR--LNASFLWVASDGWGAQESIVKGNEFTA------DGAITLELAAHPIPDFNRYFQTLTPQINHRNPWFKDFWEQKFQCSLGGTSATGAGTPKPPCDQELVIDKSN--FEPESKIMFVVNAVYAMAHALHRMQRTLCA-NTTR-LCDAMRSLDGRKLYRDFLLHVNFRAPFSPAGLESQVKFDAYGDGVGRYNIFNYQSVPGSDKFAYVQVGEWA-ESLSLNEGLIGWPRG--ADVPTSQCSDPCAPNEMKKMQAGEYCCWICTPCEPYEYLPDEFT-CMPCAPGQWPRPDLTGCYDLPEDYIMWEDAWAIGPISIACVGFICTLMVFIVFIRHNDTPLVKASGRELCYILLLGVFMSYVMTFIFIAKPSPIVCTLRRLGLGTSFAVCYSALLTKTNRIARIF-SGVKEGGAQRPRFISPSSQVFICLSLISVQLLLVSVWL--LVEVPGTRRFTTPEKRQTVILKCNVRDSSMLMSLSYDVVLVVLCTVYAFKTRKCPENFNEAKFIGFTMYTTCIIWLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVVLGCMFAPKVHIIMFQPQKNVTSH-RLNMNRFSVSGPATSYASHASVS-AHYVPTVCNGREIVDSTTS 882          
BLAST of Metabotropic glutamate receptor vs. Ensembl Zebrafish
Match: grm3 (glutamate receptor, metabotropic 3 [Source:ZFIN;Acc:ZDB-GENE-061009-13])

HSP 1 Score: 503.442 bits (1295), Expect = 1.396e-163
Identity = 309/884 (34.95%), Postives = 487/884 (55.09%), Query Frame = 3
Query:  129 IDGDIFLGGLMMVHLRSEEM-VCGVIAAEGGIQALEVMVYTINRVNE-MKILGDIKLGAYIKDDCDRDTYGLEQAVDFIKQS-SKLQ-TKSNCNEAKI----DSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKDNRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLR-ILQKIKFT---SLSGLEMEFTPITF-DGLPRYRILNFIKA-ANGIYSWVEIGNYTNQKLRIDYTKLKF-RGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQ--PQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDPVTHH---PSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGLRINIKNEQNQIDHLDNNSHTQMSYSHMILKDDQLNNIKNSVTS 2720
            IDGD+ LGGL  +H +   M  CG I  + GIQ LE M++ I+++N+ + +L  + LG +I D C RDTY LEQA++F++ S +K+  T+  C +       DS L  I GVIG S S  SI VA+LL+LF IPQIS+ STS  LS+K+R+ +F RT+P D +Q + M EI++   W YVS +  + +YG    +A ++  +   ICIATSE + R S   S  E   + L  K   +          ++F    +  + + A     L  SF W+ SDGW  +    K   F        +GAI +E  +  +  F  YF  LTP  N  NPWF +FWE  F+C L  +S T        CD+ L + K N     E+++ FV +AV A A AL  M+  +CA N ++  C +M    G  L R  L  + F    S +GLE +     + DG+ RY I N+     +  +++V++G +  + L ++   + + RG  + +P S C+  C+ ++ KK+  G   CWIC  C+ YE   +  T C  C  GQ+P  + T C  L + Y+      +IG +  + +  I  L  F +F+ +  TP+VKAS REL +ILL+G+ + +V++ +    P+ ++C+ ++ G+G SF++CYSALL K NRI RIF  G K+   Q+ R IS  SQ+FIC  ++S+Q++++   L  +   P T     P + +  ++   +  +S+++ + + ++L+++CTVYAF TR  PE FNE+K IGFTMY+TC++WL F+P +  T+    ++  T+C+S+++S  V L C+F PKV+ I+F+P++NV    R+N+             SH  +S +H +        I +S TS
Sbjct:   29 IDGDLVLGGLFPIHEKGMGMDECGRINEDRGIQRLEAMLFAIDQINQDVALLPGVVLGVHILDTCSRDTYALEQALEFVRASLTKVDDTEFICPDGSYALQEDSPL-AIAGVIGGSFSSVSIQVANLLRLFQIPQISYASTSAKLSDKSRYDYFARTVPPDFYQAKAMAEILRAFNWTYVSTVASEGDYGETGIEAFEQQARLRNICIATSEKVGRSSAKRSSYEAVVRQLLQKPTARV--------AVLFLRSDDARELIAAAAR--LNASFLWVASDGWGAQESIVKGNEFTA------DGAITLELAAHPIPDFNRYFQTLTPQINHRNPWFKDFWEQKFQCSLGGTSATGAGTPKPPCDQELVIDKSN--FEPESKIMFVVNAVYAMAHALHRMQRTLCA-NTTR-LCDAMRSLDGRKLYRDFLLHVNFRAPFSPAGLESQVKFDAYGDGVGRYNIFNYQSVPGSDKFAYVQVGEWA-ESLSLNEGLIGWPRG--ADVPTSQCSDPCAPNEMKKMQAGEYCCWICTPCEPYEYLPDEFT-CMPCAPGQWPRPDLTGCYDLPEDYIMWEDAWAIGPISIACVGFICTLMVFIVFIRHNDTPLVKASGRELCYILLLGVFMSYVMTFIFIAKPSPIVCTLRRLGLGTSFAVCYSALLTKTNRIARIF-SGVKEGGAQRPRFISPSSQVFICLSLISVQLLLVSVWL--LVEVPGTRRFTTPEKRQTVILKCNVRDSSMLMSLSYDVVLVVLCTVYAFKTRKCPENFNEAKFIGFTMYTTCIIWLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVVLGCMFAPKVHIIMFQPQKNVTSH-RLNMNRFSVSGPATSYASHASVS-AHYVPTVCNGREIVDSTTS 882          
BLAST of Metabotropic glutamate receptor vs. Ensembl Zebrafish
Match: grm3 (glutamate receptor, metabotropic 3 [Source:ZFIN;Acc:ZDB-GENE-061009-13])

HSP 1 Score: 503.442 bits (1295), Expect = 1.396e-163
Identity = 309/884 (34.95%), Postives = 487/884 (55.09%), Query Frame = 3
Query:  129 IDGDIFLGGLMMVHLRSEEM-VCGVIAAEGGIQALEVMVYTINRVNE-MKILGDIKLGAYIKDDCDRDTYGLEQAVDFIKQS-SKLQ-TKSNCNEAKI----DSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKDNRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLR-ILQKIKFT---SLSGLEMEFTPITF-DGLPRYRILNFIKA-ANGIYSWVEIGNYTNQKLRIDYTKLKF-RGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQ--PQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDPVTHH---PSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGLRINIKNEQNQIDHLDNNSHTQMSYSHMILKDDQLNNIKNSVTS 2720
            IDGD+ LGGL  +H +   M  CG I  + GIQ LE M++ I+++N+ + +L  + LG +I D C RDTY LEQA++F++ S +K+  T+  C +       DS L  I GVIG S S  SI VA+LL+LF IPQIS+ STS  LS+K+R+ +F RT+P D +Q + M EI++   W YVS +  + +YG    +A ++  +   ICIATSE + R S   S  E   + L  K   +          ++F    +  + + A     L  SF W+ SDGW  +    K   F        +GAI +E  +  +  F  YF  LTP  N  NPWF +FWE  F+C L  +S T        CD+ L + K N     E+++ FV +AV A A AL  M+  +CA N ++  C +M    G  L R  L  + F    S +GLE +     + DG+ RY I N+     +  +++V++G +  + L ++   + + RG  + +P S C+  C+ ++ KK+  G   CWIC  C+ YE   +  T C  C  GQ+P  + T C  L + Y+      +IG +  + +  I  L  F +F+ +  TP+VKAS REL +ILL+G+ + +V++ +    P+ ++C+ ++ G+G SF++CYSALL K NRI RIF  G K+   Q+ R IS  SQ+FIC  ++S+Q++++   L  +   P T     P + +  ++   +  +S+++ + + ++L+++CTVYAF TR  PE FNE+K IGFTMY+TC++WL F+P +  T+    ++  T+C+S+++S  V L C+F PKV+ I+F+P++NV    R+N+             SH  +S +H +        I +S TS
Sbjct:   29 IDGDLVLGGLFPIHEKGMGMDECGRINEDRGIQRLEAMLFAIDQINQDVALLPGVVLGVHILDTCSRDTYALEQALEFVRASLTKVDDTEFICPDGSYALQEDSPL-AIAGVIGGSFSSVSIQVANLLRLFQIPQISYASTSAKLSDKSRYDYFARTVPPDFYQAKAMAEILRAFNWTYVSTVASEGDYGETGIEAFEQQARLRNICIATSEKVGRSSAKRSSYEAVVRQLLQKPTARV--------AVLFLRSDDARELIAAAAR--LNASFLWVASDGWGAQESIVKGNEFTA------DGAITLELAAHPIPDFNRYFQTLTPQINHRNPWFKDFWEQKFQCSLGGTSATGAGTPKPPCDQELVIDKSN--FEPESKIMFVVNAVYAMAHALHRMQRTLCA-NTTR-LCDAMRSLDGRKLYRDFLLHVNFRAPFSPAGLESQVKFDAYGDGVGRYNIFNYQSVPGSDKFAYVQVGEWA-ESLSLNEGLIGWPRG--ADVPTSQCSDPCAPNEMKKMQAGEYCCWICTPCEPYEYLPDEFT-CMPCAPGQWPRPDLTGCYDLPEDYIMWEDAWAIGPISIACVGFICTLMVFIVFIRHNDTPLVKASGRELCYILLLGVFMSYVMTFIFIAKPSPIVCTLRRLGLGTSFAVCYSALLTKTNRIARIF-SGVKEGGAQRPRFISPSSQVFICLSLISVQLLLVSVWL--LVEVPGTRRFTTPEKRQTVILKCNVRDSSMLMSLSYDVVLVVLCTVYAFKTRKCPENFNEAKFIGFTMYTTCIIWLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVVLGCMFAPKVHIIMFQPQKNVTSH-RLNMNRFSVSGPATSYASHASVS-AHYVPTVCNGREIVDSTTS 882          
BLAST of Metabotropic glutamate receptor vs. Ensembl Zebrafish
Match: grm8a (glutamate receptor, metabotropic 8a [Source:ZFIN;Acc:ZDB-GENE-110421-2])

HSP 1 Score: 503.056 bits (1294), Expect = 3.284e-163
Identity = 308/848 (36.32%), Postives = 465/848 (54.83%), Query Frame = 3
Query:  129 IDGDIFLGGLMMVHLRSEEMV-CGVIAAEGGIQALEVMVYTINRVN-EMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIK---QSSKLQTKSNCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKD-NRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMC--APNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITF----DGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFI--FVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDP---------VTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAI---MVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGLR 2594
            +DGDI LGGL  VH R E  V CG +  E GI  LE M++ I+ +N +  +L ++ LGA I D C RDTY LEQ++ F++   +      +    +  I +    I GVIGA++S  SI VA++L+LF IPQIS+ ST+P LS+  R+ FF R +P D++Q Q ML+I+  + W YVS +  + NYG    +A  ++ ++   +CIA S  +PR+ +        DK++R     +  +   A  +I+F ++ ++   + + K  N T  F W+GSD W G +++         +E+  EGAI I P   TV  F+ YF + + S N+ N WF EFWE+ F CKL      P +     C    K+ +D+  +  E ++QFV DAV A A AL  M  + C   P +    C  M    G+ LL  ++ + F   +G     TP+ F    D   RY I  +         +  IG +TN KL ++   +++R     +P S C+  C   +RKK+  G+  CW C +C+ Y  F+ S   CE CP  Q PD+NRT C+ +  I L + H     + +F  +  I+A T F +  FV Y  TPIV+AS RE+S++LL GI LC+ ++ ++  TP+  +CSF++  +G      Y+ALL K NRI RIF +G+K     R IS  SQ+ I   ++S+Q  +LG  ++F    P          T  P +    L CD I   SL+  + + ++L++ CTVYA  TR +PE FNE+K IGFTMY+TC++WL FIP +  TA     ++++  TL +S+++SA V+L  L+ PKVY I+F P+QNV K  R
Sbjct:   41 LDGDIILGGLFPVHSRGERGVPCGELKKEKGIHRLEAMLFAIDLINKDPDLLPNVTLGARILDTCSRDTYALEQSLTFVQALIERDGSDVRCANGDQPIFAKPDKIVGVIGAAASSVSIMVANILRLFKIPQISYASTAPELSDNTRYDFFSRVVPPDSYQAQAMLDIVTAMGWNYVSTLASEGNYGESGVEAFVQISREMGGVCIAQSLKIPREPRAGEF----DKIIR-----RLLETPNARAIIMFANEDDIRRVLDSAKRSNQTGHFLWVGSDSW-GSKISPV-----IQQERVAEGAITILPKRATVDAFDRYFRSRSLSNNRRNVWFAEFWEENFGCKLGMHGKRPGS--LKKCTGLEKVGRDS-SYEQEGKVQFVMDAVYAMAHALHRMHREYCFGYPGL----CPRMSNINGKELLGYIRNVSFNGSAG-----TPVVFNQNGDAPGRYDIFQYQITNKSTAEYKVIGQWTN-KLHLNVNVMRWRTGDPRLPASVCSVPCQMGERKKIVKGVPCCWHCERCEGYH-FQASEFSCELCPYEQRPDRNRTGCVPIPIIKL-EWHSAWAAVPVFVAVLGILA-TSFVVVTFVRYNDTPIVRASGREMSYVLLTGIFLCYAITFLMIATPSLGICSFRRVFLGLGMCFSYAALLTKTNRIHRIFEQGKKSVAAPRFISPASQLVITFSLISVQ--LLGVFVWFAVDPPHTVVDYGEQRTSDPMKARGVLKCD-ISDLSLICSLGYSILLMVTCTVYAIKTRGVPETFNEAKPIGFTMYTTCIIWLAFIPIFFGTAQSAERMYIQTTTLTISLSLSASVSLGMLYMPKVYVIIFHPEQNVPKRKR 854          
BLAST of Metabotropic glutamate receptor vs. Ensembl Zebrafish
Match: grm6a (glutamate receptor, metabotropic 6a [Source:ZFIN;Acc:ZDB-GENE-060208-1])

HSP 1 Score: 501.516 bits (1290), Expect = 1.169e-162
Identity = 293/840 (34.88%), Postives = 450/840 (53.57%), Query Frame = 3
Query:  129 IDGDIFLGGLMMVHLRSEEMV-CGVIAAEGGIQALEVMVYTINRVN-EMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIK---QSSKLQTKSNCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKD-NRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKL--PNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITFDGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDPVTHH-------PSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVH---LRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGLR 2594
            I GDI LGGL  VH R    V CG I  E GI  LE M+Y ++++N + ++L +I LGA I D C RDTY LEQ++ F++   Q      + +  E  I      + GVIGAS S  SI VA++L+LF+IPQIS+ ST+P LS+ NR+ FF R +P D++Q Q M++I+K + W YVS +  + NYG     A  ++ ++   +CIA S  +PR+ K        DK+++     +  +   A GVIIF  + ++   + A +  NLT  F ++GSD W  +            +E   EGA+ I P   ++ GF+ YF   +   N+ N WF EFWED F CKL  P     P       C    ++S+D+  +  E ++QFV DAV A A AL  M  ++C    +   C  M   +G +LL  ++ + F   +G  + F     D   RY I  +         +  IG +TN  LR++  ++++ G S  IP S C+  C   +RKK+  G+  CW C  C  Y+ F+     CE CP    P  NRT C     I L    P ++  +  + + ++  L     F+ +  TPIV+A+ RELS++LL GI L ++++ ++   P  ++C+F++  +G   S+ YSA+L K NRI RIF +G+K     + IS  SQ+ I   ++S+Q++ +      +       +       P      L CD +   SL+  + + ++L++ CTVYA  +R +PE FNE+K IGFTMY+TC++WL F+P +  TA       ++  TL VS+++SA V+L  L+ PKVY I+F P+QNV+K  R
Sbjct:   58 IPGDITLGGLFPVHSRGPAGVPCGEIKKEKGIHRLEAMLYALDQINSDPELLPNITLGARILDTCSRDTYALEQSLTFVQALIQKDTSDIRCSNGEQPIIRKPERVVGVIGASGSSVSIMVANVLRLFEIPQISYASTAPELSDNNRYDFFSRVVPPDSYQAQAMVDIVKAMGWNYVSTLASEGNYGESGVDAFVQISRETGGLCIAQSMKIPREPKPGEF----DKIIK-----RLMETPNARGVIIFAHEDDIKQVLEAARRSNLTGHFKFVGSDSWGAKSSPI------LDQEDVAEGAVTILPKRASIDGFDQYFTTRSLENNRRNIWFAEFWEDDFRCKLTRPGIKIDPEKK---KCTGEERISRDS-HYEQEGKVQFVIDAVYAMAHALHNMHQELCPG--ATGVCDKMDPVEGRSLLNYIRAVNFNGSAGTAVLFNE-NGDAPGRYDIFQYQMTNTSSPGYRVIGQWTNN-LRLNVEEMQWTGGSRQIPDSVCSFPCRSGERKKMVKGVPCCWHCELCDGYQ-FQADEFNCEMCPFDMRPTLNRTACRPTPIIKLEWHSPWAVIPLFLAILGILATLFIIITFIRFNDTPIVRAAGRELSYVLLTGIFLIYLITFLMIAEPGTVVCAFRRLLLGLGMSITYSAMLTKTNRIYRIFEQGKKSVTPPKFISPTSQLMITFVLISVQVVGVFVWFGVMPPHTTVDYEELRPPNPELARGILKCD-MSDLSLICCLSYSIVLMVTCTVYAVKSRGVPETFNEAKPIGFTMYTTCIIWLAFVPIFFGTAQSTEKMFIQTTTLTVSMSLSASVSLGMLYIPKVYVIIFHPEQNVQKRKR 872          
BLAST of Metabotropic glutamate receptor vs. Ensembl Xenopus
Match: pias4 (protein inhibitor of activated STAT 4 [Source:Xenbase;Acc:XB-GENE-486199])

HSP 1 Score: 516.924 bits (1330), Expect = 7.493e-168
Identity = 301/843 (35.71%), Postives = 465/843 (55.16%), Query Frame = 3
Query:  132 DGDIFLGGLMMVHLRSEEMV-CGVIAAEGGIQALEVMVYTINRVN-EMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIK---QSSKLQTKSNCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKD-NRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITF----DGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDP---------VTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAI---MVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGLR 2594
            DGDI LGGL  VH +      CG +  E G+  LE M+Y ++++N + ++L ++ LGA I D C RDTY LEQ++ F++   Q      + +  +  I S    + GVIGAS+S  SI VA++L+LF IPQIS+ ST+P LS+ NR+ FF R +P D++Q Q M++I+K L W YVS +  + NYG    +A  ++ ++   +CIA S  +PR+ +        DKV+R     +  +   A G+IIF ++ ++   + A +  N T  F W+GSD W G + +   GL     E+  EGA+ I P   ++ GF+ YF + T   N+ N WF EFWED F+C+L  S+  P +     C    +++KD+  +  E ++QFV DAV A A AL  M   +C P  S   C  M   +G  LLR + ++ F   +G     TP+ F    D   RY I  +  A +   S+  IG +T + LR+   ++++ G  S IP S C+  C   +RKK+  G+  CW C  C  Y+ F+     C+ CP    P++NRT C     I L  T   ++  +  + + ++  L      V +  TPIV+AS RELS++LL GI L + ++ ++   P   +C+ ++  +G    + Y+ALL K NRI RIF +G++     R IS  SQ+ I   ++ +Q++  GT ++     P          T +P      L CD +   SLV  +++ ++L++ CTVYA   R +PE FNE+K IGFTMY+TC+VWL F+P +  TA     ++++  TL VS+++SA V+L  L+ PKVY I+F P+QNV+K  R
Sbjct:   93 DGDITLGGLFPVHAKGPAGTPCGEVKKEAGVHRLEAMLYALDQINGDPELLPNLTLGARILDTCSRDTYALEQSLTFVQALIQKDTSDIRCSNGDPPILSRPERVVGVIGASASSVSIMVANVLRLFSIPQISYASTAPELSDNNRYDFFSRVVPPDSYQAQAMVDIVKALGWNYVSTLASEGNYGESGVEAFMQISREAGGVCIAQSIKIPREPRPGEF----DKVIR-----RLLETPNARGIIIFANEDDIKRVLEASQRANQTGHFLWVGSDSW-GSKTSPVLGL-----EEVAEGAVTILPKRASIEGFDQYFTSRTLENNRRNIWFAEFWEDDFKCRLTRSAARPEDPRRK-CTGGERIAKDS-AYEQEGKVQFVIDAVYAMAHALHNMHVDLC-PGHS-GVCDKMDPIEGRLLLRYIHRVNFNGSAG-----TPVMFNENGDAPGRYDIFQYQMANDSAPSYRVIGQWT-EYLRLSIEEMQWSGGQSDIPSSVCSLPCQPGERKKMVKGVPCCWHCELCDGYQ-FQLDDFTCQLCPFDMRPNENRTACRATPIIKLEWTSAWAVLPLFLAIVGILSTLFVVGTLVRFNDTPIVRASGRELSYVLLTGIFLMYAITFLMMGEPGVAVCALRRLFLGLGMCISYAALLTKTNRIYRIFEQGKRSVTPPRFISPASQLVITFSLIGVQLV--GTSVWLAVLPPHSFIDYEEQRTPNPENARGVLKCD-MSDLSLVSCLMYSILLMVTCTVYAVKARGVPENFNEAKPIGFTMYTTCIVWLAFVPIFFGTAQSAEKIYIQTTTLTVSMSLSASVSLGMLYVPKVYVIIFHPEQNVQKRKR 906          
BLAST of Metabotropic glutamate receptor vs. Ensembl Xenopus
Match: ENSXETT00000053239.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:2:79387181:79787707:-1 gene:ENSXETG00000017572.1 transcript:ENSXETT00000053239.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 514.227 bits (1323), Expect = 1.570e-167
Identity = 319/849 (37.57%), Postives = 476/849 (56.07%), Query Frame = 3
Query:  129 IDGDIFLGGLMMVHLR-SEEMVCGVIAAEGGIQALEVMVYTINRVN-EMKILGDIKLGAYIKDDCDRDTYGLEQAVDFI-----KQSSKLQTKSNCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKA-LQEVFKDNRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITF----DGLPRYRILNFIKAANGIYSWVEIGNYTNQ-KLRIDYTKLKFRGDSSV--IPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFV--NSDPV-------THHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAI---MVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGLR 2594
            IDGD+ LGGL  VH R S+   CG +  E GI  LE M++ ++R+N ++++L +I LGA I D C RDT+ LEQ++ F+     K  ++++  S  N   I +    + GVIGASSS  SI VA++L+LF IPQ+S+ ST+P LS+ +R+ FF R +PSD +Q Q M++I+K L+W YVS +  + +YG    +A +Q+  +D  +C+A S  +PRD+K        DK++R     +  +   A  VIIF S+ ++   + A K  N T  F W+GSD W G +++         +E+  EGA+ I P   TV GF+ YF + T   N+ N WF EFWED F C+L  +S          C    ++   +  +  E ++QFV DAV + A AL  M   +C  ++    C  M    G  LL+ ++ + FT ++G     TP+TF    D   RY I  + +  NG   +  IG + +   L+ID        D  +  IP S C+  C   +RKK+  GI  CW C +C  Y+   ++ T C+ CPL   P+ N T C+ +  I L  + P ++  ++ + + +I  L     F+ Y  TPIVKAS RELS++LL GI LC+V + ++   P    CS ++  +G   S+ Y+ALL K NRI RIF +G++     R IS  SQ+ I A + SIQ  +LG L++F+   S P+       T  P      L CD I   SL+ ++ + M+L++ CTVYA  TR +PE FNE+K IGFTMY+TC++WL FIP +  TA     +H++  TL +S+++SA V+L  L+ PKVY ILF P+QNV K  R
Sbjct:   28 IDGDLILGGLFPVHGRGSDGRACGELKKEKGIHRLEAMLFALDRINSDLELLPNITLGARILDTCSRDTHALEQSLSFVQPLIDKDRAEVRCLSGGNP--IIAQPERVIGVIGASSSSVSIMVANILRLFKIPQVSYASTAPELSDNSRYDFFSRVVPSDTYQAQAMVDIVKALKWSYVSTLASEGSYGESGVEAFIQKSREDGSLCVAQSVKIPRDAKPGDF----DKIIR-----RLLETSNARAVIIFASEDDIRRVLAAAKRANQTGHFMWVGSDSW-GSKISPVH-----LQEEVAEGAVTILPKRATVKGFDRYFTSRTLDNNRRNVWFAEFWEDNFHCRLSRNS-LRRGGHGKKCTNQERIGVGS-AYEQEGKVQFVIDAVYSMAYALHTMHKTVCPGSV--GLCSRMDPVDGVELLKYIRSVNFTGIAG-----TPVTFNENGDAPGRYEIYQY-QINNGSTEYRVIGQWADHLHLKIDQMHWP---DFHLPKIPPSICSQPCRPGERKKVVKGIPCCWHCERCDGYQYQLDTYT-CKRCPLHMRPNVNHTSCIPIPIIKLEWSSPWAVVPLLLAVLGIIATLVVVGTFMRYNDTPIVKASGRELSYVLLSGIFLCYVNTFIMVAQPGFGTCSLRRVFLGLGMSISYAALLTKTNRIYRIFEQGKRSVSAPRYISPSSQLVITASLSSIQ--LLGVLVWFLVDPSRPIVDYENQRTPDPQLTRGVLKCD-ISDLSLICLLGYSMLLMVTCTVYAIKTRGVPETFNEAKPIGFTMYTTCIIWLAFIPIFFGTAQSAEKMHIQTTTLTISVSLSASVSLGMLYMPKVYVILFHPEQNVPKRKR 842          
BLAST of Metabotropic glutamate receptor vs. Ensembl Xenopus
Match: pias4 (protein inhibitor of activated STAT 4 [Source:Xenbase;Acc:XB-GENE-486199])

