SMED30005028

Overview
NameSMED30005028
Smed IDSMED30005028
Length (bp)3153
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30005028 (SMED30005028) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30005028 (SMED30005028) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30005028 (SMED30005028) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30005028 (SMED30005028) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005028

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30005028SMESG000017098.1 SMESG000014979.1 SMESG000014974.1 dd_Smed_v4_7198_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30005028SMESG000017098.1 SMESG000014979.1 SMESG000014974.1 dd_Smed_v4_7198_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005028SMESG000017098.1 SMESG000014979.1 SMESG000014974.1 dd_Smed_v4_7198_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30005028 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.001196:11490..15941 -15135
Homology
BLAST of SMED30005028 vs. Ensembl Human
Match: ANKRD44 (ankyrin repeat domain 44 [Source:HGNC Symbol;Acc:HGNC:25259])

HSP 1 Score: 126.331 bits (316), Expect = 1.236e-30
Identity = 71/255 (27.84%), Postives = 131/255 (51.37%), Query Frame = 2
Query:  134 DLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTET-VKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            D N + P+H A      +  +++I     +   D+  +  +H+A+ NGH + V LL++   +INA D+ DR  +H A   GH  +V LLI+H  ++  +DK GY PLH A   G+    K L++   +I+  + +    +H AC   +  +V  LID+  N+   +     P+H + +       ++LL+++  D+  +    + P+H+     R    + L+ +  +I+  D+ GN+PL +A + G+E LI+ L
Sbjct:  104 DKNWQTPLHVAAANKAVKCAEVIIPLLSSVNVSDRGGRTALHHAALNGHVEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASNGQINVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQPNNNGFTPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCVDKDGNTPLHVAARYGHELLINTL 358          

HSP 2 Score: 117.472 bits (293), Expect = 1.402e-27
Identity = 71/253 (28.06%), Postives = 123/253 (48.62%), Query Frame = 2
Query:  137 LNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            L  + P+  A   G  E +++LI    D+  LD   + P+H A+  G  + ++LL+     +NA+D     P+HRA        V +LI H  D+ +RDK    PLH A      + A+++I     +   D+  +  +H A       +V LL+    NI + DK +RR +H +      + V LLI+H  ++  +D     P+H A +  +   VK L++   +I+E + +GN+ L IA   G + +++ L
Sbjct:    6 LTDQPPLVQAIFSGDPEEIRMLIHKTEDVNTLDSEKRTPLHVAAFLGDAEIIELLILSGARVNAKDNMWLTPLHRAVASRSEEAVQVLIKHSADVNARDKNWQTPLHVAAANKAVKCAEVIIPLLSSVNVSDRGGRTALHHAALNGHVEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASNGQINVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNEL 258          

HSP 3 Score: 116.316 bits (290), Expect = 3.077e-27
Identity = 73/271 (26.94%), Postives = 126/271 (46.49%), Query Frame = 2
Query:   59 FIRAIRGGSIKLFHRFF-KREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKT 868
             ++AI  G  +       K E +   D  K+ P+H A   G  EI++LLI     + A D     P+H A  +  ++ V++L+    D+NARD+  + P+H A  +       ++I     +   D+ G   LH+A   G  E   LL+    +I A DK D+R +H A       +V LLI+H   +  +DK    P+H + S      VK L++   +I+  + +    +H+AC   +   V  L+D+  ++ + +  G +PL  A  +
Sbjct:   12 LVQAIFSGDPEEIRMLIHKTEDVNTLDSEKRTPLHVAAFLGDAEIIELLILSGARVNAKDNMWLTPLHRAVASRSEEAVQVLIKHSADVNARDKNWQTPLHVAAANKAVKCAEVIIPLLSSVNVSDRGGRTALHHAALNGHVEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASNGQINVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQPNNNGFTPLHFAAAS 282          

HSP 4 Score: 77.411 bits (189), Expect = 2.405e-14
Identity = 54/222 (24.32%), Postives = 89/222 (40.09%), Query Frame = 2
Query:   74 RGGSIKLFHRFF------------KREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKA----------------------------------GRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLI 601
            RGG   L H               K   +   D   +R +H A   G  ++V LLI++  ++   DK    P+H A+ NG    VK L++L  +I+  + +    +H AC +G   +VN LID+  ++   +  G+ PLH+A  +                                  GR   ++ LI +  +I+  DK    P+H A  Y    ++  LI
Sbjct:  138 RGGRTALHHAALNGHVEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASNGQINVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQPNNNGFTPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCVDKDGNTPLHVAARYGHELLINTLI 359          

HSP 5 Score: 62.003 bits (149), Expect = 2.682e-9
Identity = 37/122 (30.33%), Postives = 58/122 (47.54%), Query Frame = 2
Query:  155 IHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKT-VKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCD 517
            +H AC  GQ  +V  LIDY  ++   +     P+H+A+ + H    ++LLV+   D+N + +  + P+H    HG       LI +  +I+  DK G  PLH A + G       LI    D
Sbjct:  243 LHIACYNGQDAVVNELIDYGANVNQPNNNGFTPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCVDKDGNTPLHVAARYGHELLINTLITSGAD 364          
BLAST of SMED30005028 vs. Ensembl Human
Match: ANKRD44 (ankyrin repeat domain 44 [Source:HGNC Symbol;Acc:HGNC:25259])

HSP 1 Score: 126.331 bits (316), Expect = 2.168e-29
Identity = 71/255 (27.84%), Postives = 131/255 (51.37%), Query Frame = 2
Query:  134 DLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGC-CTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            D N + P+H A      +  +++I     +   D+  +  +H+A+ NGH + V LL++   +INA D+ DR  +H A   GH  +V LLI+H  ++  +DK GY PLH A   G+    K L++   +I+  + +    +H AC   +  +V  LID+  N+   +     P+H + +       ++LL+++  D+  +    + P+H+     R    + L+ +  +I+  D+ GN+PL +A + G+E LI+ L
Sbjct:  104 DKNWQTPLHVAAANKAVKCAEVIIPLLSSVNVSDRGGRTALHHAALNGHVEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASNGQINVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQPNNNGFTPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCVDKDGNTPLHVAARYGHELLINTL 358          

HSP 2 Score: 117.472 bits (293), Expect = 1.833e-26
Identity = 71/253 (28.06%), Postives = 123/253 (48.62%), Query Frame = 2
Query:  137 LNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            L  + P+  A   G  E +++LI    D+  LD   + P+H A+  G  + ++LL+     +NA+D     P+HRA        V +LI H  D+ +RDK    PLH A      + A+++I     +   D+  +  +H A       +V LL+    NI + DK +RR +H +      + V LLI+H  ++  +D     P+H A +  +   VK L++   +I+E + +GN+ L IA   G + +++ L
Sbjct:    6 LTDQPPLVQAIFSGDPEEIRMLIHKTEDVNTLDSEKRTPLHVAAFLGDAEIIELLILSGARVNAKDNMWLTPLHRAVASRSEEAVQVLIKHSADVNARDKNWQTPLHVAAANKAVKCAEVIIPLLSSVNVSDRGGRTALHHAALNGHVEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASNGQINVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNEL 258          

HSP 3 Score: 115.931 bits (289), Expect = 5.527e-26
Identity = 74/276 (26.81%), Postives = 128/276 (46.38%), Query Frame = 2
Query:   59 FIRAIRGGSIKLFHRFF-KREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGL 883
             ++AI  G  +       K E +   D  K+ P+H A   G  EI++LLI     + A D     P+H A  +  ++ V++L+    D+NARD+  + P+H A  +       ++I     +   D+ G   LH+A   G  E   LL+    +I A DK D+R +H A       +V LLI+H   +  +DK    P+H + S      VK L++   +I+  + +    +H+AC   +   V  L+D+  ++ + +  G +PL  A  + +  L
Sbjct:   12 LVQAIFSGDPEEIRMLIHKTEDVNTLDSEKRTPLHVAAFLGDAEIIELLILSGARVNAKDNMWLTPLHRAVASRSEEAVQVLIKHSADVNARDKNWQTPLHVAAANKAVKCAEVIIPLLSSVNVSDRGGRTALHHAALNGHVEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASNGQINVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQPNNNGFTPLHFAAASTHGAL 287          