HSP 1 Score: 512.686 bits (1319), Expect = 1.913e-167
Identity = 300/853 (35.17%), Postives = 465/853 (54.51%), Query Frame = 3
Query:  102 WPFKNQVALIDGDIFLGGLMMVHLRSEEMV-CGVIAAEGGIQALEVMVYTINRVN-EMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIK---QSSKLQTKSNCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKD-NRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITF----DGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDP---------VTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAI---MVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGLR 2594
            W      AL   DI LGGL  VH +      CG +  E G+  LE M+Y ++++N + ++L ++ LGA I D C RDTY LEQ++ F++   Q      + +  +  I S    + GVIGAS+S  SI VA++L+LF IPQIS+ ST+P LS+ NR+ FF R +P D++Q Q M++I+K L W YVS +  + NYG    +A  ++ ++   +CIA S  +PR+ +        DKV+R     +  +   A G+IIF ++ ++   + A +  N T  F W+GSD W G + +   GL     E+  EGA+ I P   ++ GF+ YF + T   N+ N WF EFWED F+C+L  S+  P +     C    +++KD+  +  E ++QFV DAV A A AL  M   +C  +     C  M   +G  LLR + ++ F   +G     TP+ F    D   RY I  +  A +   S+  IG +T + LR+   ++++ G  S IP S C+  C   +RKK+  G+  CW C  C  Y+ F+     C+ CP    P++NRT C     I L  T   ++  +  + + ++  L      V +  TPIV+AS RELS++LL GI L + ++ ++   P   +C+ ++  +G    + Y+ALL K NRI RIF +G++     R IS  SQ+ I   ++ +Q++  GT ++     P          T +P      L CD +   SLV  +++ ++L++ CTVYA   R +PE FNE+K IGFTMY+TC+VWL F+P +  TA     ++++  TL VS+++SA V+L  L+ PKVY I+F P+QNV+K  R
Sbjct:   10 WLRGGHAALWLSDITLGGLFPVHAKGPAGTPCGEVKKEAGVHRLEAMLYALDQINGDPELLPNLTLGARILDTCSRDTYALEQSLTFVQALIQKDTSDIRCSNGDPPILSRPERVVGVIGASASSVSIMVANVLRLFSIPQISYASTAPELSDNNRYDFFSRVVPPDSYQAQAMVDIVKALGWNYVSTLASEGNYGESGVEAFMQISREAGGVCIAQSIKIPREPRPGEF----DKVIR-----RLLETPNARGIIIFANEDDIKRVLEASQRANQTGHFLWVGSDSW-GSKTSPVLGL-----EEVAEGAVTILPKRASIEGFDQYFTSRTLENNRRNIWFAEFWEDDFKCRLTRSAARPEDPRRK-CTGGERIAKDS-AYEQEGKVQFVIDAVYAMAHALHNMHVDLCPGH--SGVCDKMDPIEGRLLLRYIHRVNFNGSAG-----TPVMFNENGDAPGRYDIFQYQMANDSAPSYRVIGQWT-EYLRLSIEEMQWSGGQSDIPSSVCSLPCQPGERKKMVKGVPCCWHCELCDGYQ-FQLDDFTCQLCPFDMRPNENRTACRATPIIKLEWTSAWAVLPLFLAIVGILSTLFVVGTLVRFNDTPIVRASGRELSYVLLTGIFLMYAITFLMMGEPGVAVCALRRLFLGLGMCISYAALLTKTNRIYRIFEQGKRSVTPPRFISPASQLVITFSLIGVQLV--GTSVWLAVLPPHSFIDYEEQRTPNPENARGVLKCD-MSDLSLVSCLMYSILLMVTCTVYAVKARGVPENFNEAKPIGFTMYTTCIVWLAFVPIFFGTAQSAEKIYIQTTTLTVSMSLSASVSLGMLYVPKVYVIIFHPEQNVQKRKR 833          
BLAST of Metabotropic glutamate receptor vs. Ensembl Xenopus
Match: pias4 (protein inhibitor of activated STAT 4 [Source:Xenbase;Acc:XB-GENE-486199])

HSP 1 Score: 513.072 bits (1320), Expect = 2.528e-167
Identity = 300/853 (35.17%), Postives = 465/853 (54.51%), Query Frame = 3
Query:  102 WPFKNQVALIDGDIFLGGLMMVHLRSEEMV-CGVIAAEGGIQALEVMVYTINRVN-EMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIK---QSSKLQTKSNCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKD-NRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITF----DGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDP---------VTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAI---MVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGLR 2594
            W      AL   DI LGGL  VH +      CG +  E G+  LE M+Y ++++N + ++L ++ LGA I D C RDTY LEQ++ F++   Q      + +  +  I S    + GVIGAS+S  SI VA++L+LF IPQIS+ ST+P LS+ NR+ FF R +P D++Q Q M++I+K L W YVS +  + NYG    +A  ++ ++   +CIA S  +PR+ +        DKV+R     +  +   A G+IIF ++ ++   + A +  N T  F W+GSD W G + +   GL     E+  EGA+ I P   ++ GF+ YF + T   N+ N WF EFWED F+C+L  S+  P +     C    +++KD+  +  E ++QFV DAV A A AL  M   +C  +     C  M   +G  LLR + ++ F   +G     TP+ F    D   RY I  +  A +   S+  IG +T + LR+   ++++ G  S IP S C+  C   +RKK+  G+  CW C  C  Y+ F+     C+ CP    P++NRT C     I L  T   ++  +  + + ++  L      V +  TPIV+AS RELS++LL GI L + ++ ++   P   +C+ ++  +G    + Y+ALL K NRI RIF +G++     R IS  SQ+ I   ++ +Q++  GT ++     P          T +P      L CD +   SLV  +++ ++L++ CTVYA   R +PE FNE+K IGFTMY+TC+VWL F+P +  TA     ++++  TL VS+++SA V+L  L+ PKVY I+F P+QNV+K  R
Sbjct:   16 WLRGGHAALWLSDITLGGLFPVHAKGPAGTPCGEVKKEAGVHRLEAMLYALDQINGDPELLPNLTLGARILDTCSRDTYALEQSLTFVQALIQKDTSDIRCSNGDPPILSRPERVVGVIGASASSVSIMVANVLRLFSIPQISYASTAPELSDNNRYDFFSRVVPPDSYQAQAMVDIVKALGWNYVSTLASEGNYGESGVEAFMQISREAGGVCIAQSIKIPREPRPGEF----DKVIR-----RLLETPNARGIIIFANEDDIKRVLEASQRANQTGHFLWVGSDSW-GSKTSPVLGL-----EEVAEGAVTILPKRASIEGFDQYFTSRTLENNRRNIWFAEFWEDDFKCRLTRSAARPEDPRRK-CTGGERIAKDS-AYEQEGKVQFVIDAVYAMAHALHNMHVDLCPGH--SGVCDKMDPIEGRLLLRYIHRVNFNGSAG-----TPVMFNENGDAPGRYDIFQYQMANDSAPSYRVIGQWT-EYLRLSIEEMQWSGGQSDIPSSVCSLPCQPGERKKMVKGVPCCWHCELCDGYQ-FQLDDFTCQLCPFDMRPNENRTACRATPIIKLEWTSAWAVLPLFLAIVGILSTLFVVGTLVRFNDTPIVRASGRELSYVLLTGIFLMYAITFLMMGEPGVAVCALRRLFLGLGMCISYAALLTKTNRIYRIFEQGKRSVTPPRFISPASQLVITFSLIGVQLV--GTSVWLAVLPPHSFIDYEEQRTPNPENARGVLKCD-MSDLSLVSCLMYSILLMVTCTVYAVKARGVPENFNEAKPIGFTMYTTCIVWLAFVPIFFGTAQSAEKIYIQTTTLTVSMSLSASVSLGMLYVPKVYVIIFHPEQNVQKRKR 839          
BLAST of Metabotropic glutamate receptor vs. Ensembl Xenopus
Match: GRM8 (glutamate receptor, metabotropic 8 [Source:NCBI gene;Acc:100497088])

HSP 1 Score: 512.301 bits (1318), Expect = 1.355e-166
Identity = 309/848 (36.44%), Postives = 465/848 (54.83%), Query Frame = 3
Query:  129 IDGDIFLGGLMMVHLRSEEMV-CGVIAAEGGIQALEVMVYTINRVN-EMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIK---QSSKLQTKSNCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKD-NRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEI-EGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQ--LQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITF----DGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFI-FVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDP---------VTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAI---MVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGLR 2594
            ++GDI LGGL  VH R E  V CG +  E GI  LE M+Y I+++N +  +L +I LG  I D C RDTY LEQ++ F++   +      +    +  I +    I GVIGA++S  SI VA++L+LF IPQIS+ ST+P LS+ +R+ F+ R +P D++Q Q M++I+  L W YVS +  + NYG    +A  ++ ++   +CIA S  +PR+ K+       DK++R     +  +   A  +IIF ++ ++   + A K +N T  F W+GSD W G ++A         +++EI EGA+ I P   ++ GF+ YF + + + N+ N WF EFWE+ F CKL   S    NN    C     L +     SFE +  +QFV DAV + A AL  M   +C   I    C  M    G+ LL  ++ + F   +G     TP+TF    D   RY I  + +  N    +  IG +TNQ L ++   +++       P S C+  C   +RKK   G+  CW C +C+ Y  ++     CE CPL Q P+ NRT C  +  I L    P ++ + +F  I  I+A T   + FV Y  TPIV+AS RELS++LL GI LC+ ++ ++  TP   +CS ++  +G      Y+ALL K NRI RIF +G+K     + IS  SQ+ I   ++S+Q+I  G  ++FV   P          T  P      L CD I   SL+  + + ++L++ CTVYA  TR +PE FNE+K IGFTMY+TC++WL FIP +  TA     ++++  TL +S+++SA V+L  L+ PKVY I+  P+QNV+K  R
Sbjct:   49 VEGDIILGGLFPVHARGERGVPCGDLKKEKGIHRLEAMMYAIDQINKDSDLLPNITLGVRILDTCSRDTYALEQSLTFVQALIEKDASDVRCANGDPPIFTKPDKIVGVIGAAASSVSIMVANILRLFKIPQISYASTAPELSDNSRYDFYSRVVPPDSYQAQAMVDIVTALGWNYVSTLASEGNYGESGVEAFTQLSREIGGVCIAQSLKIPREPKVGEF----DKIIR-----RLLETPNARAIIIFANEDDIRRILEAAKRNNQTGHFLWIGSDSW-GSKIA------PVYQQEEIAEGAVTILPKRASIDGFDRYFRSRSLANNRRNVWFAEFWEENFGCKL--GSHGKRNNHFKKCT---GLERIGRHSSFEQEGKVQFVIDAVYSMAHALNNMHKDLCPGYI--GLCPRMKTIDGKELLSYIRAVNFNGSAG-----TPVTFNENGDAPGRYDIYQY-QMTNKTAEYKVIGQWTNQ-LHLNVEDMQWTSREHTQPTSVCSLPCKPGERKKTVKGVPCCWHCERCEGYH-YQVDELTCELCPLDQKPNANRTGCQLIPIIKLEWHSPWAV-VPVFIAILGIVATTFVIVTFVRYNDTPIVRASGRELSYVLLTGIFLCYAITFLMIGTPDMFVCSLRRIFLGLGMCFSYAALLTKTNRIHRIFEQGKKSVTAPKFISPASQLVITFSLISVQLI--GVFIWFVVDPPHIIIDYGEQRTPDPINARGVLKCD-ISELSLICSLGYSILLMVTCTVYAIKTRGVPETFNEAKPIGFTMYTTCIIWLAFIPIFFGTAQSAERMYIQTTTLTISMSLSASVSLGMLYMPKVYIIILHPEQNVQKRKR 861          
BLAST of Metabotropic glutamate receptor vs. Ensembl Mouse
Match: Grm8 (glutamate receptor, metabotropic 8 [Source:MGI Symbol;Acc:MGI:1351345])

HSP 1 Score: 521.931 bits (1343), Expect = 1.724e-170
Identity = 311/846 (36.76%), Postives = 473/846 (55.91%), Query Frame = 3
Query:  129 IDGDIFLGGLMMVHLRSEEMV-CGVIAAEGGIQALEVMVYTINRVN-EMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIK---QSSKLQTKSNCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKD-NRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEI-EGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITF----DGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFI-FVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDP---------VTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAI---MVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGLR 2594
            +DGDI LGGL  VH + E  V CG +  E GI  LE M+Y I+++N +  +L +I LG  I D C RDTY LEQ++ F++   +      K    +  I +    I+GVIGA++S  SI VA++L+LF IPQIS+ ST+P LS+  R+ FF R +P D++Q Q M++I+  L W YVS +  + NYG    +A  ++ ++   +CIA S+ +PR+ +     E++  + RL       +   A  VI+F ++ ++   + A K+ N +  F W+GSD W G ++A         +++EI EGA+ I P   ++ GF+ YF + T + N+ N WF EFWE+ F CKL   S    N+    C    ++++D+  +  E ++QFV DAV + A AL  M  ++C   I    C  M+   G+ LL  ++ + F   +G     TP+TF    D   RY I  + +  N    +  IG++TNQ L +    +++       P S C+  C   +RKK   G+  CW C +C+ Y  ++     CE CPL Q P+ NRT C R+  I L    P ++ + +F  I  IIA T   + FV Y  TPIV+AS RELS++LL GI LC+ ++ ++   P  ++CSF++  +G      Y+ALL K NRI RIF +G+K     + IS  SQ+ I   ++S+Q  +LG  ++FV   P          T  P      L CD I   SL+  + + ++L++ CTVYA  TR +PE FNE+K IGFTMY+TC++WL FIP +  TA     ++++  TL VS+++SA V+L  L+ PKVY I+F P+QNV+K  R
Sbjct:   42 LDGDIILGGLFPVHAKGERGVPCGDLKKEKGIHRLEAMLYAIDQINKDPDLLSNITLGVRILDTCSRDTYALEQSLTFVQALIEKDASDVKCANGDPPIFTKPDKISGVIGAAASSVSIMVANILRLFKIPQISYASTAPELSDNTRYDFFSRVVPPDSYQAQAMVDIVTALGWNYVSTLASEGNYGESGVEAFTQISREIGGVCIAQSQKIPREPRPG---EFEKIIKRL------LETPNARAVIMFANEDDIRRILEAAKKLNQSGHFLWIGSDSW-GSKIA------PVYQQEEIAEGAVTILPKRASIDGFDRYFRSRTLANNRRNVWFAEFWEENFGCKL--GSHGKRNSHIKKCTGLERIARDS-SYEQEGKVQFVIDAVYSMAYALHNMHKELCPGYI--GLCPRMVTIDGKELLGYIRAVNFNGSAG-----TPVTFNENGDAPGRYDIFQY-QINNKSTEYKIIGHWTNQ-LHLKVEDMQWANREHTHPASVCSLPCKPGERKKTVKGVPCCWHCERCEGYN-YQVDELSCELCPLDQRPNINRTGCQRIPIIKLEWHSPWAV-VPVFIAILGIIATTFVIVTFVRYNDTPIVRASGRELSYVLLTGIFLCYSITFLMIAAPDTIICSFRRIFLGLGMCFSYAALLTKTNRIHRIFEQGKKSVTAPKFISPASQLVITFSLISVQ--LLGVFVWFVVDPPHTIIDYGEQRTLDPENARGVLKCD-ISDLSLICSLGYSILLMVTCTVYAIKTRGVPETFNEAKPIGFTMYTTCIIWLAFIPIFFGTAQSAEKMYIQTTTLTVSMSLSASVSLGMLYMPKVYIIIFHPEQNVQKRKR 854          
BLAST of Metabotropic glutamate receptor vs. Ensembl Mouse
Match: Grm8 (glutamate receptor, metabotropic 8 [Source:MGI Symbol;Acc:MGI:1351345])

HSP 1 Score: 521.931 bits (1343), Expect = 1.724e-170
Identity = 311/846 (36.76%), Postives = 473/846 (55.91%), Query Frame = 3
Query:  129 IDGDIFLGGLMMVHLRSEEMV-CGVIAAEGGIQALEVMVYTINRVN-EMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIK---QSSKLQTKSNCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKD-NRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEI-EGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITF----DGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFI-FVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDP---------VTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAI---MVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGLR 2594
            +DGDI LGGL  VH + E  V CG +  E GI  LE M+Y I+++N +  +L +I LG  I D C RDTY LEQ++ F++   +      K    +  I +    I+GVIGA++S  SI VA++L+LF IPQIS+ ST+P LS+  R+ FF R +P D++Q Q M++I+  L W YVS +  + NYG    +A  ++ ++   +CIA S+ +PR+ +     E++  + RL       +   A  VI+F ++ ++   + A K+ N +  F W+GSD W G ++A         +++EI EGA+ I P   ++ GF+ YF + T + N+ N WF EFWE+ F CKL   S    N+    C    ++++D+  +  E ++QFV DAV + A AL  M  ++C   I    C  M+   G+ LL  ++ + F   +G     TP+TF    D   RY I  + +  N    +  IG++TNQ L +    +++       P S C+  C   +RKK   G+  CW C +C+ Y  ++     CE CPL Q P+ NRT C R+  I L    P ++ + +F  I  IIA T   + FV Y  TPIV+AS RELS++LL GI LC+ ++ ++   P  ++CSF++  +G      Y+ALL K NRI RIF +G+K     + IS  SQ+ I   ++S+Q  +LG  ++FV   P          T  P      L CD I   SL+  + + ++L++ CTVYA  TR +PE FNE+K IGFTMY+TC++WL FIP +  TA     ++++  TL VS+++SA V+L  L+ PKVY I+F P+QNV+K  R
Sbjct:   42 LDGDIILGGLFPVHAKGERGVPCGDLKKEKGIHRLEAMLYAIDQINKDPDLLSNITLGVRILDTCSRDTYALEQSLTFVQALIEKDASDVKCANGDPPIFTKPDKISGVIGAAASSVSIMVANILRLFKIPQISYASTAPELSDNTRYDFFSRVVPPDSYQAQAMVDIVTALGWNYVSTLASEGNYGESGVEAFTQISREIGGVCIAQSQKIPREPRPG---EFEKIIKRL------LETPNARAVIMFANEDDIRRILEAAKKLNQSGHFLWIGSDSW-GSKIA------PVYQQEEIAEGAVTILPKRASIDGFDRYFRSRTLANNRRNVWFAEFWEENFGCKL--GSHGKRNSHIKKCTGLERIARDS-SYEQEGKVQFVIDAVYSMAYALHNMHKELCPGYI--GLCPRMVTIDGKELLGYIRAVNFNGSAG-----TPVTFNENGDAPGRYDIFQY-QINNKSTEYKIIGHWTNQ-LHLKVEDMQWANREHTHPASVCSLPCKPGERKKTVKGVPCCWHCERCEGYN-YQVDELSCELCPLDQRPNINRTGCQRIPIIKLEWHSPWAV-VPVFIAILGIIATTFVIVTFVRYNDTPIVRASGRELSYVLLTGIFLCYSITFLMIAAPDTIICSFRRIFLGLGMCFSYAALLTKTNRIHRIFEQGKKSVTAPKFISPASQLVITFSLISVQ--LLGVFVWFVVDPPHTIIDYGEQRTLDPENARGVLKCD-ISDLSLICSLGYSILLMVTCTVYAIKTRGVPETFNEAKPIGFTMYTTCIIWLAFIPIFFGTAQSAEKMYIQTTTLTVSMSLSASVSLGMLYMPKVYIIIFHPEQNVQKRKR 854          
BLAST of Metabotropic glutamate receptor vs. Ensembl Mouse
Match: Grm8 (glutamate receptor, metabotropic 8 [Source:MGI Symbol;Acc:MGI:1351345])

HSP 1 Score: 521.161 bits (1341), Expect = 3.754e-170
Identity = 311/846 (36.76%), Postives = 473/846 (55.91%), Query Frame = 3
Query:  129 IDGDIFLGGLMMVHLRSEEMV-CGVIAAEGGIQALEVMVYTINRVN-EMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIK---QSSKLQTKSNCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKD-NRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEI-EGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITF----DGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFI-FVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDP---------VTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAI---MVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGLR 2594
            +DGDI LGGL  VH + E  V CG +  E GI  LE M+Y I+++N +  +L +I LG  I D C RDTY LEQ++ F++   +      K    +  I +    I+GVIGA++S  SI VA++L+LF IPQIS+ ST+P LS+  R+ FF R +P D++Q Q M++I+  L W YVS +  + NYG    +A  ++ ++   +CIA S+ +PR+ +     E++  + RL       +   A  VI+F ++ ++   + A K+ N +  F W+GSD W G ++A         +++EI EGA+ I P   ++ GF+ YF + T + N+ N WF EFWE+ F CKL   S    N+    C    ++++D+  +  E ++QFV DAV + A AL  M  ++C   I    C  M+   G+ LL  ++ + F   +G     TP+TF    D   RY I  + +  N    +  IG++TNQ L +    +++       P S C+  C   +RKK   G+  CW C +C+ Y  ++     CE CPL Q P+ NRT C R+  I L    P ++ + +F  I  IIA T   + FV Y  TPIV+AS RELS++LL GI LC+ ++ ++   P  ++CSF++  +G      Y+ALL K NRI RIF +G+K     + IS  SQ+ I   ++S+Q  +LG  ++FV   P          T  P      L CD I   SL+  + + ++L++ CTVYA  TR +PE FNE+K IGFTMY+TC++WL FIP +  TA     ++++  TL VS+++SA V+L  L+ PKVY I+F P+QNV+K  R
Sbjct:   42 LDGDIILGGLFPVHAKGERGVPCGDLKKEKGIHRLEAMLYAIDQINKDPDLLSNITLGVRILDTCSRDTYALEQSLTFVQALIEKDASDVKCANGDPPIFTKPDKISGVIGAAASSVSIMVANILRLFKIPQISYASTAPELSDNTRYDFFSRVVPPDSYQAQAMVDIVTALGWNYVSTLASEGNYGESGVEAFTQISREIGGVCIAQSQKIPREPRPG---EFEKIIKRL------LETPNARAVIMFANEDDIRRILEAAKKLNQSGHFLWIGSDSW-GSKIA------PVYQQEEIAEGAVTILPKRASIDGFDRYFRSRTLANNRRNVWFAEFWEENFGCKL--GSHGKRNSHIKKCTGLERIARDS-SYEQEGKVQFVIDAVYSMAYALHNMHKELCPGYI--GLCPRMVTIDGKELLGYIRAVNFNGSAG-----TPVTFNENGDAPGRYDIFQY-QINNKSTEYKIIGHWTNQ-LHLKVEDMQWANREHTHPASVCSLPCKPGERKKTVKGVPCCWHCERCEGYN-YQVDELSCELCPLDQRPNINRTGCQRIPIIKLEWHSPWAV-VPVFIAILGIIATTFVIVTFVRYNDTPIVRASGRELSYVLLTGIFLCYSITFLMIAAPDTIICSFRRIFLGLGMCFSYAALLTKTNRIHRIFEQGKKSVTAPKFISPASQLVITFSLISVQ--LLGVFVWFVVDPPHTIIDYGEQRTLDPENARGVLKCD-ISDLSLICSLGYSILLMVTCTVYAIKTRGVPETFNEAKPIGFTMYTTCIIWLAFIPIFFGTAQSAEKMYIQTTTLTVSMSLSASVSLGMLYMPKVYIIIFHPEQNVQKRKR 854          
BLAST of Metabotropic glutamate receptor vs. Ensembl Mouse
Match: Grm7 (glutamate receptor, metabotropic 7 [Source:MGI Symbol;Acc:MGI:1351344])

HSP 1 Score: 518.079 bits (1333), Expect = 8.559e-169
Identity = 300/845 (35.50%), Postives = 458/845 (54.20%), Query Frame = 3
Query:  129 IDGDIFLGGLMMVHLRSEEMV-CGVIAAEGGIQALEVMVYTINRVN-EMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIK---QSSKLQTKSNCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKD-NRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTF-DGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITF----DGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDP---------VTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAI---MVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGLR 2594
            I+GD+ LGGL  VH +    V CG I  E GI  LE M+Y ++++N +  +L ++ LGA I D C RDTY LEQ++ F++   Q      +    E  +      + GVIGAS S  SI VA++L+LF IPQIS+ ST+P LS+  R+ FF R +P D+ Q Q M++I+K L W YVS +  + +YG +  ++  ++ K+   +CIA S  +P        +E KD+ +   + +K   D   +  V+IF +D+++   + A K  +    F W+GSD W  +     +       E   EGAI I+P   TV GF+ YF + T   N+ N WF E+WE+ F CKL   S +   +    C    ++ KD+  +  E ++QFV DAV A A AL  M   +CA    +  C  M Q  G+ LL+ ++ + F   +G     TP+ F    D   RY I  +         +  IG +T++ L+++   +++      IP S CT  C   QRKK   G   CW C  C  Y+ ++     C+ CP  Q P++NRT C  +  I L    P ++  +  + + +I  +     F+ Y  TPIV+AS RELS++LL GI LC++++ ++   P   +CSF++  +G    + Y+ALL K NRI RIF +G+K     RLIS  SQ+ I + ++S+Q  +LG  ++F    P          T +P +    L CD I    ++  + + ++L++ CTVYA  TR +PE FNE+K IGFTMY+TC+VWL FIP +  TA     ++++  TL +S+N+SA VAL  L+ PKVY I+F P+ NV+K  R
Sbjct:   45 IEGDVTLGGLFPVHAKGPSGVPCGDIKRENGIHRLEAMLYALDQINSDPNLLPNVTLGARILDTCSRDTYALEQSLTFVQALIQKDTSDVRCTNGEPPVFVKPEKVVGVIGASGSSVSIMVANILRLFQIPQISYASTAPELSDDRRYDFFSRVVPPDSFQAQAMVDIVKALGWNYVSTLASEGSYGEKGVESFTQISKEAGGLCIAQSVRIP--------QERKDRTIDFDRIIKQLLDTPNSRAVVIFANDEDIKQILAAAKRADQVGHFLWVGSDSWGSKINPLHQ------HEDIAEGAITIQPKRATVEGFDAYFTSRTLENNRRNVWFAEYWEENFNCKL-TISGSKKEDTDRKCTGQERIGKDS-NYEQEGKVQFVIDAVYAMAHALHHMNKDLCAD--YRGVCPEMEQAGGKKLLKYIRNVNFNGSAG-----TPVMFNKNGDAPGRYDIFQYQTTNTTNPGYRLIGQWTDE-LQLNIEDMQWGKGVREIPPSVCTLPCKPGQRKKTQKGTPCCWTCEPCDGYQ-YQFDEMTCQHCPYDQRPNENRTGCQNIPIIKLEWHSPWAVIPVFLAMLGIIATIFVMATFIRYNDTPIVRASGRELSYVLLTGIFLCYIITFLMIAKPDVAVCSFRRVFLGLGMCISYAALLTKTNRIYRIFEQGKKSVTAPRLISPTSQLAITSSLISVQ--LLGVFIWFGVDPPNIIIDYDEHKTMNPEQARGVLKCD-ITDLQIICSLGYSILLMVTCTVYAIKTRGVPENFNEAKPIGFTMYTTCIVWLAFIPIFFGTAQSAEKLYIQTTTLTISMNLSASVALGMLYMPKVYIIIFHPELNVQKRKR 861          
BLAST of Metabotropic glutamate receptor vs. Ensembl Mouse
Match: Grm7 (glutamate receptor, metabotropic 7 [Source:MGI Symbol;Acc:MGI:1351344])

HSP 1 Score: 518.079 bits (1333), Expect = 9.557e-169
Identity = 300/845 (35.50%), Postives = 458/845 (54.20%), Query Frame = 3
Query:  129 IDGDIFLGGLMMVHLRSEEMV-CGVIAAEGGIQALEVMVYTINRVN-EMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIK---QSSKLQTKSNCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKD-NRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTF-DGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITF----DGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDP---------VTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAI---MVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGLR 2594
            I+GD+ LGGL  VH +    V CG I  E GI  LE M+Y ++++N +  +L ++ LGA I D C RDTY LEQ++ F++   Q      +    E  +      + GVIGAS S  SI VA++L+LF IPQIS+ ST+P LS+  R+ FF R +P D+ Q Q M++I+K L W YVS +  + +YG +  ++  ++ K+   +CIA S  +P        +E KD+ +   + +K   D   +  V+IF +D+++   + A K  +    F W+GSD W  +     +       E   EGAI I+P   TV GF+ YF + T   N+ N WF E+WE+ F CKL   S +   +    C    ++ KD+  +  E ++QFV DAV A A AL  M   +CA    +  C  M Q  G+ LL+ ++ + F   +G     TP+ F    D   RY I  +         +  IG +T++ L+++   +++      IP S CT  C   QRKK   G   CW C  C  Y+ ++     C+ CP  Q P++NRT C  +  I L    P ++  +  + + +I  +     F+ Y  TPIV+AS RELS++LL GI LC++++ ++   P   +CSF++  +G    + Y+ALL K NRI RIF +G+K     RLIS  SQ+ I + ++S+Q  +LG  ++F    P          T +P +    L CD I    ++  + + ++L++ CTVYA  TR +PE FNE+K IGFTMY+TC+VWL FIP +  TA     ++++  TL +S+N+SA VAL  L+ PKVY I+F P+ NV+K  R
Sbjct:   45 IEGDVTLGGLFPVHAKGPSGVPCGDIKRENGIHRLEAMLYALDQINSDPNLLPNVTLGARILDTCSRDTYALEQSLTFVQALIQKDTSDVRCTNGEPPVFVKPEKVVGVIGASGSSVSIMVANILRLFQIPQISYASTAPELSDDRRYDFFSRVVPPDSFQAQAMVDIVKALGWNYVSTLASEGSYGEKGVESFTQISKEAGGLCIAQSVRIP--------QERKDRTIDFDRIIKQLLDTPNSRAVVIFANDEDIKQILAAAKRADQVGHFLWVGSDSWGSKINPLHQ------HEDIAEGAITIQPKRATVEGFDAYFTSRTLENNRRNVWFAEYWEENFNCKL-TISGSKKEDTDRKCTGQERIGKDS-NYEQEGKVQFVIDAVYAMAHALHHMNKDLCAD--YRGVCPEMEQAGGKKLLKYIRNVNFNGSAG-----TPVMFNKNGDAPGRYDIFQYQTTNTTNPGYRLIGQWTDE-LQLNIEDMQWGKGVREIPPSVCTLPCKPGQRKKTQKGTPCCWTCEPCDGYQ-YQFDEMTCQHCPYDQRPNENRTGCQNIPIIKLEWHSPWAVIPVFLAMLGIIATIFVMATFIRYNDTPIVRASGRELSYVLLTGIFLCYIITFLMIAKPDVAVCSFRRVFLGLGMCISYAALLTKTNRIYRIFEQGKKSVTAPRLISPTSQLAITSSLISVQ--LLGVFIWFGVDPPNIIIDYDEHKTMNPEQARGVLKCD-ITDLQIICSLGYSILLMVTCTVYAIKTRGVPENFNEAKPIGFTMYTTCIVWLAFIPIFFGTAQSAEKLYIQTTTLTISMNLSASVALGMLYMPKVYIIIFHPELNVQKRKR 861          
BLAST of Metabotropic glutamate receptor vs. UniProt/SwissProt
Match: sp|P47743|GRM8_MOUSE (Metabotropic glutamate receptor 8 OS=Mus musculus OX=10090 GN=Grm8 PE=1 SV=2)

HSP 1 Score: 521.161 bits (1341), Expect = 2.626e-169
Identity = 311/846 (36.76%), Postives = 473/846 (55.91%), Query Frame = 3
Query:  129 IDGDIFLGGLMMVHLRSEEMV-CGVIAAEGGIQALEVMVYTINRVN-EMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIK---QSSKLQTKSNCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKD-NRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEI-EGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITF----DGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFI-FVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDP---------VTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAI---MVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGLR 2594
            +DGDI LGGL  VH + E  V CG +  E GI  LE M+Y I+++N +  +L +I LG  I D C RDTY LEQ++ F++   +      K    +  I +    I+GVIGA++S  SI VA++L+LF IPQIS+ ST+P LS+  R+ FF R +P D++Q Q M++I+  L W YVS +  + NYG    +A  ++ ++   +CIA S+ +PR+ +     E++  + RL       +   A  VI+F ++ ++   + A K+ N +  F W+GSD W G ++A         +++EI EGA+ I P   ++ GF+ YF + T + N+ N WF EFWE+ F CKL   S    N+    C    ++++D+  +  E ++QFV DAV + A AL  M  ++C   I    C  M+   G+ LL  ++ + F   +G     TP+TF    D   RY I  + +  N    +  IG++TNQ L +    +++       P S C+  C   +RKK   G+  CW C +C+ Y  ++     CE CPL Q P+ NRT C R+  I L    P ++ + +F  I  IIA T   + FV Y  TPIV+AS RELS++LL GI LC+ ++ ++   P  ++CSF++  +G      Y+ALL K NRI RIF +G+K     + IS  SQ+ I   ++S+Q  +LG  ++FV   P          T  P      L CD I   SL+  + + ++L++ CTVYA  TR +PE FNE+K IGFTMY+TC++WL FIP +  TA     ++++  TL VS+++SA V+L  L+ PKVY I+F P+QNV+K  R
Sbjct:   42 LDGDIILGGLFPVHAKGERGVPCGDLKKEKGIHRLEAMLYAIDQINKDPDLLSNITLGVRILDTCSRDTYALEQSLTFVQALIEKDASDVKCANGDPPIFTKPDKISGVIGAAASSVSIMVANILRLFKIPQISYASTAPELSDNTRYDFFSRVVPPDSYQAQAMVDIVTALGWNYVSTLASEGNYGESGVEAFTQISREIGGVCIAQSQKIPREPRPG---EFEKIIKRL------LETPNARAVIMFANEDDIRRILEAAKKLNQSGHFLWIGSDSW-GSKIA------PVYQQEEIAEGAVTILPKRASIDGFDRYFRSRTLANNRRNVWFAEFWEENFGCKL--GSHGKRNSHIKKCTGLERIARDS-SYEQEGKVQFVIDAVYSMAYALHNMHKELCPGYI--GLCPRMVTIDGKELLGYIRAVNFNGSAG-----TPVTFNENGDAPGRYDIFQY-QINNKSTEYKIIGHWTNQ-LHLKVEDMQWANREHTHPASVCSLPCKPGERKKTVKGVPCCWHCERCEGYN-YQVDELSCELCPLDQRPNINRTGCQRIPIIKLEWHSPWAV-VPVFIAILGIIATTFVIVTFVRYNDTPIVRASGRELSYVLLTGIFLCYSITFLMIAAPDTIICSFRRIFLGLGMCFSYAALLTKTNRIHRIFEQGKKSVTAPKFISPASQLVITFSLISVQ--LLGVFVWFVVDPPHTIIDYGEQRTLDPENARGVLKCD-ISDLSLICSLGYSILLMVTCTVYAIKTRGVPETFNEAKPIGFTMYTTCIIWLAFIPIFFGTAQSAEKMYIQTTTLTVSMSLSASVSLGMLYMPKVYIIIFHPEQNVQKRKR 854          
BLAST of Metabotropic glutamate receptor vs. UniProt/SwissProt
Match: sp|P70579|GRM8_RAT (Metabotropic glutamate receptor 8 OS=Rattus norvegicus OX=10116 GN=Grm8 PE=1 SV=1)

HSP 1 Score: 520.776 bits (1340), Expect = 3.428e-169
Identity = 311/846 (36.76%), Postives = 472/846 (55.79%), Query Frame = 3
Query:  129 IDGDIFLGGLMMVHLRSEEMV-CGVIAAEGGIQALEVMVYTINRVN-EMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIK---QSSKLQTKSNCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKD-NRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEI-EGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITF----DGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFI-FVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDP---------VTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAI---MVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGLR 2594
            +DGDI LGGL  VH + E  V CG +  E GI  LE M+Y I+++N +  +L +I LG  I D C RDTY LEQ++ F++   +      K    +  I +    I+GVIGA++S  SI VA++L+LF IPQIS+ ST+P LS+  R+ FF R +P D++Q Q M++I+  L W YVS +  + NYG    +A  ++ ++   +CIA S+ +PR+ +     E++  + RL       +   A  VI+F ++ ++   + A K+ N +  F W+GSD W G ++A         +++EI EGA+ I P   ++ GF+ YF + T + N+ N WF EFWE+ F CKL   S    N+    C    ++++D+  +  E ++QFV DAV + A AL  M  + C   I    C  M+   G+ LL  ++ + F   +G     TP+TF    D   RY I  + +  N    +  IG++TNQ L +    +++       P S C+  C   +RKK   G+  CW C +C+ Y  ++     CE CPL Q P+ NRT C R+  I L    P ++ + +F  I  IIA T   + FV Y  TPIV+AS RELS++LL GI LC+ ++ ++   P  ++CSF++  +G      Y+ALL K NRI RIF +G+K     + IS  SQ+ I   ++S+Q  +LG  ++FV   P          T  P      L CD I   SL+  + + ++L++ CTVYA  TR +PE FNE+K IGFTMY+TC++WL FIP +  TA     ++++  TL VS+++SA V+L  L+ PKVY I+F P+QNV+K  R
Sbjct:   42 VDGDIILGGLFPVHAKGERGVPCGELKKEKGIHRLEAMLYAIDQINKDPDLLSNITLGVRILDTCSRDTYALEQSLTFVQALIEKDASDVKCANGDPPIFTKPDKISGVIGAAASSVSIMVANILRLFKIPQISYASTAPELSDNTRYDFFSRVVPPDSYQAQAMVDIVTALGWNYVSTLASEGNYGESGVEAFTQISREIGGVCIAQSQKIPREPRPG---EFEKIIKRL------LETPNARAVIMFANEDDIRRILEAAKKLNQSGHFLWIGSDSW-GSKIA------PVYQQEEIAEGAVTILPKRASIDGFDRYFRSRTLANNRRNVWFAEFWEENFGCKL--GSHGKRNSHIKKCTGLERIARDS-SYEQEGKVQFVIDAVYSMAYALHNMHKERCPGYI--GLCPRMVTIDGKELLGYIRAVNFNGSAG-----TPVTFNENGDAPGRYDIFQY-QINNKSTEYKIIGHWTNQ-LHLKVEDMQWANREHTHPASVCSLPCKPGERKKTVKGVPCCWHCERCEGYN-YQVDELSCELCPLDQRPNINRTGCQRIPIIKLEWHSPWAV-VPVFIAILGIIATTFVIVTFVRYNDTPIVRASGRELSYVLLTGIFLCYSITFLMIAAPDTIICSFRRIFLGLGMCFSYAALLTKTNRIHRIFEQGKKSVTAPKFISPASQLVITFSLISVQ--LLGVFVWFVVDPPHTIIDYGEQRTLDPENARGVLKCD-ISDLSLICSLGYSILLMVTCTVYAIKTRGVPETFNEAKPIGFTMYTTCIIWLAFIPIFFGTAQSAEKMYIQTTTLTVSMSLSASVSLGMLYMPKVYIIIFHPEQNVQKRKR 854          
BLAST of Metabotropic glutamate receptor vs. UniProt/SwissProt
Match: sp|O00222|GRM8_HUMAN (Metabotropic glutamate receptor 8 OS=Homo sapiens OX=9606 GN=GRM8 PE=1 SV=2)

HSP 1 Score: 520.005 bits (1338), Expect = 9.040e-169
Identity = 310/846 (36.64%), Postives = 471/846 (55.67%), Query Frame = 3
Query:  129 IDGDIFLGGLMMVHLRSEEMV-CGVIAAEGGIQALEVMVYTINRVN-EMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIK---QSSKLQTKSNCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKD-NRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEI-EGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITF----DGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFI-FVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDP---------VTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAI---MVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGLR 2594
            +DGDI LGGL  VH + E  V CG +  E GI  LE M+Y I+++N +  +L +I LG  I D C RDTY LEQ++ F++   +      K    +  I +    I+GVIGA++S  SI VA++L+LF IPQIS+ ST+P LS+  R+ FF R +P D++Q Q M++I+  L W YVS +  + NYG    +A  ++ ++   +CIA S+ +PR+ +     E++  + RL       +   A  VI+F ++ ++   + A K+ N +  F W+GSD W G ++A         +++EI EGA+ I P   ++ GF+ YF + T + N+ N WF EFWE+ F CKL   S    N+    C    ++++D+  +  E ++QFV DAV + A AL  M   +C   I    C  M    G+ LL  ++ + F   +G     TP+TF    D   RY I  + +  N    +  IG++TNQ L +    +++       P S C+  C   +RKK   G+  CW C +C+ Y  ++     CE CPL Q P+ NRT C  +  I L    P ++ + +F  I  IIA T   + FV Y  TPIV+AS RELS++LL GI LC+ ++ ++   P  ++CSF++  +G      Y+ALL K NRI RIF +G+K     + IS  SQ+ I   ++S+Q  +LG  ++FV   P          T  P +    L CD I   SL+  + + ++L++ CTVYA  TR +PE FNE+K IGFTMY+TC++WL FIP +  TA     ++++  TL VS+++SA V+L  L+ PKVY I+F P+QNV+K  R
Sbjct:   42 VDGDIILGGLFPVHAKGERGVPCGELKKEKGIHRLEAMLYAIDQINKDPDLLSNITLGVRILDTCSRDTYALEQSLTFVQALIEKDASDVKCANGDPPIFTKPDKISGVIGAAASSVSIMVANILRLFKIPQISYASTAPELSDNTRYDFFSRVVPPDSYQAQAMVDIVTALGWNYVSTLASEGNYGESGVEAFTQISREIGGVCIAQSQKIPREPRPG---EFEKIIKRL------LETPNARAVIMFANEDDIRRILEAAKKLNQSGHFLWIGSDSW-GSKIA------PVYQQEEIAEGAVTILPKRASIDGFDRYFRSRTLANNRRNVWFAEFWEENFGCKL--GSHGKRNSHIKKCTGLERIARDS-SYEQEGKVQFVIDAVYSMAYALHNMHKDLCPGYI--GLCPRMSTIDGKELLGYIRAVNFNGSAG-----TPVTFNENGDAPGRYDIFQY-QITNKSTEYKVIGHWTNQ-LHLKVEDMQWAHREHTHPASVCSLPCKPGERKKTVKGVPCCWHCERCEGYN-YQVDELSCELCPLDQRPNMNRTGCQLIPIIKLEWHSPWAV-VPVFVAILGIIATTFVIVTFVRYNDTPIVRASGRELSYVLLTGIFLCYSITFLMIAAPDTIICSFRRVFLGLGMCFSYAALLTKTNRIHRIFEQGKKSVTAPKFISPASQLVITFSLISVQ--LLGVFVWFVVDPPHIIIDYGEQRTLDPEKARGVLKCD-ISDLSLICSLGYSILLMVTCTVYAIKTRGVPETFNEAKPIGFTMYTTCIIWLAFIPIFFGTAQSAEKMYIQTTTLTVSMSLSASVSLGMLYMPKVYIIIFHPEQNVQKRKR 854          
BLAST of Metabotropic glutamate receptor vs. UniProt/SwissProt
Match: sp|P91685|GRM_DROME (Metabotropic glutamate receptor OS=Drosophila melanogaster OX=7227 GN=mGluR PE=1 SV=2)

HSP 1 Score: 520.39 bits (1339), Expect = 3.155e-168
Identity = 323/871 (37.08%), Postives = 467/871 (53.62%), Query Frame = 3
Query:  129 IDGDIFLGGLMMVHLRSEEMVCGVIAAEGGIQALEVMVYTINRVN-EMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIKQS-SKLQTKS-NCNEA-----KIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKDNRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKL------PNSSDTPYNNFTDI-------CDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMC------------------------APNISKNACISMLQNKGETLLR-ILQKIKFTSLSGLEMEFTPITFDGLPRYRILNFIKAANGI-YSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLI-IALTCFFIFVFY--FKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDPVT--HHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRK 2585
            + GDI LGGL  VH + E   CG      G+Q LE M+Y I+RVN +  IL  I +G +I D C RDTY L Q++ F++ S + L T    C +      + +++   + GVIG S S  S+ VA+LL+LF IPQ+S  ST+  LS+K RF  F RT+P D  Q   +++I+K   W YVS I+ + +YG    +AL +   +  +CIA +E +P     A  K +   + +L+K         A GV++F   ++    + A K  NL+  F+W+ SDGW G++    +GL     E   EGAI +E  S+ +  F+ Y + LTP TN+ NPWF E+WED F C L      P++S++  +    I       CD++ +LS +   +  E++ QFV DAV AFA AL  + N  C                        + +    AC  M    G+      L  + F  L+G E++F     DGL RY ILN+ +  N   Y +  IG + N  L+++   + +  ++   P S+C+  C     KK     C CWIC  C+ +E   +  T C+ C  G +P  ++  C  L   Y+      S+  +I   I +  IALT   I +F     TP+V+AS RELS+ LL GI++C+  +  L   PT   C  Q+FGIG  FS+ YSALL K NRI RIF    K  Q+L+ IS QSQ+ I   +++IQ++I  T+++ V   P T  ++P R E  L C  I   S +   L+ MILI ICT+YA  TR IPE FNESK IGFTMY+TC++WL F+P Y  T     ++  TLC+SI++SA VAL CL+ PKVY ++F P +NVRK
Sbjct:   41 LPGDIILGGLFPVHEKGEGAPCGPKVYNRGVQRLEAMLYAIDRVNNDPNILPGITIGVHILDTCSRDTYALNQSLQFVRASLNNLDTSGYECADGSSPQLRKNASSGPVFGVIGGSYSSVSLQVANLLRLFHIPQVSPASTAKTLSDKTRFDLFARTVPPDTFQSVALVDILKNFNWSYVSTIHSEGSYGEYGIEALHKEATERNVCIAVAEKVP---SAADDKVFDSIISKLQKK------PNARGVVLFTRAEDARRILQAAKRANLSQPFHWIASDGW-GKQQKLLEGL-----EDIAEGAITVELQSEIIADFDRYMMQLTPETNQRNPWFAEYWEDTFNCVLTSLSVKPDTSNSANSTDNKIGVKAKTECDDSYRLS-EKVGYEQESKTQFVVDAVYAFAYALHNLHNDRCNTQSDQTTETRKHLQSESVWYRKISTDTKSQACPDMANYDGKEFYNNYLLNVSFIDLAGSEVKFDR-QGDGLARYDILNYQRQENSSGYQYKVIGKWFN-GLQLNSETVVWNKETEQ-PTSACSLPCEVGMIKKQQGDTC-CWICDSCESFEYVYDEFT-CKDCGPGLWPYADKLSCYALDIQYMKWN---SLFALIPMAIAIFGIALTSIVIVLFAKNHDTPLVRASGRELSYTLLFGILVCYCNTFALIAKPTIGSCVLQRFGIGVGFSIIYSALLTKTNRISRIFHSASKSAQRLKYISPQSQVVITTSLIAIQVLI--TMIWMVVEPPGTRFYYPDRREVILKCK-IQDMSFLFSQLYNMILITICTIYAIKTRKIPENFNESKFIGFTMYTTCIIWLAFVPIYFGTGNSYEVQTTTLCISISLSASVALVCLYSPKVYILVFHPDKNVRK 884          
BLAST of Metabotropic glutamate receptor vs. UniProt/SwissProt
Match: sp|Q14831|GRM7_HUMAN (Metabotropic glutamate receptor 7 OS=Homo sapiens OX=9606 GN=GRM7 PE=1 SV=1)

HSP 1 Score: 518.464 bits (1334), Expect = 3.368e-168
Identity = 300/845 (35.50%), Postives = 458/845 (54.20%), Query Frame = 3
Query:  129 IDGDIFLGGLMMVHLRSEEMV-CGVIAAEGGIQALEVMVYTINRVN-EMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIK---QSSKLQTKSNCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKD-NRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTF-DGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITF----DGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDP---------VTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAI---MVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGLR 2594
            I+GD+ LGGL  VH +    V CG I  E GI  LE M+Y ++++N +  +L ++ LGA I D C RDTY LEQ++ F++   Q      +    E  +      + GVIGAS S  SI VA++L+LF IPQIS+ ST+P LS+  R+ FF R +P D+ Q Q M++I+K L W YVS +  + +YG +  ++  ++ K+   +CIA S  +P        +E KD+ +   + +K   D   +  V+IF +D+++   + A K  +    F W+GSD W  +     +       E   EGAI I+P   TV GF+ YF + T   N+ N WF E+WE+ F CKL   S +   +    C    ++ KD+  +  E ++QFV DAV A A AL  M   +CA    +  C  M Q  G+ LL+ ++ + F   +G     TP+ F    D   RY I  +         +  IG +T++ L+++   +++      IP S CT  C   QRKK   G   CW C  C  Y+ ++     C+ CP  Q P++NRT C  +  I L    P ++  +  + + +I  +     F+ Y  TPIV+AS RELS++LL GI LC++++ ++   P   +CSF++  +G    + Y+ALL K NRI RIF +G+K     RLIS  SQ+ I + ++S+Q  +LG  ++F    P          T +P +    L CD I    ++  + + ++L++ CTVYA  TR +PE FNE+K IGFTMY+TC+VWL FIP +  TA     ++++  TL +S+N+SA VAL  L+ PKVY I+F P+ NV+K  R
Sbjct:   45 IEGDVTLGGLFPVHAKGPSGVPCGDIKRENGIHRLEAMLYALDQINSDPNLLPNVTLGARILDTCSRDTYALEQSLTFVQALIQKDTSDVRCTNGEPPVFVKPEKVVGVIGASGSSVSIMVANILRLFQIPQISYASTAPELSDDRRYDFFSRVVPPDSFQAQAMVDIVKALGWNYVSTLASEGSYGEKGVESFTQISKEAGGLCIAQSVRIP--------QERKDRTIDFDRIIKQLLDTPNSRAVVIFANDEDIKQILAAAKRADQVGHFLWVGSDSWGSKINPLHQ------HEDIAEGAITIQPKRATVEGFDAYFTSRTLENNRRNVWFAEYWEENFNCKL-TISGSKKEDTDRKCTGQERIGKDS-NYEQEGKVQFVIDAVYAMAHALHHMNKDLCAD--YRGVCPEMEQAGGKKLLKYIRNVNFNGSAG-----TPVMFNKNGDAPGRYDIFQYQTTNTSNPGYRLIGQWTDE-LQLNIEDMQWGKGVREIPASVCTLPCKPGQRKKTQKGTPCCWTCEPCDGYQ-YQFDEMTCQHCPYDQRPNENRTGCQDIPIIKLEWHSPWAVIPVFLAMLGIIATIFVMATFIRYNDTPIVRASGRELSYVLLTGIFLCYIITFLMIAKPDVAVCSFRRVFLGLGMCISYAALLTKTNRIYRIFEQGKKSVTAPRLISPTSQLAITSSLISVQ--LLGVFIWFGVDPPNIIIDYDEHKTMNPEQARGVLKCD-ITDLQIICSLGYSILLMVTCTVYAIKTRGVPENFNEAKPIGFTMYTTCIVWLAFIPIFFGTAQSAEKLYIQTTTLTISMNLSASVALGMLYMPKVYIIIFHPELNVQKRKR 861          
BLAST of Metabotropic glutamate receptor vs. TrEMBL
Match: A0A193KUL0 (GCR106 OS=Schmidtea mediterranea OX=79327 GN=gcr106 PE=2 SV=1)

HSP 1 Score: 1896.32 bits (4911), Expect = 0.000e+0
Identity = 916/916 (100.00%), Postives = 916/916 (100.00%), Query Frame = 3
Query:  159 MMVHLRSEEMVCGVIAAEGGIQALEVMVYTINRVNEMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIKQSSKLQTKSNCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKDNRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITFDGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDPVTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGLRINIKNEQNQIDHLDNNSHTQMSYSHMILKDDQLNNIKNSVTSISGSVITCHRETQFPDCSDAFVIVNEKFEAQMFKHLLANRNHSTIKKPSPKVESDNVYHLKS 2906
            MMVHLRSEEMVCGVIAAEGGIQALEVMVYTINRVNEMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIKQSSKLQTKSNCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKDNRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITFDGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDPVTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGLRINIKNEQNQIDHLDNNSHTQMSYSHMILKDDQLNNIKNSVTSISGSVITCHRETQFPDCSDAFVIVNEKFEAQMFKHLLANRNHSTIKKPSPKVESDNVYHLKS
Sbjct:    1 MMVHLRSEEMVCGVIAAEGGIQALEVMVYTINRVNEMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIKQSSKLQTKSNCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKDNRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITFDGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDPVTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGLRINIKNEQNQIDHLDNNSHTQMSYSHMILKDDQLNNIKNSVTSISGSVITCHRETQFPDCSDAFVIVNEKFEAQMFKHLLANRNHSTIKKPSPKVESDNVYHLKS 916          
BLAST of Metabotropic glutamate receptor vs. TrEMBL
Match: A0A1I8IP55 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 820.846 bits (2119), Expect = 0.000e+0
Identity = 409/936 (43.70%), Postives = 590/936 (63.03%), Query Frame = 3
Query:   72 FIGKSGLVNVWPFKNQVALIDGDIFLGGLMMVHLRSEEMVCGVIAAEGGIQALEVMVYTINRVNEMKILG-DIKLGAYIKDDCDRDTYGLEQAVDFIKQSSKLQT-KSNCNE-AKIDSNLRT-------ITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKDNRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNN-FTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITFDGLPRYRILNFIKAANGIYSWVEIGNYTNQK--LRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRK--QPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDPVTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRK----GLRINIKNEQNQID---------HLDNNSHTQMSYSHMILKDDQLNNIKNSVTSISGSVITCHRETQF--PDCSDAFVI 2789
            F G+ G  + WP K Q  L+ GDI+LGGLMMVH RSE  VCG +  +GG+QALE M++T+++VN + + G ++ LGA+IKDDCDRDTYGL+QAV+FIK S K+ + ++ C+     D+ +         ITGV+GA SS+TS HVASLLKLFDIPQISFFST+P LS+KNRFPFF+RTIPSDA+Q   ++E+ K   W YVS++YEDS+YGR A + ++ +F+++ IC+A  E LPRDSKLA V++Y DK+ RL  H   FDG+GA GVIIFGSDQEVGDFM A++  N +  F+W+GSDGW  R +AY+ G      E+ +EGA+ ++PL++ + GF+ YFL+L P TNK NPWF EFWED+F+C LP+   TPYN   +++C   L++S+ + K   E QLQFVSDA          ++ Q+C P +S  AC+  L   G  LL  L+ + FT LSG+++ FTP   DG PRYRILNF   +   YSW E+G +   +  ++++++ L+FRG +S  P+S+C P+CSD   +++ PG C+CW+C+ C +Y +    R  C  C  G  P  +RT C  +   +L+  HP++      + + +  +L   F F  Y  + +V+AS  ELS +LL+G+++C+  + +LC  P+  +C  Q+F +GF  ++  SALLVK  R+ER FR GR   +P K  L+         A ++          L       V+H PSR+   L+C  +IG   ++ + +PM+L+L+CTV AF  RNIP+ FNE+KHIGFTMYS+CV+WLGF+PCY  T   VH+RVATLC +I +SA V L+CLFGPK+Y IL +P+ NVR+    G +  ++  Q + +          +D+ S T    + +        +I+   T ++ +     R TQ    DC    V+
Sbjct:  494 FTGRDGRWHQWPVKEQRVLVRGDIYLGGLMMVHSRSESRVCGSVMPQGGVQALEAMLFTLDQVNRLGLAGPNVTLGAFIKDDCDRDTYGLDQAVEFIKASPKISSGQAACSRRPSFDAGVGGEGDGPPLITGVVGAPSSITSSHVASLLKLFDIPQISFFSTAPQLSDKNRFPFFMRTIPSDAYQAVAIVELAKLFNWSYVSVVYEDSSYGRGALEQMERLFRESDICLARVETLPRDSKLARVEDYYDKIERLLNHQSLFDGLGAKGVIIFGSDQEVGDFMSAVRRLNCSDKFSWIGSDGWGARPLAYRDG-----NEKTVEGAVTVQPLAEPIVGFKEYFLSLRPDTNKRNPWFAEFWEDYFDCWLPDGPQTPYNQKHSEMCRPELRMSESDAKFVLEPQLQFVSDA---------NLRIQLCRPGVSHPACLHRLATSGSELLVELKSVNFTGLSGMDVHFTPGNADGPPRYRILNFQADSESGYSWREVGRFDGARGGVQLEWSSLRFRGGASQPPVSACRPECSDSSIRQVSPGECSCWMCVHCPDYHVVDEERQHCILCKKGTRPSSDRTTCEPIDMEFLSFGHPVAAVAATLASLGVAASLFVLFEFARYRDSAVVQASGLELSLLLLLGLVVCYSATFLLCARPSNWLCGVQRFVVGFGVAVSSSALLVKTVRLERRFRTGRPGFEPLKQVLLFLLLVAVQLAALIG--------WLLLQPPKSVSHFPSRDRHQLVCSSLIGLLYLVGLAYPMLLVLLCTVCAFFARNIPDGFNETKHIGFTMYSSCVIWLGFVPCYALTGAFVHIRVATLCFAITLSATVTLACLFGPKLYIILLRPELNVRQAEQCGCQYPLQERQPEPEAKRLLSSQLQIDDCSQTGFELASLHSPVKSPTSIRAVQTEVTHASWHSDRMTQTGSGDCGSVLVL 1407          
BLAST of Metabotropic glutamate receptor vs. TrEMBL
Match: A0A1I8IL26 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 819.691 bits (2116), Expect = 0.000e+0
Identity = 402/887 (45.32%), Postives = 571/887 (64.37%), Query Frame = 3
Query:   72 FIGKSGLVNVWPFKNQVALIDGDIFLGGLMMVHLRSEEMVCGVIAAEGGIQALEVMVYTINRVNEMKILG-DIKLGAYIKDDCDRDTYGLEQAVDFIKQSSKLQT-KSNCNE-AKIDSNLRT-------ITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKDNRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNN-FTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALK---------------------------------EMKNQMCAPNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITFDGLPRYRILNFIKAANGIYSWVEIGNYTNQK--LRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRK--QPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDPVTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKG 2588
            F G+ G  + WP K Q  L+ GDI+LGGLMMVH RSE  VCG +  +GG+QALE M++T+++VN + + G ++ LGA+IKDDCDRDTYGL+QAV+FIK S K+ + ++ C+     D+ +         ITGV+GA SS+TS HVASLLKLFDIPQISFFST+P LS+KNRFPFF++TIPSDA+Q   ++E+ K   W YVS++YEDS+YGR A + ++ +F+++ IC+A  E LPRDSKLA V++Y DK+ RL  H   FDG+GA GVIIFGSDQEVGDFM A++  N +  F+W+GSDGW  R +AY+ G      E+ +EGA+ ++PL++ + GF+ YFL+L P TNK NPWF EFWED+F+C LP+   TPYN   +++C   L++S+ + K   E QLQFVSDAVMAFA+AL+                                  ++ Q+C P +S  AC+  L   G  LL  L+ + FT LSG+++ FTP   DG PRYRILNF   +   YSW E+G +   +  ++++++ L+FRG +S  P+S+C P+CSD   +++ PG C+CW+C+ C +Y +    R  C  C  G  P  +RT C  +   +L+  HP++      + + +  +L   F F  Y  + +V+AS  ELS +LL+G+++C+  + +LC  P+  +C  Q+F +GF  ++  SALLVK  R+ER FR GR   +P K  L+         A ++          L       V+H PSR+   L+C  +IG   ++ + +PM+L+L+CTV AF  RNIP+ FNE+KHIGFTMYS+CV+WLGF+PCY  T   VH+RVATLC +I +SA V L+CLFGPK+Y IL +P+ NVR+ 
Sbjct:  266 FTGRDGRWHQWPVKEQRVLVRGDIYLGGLMMVHSRSESRVCGSVMPQGGVQALEAMLFTLDQVNRLGLAGPNVTLGAFIKDDCDRDTYGLDQAVEFIKASPKISSGQAACSRRPSFDAGVGGEGDGPPLITGVVGAPSSITSSHVASLLKLFDIPQISFFSTAPQLSDKNRFPFFMKTIPSDAYQAVAIVELAKLFNWSYVSVVYEDSSYGRGALEQMERLFRESDICLARVETLPRDSKLARVEDYYDKIERLLNHQSLFDGLGAKGVIIFGSDQEVGDFMSAVRRLNCSDKFSWIGSDGWGARPLAYRDG-----NEKTVEGAVTVQPLAEPIVGFKEYFLSLRPDTNKRNPWFAEFWEDYFDCWLPDGPQTPYNQKHSEMCRPELRMSESDAKFVLEPQLQFVSDAVMAFAVALRVRWAALSKRGWLQSLSVSENHSHAKLPCKIFPQNLRIQLCRPGVSHPACLHRLATSGSELLVELKSVNFTGLSGMDVHFTPGNADGPPRYRILNFQADSESGYSWREVGRFDGARGGVQLEWSSLRFRGGASQPPVSACRPECSDSSIRQVSPGECSCWMCVHCPDYHVVDEERQHCILCKKGTRPSSDRTTCEPIDMEFLSFGHPVAAVAATLASLGVAASLFVLFEFARYRDSAVVQASGLELSLLLLLGLVVCYSATFLLCARPSNWLCGVQRFVVGFGVAVSSSALLVKTVRLERRFRTGRPGFEPLKQVLLFLLLVAVQLAALIG--------WLLLQPPKSVSHFPSRDRHQLVCSSLIGLLYLVGLAYPMLLVLLCTVCAFFARNIPDGFNETKHIGFTMYSSCVIWLGFVPCYALTGAFVHIRVATLCFAITLSATVTLACLFGPKLYIILLRPELNVRQA 1139          
BLAST of Metabotropic glutamate receptor vs. TrEMBL
Match: A0A1I8M0J9 (G_PROTEIN_RECEP_F3_4 domain-containing protein OS=Musca domestica OX=7370 PE=3 SV=1)

HSP 1 Score: 811.601 bits (2095), Expect = 0.000e+0
Identity = 395/833 (47.42%), Postives = 551/833 (66.15%), Query Frame = 3
Query:  102 WPFKNQVALIDGDIFLGGLMMVHLRSEEMVCGVIAAEGGIQALEVMVYTINRVNEMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIKQS-SKLQ-TKSNCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKDNRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITFDGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEI-FKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDPVTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGL 2591
            WP K + A+++GD+ LGGLMMVH R + ++CG I  +GGIQALE M+YTI+R+NE  +L +I LGA+I DDCD+D+YGLE AVDFIK S S +   + +CN+ ++    + I+GV+GA+SSVTSI VA+LL+LF IPQ+SFFSTSP LSNK RF +F RTIPSD +QV+ M+EI+K+L W YVSIIYE+SNYG +AF+ L+E+   + ICIA  E L +DS +A    Y + VL+L    +      A G IIFGSDQEV + M A++ +N T +F+W+GSDGWS R       L     E E+EG + ++P +  V GFE YFLNLT   N  NPWF EFWED F+C+ P SS TPYNN+   C +  +L++++    FE+QLQFVSDAVMAFA AL++M  ++C    S   C +M   KG  LLR L+K++F  LSG    F     DG  RY I++F +   G Y+WV++G Y   +LR++ ++++F+      P S C+ +C   Q KK   G   CW C  C  Y+I      T C  C LG  PD  +  C  + ++YL      +IG M FS   +++ L    +FV +  TPIV+AS RELS+ILL GI++C+ V+  L   PT ++C+ Q+F +GF F++ Y+ALL K NRI RIF+ G++  ++   IS +SQ+ IC+F +S+QI+I G  +    S  + HHP+R +  L+CD  I  S VI   +P++LI++CTVYA LTR IPEAFNESKHIGFTMY+TCV+WL F+P Y  TA  V LR+ ++ V+I++SA V ++CLF PK+Y IL +P++NVR+ +
Sbjct:  444 WPIKRE-AIVEGDVILGGLMMVHSREDNLMCGPIMPQGGIQALEAMLYTIDRINERGLLPNITLGAHILDDCDKDSYGLEMAVDFIKGSISNIDDAEYHCNKTQV---RKVISGVVGAASSVTSIQVANLLRLFRIPQVSFFSTSPELSNKQRFEYFSRTIPSDHYQVKAMVEIVKRLGWSYVSIIYEESNYGIKAFEELEELLARHNICIAVKEKLVKDSGVADETAYNNIVLKLLTKPR------ARGAIIFGSDQEVREVMRAVRRNNATGAFSWIGSDGWSAR------NLVSDGNEPEVEGTLSVQPQANPVKGFEEYFLNLTVENNLRNPWFVEFWEDHFQCRYPGSSSTPYNNYNRTCSKTERLTREDT--DFEDQLQFVSDAVMAFAYALRDMHRELCGGKPS--LCEAMKPTKGADLLRFLRKVEFEGLSGDHFRFDN-NGDGPARYNIIHFKQIKEGQYNWVKVGEYYEGELRLNMSEVQFKMLQPKPPESVCSLECERGQAKKYVEGESCCWHCFNCSTYQIRHPTDETQCLTCQLGTLPDATKQFCQTIPEVYLRPESAWAIGAMAFSATGILVTLFVVGVFVRHNDTPIVRASGRELSYILLAGILMCYAVTFALVLKPTNVVCAIQRFSVGFCFTVVYAALLTKTNRIARIFKAGKQSAKRPSFISPKSQLVICSFFISVQILINGVWMLIAPSHAMHHHPTREDNLLVCDSYIDASYVIAFFYPIVLIVVCTVYAVLTRKIPEAFNESKHIGFTMYTTCVIWLAFVPLYFGTANHVPLRITSMSVTISLSASVTIACLFSPKLYIILIRPERNVRQSM 1255          
BLAST of Metabotropic glutamate receptor vs. TrEMBL
Match: A0A0K8U462 (Metabotropic glutamate receptor OS=Bactrocera latifrons OX=174628 GN=mGluRA_1 PE=3 SV=1)

HSP 1 Score: 811.216 bits (2094), Expect = 0.000e+0
Identity = 396/833 (47.54%), Postives = 551/833 (66.15%), Query Frame = 3
Query:  102 WPFKNQVALIDGDIFLGGLMMVHLRSEEMVCGVIAAEGGIQALEVMVYTINRVNEMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIKQS-SKLQ-TKSNCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKDNRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITFDGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKN-SRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDPVTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGL 2591
            WP K + A+++GD+ LGGLMMVH R + ++CG I  +GGIQALE M+YTI+R+NE  +L +I LGA+I DDCD+D+YGLE AVDFIK S S +   + +CN+ ++    + I+GV+GA+SSVTSI VA+LL+LF IPQ+SFFSTSP LSNK RF +F RTIPSD +QV+ M+EI+K++ W YVSIIYE+SNYG +AF+ L+E+   + ICIA  E L +DS +A    Y + V +L    +      A G IIFGSDQEV + M A++ +N T +F+W+GSDGWS R       L     E E+EG + ++P +  V GFE YFLNLT   N+ NPWF EFWED F+C+ P S  TPYNN+   C  + +LSKD     FE+QLQFVSDAVMAFA AL++M   +C    S   C +M   KG  LL+ L+K++F  LSG    F     DG  RY I++F ++A G+Y WV++G Y   +LR++ T+++F+      P S C+  C   Q KK   G   CW C  C  Y+I      T C  C LG  PD ++ LC  + ++YL      +IG M FS   +++ L    +FV +  TPIV+AS RELS+ILL GI++C+ V+  L   PT ++C+ Q+F +GF F++ Y+ALL K NRI RIF+ G++  ++   IS +SQ+ IC+F++ IQI+I G  +    S  + HHP+R +  L+CD  I  S +I   +P++LI++CTVYA LTR IPEAFNESKHIGFTMY+TCV+WL F+P Y  TA  V LR+ ++ V+I++SA V ++CLF PK+Y IL +P++NVR+ +
Sbjct:  518 WPVKRE-AIVEGDVILGGLMMVHSREDTVMCGPIMPQGGIQALEAMLYTIDRINEASLLPNITLGAHILDDCDKDSYGLEMAVDFIKGSISNIDDAEYHCNKTQVR---KVISGVVGAASSVTSIQVANLLRLFRIPQVSFFSTSPELSNKQRFEYFSRTIPSDHYQVKAMVEIVKRMGWSYVSIIYEESNYGIKAFEELEELLARHNICIAVKEKLVKDSGVAEEIAYDNIVQKLLTKPR------ARGAIIFGSDQEVREVMRAVRRNNATGAFSWIGSDGWSAR------NLVSDGNEPEVEGTLSVQPQANPVKGFEEYFLNLTVENNQRNPWFVEFWEDHFQCRYPGSLSTPYNNYNSTCTTHERLSKDT---DFEDQLQFVSDAVMAFAYALRDMHRDLCGGRPS--LCDAMRPTKGADLLKYLRKVQFQGLSGDHFRFD-ANGDGPARYNIIHFKQSAEGLYHWVKVGEYYEGELRLNMTEVQFKLLHPKPPESVCSLPCERGQAKKYVEGESCCWHCFNCSTYQIRHPIDETQCLTCQLGTLPDASKQLCQTIPEVYLRPESAWAIGAMAFSATGILVTLFVVGVFVRHNDTPIVRASGRELSYILLAGILMCYAVTFALVLKPTNIVCAIQRFSVGFCFTVVYAALLTKTNRIARIFKAGKQSAKRPSFISPKSQLVICSFLIFIQILINGVWMVIAPSHAMYHHPTREDNLLVCDSYIDASYMIAFFYPIVLIVVCTVYAVLTRKIPEAFNESKHIGFTMYTTCVIWLAFVPLYFGTANHVPLRITSMSVTISLSASVTVACLFSPKLYIILIRPERNVRQSM 1328          
BLAST of Metabotropic glutamate receptor vs. Ensembl Cavefish
Match: GRM7 (glutamate metabotropic receptor 7 [Source:HGNC Symbol;Acc:HGNC:4599])

HSP 1 Score: 508.834 bits (1309), Expect = 1.268e-165
Identity = 300/840 (35.71%), Postives = 457/840 (54.40%), Query Frame = 3
Query:  129 IDGDIFLGGLMMVHLRS-EEMVCGVIAAEGGIQALEVMVYTINRVN-EMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIK---QSSKLQTKSNCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKD-NRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITFDGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDP---------VTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAI---MVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGLR 2594
            I+GD+ LGGL  VH R      CG +  E GI  LE M+Y ++ +N + ++L +I LGA + D C RDT+ LEQ++ F++   Q      +    E  +      + GVIGAS+S  SI VA++L+LF IPQIS+ ST+P LS+  R+ FF R +P D+ Q Q M++I+K + W YVS I  + +YG +  +A  ++ ++   ICIA S  +P D K A      DK++R+       D   A  VI+F  D+++ + + A K       F W+GSD W G + +   GL     E    GAI I P   T+ GF+ YF + T   N+ N WF EFWE+ F CKL +SS     + +  C    ++  D+ K+  E ++QFV DAV A A AL  M+  +C  +     C  M    G+ LL+ ++ + F   +G  + F     D   RY +  +    N    +  IG +T + L+++  ++++      IP S C+  C   QRKK   G+  CW C  C  Y+ ++   T C+ C     P+ NRT C  +  + L    P ++  +  + + +I  +     FV Y  TPIV+AS RELS++LL GI LC++++ V+   P   +CSF++  +G    + Y+ALL K NRI RIF +G+K     RLIS  SQ+ I + ++S+Q  +LG  ++F    P          T +P +    L CD I    ++  + + ++L++ CTVYA  TR +PE FNE+K IGFTMY+TC+VWL FIP +  TA     ++++  TL +S+N+SA VAL  L+ PKVY I+F P+ NV+K  R
Sbjct:   45 IEGDVTLGGLFPVHARGVAGEPCGDVKKENGIHRLEAMLYALDLINGDEELLPNITLGARVLDTCSRDTHALEQSLTFVQALIQKDTSDVRCTNGEPPVFVKPEKVVGVIGASASSVSIMVANILRLFQIPQISYASTAPELSDDRRYDFFSRVVPPDSFQAQAMVDIVKAMGWNYVSTIASEGSYGEKGVEAFMQISREAGGICIAQSLKIPHDHKQADF----DKIIRM-----LLDTRQARAVIMFAYDEDIREILNASKRAEQVGHFLWIGSDSW-GAKNSPIHGL-----EDAAVGAITILPKRATIAGFDAYFTSRTLENNRRNVWFAEFWEENFNCKLMSSSKK--EDTSRKCTGQERIGTDS-KYEQEGKVQFVIDAVYAMAHALHNMQKDLCPEH--SGVCAEMEVAGGKKLLKYIRNVNFNGSAGTSVTFNH-NGDAPGRYDLFQYQMNNNSSPGYKVIGQWT-ENLQLNIDEMQWPNGEVEIPGSVCSQPCKTGQRKKTVKGMPCCWHCEPCDGYQ-YQYDETTCKLCAYNMRPNLNRTGCQPIPIVKLEWHSPWAVIPVFLAMLGIIATIFVMATFVRYNDTPIVRASGRELSYVLLTGIFLCYIITFVMIAKPDVAVCSFRRIFLGLGMCISYAALLTKTNRIYRIFEEGKKSVSPPRLISPTSQLAITSSLISVQ--LLGVFIWFGVDPPNTIIDYDEQKTINPDKARGVLKCD-ITDLQIICSLGYSILLMVTCTVYAIKTRGVPENFNEAKPIGFTMYTTCIVWLAFIPIFFGTAQSAEKLYIQTTTLTISMNLSASVALGMLYMPKVYVIIFHPELNVQKRKR 858          
BLAST of Metabotropic glutamate receptor vs. Ensembl Cavefish
Match: grm2a (metabotropic glutamate receptor 2 [Source:NCBI gene;Acc:103035135])

HSP 1 Score: 501.901 bits (1291), Expect = 4.782e-163
Identity = 315/891 (35.35%), Postives = 489/891 (54.88%), Query Frame = 3
Query:  111 KNQVALIDGDIFLGGLMMVHLRSEEMV-CGVIAAEGGIQALEVMVYTINRVNEM-KILGDIKLGAYIKDDCDRDTYGLEQAVDFIKQSSKLQTKSNCNE--------AKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKDNRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLR-ILQKIKFTS-LSGLEMEFTPITFDG----LPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYF--KTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDPVTHH---PSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGLRINIKNEQNQIDHLDNNSHTQMSYSHMILKDDQLNNIKNSVTS 2720
            K ++A I+GD+ +GGL  VH + E +  CG I A+ GIQ LE M+  ++++NE   IL  + LGA+I D C +DTY LEQ+++F++ S    TK + NE        A  D     I+GVIG S S  SI VA+LL+LF IPQIS+ STS  LS+K+R+ +F RT+P D +Q + + EI++   W YVS +  + +YG     A Q+  +  +ICIATS  + R   L S     D+V+R            A  VI+F   ++  + ++A K  N+  SF W+ SDGW  +    +        E   +GA  IE  S  +  F +YFL L P  N  NPWF EFWE+ F+C L +               +L+  K  P    E+++ FV +AV A A A+  M+  +C  N +K  C +M    G+   +  + K+KF +     + E T + FD     L RY I ++ K  +G Y + ++G Y  Q L ++ + + +     ++P S C+  C  ++ K + PG   CWICI CQ Y+   +  T C  C  GQ+P+ N T C  L + Y++     +IG +  +  CL I  T F I +F    +TP+VKAS RELS+ILL+G++LC+ ++ +  T P+ ++C+ ++ G+G SF++CYSALL K NRI RIF   +   Q+ R IS  SQ+ ICA ++S Q++++   L  +   P       P R +   +      +S+++ + +  ILI++CT YAF TR  PE FNE+K IGFTMY+TC++WL F P +  TA    ++  T+C+S+++S  V L CLF PK++ ILF+P++NV     + +   +  +     +S +Q S ++M+        + +S TS
Sbjct:   44 KKEIA-IEGDLVIGGLFPVHQKGEGVEDCGRINAQRGIQRLEAMLLALDKINEDDSILPGVTLGAHILDTCSKDTYALEQSLEFVRAS---LTKVDDNEYTCPDGSYAIHDDTPLAISGVIGGSYSDVSIQVANLLRLFQIPQISYASTSAKLSDKSRYDYFARTVPPDFYQAKAIAEILRYFNWTYVSTVASEGDYGETGIDAFQQEARALQICIATSAKVSRSMDLHSY----DQVIR-----SLLQKSNAKVVILFTRSEDARELLVAAKRMNV--SFIWVASDGWGAQESVVR------GSESVADGAFTIELASYPIPEFADYFLGLNPYNNTRNPWFREFWENHFQCSLHD---------IHCGKHSLRDGKFEP----ESKIMFVVNAVYAMAHAMHNMRQAVCL-NTTK-ICSAMKPPNGKKFYKDYILKLKFDAPFRPADTENT-VHFDAYGDSLGRYNIFHYHKEDDG-YVYRKVG-YWAQTLDLNTSLIPW---DQMVPTSQCSDPCRKNEIKSMQPGDVCCWICIPCQPYQYLLDEFT-CADCSFGQWPNANLTGCYNLPEEYIHWEDAWAIGPVTIA--CLGILCTLFVIGLFLKNNETPVVKASGRELSYILLLGVLLCYCITFIYITKPSAVVCTLRRLGLGTSFAVCYSALLTKTNRIARIFNGVKDGAQRPRFISPASQVAICAALISFQLLVVVVWL--LVEAPGVRKEVSPERRDIVRLKCNSKDSSMLMSLTYNCILIILCTFYAFKTRKCPENFNEAKFIGFTMYTTCIIWLAFQPIFYVTASDYRVQTTTMCISVSLSGSVVLGCLFAPKIHIILFQPQKNVTT---LRVATTRFSVTTGPGSSFSQASAANMVPTVCNGREVVDSTTS 884          
BLAST of Metabotropic glutamate receptor vs. Ensembl Cavefish
Match: grm2b (metabotropic glutamate receptor 2-like [Source:NCBI gene;Acc:103030591])

HSP 1 Score: 501.13 bits (1289), Expect = 5.016e-163
Identity = 299/848 (35.26%), Postives = 467/848 (55.07%), Query Frame = 3
Query:  105 PFKNQVALIDGDIFLGGLMMVHLRSE-EMVCGVIAAEGGIQALEVMVYTINRVNE-MKILGDIKLGAYIKDDCDRDTYGLEQAVDFIKQS-SKLQTKS----NCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKDNRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLR-ILQKIKFTS-LSGLEME----FTPITFDGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDPVTHH---PSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGLRIN 2600
            P   +  ++DGD+ +GGL  VH + E    CG I  + GIQ LE M+  ++ +N+  +IL   +LGA+I D C +DTY LEQ+++F++ S +K+        + +    D     I+GVIG S S  SI VA+LL+LF IPQIS+ STS  LS+K+R+ +F RT+P D +Q + M EI++   W YVS +  + +YG     A Q+  +  +ICIATS  + R     +   Y+  +  L++         A  VI+F   ++  + ++A    N+T  F W+ SDGW  +             E+   GA  IE  S ++  FE+YF  LTP  N  NPWF EFWE  F C+L      P      + D + K          E+++ FV +AV A A AL  M+  +C PN ++  C +M    G+   R  + K KF +     E E    FT +  D L RY I ++ +  NG Y + ++G Y +Q L ++ + + + G +  IP S C+  C  ++ K + PG   CWICI CQ ++   +  T CE C  G++P  N T C  L + Y++ +   ++G +  + + ++  +    +F+    TP+VKAS RELS+ILL G++LC+ ++ +    P+ ++C+ ++ G+G SF++CYSALL K NRI RIF   R   Q+ R IS  SQ+ ICA ++S Q+++    L  +   P       P R +   +    + +S+++ + +  ILI++CT YAF TR  PE FNE+K IGFTMY+TC++WL F P +  TA    ++  T+C+S+++S  V L CLF PK++ ILF+P++NV   LR N
Sbjct:   17 PGTKREIVMDGDLVIGGLFPVHEKGEGTQDCGKINEQRGIQRLEAMLLALDEINQDNRILPGFRLGAHILDTCSKDTYALEQSLEFVRASLTKVHQPGFICPDGSNPVPDEAPLAISGVIGGSYSDVSIQVANLLRLFQIPQISYASTSAKLSDKSRYDYFARTVPPDFYQAKAMAEILRYFNWTYVSTVASEGDYGETGIDAFQQEARVRQICIATSVKVSRSMNRVN---YETVIRSLQQK------ANAKVVILFTRSEDARELLVAAARMNVT--FIWVASDGWGAQESVVH------GSEKAANGAFTIELASYSIREFEDYFTKLTPELNTRNPWFREFWEHKFGCRL----HEPGCASHSLRDGSFKQ---------ESKIMFVMNAVYAMAHALHNMRQAVC-PNTTR-VCEAMKPGNGKRFYREFILKTKFDAPFRPAETENVVRFTSLG-DSLGRYNIFHYGQE-NGRYVYKKVG-YWSQGLVLNTSLVPWPGGA--IPTSQCSDPCQPNEAKSMQPGDVCCWICIPCQAHQFLLDEFT-CEDCGFGEWPLTNLTGCYELPEEYIHWSDAWAVGPVTIACLGMLCTMAVAGVFLRNNDTPVVKASGRELSYILLFGVLLCYAMTFIYIAKPSAVVCALRRLGLGTSFAVCYSALLTKTNRIARIFGGARDSAQRPRFISPASQMAICAVLISAQLLVALVWL--LVEAPGVRKELSPERRDVVTLKCNSLDSSMLVSLTYNCILIILCTFYAFKTRKCPENFNEAKFIGFTMYTTCIIWLAFQPIFYVTASDYRVQTTTMCISVSLSGSVVLGCLFAPKIHIILFQPQKNV-TSLRKN 823          
BLAST of Metabotropic glutamate receptor vs. Ensembl Cavefish
Match: grm2b (metabotropic glutamate receptor 2-like [Source:NCBI gene;Acc:103030591])

HSP 1 Score: 501.516 bits (1290), Expect = 7.156e-163
Identity = 305/888 (34.35%), Postives = 486/888 (54.73%), Query Frame = 3
Query:  105 PFKNQVALIDGDIFLGGLMMVHLRSE-EMVCGVIAAEGGIQALEVMVYTINRVNE-MKILGDIKLGAYIKDDCDRDTYGLEQAVDFIKQS-SKLQTKS----NCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKDNRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLR-ILQKIKFTS-LSGLEME----FTPITFDGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDPVTHH---PSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGLRINIKNEQNQIDHLDNNSHTQMSYSHMILKDDQLNNIKNSVTS 2720
            P   +  ++DGD+ +GGL  VH + E    CG I  + GIQ LE M+  ++ +N+  +IL   +LGA+I D C +DTY LEQ+++F++ S +K+        + +    D     I+GVIG S S  SI VA+LL+LF IPQIS+ STS  LS+K+R+ +F RT+P D +Q + M EI++   W YVS +  + +YG     A Q+  +  +ICIATS  + R     +   Y+  +  L++         A  VI+F   ++  + ++A    N+T  F W+ SDGW  +             E+   GA  IE  S ++  FE+YF  LTP  N  NPWF EFWE  F C+L      P      + D + K          E+++ FV +AV A A AL  M+  +C PN ++  C +M    G+   R  + K KF +     E E    FT +  D L RY I ++ +  NG Y + ++G Y +Q L ++ + + + G +  IP S C+  C  ++ K + PG   CWICI CQ ++   +  T CE C  G++P  N T C  L + Y++ +   ++G +  + + ++  +    +F+    TP+VKAS RELS+ILL G++LC+ ++ +    P+ ++C+ ++ G+G SF++CYSALL K NRI RIF   R   Q+ R IS  SQ+ ICA ++S Q+++   L++ +   P       P R +   +    + +S+++ + +  ILI++CT YAF TR  PE FNE+K IGFTMY+TC++WL F P +  TA    ++  T+C+S+++S  V L CLF PK++ ILF+P++NV   LR N  N  +      +++++Q S + ++        + +S TS
Sbjct:   42 PGTKREIVMDGDLVIGGLFPVHEKGEGTQDCGKINEQRGIQRLEAMLLALDEINQDNRILPGFRLGAHILDTCSKDTYALEQSLEFVRASLTKVHQPGFICPDGSNPVPDEAPLAISGVIGGSYSDVSIQVANLLRLFQIPQISYASTSAKLSDKSRYDYFARTVPPDFYQAKAMAEILRYFNWTYVSTVASEGDYGETGIDAFQQEARVRQICIATSVKVSRSMNRVN---YETVIRSLQQK------ANAKVVILFTRSEDARELLVAAARMNVT--FIWVASDGWGAQESVVH------GSEKAANGAFTIELASYSIREFEDYFTKLTPELNTRNPWFREFWEHKFGCRL----HEPGCASHSLRDGSFKQ---------ESKIMFVMNAVYAMAHALHNMRQAVC-PNTTR-VCEAMKPGNGKRFYREFILKTKFDAPFRPAETENVVRFTSLG-DSLGRYNIFHYGQE-NGRYVYKKVG-YWSQGLVLNTSLVPWPGGA--IPTSQCSDPCQPNEAKSMQPGDVCCWICIPCQAHQFLLDEFT-CEDCGFGEWPLTNLTGCYELPEEYIHWSDAWAVGPVTIACLGMLCTMAVAGVFLRNNDTPVVKASGRELSYILLFGVLLCYAMTFIYIAKPSAVVCALRRLGLGTSFAVCYSALLTKTNRIARIFGGARDSAQRPRFISPASQMAICAVLISAQLLV--ALVWLLVEAPGVRKELSPERRDVVTLKCNSLDSSMLVSLTYNCILIILCTFYAFKTRKCPENFNEAKFIGFTMYTTCIIWLAFQPIFYVTASDYRVQTTTMCISVSLSGSVVLGCLFAPKIHIILFQPQKNV-TSLRKN-DNRFSTAITAPSSTYSQASSATVVPTVCNGREVVDSTTS 887          
BLAST of Metabotropic glutamate receptor vs. Ensembl Cavefish
Match: grm6b (metabotropic glutamate receptor 6-like [Source:NCBI gene;Acc:111195348])

HSP 1 Score: 501.516 bits (1290), Expect = 7.401e-163
Identity = 300/841 (35.67%), Postives = 460/841 (54.70%), Query Frame = 3
Query:  129 IDGDIFLGGLMMVHLRSEEMV-CGVIAAEGGIQALEVMVYTINRVN-EMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIK---QSSKLQTKSNCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKD-NRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITFDGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFI-FVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDPVT---------HHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVH---LRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGLR 2594
            I+GDI LGGL  VH R    V CG I  E GI  +E M+Y ++++N +  +L +I LGA I D C RDTY LEQ++ F++   Q      + +  E  I      + GVIGAS+S  SI VA++L+LF +PQIS+ ST+P LS+ NR+ FF R +P D+ Q Q M++I+K + W YVS +  + NYG     A  ++ ++   +CIA S  +PR+ +        DK++  K+ ++T +   A GVIIF ++ ++   + A K  NLT  F ++GSD W G ++A         +E   EGA+ I P   ++ GF+ YF + +   N+ N WF EFWED F+CKL        +     C    ++ + +P +  E ++QFV DAV A A AL  M   MC    S   C SM   +G+ LL+ ++ + F   +G  + F     D   RY I  +  +      +  IG +TN  LR+    +++ G    +P S C+  C   +RK++  G+  CW C  C  Y+   +    C+ CP    P  NRT C     I L  + P +I + +F  +  I+A T   + FV +  TPIV+AS RELS++LL GI L ++++ ++   P  ++C+F++  +G    + YSA+L K NRI RIF +G+K     + IS  SQ+ I   ++S+Q  +L   ++F    P T          +P      L CD +   SL+  + + M+L++ CTVYA  +R +PE FNE+K IGFTMY+TC++WL F+P +  TA       ++  TL VS+++SA V+L  L+ PKVY I+F P+QNV+K  R
Sbjct:   50 IEGDITLGGLFPVHSRGPAGVPCGDIKKEKGIHRMEAMLYALDQINSDPDLLPNITLGARILDTCSRDTYALEQSLTFVQALIQKDNSDVRCSNGEPPIIPKPERVVGVIGASASSVSIMVANVLRLFAVPQISYASTAPELSDNNRYDFFSRVVPPDSFQAQAMVDIVKAMGWNYVSTLASEGNYGESGVDAFLQISREAGGLCIAQSIKIPREPRPGEF----DKII--KRLMETSN---ARGVIIFANEDDIKRVLEAAKRANLTGHFLFVGSDSW-GSKIAPI-----LDQEDVAEGAVTILPKRASIEGFDQYFTSRSLENNRRNIWFAEFWEDDFKCKL-TRPGIKLDGGQRKCTGEERIGRHSP-YEQEGKVQFVIDAVYAMAHALHSMHIDMCPG--STGICDSMDPVEGKLLLKYIRAVNFNGSAGTGVMFNE-DGDAPGRYDIFQYQLSNTTNPGYKNIGQWTNH-LRLSAEDMQWSGGDKAVPDSVCSFPCESGERKRMVKGVPCCWHCELCDGYQFLLDEFN-CDTCPFDMRPTPNRTGCRPTPIIKLEWSSPWAI-IPVFLAVLGILATTGVIVTFVRFNDTPIVRASGRELSYVLLTGIFLIYLITFLMIAEPGAVVCAFRRLLLGLGMCISYSAMLTKTNRIYRIFEQGKKSVTPPKFISPTSQLIITFILISVQ--LLSIFIWFGVVPPHTTIDFEEQRPPNPELARGILKCD-MSDLSLIGCLSYSMVLMVTCTVYAIKSRGVPETFNEAKPIGFTMYTTCIIWLAFVPIFFGTAQSTEKMFIQTTTLTVSMSLSATVSLGMLYIPKVYVIIFHPEQNVQKRKR 864          
BLAST of Metabotropic glutamate receptor vs. Ensembl Sea Lamprey
Match: grm3 (glutamate receptor, metabotropic 3 [Source:ZFIN;Acc:ZDB-GENE-061009-13])

HSP 1 Score: 471.855 bits (1213), Expect = 2.016e-152
Identity = 292/869 (33.60%), Postives = 463/869 (53.28%), Query Frame = 3
Query:   45 TCLRNKEIIFIGKSGLVNVWPFKNQVALIDGDIFLGGLMMVHLR-SEEMVCGVIAAEGGIQALEVMVYTINRVN-EMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIKQS--SKLQTKSNCNEAKI---DSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKDNRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGV--------GATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLR-ILQKIKFTSLSGLEMEFTPI--TFDGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQ-PQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDPVTHH---PSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRK 2585
            TCL  +++      G       K +V + DGD+ LGGL  VH + S    CG I  + GIQ LE M++ + ++N +  +L  IKLGA+I D C RDTY LEQ+++F++ S     +T+  C +      +     I GVIG S S  SI VA+LL+LF IPQIS+ STS  LS+K+R+ FF RT+P D +Q + M EI++  +W YVS +  D +YG    +A +   +   ICIA SE + R +                 + KT+DGV         A  V++F    +  + + A +   L  SF W+ SDGW       K       +E   +GA+ IE  S+ V  F++YF +L P+ NK NPWF EFW+  F+C L        +   ++C+ ++ L + + K   E ++ FV DAV A A AL  M  ++C PN +K  C +     G  L +  +  + F +  G          + DGL +Y I  F K+ NG YS+ ++G+++ Q L +   ++ +   S  IP+S C+  C+ ++ K    G   CW+CI CQ YE   +  T C  C  G++P  +   C  L + Y+      ++  +  S I LI  +T    F+ +  TPIVKAS REL + LL G+ +C+  +       T L+C+ ++  +  SF +CYSALL K NRI R+F   R+    + + +S  +Q+ IC  ++ IQ+ ++   ++ +  +P       P + E  ++   +  ++++I ++  + L+++CTVYAF  R   ++FNE+K I FTMY+TC++WL F+P +  T+    ++  T+CVS+++S  V L CLF PKV  ILF+P +NV +
Sbjct:    9 TCLVAQQVALTQNEGGSG----KREVRM-DGDLVLGGLFPVHEKGSGPEDCGKINEDRGIQRLEAMLFALGQINRDSSLLPGIKLGAHILDTCSRDTYALEQSLEFVRSSLLKVDETEYMCPDGSYAIQNQGPTAIAGVIGGSYSSVSIQVANLLRLFQIPQISYASTSAKLSDKSRYDFFARTVPPDFYQAKAMAEILRFFKWTYVSTVASDDDYGEAGMEAFEHEVRSRNICIAVSEKVGRSA-----------------NKKTYDGVIKALMQKPNAKVVVLFTRSDDAKELLAAARM--LHASFYWVASDGWGALESVIK------GQEDVADGALTIELNSQRVKEFDDYFQSLLPAKNKRNPWFTEFWQQRFQCTLSRG-----HRHGNVCNASMSLRRGSYKQ--ETKIMFVIDAVFALAHALHNMHKELC-PNTTK-LCAAFTPINGVKLYKEFILNVSFQAPFGDHDRIVKFDSSGDGLAKYNIFIFQKS-NGKYSYTKVGHWS-QGLVLQANEIHWAKSS--IPVSQCSDPCAPNEMKSTQRGDSCCWVCISCQPYEYLYDEFT-CMDCGPGRWPSADLRDCYDLPEEYIKWEDAWALVPIAISCIGLICTVTVLITFIVHGNTPIVKASGRELCYALLAGVSMCYSTTFAFVAKATVLVCALRRLVLAASFVVCYSALLTKTNRISRMFNSAREGGSSRPKFVSPLAQMVICLTLILIQLSVVA--IWLIVENPGLRRFTIPDKREVVILKCSVQDSNMLISLVCNVCLVMVCTVYAFKNRKCHDSFNEAKFIAFTMYTTCIIWLAFVPIFYVTSGDYRVQTTTICVSVSLSGSVVLGCLFAPKVNIILFQPHKNVER 831          
BLAST of Metabotropic glutamate receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007590.1 (pep scaffold:Pmarinus_7.0:GL478498:6932:63706:-1 gene:ENSPMAG00000006812.1 transcript:ENSPMAT00000007590.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 456.062 bits (1172), Expect = 5.176e-147
Identity = 269/799 (33.67%), Postives = 424/799 (53.07%), Query Frame = 3
Query:  129 IDGDIFLGGLMMVHLRSEE-MVCGVIAAEGGIQALEVMVYTINRVN-EMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIK---QSSKLQTKSNCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKD-----NRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITF----DGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDPVT---HHPSRNEE------YLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATA 2456
            +DGDI LG L  VH R +   +CG +  E GI  LE M+Y ++ +N + +IL ++ LGA + D C RDTY LEQ++ F++   +      +   N   I +    + GVIGA+ S  SI VA++L+LF IPQIS+ ST+P LS+  R+ +F R +P D++Q Q M+EI+  L W YVS +  + NYG    +      +D       +CIA S  +P + K +      DK++      +  +   A  +I+F ++ ++   + A +  N T  F W+ SD W G ++A  +     ++E E EGAI I P   +V  F+ YF + T   N+ N WF EFWE+ F+C+L +            C    ++ +D+ ++  E ++QFV DAV A A AL  +  + C P +S   C+ M     + LL  ++ + F   +G     TP+ F    D   RY I  +         +  IG + N  L+++ + L++      +P S C+  C+  +RKK   G+  CW C +C+ Y  F+     C  CP    P+ NRT C  +  + L    P ++  +  + + L+        FV Y  TPIV+AS RELS++LL GI LC+  + ++   P+  +CSF++  +G    + Y+ALL K NRI RIF +G++     RLIS  SQ+ I   ++++Q  +LG  ++F  + P T   +   R++E       L CD I   +L+  + + ++L++ CTVYA  TR +PE FNE+K IGFTMY+TC+VWL FIP +  TA
Sbjct:   41 LDGDITLGALFPVHARGDRGAMCGALKMEKGIHRLEAMLYALDTINADPRILPNVTLGARVLDTCSRDTYALEQSLTFVQALIEKDTADVRCTNNAQPIFAKPEKVVGVIGAAGSSVSIMVANILRLFKIPQISYASTAPELSDNTRYDYFSRVVPPDSYQAQAMVEIVSALGWNYVSTVAANDNYGESGIEYFSRFARDTGKPPGGVCIAQSLKIPHEPKPSDF----DKIIH-----RLLETPSARAIILFANEDDIKRLLEATRRANQTGHFLWVASDSW-GSKIAPIR-----NQEDEAEGAITILPKRASVAEFDKYFTSRTLENNRRNVWFAEFWEENFKCRL-SRHGARQTVHAKKCTGQERVGRDS-QYEQEGKVQFVIDAVYAMAHALHNLYQKRC-PRLS-GLCVDMEPVPTKDLLEEIRSVSFNGSAG-----TPVMFNKDGDAPGRYDIFQYHLHNTSTPGYNVIGEWVNH-LQLNISALQWTAGRRELPYSICSMPCASGERKKKVKGVPCCWNCERCEGY-YFQLDEFNCHLCPYNMRPNVNRTGCDAIPIVKLEWHSPFAVVPVFLAILGLLTTAFVIVTFVRYNDTPIVRASGRELSYVLLTGIFLCYATTFLMIAEPSLAVCSFRRIFLGLGMCVSYAALLTKTNRIYRIFEQGKRSVTAPRLISPASQLVITFSLIAVQ--LLGVCIWFGLTPPHTVIDYEEQRSQEAELARGMLKCD-ISDLALICSLGYSILLMVTCTVYAIKTRGVPENFNEAKPIGFTMYTTCIVWLAFIPIFFGTA 810          
BLAST of Metabotropic glutamate receptor vs. Ensembl Sea Lamprey
Match: casr (calcium-sensing receptor [Source:ZFIN;Acc:ZDB-GENE-050119-8])

HSP 1 Score: 305.834 bits (782), Expect = 3.460e-90
Identity = 244/887 (27.51%), Postives = 408/887 (46.00%), Query Frame = 3
Query:  123 ALIDGDIFLGGLMMVHL----RSEEMVCGVIAAE------GGIQALEVMVYTINRVN-EMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIKQSS----KLQTKSNCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKDNRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDI------CDENLKLSKDNP-------------KHSFENQLQF-----VSDAVMAFAMALKEM--KNQMCAPNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITFDGLPR--YRILNFIKAA-NGIYSWVEIGNY-----TNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPG--ICTCWICIKCQEYEIFKNSRT-ICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRK---GRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDPVTHHPSRNEE--------YLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGLR 2594
            A  DGD+ LGGL  +H     R++ +     A E       G++ +  M + +  +N +  +L  ++LG  + D C+  +  LE  + F+ ++      +    NC  A   + +     V+GA+SS  S  VA+LL LF IPQ+S+ S+S  LSNK ++  F+RTI SD  Q   + E++++  W +V +I  D +YGR   +  +E  ++  IC+  SE +        + E  D +      +          +++F S  ++   M  +   NLT    W+GS+ W    +  +  +F       +   +G       + GF  Y   + P  + +N +  + WE  F C L   + +  N    +       +E +K + + P             K  F +         V  AV A A AL +M    +  A       C ++ Q +   LLR LQ ++F +  G E++F      G PR  Y ++N+ ++  +G    VE+G+Y     + Q+L  + +K   +G S  IP S CT  C+   RK +  G  +C C+ CI C E E    S    C  CP   +P  N T+C+  ++ YL+   P  + L     +  ++ L+   +FV +  T IVKA++ ELS++L   +  CF+ SL     P+ + C  ++   G SF LC S +LVK +R+ ++F     GR   +KL  +  Q  +        +Q++I    LY       T  P+  E+        YL CD     +L  ++ +  +L  +C ++AF  R +PE FNE+K I F+M    +VWL FIP Y+++        A   ++I VS+   LSC+F  K Y IL KP++N  + +R
Sbjct:    1 AWKDGDLNLGGLFPIHFGVLSRADSLTVRPEAVECVRFNFRGLRWMLAMAFAVEEINADNLLLPGLRLGYKMADTCNTVSKALEATLGFVARNKLGALGMGGVCNCTPAPRANTV----SVVGATSSGVSTAVANLLSLFRIPQVSYASSSRVLSNKQQYRSFMRTILSDEQQATALAELVREFGWTWVGLIASDDDYGRPGIERFREENEEEVICVEFSETVSLYDPPERIHELADMIANATARV----------IVVFASGTDLDPLMREVARRNLTGR-TWIGSEAWVSSSLIARPEIFHV-----VGSTLGFVQRPGHIPGFREYLQKVHPQRHPNNVFVRQLWEATFNCTLKAEAASSDNCTQSVQSHEQGINECVKGAANAPRPFCTGRENISAVKTPFLDYTDLRITYNVYLAVYAIAHALHDMLFGCREGAGLFEGGKCTNIQQLEPWQLLRYLQVVRFRNNKGEEVQFDE---KGDPRGGYSLVNWQQSPKDGSVQLVEVGSYDGRKPSGQRLLCNGSKQISKGYSREIPTSVCTQPCAPGTRKGILEGEQVC-CFECISCAEGEYNNESDANSCLGCPEDSWPSANHTMCVPKREEYLSWREPFGVCLAFVGCLGAVLTLSVAAVFVKHRGTAIVKATNVELSYLLFFSLFCCFLSSLFFIGKPSTVACKLRQPTFGISFVLCVSCVLVKTHRVLQVFESQIPGRGGVRKLLGLDHQLLLV--FLFTLVQVVICAVWLY-------TAPPTFEEDDTFKNDVIYLSCDEGSQLALGFVIGYTCLLAGVCFLFAFRARKLPENFNEAKFITFSMLVFFIVWLSFIPAYVSS--QGKFVAAVEVIAILVSSFGLLSCIFFHKCYIILLKPERNTPEEVR 852          
BLAST of Metabotropic glutamate receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005888.1 (pep scaffold:Pmarinus_7.0:GL487952:898:2919:-1 gene:ENSPMAG00000005329.1 transcript:ENSPMAT00000005888.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 230.72 bits (587), Expect = 2.993e-67
Identity = 146/421 (34.68%), Postives = 223/421 (52.97%), Query Frame = 3
Query:  138 DIFLGGLMMVHLRSE-EMVCGVIAAEGGIQALEVMVYTINRVNE-MKILGDIKLGAYIKDDCDRDTYGLEQAVDFIKQSSKLQTKSN--CNEAKI---DSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKDNRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLR 1379
            ++ +GGL  VH + +    CG I    GIQ +E M++ ++R+NE  ++L  ++LGA + D C +DTY LEQA++F++ S +    ++  C +        N + I GVIG S S  SI VA+LL+LF IPQIS+ STS  LS+K+R+ +F RT+P D +Q + M +I++   W YVS +  + +YG    +A +   +   ICIATSE + R   L     YK  V  L +         A  V++F    +  + + A   +N   SF W+ SDGW       K        E+   GAI IE  S  V  F  YF +L P+ N+ NPWF E+W+  F+C LP   + P+    + C +   L+  N +   E+++ FV +AV A A AL  M+  +C PN +   C +M    G+ L +
Sbjct:    9 ELLVGGLFPVHEKGDGSKDCGPINEARGIQRMEAMLFALDRINEDPRLLPGVRLGARVLDTCLKDTYALEQALEFVRSSLQKVDGTDFMCPDGTYAIHGGNAQPIAGVIGGSDSSVSIQVANLLRLFQIPQISYASTSAKLSDKSRYDYFARTVPPDFYQAKAMADILRFFNWTYVSTVASEGDYGETGIEAFENEARSRNICIATSEKVGR---LTGPDSYKGIVHNLMQK------PNARVVVLFMRSDDAKNLLAAATSNNT--SFLWVASDGWGALENVVK------GNEKAALGAITIELSSFPVQEFSEYFKSLRPTANERNPWFREYWQHKFQCTLP---ELPH--VENECSQQRSLNDKNFEQ--ESKIMFVVNAVYAMAHALHNMQRSLC-PNTT-GLCDAMKPIDGKRLYK 403          
BLAST of Metabotropic glutamate receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003019.1 (pep scaffold:Pmarinus_7.0:GL478098:6745:34806:-1 gene:ENSPMAG00000002755.1 transcript:ENSPMAT00000003019.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 222.631 bits (566), Expect = 1.214e-64
Identity = 128/347 (36.89%), Postives = 196/347 (56.48%), Query Frame = 3
Query: 1590 PISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVF--YFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDP-------VTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVH---LRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGLR 2594
            P S C+ +C   +R++   G+  CW C +C+ Y       T C+ CP    PD N T C     + L    P +  + +F  +  I+A T F    F  +  TPIV+AS RELS+ LL GI LC+VV+ ++   P+  +C+ ++  +G    + Y+ALL K NRI RIF +G+K     R IS  SQ+ I   ++S+Q  +LG  ++F  + P        T  P      L CD I   +L+  + + ++L++ CTVYA  TR +PE FNE+K IGFTMY+TC++WL FIP +  T+  V+   ++  TL +++++SA V+L  LF PKVY +L +P+ NV+K  R
Sbjct:   17 PASECSVQCEPGERRRQLKGVPCCWTCERCEGYTYLHKDFT-CKLCPYHLRPDANHTACHPFPTVKLEWHSPWA-AVPLFVAVLGILA-TSFVAATFARFNDTPIVRASGRELSYTLLTGIFLCYVVTFLMIAAPSVALCTLRRLFLGLGMCISYAALLTKTNRIHRIFEQGKKSVAPPRFISPASQLVIAFSLISVQ--LLGVFVWFGANPPQVFINEQRTLDPMEAHWVLQCD-ISDLALICSLGYSILLMVTCTVYAIKTRGVPEGFNEAKPIGFTMYTTCIIWLIFIPIFFGTSQSVNKLGIQTTTLTIAMSLSASVSLGMLFCPKVYIVLLRPELNVQKRKR 357          
BLAST of Metabotropic glutamate receptor vs. Ensembl Nematostella
Match: EDO35253 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM25])

HSP 1 Score: 485.337 bits (1248), Expect = 3.250e-158
Identity = 293/831 (35.26%), Postives = 447/831 (53.79%), Query Frame = 3
Query:  129 IDGDIFLGGLMMVHLRSEEMV---CGVIAAEGGIQALEVMVYTINRVNE-MKILGDIKLGAYIKDDCDRDTYGLEQAVDFIKQSSKLQTKSNCNEAKIDSNLRT--ITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKDNRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPST-NKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITFDGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRID----YTKLKFRGDSSVIPIS----SCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDPVTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQN 2576
            I  DI LGGL  VH R E  V   CG +++E G+Q LE M++ I  VN+   +L ++ LGA I D C  DT GLE+ ++FI  S   Q       + +D N     + GVIGA+SS  SI VA+LL+LF +PQIS+ STSP LSNK+R+ FF+RT+PSDA Q +V+ ++I+ L W  V  +    NYG    +    + K+  IC+  +  +       + + + D + R  +        G  GV++F +D ++   + A +       F+W+ SD W G R    KG     +E   +GAI I   S     +  YF +LTP+  +K NPWF EFWE  F+CKL  +S T        C  N  LSK+      +N++ FV DAV AFA  L  +    C PN        M QN GE L+ ILQ I F  +SG E++F     D    Y +  F +  +G Y+++++  +      +D       L   G+  ++  S    SC   C+    +KL      CW C+ C + E  K+  T C  C   + PD  RT C+ L   YL+ +   SI +  F+ + +I  L    IF+ + +TP+VKAS REL+  LL+G+ LC+V  ++L   P+  +C  Q+FG+GF+  +CY+ALL+K NRI RIF K  +  +    I+  SQ+ I A +V +++++ G  L + +       P++++    C+ I    LV+ + + ++LIL+CT+YAF TR  P  FNE+++IGF MY+TCV+WL F+P  +      + +  TL +++ ++A   L C+FGPKVY +LF+P +N
Sbjct:    2 ITADIVLGGLFPVHSRLETAVGQTCGELSSERGVQRLEAMIFAIKEVNKNTTLLPNLTLGALIHDTCGTDTIGLEETLEFIMDSLSRQNLPTQQCSGVDENFNKTLLAGVIGAASSSVSIQVANLLRLFKMPQISYASTSPDLSNKHRYDFFMRTVPSDAFQARVIRDVIRALNWSAVFTVNSKGNYGERGIEEFHMLAKEANICVVEAVTIEHS---FTAEAFDDVIRRFMRE------TGMRGVVLFCTDNDIRKLLNAAERVQAEGRFSWIASDYW-GTRHGLVKG-----RESLAKGAITITLRSIPHTEYREYFTSLTPTNYSKANPWFEEFWEKNFKCKLTGNSST--------CPANTSLSKE---MYIDNKVPFVIDAVRAFATGLDVLYRNKC-PNTDGLCEDLMRQNNGEELMSILQNISFQGVSG-EVKFDS-QGDATGMYDVFTFNQTESG-YNYIKVATWDGGLHFVDPALQAGGLDLGGEGVLLNPSGVQSSCGEPCARGYYRKLRRDKACCWTCLPCGKDEYVKD-LTGCGRCTELERPDPTRTGCVLLPLRYLSDS--WSIMVTCFATVGIICVLGVSVIFIMFSETPLVKASGRELTATLLIGLFLCYVEGIMLILRPSVFVCGLQRFGVGFAPCVCYAALLIKTNRIARIFAKSERSTKPPDFINPASQLLILAAVVGVEVVLAGVGLGYWSPKQTEKFPTKSDILSTCN-IQDYDLVVAMSYNVLLILLCTIYAFRTRKTPANFNEARYIGFAMYTTCVIWLAFLPVQIGVNDKDY-KTLTLSINVTLNATTLLLCVFGPKVYIVLFRPTRN 797          
BLAST of Metabotropic glutamate receptor vs. Ensembl Nematostella
Match: EDO31767 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWZ2])

HSP 1 Score: 406.757 bits (1044), Expect = 1.649e-127
Identity = 266/857 (31.04%), Postives = 438/857 (51.11%), Query Frame = 3
Query:  129 IDGDIFLGGLMMVH-LRSEEMVCGVIAAEGGIQALEVMVYTINRVN-EMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIKQSSKLQTKSNCNEAKIDSNLRTIT-GVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKDNRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLS--KTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKH-SFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITFDGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLK--FRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDPVTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGLRINIKNEQNQIDH---LDNNSHTQMSYS 2666
            + GD+ +GGL  VH    ++  CG +  + GI  LE M+Y I+ VN +  +L +I LGA I+DDC+    GLEQ+++ + Q        NC           IT GV+G S S  +  VASLL+LF +PQIS+ +TS  LS+ +RF +F+RT+P D  Q   +++II+ + W  V  I    +YG    ++ Q++ +   +CI   ++   D K+  V EY + + R  K  +T        V++F + +++   + +    NLT  F WL SD W  +     + LF    E    GA+ IE  +  + +  F +YF  L P TN  NPWF E+WE  F+CKL N+S + +N     C +N    +    H  ++ ++ FV +AV++FA AL  + + +C+       C +M Q   ++L+  L+ + F   +G  ++F     D   +Y +L + +       +V +G++   +L+++ +++   +  DS+ I  S C   C     +++    C CW C  C       N+   C  C  G  PD +   C  L   YL+   P    +   +G+ +++ +    +F+ +  TP++ A+ RE+S +L  G+I+C+ ++ V+   P   +C  ++FG G SF L Y++LLVK NRI RIF  G K P     IS +SQ+FI   I+S  + I  TLL F    P   +    +  L+       +++  + + ++LIL+CT YAF TR  P  FNE+K IGF MY+TCV+W+ F+P Y             +C S   SA   L  +F PKVY ++FKP++N++   R+  + +  +I     +DN+S     Y 
Sbjct:   55 VSGDVIIGGLFSVHSAGGDKFRCGPLNEQVGIHRLEAMLYAIDLVNADHTLLPNISLGADIRDDCENINRGLEQSLNLL-QGMLGNNNRNCPARDWIKERGPITAGVVGPSYSSLATQVASLLRLFKVPQISYAATSTELSDTHRFDYFMRTVPPDLFQALAIVDIIRAMNWSAVFAINSRGSYGEGGIQSFQKMARKANVCIV--DVAQVDDKMNPV-EYTEILERFTKESRT------RVVVLFCNTEDIHSILASASRLNLTRYFMWLASDFWGSK----NEPLFGV--EDVANGAMTIELQTNQRELNKFYDYFKQLRPETNSRNPWFREYWEWHFKCKLENNSLSVFNR---SCSDN----QSGTHHLHYDGKVMFVVNAVLSFAHALHNLHSDICSG--EPGMCYAMRQATRDSLISYLRNVTFNGTTG-RIQFDS-NGDTSGKYDVLQYRRDGEDDGRYVRVGSWIEGELKLNTSEITEWYVSDSNAIE-SHCGKPCKPGYIRRMTKAKC-CWSCEWCSLGSFVYNN--TCIRCKEGYQPDTSYQDCTLLPVKYLDT--PWKAVVATAAGVGVVVTMFVIGVFIKFKDTPLIMAAGREVSTLLFTGMIMCYALAFVMVVPPNTTLCGIRRFGTGISFCLLYTSLLVKTNRIARIF-SGTKSPS---FISPKSQLFITLLIISPVLTI--TLLEFYFHPPKIKYTHLEKYNLLSCSNKEIAVITKLCYNVLLILLCTYYAFRTRKTPLNFNEAKFIGFCMYTTCVIWIAFLPLYFGAG--GGFEGLAVCFSAVFSATTILVFIFAPKVYIVIFKPEKNLKSNSRLRSRTKSLEIAATATMDNDSDDDRKYG 870          
BLAST of Metabotropic glutamate receptor vs. Ensembl Nematostella
Match: EDO41315 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4N3])

HSP 1 Score: 389.808 bits (1000), Expect = 7.328e-122
Identity = 266/828 (32.13%), Postives = 421/828 (50.85%), Query Frame = 3
Query:  129 IDGDIFLGGLMMVHLRSEEMVCGVIAAEGGIQALEVMVYTINRVNEMK--ILGDIKLGAYIKDDCDRDTYGLEQAVDFIKQSSKLQTKSNCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKDNRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITFDGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDS--SVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQ--NRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDPVTHHPSRNEEYLIC---DYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRK 2585
            + GDI LGGL+ VH ++ ++ CG +    GIQ LE ++Y ++++N     +L  I LG  + D C  +T  L+++++FI   S+L+++S  +          + G+IGA+ S  SI +A L +LF+IPQIS+ STS  LS+K RF FF RT+P D  Q + +++++K   W YVS++Y D +YG     AL+       IC+A+S  +      ++     D +L             A  VI+F    ++   + A++  N      ++GSD W    V + K L     +      I + P S  + GFE YF +L+P  N  NPWF E+WE  F C L    +     +   C+++LKLS  N     + ++    DAV AFA AL+ M   +C   +    C +M    G  LL  ++   F   +G ++ F     D    Y ++ F K++ G Y  V IG + +        KL+ R +    ++  S      SD+    +      CW C  C+      N RT C  CPLG +P+   +R  CL+++  Y  +    ++  M F+G  + I +   ++   + KTPIVKA  REL+++LLV I+LCF  + ++   PT+++C  + F     F++ Y+A+ +K NRI RIF + R   ++  L+   SQ+ +   +V +Q + L  L           +P+ +  YL C   D   G S V    +  ILI++CTVYAF TR IP  FNE+K I F MYS+CV+WL F+  Y     +V  R   L +SI++ A V L  L+GPKVY ++F+P +N  K
Sbjct:    1 MKGDILLGGLVPVHSKNVDLQCGELQERLGIQRLEALLYALDKINAANSTLLNGITLGLQLYDTCSSETMALDKSLNFIY--SQLKSESTSSR---------VVGIIGAAYSSVSIQIARLSRLFEIPQISYDSTSFELSDKKRFGFFSRTVPHDNFQAKALVDVLKYFNWTYVSVVYSDDSYGILGVDALRSAATRAGICMASSHKVRSSGHESTYLLVVDSILSEPL---------ARTVIVFAQVHQIRGLLHAVQVRNAADQLQFVGSDAWGN--VVWLKDL-----QSVALNTITVSPKSVRLKGFEEYFTSLSPINNSRNPWFQEYWEHHFNCSL----NETLGKYPTKCNDSLKLSLGN--SDIDMRIASAIDAVYAFAHALEAMHADLCRYTV--GVCPAMENISGSELLGYIRNASFVGATGEKVHFDA-NGDVEGIYDVMRFEKSS-GTYRNVIIGTWKD--------KLRMRNEHKFEIVKSSCSDECSSDEVMLPVRGKEACCWSCEPCKGNSYVIN-RTTCLTCPLGSWPNHSADRKQCLQIELQYFGKNLMYAVPAMGFAGTGIFITIFVVYLLAKHDKTPIVKACGRELAYLLLVSILLCFSDTFIVVLRPTRIICIARFFLSSLGFTISYAAIFIKTNRISRIFNR-RNVAKRPILVLPSSQLVLVLGVVCVQALFLVLLTLLRTPTARHFYPTVDTVYLSCSTSDLDFGLSQV----YNFILIIMCTVYAFKTRKIPSNFNEAKLIAFAMYSSCVIWLAFLAVYFMQRSLVE-RPLILSISISLIAYVLLGSLYGPKVYILIFRPHRNKTK 776          
BLAST of Metabotropic glutamate receptor vs. Ensembl Nematostella
Match: EDO48665 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIA2])

HSP 1 Score: 390.578 bits (1002), Expect = 6.497e-121
Identity = 256/826 (30.99%), Postives = 417/826 (50.48%), Query Frame = 3
Query:  129 IDGDIFLGGLMMVHLRSE--EMVCGVIAAEGGIQALEVMVYTINRVNEMK-ILGDIKLGAYIKDDCDRDTYGLEQAVDFIKQSSKLQTKSNCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKDNRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNK-GETLLRILQKIKFTSLS-GLEMEFTP-ITFDGLPRYRILNF-------IKAANGIYSWV-EIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQ-RKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDPVTHHP-SRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVHLRVATLCVSINVSALVALSCLFGPKVYTIL 2558
            I GD+ +GGL  VHL+++  E  CG I+ + G Q L  M++ +  +N    +L +I LGA I D C   T G + A D IK+S             + +N + + GV+G   S  SI    LL++F +PQ+SF STSP LSNK+ +  F RT+P D+ Q + +++I++   W Y+  I    NYG     A+ ++ +   ICIA +  +P      S   + ++++R     + FD V    +++F +  +    + A      T  F WLGS+GWS R             E    G+I +  +   V GFE +F ++ P  N++ PW +EFWE++F+C LP    T Y N    C E+L L    PK      ++ V +AV AFA AL +M+  +C   +    C +M+ +  G+TL+  L+ + F   S G  + F      DG   Y I+NF       I    G +SW  E  N   + L ++  K+ +       P S C+  C   Q R +L      CW C  C E++I  N    C++C  G  P  N ++C++L  ++ +    + I   ++S + +++ L     FV   +  +VKA+ REL  I+L+GI+LC+         P  + C+ ++F     ++ CY+ LL+K NRI RIF + RK   +  L S  SQ+ + A ++++Q+++  T ++ ++S    H    R    +I     G  L + + + ++L+LICT++AF TRN P  FNE+K+IG  MY TC  W+ ++P YL T  +         VS+ + A + L+ +F PKV+ I+
Sbjct:   97 IPGDVIIGGLFPVHLKNQKSENSCGPISTQPGFQYLAAMLFALELINNSSTLLRNITLGASIYDTCQSQTIGADHAKDIIKES-------------LLTNNKLLKGVVGPLVSDVSIATVQLLRVFGLPQVSFGSTSPDLSNKDLYGSFFRTVPPDSFQAEALVDILEHHGWNYIITINSAGNYGENGMSAIIKITEKRDICIAATFTVPP----LSTDAHYERIIREIAQAR-FDAVNI--IVVFTTQTDSAGLLSAAARLGATR-FTWLGSNGWSNRMTV------TIGNEMVANGSITVNHMDGQVAGFEEFFSSMNPINNQNIPWIDEFWENWFKCDLPGGKPTFYKN----CTEDLVL----PKMEVA-PVRVVINAVYAFAHALDDMQRALCPGKV--GLCEAMIADSSGKTLIDFLRNVTFPDASYGWPVRFNKNQEMDG--NYSIMNFQYQNGKWIYENVGSWSWGDESDNVRMEHLILESQKISWGKGKLSPPHSICSAPCQFPQIRNQLPVNPKCCWECSFCDEHQIVVNDS--CQSCLPGHRPYTNHSMCVKLPVVHPSLGEAMGITFAVWSCLGMLVTLAICVFFVKSREHEVVKAAGRELCAIILLGIMLCYASIFTNLVEPDAITCTVERFFSSVCYTTCYAPLLMKTNRIYRIFSRARKAASRPHLTSPTSQVLVTAGLIAVQLLL--TTVWTISSPSHIHITYERLTRTVISCESHGGMLALNLSYNILLMLICTLFAFKTRNFPRNFNEAKYIGVMMYLTCAAWIIYLPSYLNTHDVWAQVYLNCGVSVTI-ATITLAGIFAPKVHVII 877          
BLAST of Metabotropic glutamate receptor vs. Ensembl Nematostella
Match: EDO42746 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0J8])

HSP 1 Score: 343.199 bits (879), Expect = 2.495e-104
Identity = 248/844 (29.38%), Postives = 414/844 (49.05%), Query Frame = 3
Query:  129 IDGDIFLGGLMMVH-LRSEEMVCGVIAAEGGIQALEVMVYTINRV-NEMKILGDIKLGAYIKDDCDRDTYGLEQAVDFI--KQSSKLQTKSNCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKDNRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFEC-KLPNSS----DTPYNNFTDICDENLKL----SKDNPKHSF--ENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITFDGLPRY-----RILNFIKAANGIYSWVEIGNY--TNQKLRI-DYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTI--CEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDP-VTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVHL--RVATLCVSINVSALVALSCLFGPKVYTILFKPKQN 2576
            ++GD+ LGGL  VH L++     G       I  +E M+Y +N + +   +L +  LG  I+D C++ +  LE ++DF+    + K    S   E +    +  +  VIG ++S  S+++A++L + DIPQIS+ STS  LSNK+ +P FLRTIPSD +Q + + +++   QW YVS++  D  YGR    AL+E  K   IC+A   I   +        YK ++ ++   LK+     A  ++++        F+    E  LT    W+G++ W          L E+  +  + G +G+ P      GFE++   L+P+ ++ NPW  E+WE  F C K  N S       Y  +    D N+ +    +K  P   F   N+   V DAV + A A++ +  +    N SK   IS  Q        +L  IK TS +GL         +G  +Y     + L    +      +VEIG++     +L+I D    K+ G  +  P+S C   C+  Q        C CW C+ C    + K SR    C+ CP G   ++  T C+++ + YL       I +++FS +  ++++T   IF+ + +T +VKAS+RELSF+ L  I+L F     L   P+++ C    F     F L  S +L+K +R+ R+FR   +   +  L++ + Q    + + S  +++  + ++F+ S P VT         ++CD  +    ++I+++ ++L L+CT +A+  R +PE FNE+K IGF M++ C+ WL    CY A +       RV  LCV+I  S  + L  ++ PKV  I+F P +N
Sbjct:    1 LNGDLVLGGLFPVHVLKAVGDRKGSDLNYYAITWVEAMLYALNEIRHNSSMLQNYTLGFDIRDSCNKVSTALEASLDFLLGDTAGKTWNASCFCEGR---GMPLVGAVIGGAASPISLNIANVLSVNDIPQISYSSTSVLLSNKDVYPSFLRTIPSDTYQAKAIADLLAAFQWAYVSVVASDDAYGRAGMDALKEELKKRDICLAIDAIFHHE-------MYKSELHQIITSLKS--KPRAKVIVLWCQRPNAIGFLQVATELQLTQR-TWIGTETWGDSY------LLESLSQDIVGGLVGVVPHLIKNPGFESHLSGLSPANSERNPWMFEYWEQEFSCHKTANDSYMLNTANYFVYKTNSDVNVTIVCERTKGKPTTEFLPRNKYTNVMDAVYSVAYAVQALLKE--NTNSSKKTTISPKQ--------LLGYIKNTSFAGLSGSVVSFDKNGDLKYGSFSIKSLQVDASKPAKMKFVEIGSWEGVTGELKIFDEVSFKWNGWRNETPVSRCNDICAPGQYPVNGSTRC-CWTCVPCPA-GLIKPSRGQDGCKGCPEGYEANEMHTSCVQITEEYLRWGSTSGIIVLVFSSLGTMLSITVITIFIKHRETAVVKASNRELSFVHLACILLTFTFPFSLVGRPSRVQCGVWPFVFAVVFCLGTSIMLLKTDRLLRVFRAKARLTSRSNLLTNKMQFLTASALTSFPVVM--SAVWFLISPPDVTVTQQGATRRVMCDKNVYTVQLVILVYILVLALVCTYFAYRARTLPENFNEAKFIGFAMFAFCISWL----CYFAASYGSAAVDRVLILCVTILASGFIVLGMMYFPKVQIIVFYPSRN 807          
BLAST of Metabotropic glutamate receptor vs. Ensembl Medaka
Match: grm8b (metabotropic glutamate receptor 8-like [Source:NCBI gene;Acc:101169446])

HSP 1 Score: 530.02 bits (1364), Expect = 4.977e-174
Identity = 313/846 (37.00%), Postives = 472/846 (55.79%), Query Frame = 3
Query:  129 IDGDIFLGGLMMVHLRSE-EMVCGVIAAEGGIQALEVMVYTINRVN-EMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIKQS-SKLQTKSNC--NEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKDN-RICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCA--PNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITF----DGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDP---------VTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAI---MVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGLR 2594
            +DGDI+LGGL  VH R E    CG +  E GI  LE M++ I+ +N + ++L ++ LGA I D C RDTY LEQ++ F++    K  +  +C   E  I +    + GVIGAS+S  SI VA++L+LF IPQIS+ ST+P LS+ +R+ FF R +P D +Q Q ML+I+  L W YVS +  + NYG    +A  ++ +++  +CIA S  +PR+ +L   +E+   ++RL       +   A  VI+F ++ ++   + A K +NLT  F W+GSD W  +     +      +EQ  EGAI I P    V  F+ +F + + S N+ N WF EFWE+ F CKL      P +     C    K+ +D+  +  E ++QFV DAV A A AL  M  ++C+  P +    C  M    G+ LL  +  + F    G     TP+TF    D   RY I  +         +  IG++T+Q L ++   L++    S  P S C+  CS  +RKK+  G+  CW C  C+ Y  F+ +   CE CP  + P+QNRT+C  +  I +    P ++  ++ S + +I       IFV Y  TPIV+AS RE+S++LL GI LC++V+  +   P  ++CSF++  +G      Y+AL  K NRI RIFR+G+K     R IS  SQ+ I   ++S+Q  +LG L++F  + P          T +P      L CD I   SL+  + + ++L++ CTVYA  TR++PE FNE+K IGFTMY+TC++WL FIP +  TA     ++++ ATL +S+ +SA V+L  L+ PKVYTI+F P+QNV K  R
Sbjct:   24 LDGDIYLGGLFPVHARGEMGAPCGELKKEKGIHRLEAMLFAIDLINKDPELLPNVTLGARILDTCSRDTYALEQSLTFVQALIEKDGSNVHCANGEPPIFTKPDKVVGVIGASASSVSIMVANILRLFKIPQISYASTAPELSDSSRYDFFSRVVPPDTYQAQAMLDIVTALGWNYVSTLASEGNYGESGVEAFVQISRESGSVCIAQSLKIPREPRL---QEFDRIIIRL------LETPNARAVIMFTNEDDIRRILEAAKRNNLTGHFLWVGSDSWGSKISPVLQ------QEQVAEGAITILPRRTAVDAFDRHFKSRSLSNNRRNIWFAEFWEENFGCKLGMHGKRPGS--PKKCTGMEKIGRDS-IYEQEGKVQFVMDAVYAMAHALHHMHLELCSGYPGL----CPRMANIDGKELLAHIHAVTFNGSGG-----TPVTFNEKGDAPGRYDIFQYQINNRSTADYRVIGHWTDQ-LHLNMEALQWDASDSSRPSSVCSMPCSPGERKKVVKGMPCCWHCEHCEGYH-FQANEFTCELCPYEKRPNQNRTMCHPIPIIKIEWHSPWAVLAILISVLGIIATTFVTVIFVRYNDTPIVRASGREMSYVLLTGIFLCYIVTFPMIAAPDVVVCSFRRILLGLGMCFSYAALFTKTNRIHRIFRQGKKAVTPPRFISPASQVVITFSLISLQ--LLGVLVWFATNPPHTFVDYGEQRTQNPENARGILKCD-ISDLSLICSLGYSILLMVTCTVYAIKTRSVPETFNEAKPIGFTMYTTCIIWLAFIPIFFGTAQSEERMYIQTATLTISLGLSASVSLGMLYMPKVYTIIFHPEQNVPKRKR 837          
BLAST of Metabotropic glutamate receptor vs. Ensembl Medaka
Match: grm2b (metabotropic glutamate receptor 2-like [Source:NCBI gene;Acc:101174659])

HSP 1 Score: 510.76 bits (1314), Expect = 9.673e-167
Identity = 301/847 (35.54%), Postives = 468/847 (55.25%), Query Frame = 3
Query:  105 PFKNQVALIDGDIFLGGLMMVHLRSEEMV-CGVIAAEGGIQALEVMVYTINRVNEM-KILGDIKLGAYIKDDCDRDTYGLEQAVDFIKQS-SKLQTKSN-CNEAKIDSNLR---TITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKDNRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLR-ILQKIKFTSLSGLEMEFTP------ITFD----GLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDPVTHHP----SRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNV 2579
            P   +  ++DGD+ +GGL  VH + + M  CG I  E GIQ LE M+  ++ +N   +IL  ++LGA+I D C +DTY LEQ++DF++ S +K+      C +            I+GVIG S S  SI VA+LL+LF IPQIS+ STS  LS+K R+ +F RT+P D +Q + M EI++   W YVS +  + +YG     A Q+  +  +ICIATS    + S+  + + Y++ +  L++         A  VI+F   ++  + ++A    N   SF W+ SDGW  +    +        E   +GA  IE  S  +  FE+YF  L P TN  NPWF EFWE  F C+L     +         D +L+    +     E+++ FV +AV A A AL  M+  +C+ N SK  C +M    G    +  + K KF      E  F P      + FD    G+ RY I ++ K  +G +++ ++G Y +Q L ++ + + +RG   V P S C+  C  ++ K + PG   CWICI CQ Y+  ++  T C  C  GQ+P  N T C  L + Y+      +IG +  S + ++  LT   +F+ + +TP+VKAS REL++ILL+G+++C+ ++ +    P+  +C+ ++ G+G SF++CYSALL K NRI RIF   +   Q+ R IS  SQ+ IC  ++S Q+++   +++ +   P          RN   L C+     S+++ + +  ILI++CTVYAF TR  PE FNE+K IGFTMY+TC++WL F P +  TA    ++  T+C+S+++S  V L CLF PKV+ ILF+P++NV
Sbjct:   15 PAAKREIIMDGDLVIGGLFPVHEKGDGMEDCGKINEERGIQRLEAMLLALDEINSSDRILPGLQLGAHILDTCSKDTYALEQSLDFVRASLTKVHDPGFICPDGSRPVQKEVPLAISGVIGGSYSDVSIQVANLLRLFQIPQISYASTSAKLSDKTRYDYFARTVPPDFYQAKAMAEILRYFNWTYVSTVASEGDYGETGIDAFQQEARTRQICIATSA---KVSRSMNRQGYENVIRSLQQK------SNAKVVILFTRSEDARELLVAAARMN--ASFTWVASDGWGAQESVVR------GSETGADGAFTIELASYPIREFEDYFTKLNPYTNTRNPWFREFWEHKFGCRLEEHGCS---------DRSLR----DGTFEQESKIMFVVNAVYAMAFALHNMRQAVCS-NTSK-VCDAMKPGNGRRFYKEFILKTKF------EAPFRPADTDSMVRFDSFGDGISRYNIFHYHKE-DGKFTYRKVG-YWDQILTLNTSLIPWRG--LVPPTSQCSDPCRKNEVKSMQPGDVCCWICIPCQPYQYLQDEFT-CADCSFGQWPLANLTGCYELPEEYIRWEDAWAIGPVAISCLGIMCTLTVVGLFLKHNETPVVKASGRELTYILLLGVLMCYSITFIYIAKPSTTVCTLRRLGLGTSFAVCYSALLTKTNRIARIFSGVKDGAQRPRFISPASQVAICGALISCQLLV--AVIWLLVEVPGVRKEVTPDRRNVVTLKCNS-RDTSMLMSLTYNCILIILCTVYAFKTRKCPENFNEAKFIGFTMYTTCIIWLAFQPIFYVTASDYRVQTTTMCISVSLSGSVVLGCLFAPKVHIILFQPQKNV 815          
BLAST of Metabotropic glutamate receptor vs. Ensembl Medaka
Match: grm2b (metabotropic glutamate receptor 2-like [Source:NCBI gene;Acc:101174659])

HSP 1 Score: 509.99 bits (1312), Expect = 3.794e-166
Identity = 301/847 (35.54%), Postives = 468/847 (55.25%), Query Frame = 3
Query:  105 PFKNQVALIDGDIFLGGLMMVHLRSEEMV-CGVIAAEGGIQALEVMVYTINRVNEM-KILGDIKLGAYIKDDCDRDTYGLEQAVDFIKQS-SKLQTKSN-CNEAKIDSNLR---TITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKDNRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLR-ILQKIKFTSLSGLEMEFTP------ITFD----GLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDPVTHHP----SRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNV 2579
            P   +  ++DGD+ +GGL  VH + + M  CG I  E GIQ LE M+  ++ +N   +IL  ++LGA+I D C +DTY LEQ++DF++ S +K+      C +            I+GVIG S S  SI VA+LL+LF IPQIS+ STS  LS+K R+ +F RT+P D +Q + M EI++   W YVS +  + +YG     A Q+  +  +ICIATS    + S+  + + Y++ +  L++         A  VI+F   ++  + ++A    N   SF W+ SDGW  +    +        E   +GA  IE  S  +  FE+YF  L P TN  NPWF EFWE  F C+L     +         D +L+    +     E+++ FV +AV A A AL  M+  +C+ N SK  C +M    G    +  + K KF      E  F P      + FD    G+ RY I ++ K  +G +++ ++G Y +Q L ++ + + +RG   V P S C+  C  ++ K + PG   CWICI CQ Y+  ++  T C  C  GQ+P  N T C  L + Y+      +IG +  S + ++  LT   +F+ + +TP+VKAS REL++ILL+G+++C+ ++ +    P+  +C+ ++ G+G SF++CYSALL K NRI RIF   +   Q+ R IS  SQ+ IC  ++S Q+++   +++ +   P          RN   L C+     S+++ + +  ILI++CTVYAF TR  PE FNE+K IGFTMY+TC++WL F P +  TA    ++  T+C+S+++S  V L CLF PKV+ ILF+P++NV
Sbjct:   38 PAAKREIIMDGDLVIGGLFPVHEKGDGMEDCGKINEERGIQRLEAMLLALDEINSSDRILPGLQLGAHILDTCSKDTYALEQSLDFVRASLTKVHDPGFICPDGSRPVQKEVPLAISGVIGGSYSDVSIQVANLLRLFQIPQISYASTSAKLSDKTRYDYFARTVPPDFYQAKAMAEILRYFNWTYVSTVASEGDYGETGIDAFQQEARTRQICIATSA---KVSRSMNRQGYENVIRSLQQK------SNAKVVILFTRSEDARELLVAAARMN--ASFTWVASDGWGAQESVVR------GSETGADGAFTIELASYPIREFEDYFTKLNPYTNTRNPWFREFWEHKFGCRLEEHGCS---------DRSLR----DGTFEQESKIMFVVNAVYAMAFALHNMRQAVCS-NTSK-VCDAMKPGNGRRFYKEFILKTKF------EAPFRPADTDSMVRFDSFGDGISRYNIFHYHKE-DGKFTYRKVG-YWDQILTLNTSLIPWRG--LVPPTSQCSDPCRKNEVKSMQPGDVCCWICIPCQPYQYLQDEFT-CADCSFGQWPLANLTGCYELPEEYIRWEDAWAIGPVAISCLGIMCTLTVVGLFLKHNETPVVKASGRELTYILLLGVLMCYSITFIYIAKPSTTVCTLRRLGLGTSFAVCYSALLTKTNRIARIFSGVKDGAQRPRFISPASQVAICGALISCQLLV--AVIWLLVEVPGVRKEVTPDRRNVVTLKCNS-RDTSMLMSLTYNCILIILCTVYAFKTRKCPENFNEAKFIGFTMYTTCIIWLAFQPIFYVTASDYRVQTTTMCISVSLSGSVVLGCLFAPKVHIILFQPQKNV 838          
BLAST of Metabotropic glutamate receptor vs. Ensembl Medaka
Match: grm6b (metabotropic glutamate receptor 6 [Source:NCBI gene;Acc:101159432])

HSP 1 Score: 504.982 bits (1299), Expect = 4.992e-164
Identity = 299/841 (35.55%), Postives = 462/841 (54.93%), Query Frame = 3
Query:  129 IDGDIFLGGLMMVHLRSEEMV-CGVIAAEGGIQALEVMVYTINRVN-EMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIK---QSSKLQTKSNCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKD-NRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITFDGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFF-IFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDPVTH---------HPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVH---LRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGLR 2594
            I+GDI LGGL  VH R    V CG I  E GI  LE M+Y ++++N +  +L +I LGA I D C RDTY LEQ++ F++   Q      + +  E  I      + GVIGAS S  SI VA++L+LF IPQIS+ ST+P LS+ +R+ FF R +P D++Q Q M++I+K + W YVS +  + NYG     A  ++ ++   +CIA S  +PR+ +     E++  + RL       +   A GVIIF ++ ++   + A K+ NLT  F ++GSD W  +    +      ++E+  EGA+ I P   ++ GF+ YF + +   N+ N WF EFWED F+CKL       Y+     C    ++S+D+ ++  E ++QFV DAV A A AL  M   +C    S   C  M   +G  LL+ +  + F   +G  + F     D   RY I  +  +      +  IG +TN  LR++  ++++ G    IP S C+  C   +RKK+  G+  CW C  C  Y+ ++     C+ CP    P +NRT C     I L  + P +I + +F  I  I A T     F+ +  TPIV+AS RELS++LL GI L ++++ ++   P+  +C+F++  +G    + YSA+L K NRI RIF +G+K     + IS  SQ+ I   ++S+Q  +LG  ++F    P T+         +P      L CD +   SL+  + + ++L++ CTVYA  +R +PE FNE+K IGFTMY+TC++WL F+P +  T+       ++  TL VS+++SA V+L  L+ PKVY I+F P+QNV+K  R
Sbjct:   60 IEGDITLGGLFPVHSRGPAGVPCGEIKREKGIHRLEAMLYALDQINSDPDLLPNITLGARILDTCSRDTYALEQSLTFVQALIQKDNSDVRCSNGEPPIIPKPERVVGVIGASGSSVSIMVANVLRLFAIPQISYASTAPELSDNSRYEFFSRVVPPDSYQAQAMVDIVKAMGWNYVSTLASEGNYGESGVDAFLQISREAGGLCIAQSIRIPREPRPG---EFEKVIKRL------METSNARGVIIFANEDDIKRVLQAAKKANLTGHFLFVGSDSWGAKSSPIE------NQEEVAEGAVTILPKRASIDGFDQYFTSRSLENNRRNIWFAEFWEDDFKCKL-TRPGIKYDPGRRKCTGEERISRDS-QYEQEGKVQFVIDAVYAMAHALHNMHLDLCPS--STGVCEKMDPVEGRMLLQYIHSVNFNGSAGTGVMFNE-NGDAPGRYDIFQYQMSNISNPGYKVIGQWTNH-LRLNVEEMQWSGGERKIPESVCSFPCEPGERKKMVKGVPCCWHCELCDGYQ-YQLDEFTCDMCPFDMRPLKNRTGCRPTPIIKLEWSSPWAI-IPVFLAILGIFATTGVIGTFIRFNDTPIVRASGRELSYVLLTGIFLIYLITFLMIAEPSVAVCAFRRLLLGLGMCISYSAMLTKTNRIYRIFEQGKKSVTPPKFISPTSQLIITFILISVQ--VLGVFVWFGVVPPHTNIDYEELKPPNPEFARGILKCD-MSDLSLIYCLSYSILLMVTCTVYAIKSRGVPETFNEAKPIGFTMYTTCIIWLAFVPIFFGTSQSTEKMFIQTTTLTVSMSLSATVSLGMLYIPKVYVIIFHPEQNVQKRKR 874          
BLAST of Metabotropic glutamate receptor vs. Ensembl Medaka
Match: grm8a (glutamate metabotropic receptor 8 [Source:NCBI gene;Acc:101168089])

HSP 1 Score: 501.516 bits (1290), Expect = 1.318e-162
Identity = 309/847 (36.48%), Postives = 468/847 (55.25%), Query Frame = 3
Query:  129 IDGDIFLGGLMMVHLRSEEMV-CGVIAAEGGIQALEVMVYTINRVN-EMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIK---QSSKLQTKSNCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKD-NRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCA--PNISKNACISMLQN-KGETLLRILQKIKFTSLSGLEMEFTPITF----DGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDP---------VTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLAT---AIMVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGLR 2594
            +DGDI LGGL  VH R +    CG +  E GI  LE M++ I+ +N + ++L +I LGA I D C RDTY LEQ++ F++   +      +    +  I +    I GVIGA++S  SI VA++L+LF IPQIS+ ST+P LS+ +R+ FF R +P D++Q Q M++I+  + W YVS +  + NYG    +A   + ++   +CIA S  +PR+ +        DK++  K+ L+T +   A  +I+F ++ ++   + A K +N T  F W+GSD W G +++   G     +E+  EGAI I P   +V  F+ YF + + S N+ N WF EFWE+ F CKL      P +     C    K+ +D+  +  E ++QFV DAV A A AL  M  ++C   P +    C  M QN  G+ LL  ++ + FT  +G     TP+ F    D   RY I  + +  N    +  IG++TN KL +    + +R     +P S C+  C   +RKK+  G+  CW C +C+ Y  ++ S   CE CP    PD NRT C+ +  I L    P +I  +  S + +I        FV Y  TPIV+AS RE+S++LL GI LC+V++ ++  TP   +CS ++  +G      Y+ALL K NRI RIF +G+K     R IS  SQ+ I   ++S+Q++  G  ++F    P          T +P      L CD I   SL+  + + ++L++ CTVYA  TR +PE FNE+K IGFTMY+TC++WL FIP +  T   A  ++++  TL +S+++SA V+L  L+ PKVY ILF P+QNV K  R
Sbjct:   53 LDGDIILGGLFPVHSRGDRGTPCGELKKEKGIHRLEAMMFAIDLINKDPELLPNITLGARILDTCSRDTYALEQSLTFVQALIERDGSDVRCANGDPPIFTKPDKIVGVIGAAASSVSIMVANILRLFKIPQISYASTAPELSDNSRYDFFSRVVPPDSYQAQAMMDIVTAMGWNYVSTLASEGNYGESGVEAFVHISRETGGVCIAQSLKIPREPRPGEF----DKII--KRLLETSN---ARAIIMFANEDDIRRVLDAAKRNNQTGHFLWVGSDSW-GSKISPVIG-----QERVAEGAITILPKRASVDAFDRYFRSRSLSNNRRNVWFAEFWEENFNCKLGMHGKRPGS--LKKCTGLEKVGRDS-SYEQEGKVQFVMDAVYAMAHALHRMHRELCYGYPGL----CPRMAQNIDGKELLSHIRAVNFTGSAG-----TPVVFNENGDAPGRYDIFQY-QITNRTAEYRVIGSWTN-KLHLKVEAMHWRTGDPSLPPSVCSLPCRTGERKKVVKGVPCCWHCERCEGYH-YQASEFTCELCPYEMRPDLNRTGCVPIPIIKLEWHSPWAIVPVFISMLGIIATSFVIVTFVRYNDTPIVRASGREMSYVLLTGIFLCYVITFLMIATPDVGVCSLRRIFLGLGMCFSYAALLTKTNRIHRIFEQGKKSVTAPRFISPASQLVITFSLISVQLV--GVFVWFAVDPPHILVDYGEQRTQNPMSARGVLKCD-ISDLSLICSLGYSILLMVTCTVYAIKTRGVPETFNEAKPIGFTMYTTCIIWLAFIPIFFGTSQSAERMYIQTTTLTISLSLSASVSLGMLYMPKVYIILFHPEQNVPKRKR 866          
BLAST of Metabotropic glutamate receptor vs. Planmine SMEST
Match: SMESG000022915.1 (SMESG000022915.1)

HSP 1 Score: 1999.94 bits (5180), Expect = 0.000e+0
Identity = 968/968 (100.00%), Postives = 968/968 (100.00%), Query Frame = 3
Query:    3 AKFCVAIIIFVKFSTCLRNKEIIFIGKSGLVNVWPFKNQVALIDGDIFLGGLMMVHLRSEEMVCGVIAAEGGIQALEVMVYTINRVNEMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIKQSSKLQTKSNCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKDNRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITFDGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDPVTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGLRINIKNEQNQIDHLDNNSHTQMSYSHMILKDDQLNNIKNSVTSISGSVITCHRETQFPDCSDAFVIVNEKFEAQMFKHLLANRNHSTIKKPSPKVESDNVYHLKS 2906
            AKFCVAIIIFVKFSTCLRNKEIIFIGKSGLVNVWPFKNQVALIDGDIFLGGLMMVHLRSEEMVCGVIAAEGGIQALEVMVYTINRVNEMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIKQSSKLQTKSNCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKDNRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITFDGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDPVTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGLRINIKNEQNQIDHLDNNSHTQMSYSHMILKDDQLNNIKNSVTSISGSVITCHRETQFPDCSDAFVIVNEKFEAQMFKHLLANRNHSTIKKPSPKVESDNVYHLKS
Sbjct:    4 AKFCVAIIIFVKFSTCLRNKEIIFIGKSGLVNVWPFKNQVALIDGDIFLGGLMMVHLRSEEMVCGVIAAEGGIQALEVMVYTINRVNEMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIKQSSKLQTKSNCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKDNRICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKGETLLRILQKIKFTSLSGLEMEFTPITFDGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDPVTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGLRINIKNEQNQIDHLDNNSHTQMSYSHMILKDDQLNNIKNSVTSISGSVITCHRETQFPDCSDAFVIVNEKFEAQMFKHLLANRNHSTIKKPSPKVESDNVYHLKS 971          
BLAST of Metabotropic glutamate receptor vs. Planmine SMEST
Match: SMESG000024379.1 (SMESG000024379.1)

HSP 1 Score: 481.485 bits (1238), Expect = 2.485e-160
Identity = 232/444 (52.25%), Postives = 312/444 (70.27%), Query Frame = 3
Query: 1443 FDGLPRYRILNFIKAANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDPVTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGLR-----INIKNEQNQIDHLDNNSHTQMSYSHMILKDDQLNNIKNSVTSISGSVITCHRETQ 2759
            +DG PRY+ILNF K   G+Y W++IG + N +L ID  KL+FR +S+ IPISSCTPKC  DQR K HPGIC+CWICI+CQ+Y+I    +T C  C +GQ PD+N+T C+ + Q YL    P+++G+++F+ + +  A T   IF+ +  +PIV+ASSRELSFILL GI++CFV++++LCT PT   CS +KF IG SFS+CYSALLVK NRIERIFR+GR+  ++L  IS  SQI +C  IV IQI+IL   LY   +  + H+P R E  LIC++I G+S +I + HPMILIL+CTVY FLTRNIPE +NESKHIGF MYSTCVVWLGFIPCY ATA + HLR+ATLCVSI++SA+V L CLFGPK+Y ILFK + N R+G++     + I  + +    L  +  +Q     ++LK +  +  K         ++  H++TQ
Sbjct:   10 YDGPPRYKILNFQKIKPGLYGWIDIGKFENNQLWIDRRKLRFRKNSTAIPISSCTPKCQSDQRIKFHPGICSCWICIRCQKYDILNKLKTECLPCEMGQIPDKNKTGCINITQSYLEPNSPIALGILLFTSMGICCAATVVIIFIKFINSPIVRASSRELSFILLFGIMMCFVMTIILCTKPTDFNCSIEKFCIGLSFSVCYSALLVKTNRIERIFRRGRRTVKRLFCISPLSQISMCFLIVLIQIVILSLWLYMDPAKAIHHYPERIENQLICNFIKGSSFLIGLCHPMILILVCTVYVFLTRNIPEGYNESKHIGFAMYSTCVVWLGFIPCYFATAKLTHLRLATLCVSIDLSAMVTLFCLFGPKIYIILFKQELNTRQGMKPMMNSLRIGTKSSNYQSLTKSHESQYFNDSIVLKKENGSEKK-------PPILLAHKQTQ 446          
BLAST of Metabotropic glutamate receptor vs. Planmine SMEST
Match: SMESG000033752.1 (SMESG000033752.1)

HSP 1 Score: 457.218 bits (1175), Expect = 3.481e-146
Identity = 297/856 (34.70%), Postives = 439/856 (51.29%), Query Frame = 3
Query:  111 KNQVALIDGDIFLGGLMMVHLRSEEMVCGVIAAEGGIQALEVMVYTINRVNEM-KILGDIKLGAYIKDDCDRDTYGLEQAVDFIKQS-------SKLQTKSNCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKDNRICIATSEIL---PRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFEC-------KLPNSSDTPYN--------NFTDICDE-NLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQN-KGETLLRILQKIKFTSLSGLEMEFTPITFDGLPRYRILNFIK-AANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDPVTHHPSRNEEY--LICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRK 2585
            K Q A+ +GDI LGGL  VH  SE  +C  I  + GIQ LE M++TI  +N    IL +I +GA I D C +DTY L+Q++DFIK S       S    K      +     + I  V+G S S  SI VA+LL+LF IPQIS+ STS  LS K   P F RT+PSD  Q + M E++    W YVS +    +YG     A  +  K   +CIA  E++   P  S L ++         +K   + F       V++F         + A+K  N ++ F W+ SDGW             T+      GAI  E  +  +  F  YF  LT + N +NPWF+E+WE+ F+C       ++  SS   Y         +   +C   N      N K   E+++Q V DAV A A  L   + ++C P + +  C+  L N  G    + L    FT   G  + F     D + +Y I N+I+    G Y +  IG + +  L ++ +++ + G+   IP S C+  C   Q +        CW C  C+  E   N  T CE C  G++P QNRT C  L   Y+  +  L+I  MI S +      +   +F +Y  TPIV+AS RELSF++L G ++C++VS +    PT   C+ Q+  +G  F++ Y++LL K NRI RIF   +K  ++   IS +SQ+ ICA ++S+Q++     L+F  S P   +  +  E+  L C  I   + ++ +++ M+LI +CT YA  TR IPE FNESK IGFTMY+TCV+WL FI  Y  T     ++++TL +S+++SA V L CLF PK++ I  +P++NVRK
Sbjct:   33 KYQSAIYNGDIILGGLFPVH-DSETELCKKINPDRGIQRLEAMLFTIQEINNRPDILPNINIGARILDTCSKDTYALQQSLDFIKSSLSDNNDASDYYCKDKSEVLRHTKATQKIRTVVGGSYSSVSILVANLLRLFSIPQISYASTSALLSEKKNHPIFARTLPSDQQQAKAMAELVASFNWTYVSTVRSSGDYGDSGIDAFWKESKKLGVCIAAKEMIKPNPLHSDLLAI---------VKTLYQEFSKTRV--VVLFTRLDHTKLLLNAVKIMNYSNYFLWIASDGWGQENGPV------TNNSNVANGAITFEVKTVEIKNFTTYFHQLTYNRNSNNPWFDEYWEELFDCIPIKQKMRVSRSSVKDYRFPRSNSVKSRKQLCTMFNFSSKLKNFKQ--ESKIQSVYDAVYAVAYTLDRFQAKLCKPFVLEK-CVKALNNIDGMVFYKDLINNSFTDSYGNLVSFDS-NGDSVGQYNIYNYIRNKKTGKYYYKNIGEFRHDGLFLN-SEVTWPGEEKEIPRSICSEDCPVGQIRIYSKESKCCWGCSLCKSNEFVVN-MTKCEMCAEGEWPYQNRTGCYLLTVHYMKLSGWLAIIPMILSFLGTATTTSVMGVFYYYKNTPIVRASGRELSFLILSGCLVCYLVSFIFLLKPTPYSCAIQRILLGLGFAVMYASLLTKTNRIARIFESAQKTAKRPPCISPKSQLMICAVLISVQLLSNAIWLFF--SPPGIRYDRKKPEFPVLKCK-IETKTFLVSLVYNMLLISVCTYYAIKTRKIPENFNESKFIGFTMYTTCVIWLAFITIYFGTLHSFEVQISTLGISVSLSAWVTLICLFFPKLHIIFLQPEKNVRK 861          
BLAST of Metabotropic glutamate receptor vs. Planmine SMEST
Match: SMESG000033752.1 (SMESG000033752.1)

HSP 1 Score: 453.366 bits (1165), Expect = 1.666e-144
Identity = 296/869 (34.06%), Postives = 434/869 (49.94%), Query Frame = 3
Query:  111 KNQVALIDGDIFLGGLMMVHLRSEEMVCGVIAAEGGIQALEVMVYTINRVNEM-KILGDIKLGAYIKDDCDRDTYGLEQAVDFIKQS-------SKLQTKSNCNEAKIDSNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKDNRICIATSEIL---PRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFEC--------------KLPNSSDTPYNNFTDICD---------------ENLKLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQN-KGETLLRILQKIKFTSLSGLEMEFTPITFDGLPRYRILNFIK-AANGIYSWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDPVTHHPSRNEEY--LICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIMVHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRK 2585
            K Q A+ +GDI LGGL  VH  SE  +C  I  + GIQ LE M++TI  +N    IL +I +GA I D C +DTY L+Q++DFIK S       S    K      +     + I  V+G S S  SI VA+LL+LF IPQIS+ STS  LS K   P F RT+PSD  Q + M E++    W YVS +    +YG     A  +  K   +CIA  E++   P  S L ++         +K   + F       V++F         + A+K  N ++ F W+ SDGW             T+      GAI  E  +  +  F  YF  LT + N +NPWF+E+WE+ F+C              K   S       FT I                      S        E+++Q V DAV A A  L   + ++C P + +  C+  L N  G    + L    FT   G  + F     D + +Y I N+I+    G Y +  IG + +  L ++ +++ + G+   IP S C+  C   Q +        CW C  C+  E   N  T CE C  G++P QNRT C  L   Y+  +  L+I  MI S +      +   +F +Y  TPIV+AS RELSF++L G ++C++VS +    PT   C+ Q+  +G  F++ Y++LL K NRI RIF   +K  ++   IS +SQ+ ICA ++S+Q++     L+F  S P   +  +  E+  L C  I   + ++ +++ M+LI +CT YA  TR IPE FNESK IGFTMY+TCV+WL FI  Y  T     ++++TL +S+++SA V L CLF PK++ I  +P++NVRK
Sbjct:   33 KYQSAIYNGDIILGGLFPVH-DSETELCKKINPDRGIQRLEAMLFTIQEINNRPDILPNINIGARILDTCSKDTYALQQSLDFIKSSLSDNNDASDYYCKDKSEVLRHTKATQKIRTVVGGSYSSVSILVANLLRLFSIPQISYASTSALLSEKKNHPIFARTLPSDQQQAKAMAELVASFNWTYVSTVRSSGDYGDSGIDAFWKESKKLGVCIAAKEMIKPNPLHSDLLAI---------VKTLYQEFSKTRV--VVLFTRLDHTKLLLNAVKIMNYSNYFLWIASDGWGQENGPV------TNNSNVANGAITFEVKTVEIKNFTTYFHQLTYNRNSNNPWFDEYWEELFDCIPIKQKMRVSRSSVKSLMSEKKAITTFTQISPIFPRSNSVKSRKQLCTMFNFSSKLKNFKQESKIQSVYDAVYAVAYTLDRFQAKLCKPFVLEK-CVKALNNIDGMVFYKDLINNSFTDSYGNLVSFDS-NGDSVGQYNIYNYIRNKKTGKYYYKNIGEFRHDGLFLN-SEVTWPGEEKEIPRSICSEDCPVGQIRIYSKESKCCWGCSLCKSNEFVVN-MTKCEMCAEGEWPYQNRTGCYLLTVHYMKLSGWLAIIPMILSFLGTATTTSVMGVFYYYKNTPIVRASGRELSFLILSGCLVCYLVSFIFLLKPTPYSCAIQRILLGLGFAVMYASLLTKTNRIARIFESAQKTAKRPPCISPKSQLMICAVLISVQLLSNAIWLFF--SPPGIRYDRKKPEFPVLKCK-IETKTFLVSLVYNMLLISVCTYYAIKTRKIPENFNESKFIGFTMYTTCVIWLAFITIYFGTLHSFEVQISTLGISVSLSAWVTLICLFFPKLHIIFLQPEKNVRK 876          
BLAST of Metabotropic glutamate receptor vs. Planmine SMEST
Match: SMESG000058947.1 (SMESG000058947.1)

HSP 1 Score: 303.908 bits (777), Expect = 3.613e-88
Identity = 241/890 (27.08%), Postives = 407/890 (45.73%), Query Frame = 3
Query:   69 IFIGKSGLVNVWPFKNQV-ALIDGDIFLGGLMMVHLRSEEMVCGVIAAEGGIQALEVMVYTINRVNEMKILGDIKLGAYIKDDCDRDTYGLEQAVDFIK-QSSKLQTKSNCNEAKID------SNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKDN-------RICIATSEILPRDSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKEHNLTHSFN--WLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFGFENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDI--CDENL---KLSKDNPKHSFENQ------LQFVSDAVMAFAMALKEMKNQMCAPNISKNACISMLQNKG----ETLLRILQKIKFTSLSGLEMEFTPITFDGLPRYRILNFIKAANGIYSWVEIGNYTNQ-KLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGICTCWICIKCQEYEIFKNSRTI------------CEACPLGQYPDQNRTLCLRLQQIYLNQTHPLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIILCFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGRKQPQKL--RLISQQSQIFICAFIVSIQIIILGTLLYFVNSDPVTHHPSRNEEYLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTMYSTCVVWLGFIPCYLATAIM--VHLRVATLCVSINVSALVALSCLFGPKVYTILFKPKQNVRKGL 2591
            IF+ K G  +     N+V A   GDI++ GL  +H      +C  +  + G+Q L   +Y I  + ++ I+  +KLG    D C    Y ++Q+  F++ + S +     C    I        N + + GV GA +S  SI V+  L+L  +PQ+SFFSTS  LS +++FP F RTIPSD + ++ ++ ++K+  W Y+ +I ++S Y +E    L  +F  N       ++C+A +  + +   +  V+  ++KV +            A  ++   +  +  D    + +     S N  W+ +D W GR   + +     + +  +   I + P       F++Y++N  PS    +PW  E +E+F  C+  N S   Y     +   +EN    +  + N  H F         + +V D + A+A +L ++    C  +IS   C+  L   G    E +   L+ I FT  +G   +F   T DG+P Y I+ F +  +    W  +GN +   + ++     ++   S  IP   C  +CS  + K      C CW C  C   EI    + I            C+ C   Q    N   C+ +   +++    ++I +++ + + L ++L    I V Y+KTPI+KA  RE S I+L G +L F  S++L   PT + C  +    G   ++CY+A+L K NRI RIF       +K   R IS  SQI I   I + +  IL  ++     +  T           C  I  +S++ I L P IL++  TVYAF  R  P+ FNE+++I F  ++ CVV    + C L   ++      V   C+ + +     L  LF PK+Y ILF+P +N  + +
Sbjct:   25 IFLDKYGQFHNESLYNKVYAKYTGDIYIAGLFSMHHMESTGLCRGLIDQDGLQVLAAAIYGIKIIEKLNII-PLKLGLLAIDTCQSIEYVMDQSKTFLQFKMSNIANSYTCPSGDIPQPREELENFQNVFGVFGAGNSDVSIEVSKYLRLVSLPQLSFFSTSTILSEQSKFPTFFRTIPSDKNMIKAIIHLLKRYNWNYLLVINDNSEYSQE----LTNLFNKNIDEVGQLQLCVAGTFTILKSKDIKIVEWLQEKVNQ---------SNSARVIVTLLTQPKAEDLFRDLNKTKNWTSVNLLWIATDSWGGRDWDFLR-----NSKTTLNNTIAVVPKVYFDNSFKSYYVNRLPSEIDSDPWLAEAFENFCSCQYKNRSLFIYLELRKMRPVEENTIPCETLEKNCSHIFYRNFTQMLYIHYVIDGIFAYAYSLAKLIPNNCT-DISPKMCVRFLFKNGLVSMEKITETLKNITFTDSTGERFKFWNGTHDGIPNYSIVKFEQNES---IWSVVGNISEHMEFKMSQEFDEYLKTSFNIP--PCNKECSIREAKFFEVNKC-CWKCSLCLANEIISTEQNIVPLTKRSFIQQSCKQCQSNQTVIDNT--CIGINATFMSFKDDIAISIILMNMLGLCMSLVSLSIMVIYWKTPIIKAFGRETSSIILSGTMLSFAFSILLLHKPTNVFCYLRWCSPGLCSTICYAAILTKTNRIARIFGIKFTASKKATPRFISPISQINIVLIITAAESCILIVVMITSKIEATTMF----NNVWNCYNIETSSVLAIFLIPSILLIFSTVYAFKVRKTPDGFNETRNINFLNFTNCVV---LVTCLLLHQVLKDKEYSVIPFCILLTLGGHGNLMGLFIPKIYIILFRPNKNTMQAI 879          
The following BLAST results are available for this feature:
BLAST of Metabotropic glutamate receptor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRM81.882e-16936.64glutamate metabotropic receptor 8 [Source:HGNC Sym... [more]
GRM82.676e-16936.64glutamate metabotropic receptor 8 [Source:HGNC Sym... [more]
GRM82.676e-16936.64glutamate metabotropic receptor 8 [Source:HGNC Sym... [more]
GRM74.603e-16935.50glutamate metabotropic receptor 7 [Source:HGNC Sym... [more]
GRM75.684e-16935.50glutamate metabotropic receptor 7 [Source:HGNC Sym... [more]
back to top
BLAST of Metabotropic glutamate receptor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mgl-11.946e-14433.56Probable metabotropic glutamate receptor mgl-1 [S... [more]
mgl-12.059e-14433.56Probable metabotropic glutamate receptor mgl-1 [S... [more]
mgl-12.391e-14433.56Probable metabotropic glutamate receptor mgl-1 [S... [more]
mgl-11.942e-13533.25Probable metabotropic glutamate receptor mgl-1 [S... [more]
mgl-11.942e-13533.25Probable metabotropic glutamate receptor mgl-1 [S... [more]
back to top
BLAST of Metabotropic glutamate receptor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mtt8.790e-2747.78gene:FBgn0050361 transcript:FBtr0330608[more]
mtt9.612e-2747.78gene:FBgn0050361 transcript:FBtr0273325[more]
mtt0.000e+047.78gene:FBgn0050361 transcript:FBtr0273327[more]
mtt0.000e+047.66gene:FBgn0050361 transcript:FBtr0273326[more]
mtt8.595e-17545.44gene:FBgn0050361 transcript:FBtr0088756[more]
back to top
BLAST of Metabotropic glutamate receptor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grm31.396e-16334.95glutamate receptor, metabotropic 3 [Source:ZFIN;Ac... [more]
grm31.396e-16334.95glutamate receptor, metabotropic 3 [Source:ZFIN;Ac... [more]
grm31.396e-16334.95glutamate receptor, metabotropic 3 [Source:ZFIN;Ac... [more]
grm8a3.284e-16336.32glutamate receptor, metabotropic 8a [Source:ZFIN;A... [more]
grm6a1.169e-16234.88glutamate receptor, metabotropic 6a [Source:ZFIN;A... [more]
back to top
BLAST of Metabotropic glutamate receptor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pias47.493e-16835.71protein inhibitor of activated STAT 4 [Source:Xenb... [more]
ENSXETT00000053239.11.570e-16737.57pep primary_assembly:Xenopus_tropicalis_v9.1:2:793... [more]
pias41.913e-16735.17protein inhibitor of activated STAT 4 [Source:Xenb... [more]
pias42.528e-16735.17protein inhibitor of activated STAT 4 [Source:Xenb... [more]
GRM81.355e-16636.44glutamate receptor, metabotropic 8 [Source:NCBI ge... [more]
back to top
BLAST of Metabotropic glutamate receptor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Grm81.724e-17036.76glutamate receptor, metabotropic 8 [Source:MGI Sym... [more]
Grm81.724e-17036.76glutamate receptor, metabotropic 8 [Source:MGI Sym... [more]
Grm83.754e-17036.76glutamate receptor, metabotropic 8 [Source:MGI Sym... [more]
Grm78.559e-16935.50glutamate receptor, metabotropic 7 [Source:MGI Sym... [more]
Grm79.557e-16935.50glutamate receptor, metabotropic 7 [Source:MGI Sym... [more]
back to top
BLAST of Metabotropic glutamate receptor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P47743|GRM8_MOUSE2.626e-16936.76Metabotropic glutamate receptor 8 OS=Mus musculus ... [more]
sp|P70579|GRM8_RAT3.428e-16936.76Metabotropic glutamate receptor 8 OS=Rattus norveg... [more]
sp|O00222|GRM8_HUMAN9.040e-16936.64Metabotropic glutamate receptor 8 OS=Homo sapiens ... [more]
sp|P91685|GRM_DROME3.155e-16837.08Metabotropic glutamate receptor OS=Drosophila mela... [more]
sp|Q14831|GRM7_HUMAN3.368e-16835.50Metabotropic glutamate receptor 7 OS=Homo sapiens ... [more]
back to top
BLAST of Metabotropic glutamate receptor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUL00.000e+0100.00GCR106 OS=Schmidtea mediterranea OX=79327 GN=gcr10... [more]
A0A1I8IP550.000e+043.70Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8IL260.000e+045.32Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8M0J90.000e+047.42G_PROTEIN_RECEP_F3_4 domain-containing protein OS=... [more]
A0A0K8U4620.000e+047.54Metabotropic glutamate receptor OS=Bactrocera lati... [more]
back to top
BLAST of Metabotropic glutamate receptor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRM71.268e-16535.71glutamate metabotropic receptor 7 [Source:HGNC Sym... [more]
grm2a4.782e-16335.35metabotropic glutamate receptor 2 [Source:NCBI gen... [more]
grm2b5.016e-16335.26metabotropic glutamate receptor 2-like [Source:NCB... [more]
grm2b7.156e-16334.35metabotropic glutamate receptor 2-like [Source:NCB... [more]
grm6b7.401e-16335.67metabotropic glutamate receptor 6-like [Source:NCB... [more]
back to top
BLAST of Metabotropic glutamate receptor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grm32.016e-15233.60glutamate receptor, metabotropic 3 [Source:ZFIN;Ac... [more]
ENSPMAT00000007590.15.176e-14733.67pep scaffold:Pmarinus_7.0:GL478498:6932:63706:-1 g... [more]
casr3.460e-9027.51calcium-sensing receptor [Source:ZFIN;Acc:ZDB-GENE... [more]
ENSPMAT00000005888.12.993e-6734.68pep scaffold:Pmarinus_7.0:GL487952:898:2919:-1 gen... [more]
ENSPMAT00000003019.11.214e-6436.89pep scaffold:Pmarinus_7.0:GL478098:6745:34806:-1 g... [more]
back to top
BLAST of Metabotropic glutamate receptor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Metabotropic glutamate receptor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO352533.250e-15835.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317671.649e-12731.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO413157.328e-12232.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486656.497e-12130.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO427462.495e-10429.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Metabotropic glutamate receptor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grm8b4.977e-17437.00metabotropic glutamate receptor 8-like [Source:NCB... [more]
grm2b9.673e-16735.54metabotropic glutamate receptor 2-like [Source:NCB... [more]
grm2b3.794e-16635.54metabotropic glutamate receptor 2-like [Source:NCB... [more]
grm6b4.992e-16435.55metabotropic glutamate receptor 6 [Source:NCBI gen... [more]
grm8a1.318e-16236.48glutamate metabotropic receptor 8 [Source:NCBI gen... [more]
back to top
BLAST of Metabotropic glutamate receptor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022915.10.000e+0100.00SMESG000022915.1[more]
SMESG000024379.12.485e-16052.25SMESG000024379.1[more]
SMESG000033752.13.481e-14634.70SMESG000033752.1[more]
SMESG000033752.11.666e-14434.06SMESG000033752.1[more]
SMESG000058947.13.613e-8827.08SMESG000058947.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005030 ID=SMED30005030|Name=Metabotropic glutamate receptor|organism=Schmidtea mediterranea sexual|type=transcript|length=2907bp
CTGCTAAATTTTGTGTCGCAATAATAATTTTCGTGAAATTTTCCACATGT
CTTCGAAACAAAGAAATTATTTTTATTGGTAAAAGTGGACTTGTAAATGT
TTGGCCATTTAAAAATCAGGTCGCTCTAATTGATGGGGACATTTTTCTTG
GTGGATTGATGATGGTCCATTTACGGAGTGAAGAAATGGTTTGTGGAGTT
ATTGCTGCAGAAGGTGGAATTCAGGCTCTGGAAGTGATGGTCTACACGAT
TAATAGAGTGAACGAAATGAAAATTCTCGGAGACATAAAATTGGGTGCTT
ATATTAAAGACGATTGCGATAGGGATACTTATGGACTTGAACAAGCTGTT
GATTTTATTAAACAAAGCAGCAAGCTACAGACAAAGTCCAATTGCAACGA
AGCAAAAATAGATTCTAACCTCCGAACCATTACTGGAGTAATTGGAGCCT
CAAGCAGTGTCACTTCGATTCATGTCGCAAGCCTTTTGAAACTTTTTGAT
ATACCTCAAATAAGCTTCTTTTCTACAAGTCCTGCACTATCTAACAAAAA
CAGATTTCCATTCTTTCTGAGGACCATACCGTCAGACGCACATCAAGTAC
AAGTGATGCTCGAGATAATTAAACAACTACAATGGAAATATGTATCTATA
ATTTATGAAGATTCAAACTATGGAAGAGAGGCATTTAAAGCATTGCAGGA
AGTGTTTAAAGATAACAGAATTTGTATTGCAACCTCTGAAATCCTTCCGA
GAGATTCGAAACTAGCATCAGTAAAAGAATACAAGGATAAAGTTCTCAGA
TTGAAAAAGCATTTGAAAACGTTTGATGGAGTCGGAGCTACAGGCGTAAT
TATATTTGGATCAGATCAAGAAGTCGGAGACTTTATGATGGCCATCAAAG
AACATAATTTGACTCACAGTTTTAATTGGTTAGGTTCAGATGGATGGTCG
GGTAGAAGAGTTGCCTACAAAAAGGGTTTATTTGAGACTAGTAAAGAGCA
AGAGATTGAAGGAGCGATTGGAATCGAACCTTTATCAAAAACGGTTTTTG
GATTTGAAAATTATTTTCTGAATTTGACTCCTAGCACCAACAAGCATAAC
CCTTGGTTCAATGAGTTTTGGGAAGATTTTTTTGAATGTAAATTGCCGAA
TTCTAGTGATACTCCTTATAATAATTTTACTGACATATGCGATGAAAACT
TAAAACTCTCCAAAGACAATCCGAAGCATTCTTTCGAAAATCAACTGCAA
TTTGTCAGTGATGCTGTAATGGCTTTTGCGATGGCATTAAAAGAGATGAA
AAATCAAATGTGTGCTCCGAATATATCAAAAAATGCATGCATTTCGATGC
TGCAAAACAAAGGGGAAACCCTGTTAAGAATTTTGCAGAAAATTAAATTT
ACAAGCTTATCTGGATTAGAAATGGAATTTACTCCCATTACATTTGATGG
GCTTCCGAGATACAGGATTCTTAATTTCATCAAGGCGGCAAATGGTATCT
ATTCCTGGGTCGAAATTGGTAATTATACCAATCAAAAGTTAAGAATTGAC
TATACAAAATTAAAATTTCGAGGAGATTCATCAGTGATTCCAATTTCATC
ATGTACTCCCAAATGTTCTGATGACCAACGCAAAAAGCTTCATCCTGGGA
TTTGTACATGTTGGATATGCATAAAATGCCAGGAATATGAAATCTTCAAG
AATTCCCGAACGATTTGTGAAGCATGTCCACTGGGACAATATCCAGACCA
AAACAGAACTCTCTGTCTAAGACTCCAACAAATTTATTTAAATCAAACCC
ACCCTTTATCTATCGGACTGATGATATTTTCTGGAATTTGTCTCATAATT
GCTTTGACATGTTTTTTCATATTTGTATTTTATTTTAAAACTCCAATAGT
GAAAGCGTCAAGCCGCGAATTGAGTTTCATTTTACTGGTCGGTATTATTT
TATGTTTTGTTGTATCATTAGTTTTATGTACGACCCCGACAAAATTGATG
TGCTCATTTCAAAAGTTCGGAATCGGTTTTTCTTTCTCACTCTGTTATTC
GGCTCTTTTAGTGAAATTGAATCGAATCGAAAGAATATTCAGAAAGGGTC
GCAAACAACCACAAAAACTACGTTTGATATCACAACAATCTCAAATTTTT
ATATGCGCTTTTATTGTTTCAATTCAGATAATTATTTTGGGAACTTTATT
GTACTTTGTCAATTCAGATCCAGTAACCCATCACCCTAGTCGAAATGAAG
AGTATTTAATATGTGATTACATAATTGGAAATTCTCTCGTAATAATTGTC
CTCCATCCGATGATATTAATACTGATTTGTACAGTGTACGCTTTTCTAAC
TCGAAACATACCGGAAGCCTTTAATGAAAGTAAACATATCGGATTCACAA
TGTATAGCACTTGCGTCGTTTGGTTGGGATTTATCCCATGTTATTTGGCA
ACGGCAATTATGGTGCATTTACGTGTGGCAACATTATGTGTTTCTATCAA
TGTTTCGGCTTTAGTAGCGTTATCTTGTTTATTCGGTCCAAAAGTCTATA
CGATATTATTCAAGCCAAAACAAAATGTCAGAAAAGGTTTGCGGATAAAT
ATCAAAAATGAACAGAACCAAATAGATCATTTGGATAACAATTCTCATAC
TCAGATGTCATACTCACATATGATTCTCAAAGACGATCAACTTAACAACA
TAAAAAATTCAGTAACCTCAATTTCGGGATCAGTGATTACATGTCACAGG
GAAACTCAGTTTCCCGATTGCAGTGACGCTTTTGTTATTGTAAATGAAAA
ATTTGAAGCTCAAATGTTCAAGCATTTGCTTGCTAACAGAAATCACAGCA
CAATCAAAAAACCCTCGCCCAAGGTTGAATCAGACAATGTCTACCACTTG
AAAAGCA
back to top

protein sequence of SMED30005030-orf-1

>SMED30005030-orf-1 ID=SMED30005030-orf-1|Name=SMED30005030-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=968bp
AKFCVAIIIFVKFSTCLRNKEIIFIGKSGLVNVWPFKNQVALIDGDIFLG
GLMMVHLRSEEMVCGVIAAEGGIQALEVMVYTINRVNEMKILGDIKLGAY
IKDDCDRDTYGLEQAVDFIKQSSKLQTKSNCNEAKIDSNLRTITGVIGAS
SSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQ
VMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKDNRICIATSEILPR
DSKLASVKEYKDKVLRLKKHLKTFDGVGATGVIIFGSDQEVGDFMMAIKE
HNLTHSFNWLGSDGWSGRRVAYKKGLFETSKEQEIEGAIGIEPLSKTVFG
FENYFLNLTPSTNKHNPWFNEFWEDFFECKLPNSSDTPYNNFTDICDENL
KLSKDNPKHSFENQLQFVSDAVMAFAMALKEMKNQMCAPNISKNACISML
QNKGETLLRILQKIKFTSLSGLEMEFTPITFDGLPRYRILNFIKAANGIY
SWVEIGNYTNQKLRIDYTKLKFRGDSSVIPISSCTPKCSDDQRKKLHPGI
CTCWICIKCQEYEIFKNSRTICEACPLGQYPDQNRTLCLRLQQIYLNQTH
PLSIGLMIFSGICLIIALTCFFIFVFYFKTPIVKASSRELSFILLVGIIL
CFVVSLVLCTTPTKLMCSFQKFGIGFSFSLCYSALLVKLNRIERIFRKGR
KQPQKLRLISQQSQIFICAFIVSIQIIILGTLLYFVNSDPVTHHPSRNEE
YLICDYIIGNSLVIIVLHPMILILICTVYAFLTRNIPEAFNESKHIGFTM
YSTCVVWLGFIPCYLATAIMVHLRVATLCVSINVSALVALSCLFGPKVYT
ILFKPKQNVRKGLRINIKNEQNQIDHLDNNSHTQMSYSHMILKDDQLNNI
KNSVTSISGSVITCHRETQFPDCSDAFVIVNEKFEAQMFKHLLANRNHST
IKKPSPKVESDNVYHLKS
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000044cephalic ganglia
PLANA:0000224cement gland
Vocabulary: INTERPRO
TermDefinition
IPR038550GPCR_3_9-Cys_sf
IPR000337GPCR_3
IPR000162GPCR_3_mtglu_rcpt
IPR011500GPCR_3_9-Cys_dom
IPR001828ANF_lig-bd_rcpt
IPR017978GPCR_3_C
IPR017979GPCR_3_CS
IPR028082Peripla_BP_I
IPR023795Serpin_CS
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005886plasma membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 860..880
NoneNo IPR availableGENE3DG3DSA:3.40.50.2300coord: 45..486
e-value: 2.0E-122
score: 410.8
NoneNo IPR availableGENE3DG3DSA:3.40.50.2300coord: 196..506
e-value: 2.0E-122
score: 410.8
NoneNo IPR availablePANTHERPTHR24060:SF155MANGETOUT, ISOFORM Gcoord: 29..883
NoneNo IPR availablePANTHERPTHR24060METABOTROPIC GLUTAMATE RECEPTORcoord: 29..883
NoneNo IPR availableCDDcd150457tmC_mGluRscoord: 601..853
e-value: 3.38159E-100
score: 312.257
NoneNo IPR availableTMHMMTMhelixcoord: 640..662
NoneNo IPR availableTMHMMTMhelixcoord: 761..783
NoneNo IPR availableTMHMMTMhelixcoord: 713..735
NoneNo IPR availableTMHMMTMhelixcoord: 672..692
NoneNo IPR availableTMHMMTMhelixcoord: 804..826
NoneNo IPR availableTMHMMTMhelixcoord: 831..853
NoneNo IPR availableTMHMMTMhelixcoord: 606..628
IPR000337GPCR, family 3PRINTSPR00248GPCRMGRcoord: 198..214
score: 39.34
coord: 146..172
score: 54.63
coord: 791..812
score: 62.64
coord: 630..652
score: 63.59
coord: 714..737
score: 22.14
coord: 768..791
score: 47.4
coord: 214..231
score: 29.51
coord: 72..87
score: 39.45
coord: 675..696
score: 54.4
coord: 44..56
score: 58.41
coord: 179..198
score: 54.84
IPR000162GPCR, family 3, metabotropic glutamate receptorPRINTSPR00593MTABOTROPICRcoord: 240..251
score: 47.81
coord: 671..685
score: 43.16
coord: 410..421
score: 41.23
coord: 827..841
score: 51.23
IPR011500GPCR, family 3, nine cysteines domainPFAMPF07562NCD3Gcoord: 530..581
e-value: 1.1E-7
score: 31.7
IPR038550GPCR, family 3, nine cysteines domain superfamilyGENE3DG3DSA:2.10.50.30coord: 528..603
e-value: 6.4E-15
score: 56.7
IPR017978GPCR family 3, C-terminalPFAMPF000037tm_3coord: 615..849
e-value: 4.2E-55
score: 187.1
IPR017978GPCR family 3, C-terminalPROSITEPS50259G_PROTEIN_RECEP_F3_4coord: 602..867
score: 52.419
IPR001828Receptor, ligand binding regionPFAMPF01094ANF_receptorcoord: 75..493
e-value: 1.4E-72
score: 244.8
IPR017979GPCR, family 3, conserved sitePROSITEPS00981G_PROTEIN_RECEP_F3_3coord: 790..800
IPR028082Periplasmic binding protein-like ISUPERFAMILYSSF53822Periplasmic binding protein-like Icoord: 41..510