HSP 4 Score: 107.071 bits (266), Expect = 3.788e-23
Identity = 73/299 (24.41%), Postives = 135/299 (45.15%), Query Frame = 2
Query:    5 IVILINIFIMSNSEHYQCFIRAIRGGSIKLFHRFF-KREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAET-AKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            I+ L++   +S+         A   G +++ +    K   +   D   +R +H A   G  ++V LLI++  ++   DK    P+H A+ NG    VK L++L  +I+  + +    +H AC +G   +VN LID+  ++   +  G+ PLH+A  +       +LL+++  D+  + K  + P+H    + R    + LI +   I+  DK    P+H++        +  LI    D          P+HLA     ++  + L+    +I+  D+FG + L  A   GN   I +L
Sbjct:  126 IIPLLSSVNVSDRGGRTALHHAALNGHVEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASNGQINVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQPNNNGFTPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCVDKDGNTPLHVAARYGHELLINTLITSGADTAKCGIHSMFPLHLAALNAHSDCCRKLLSSGFEIDTPDKFGRTCLHAAAAGGNVECIKLL 424          

HSP 5 Score: 95.1301 bits (235), Expect = 1.869e-19
Identity = 63/239 (26.36%), Postives = 105/239 (43.93%), Query Frame = 2
Query:  155 IHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKT-VKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKT 868
            +H AC  GQ  +V  LIDY  ++   +     P+H+A+ + H    ++LLV+   D+N + +  + P+H    HG       LI +  +I+  DK G  PLH A + G       LI    D          P+H A     +   + L+     I++ DK+ R  +H + +G   E +KLL     D   +D   + P+H A        ++ LV    ++ E D +G + L  A  +
Sbjct:  243 LHIACYNGQDAVVNELIDYGANVNQPNNNGFTPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCVDKDGNTPLHVAARYGHELLINTLITSGADTAKCGIHSMFPLHLAALNAHSDCCRKLLSSGFEIDTPDKFGRTCLHAAAAGGNVECIKLLQSSGADFHKKDKCGRTPLHYAAANCHFHCIETLVTTGANVNETDDWGRTALHYAAAS 481          

HSP 6 Score: 75.485 bits (184), Expect = 3.364e-13
Identity = 46/174 (26.44%), Postives = 75/174 (43.10%), Query Frame = 2
Query:  146 KRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCS 667
            K P+H     G+    + LI    +I+ +DK    P+H A++ GH+  +  L++   D          P+H A  + HS     L+    +I++ DK G   LH A   G  E  KLL     D   +DK  + P+H A        ++ L+    N+   D W R  +H + +
Sbjct:  307 KSPLHMTAVHGRFTRSQTLIQNGGEIDCVDKDGNTPLHVAARYGHELLINTLITSGADTAKCGIHSMFPLHLAALNAHSDCCRKLLSSGFEIDTPDKFGRTCLHAAAAGGNVECIKLLQSSGADFHKKDKCGRTPLHYAAANCHFHCIETLVTTGANVNETDDWGRTALHYAAA 480          

HSP 7 Score: 62.003 bits (149), Expect = 4.536e-9
Identity = 50/210 (23.81%), Postives = 83/210 (39.52%), Query Frame = 2
Query:  134 DLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLAC 763
            D +   P+H A   G   ++  LI    D       +  P+H A+ N H    + L+S   +I+  D++ R  +H A   G+   + LL     D   +DK G  PLHYA         + L+    ++   D W +  +H A   +      +L + H N E  ++   R +    +  C E    L+ +  +   RD      IH A 
Sbjct:  336 DKDGNTPLHVAARYGHELLINTLITSGADTAKCGIHSMFPLHLAALNAHSDCCRKLLSSGFEIDTPDKFGRTCLHAAAAGGNVECIKLLQSSGADFHKKDKCGRTPLHYAAANCHFHCIETLVTTGANVNETDDWGRTALHYAAASDMDRNKTILGNAHDNSEELER--ARELKEKEATLCLE---FLLQNDANPSIRDKEGYNSIHYAA 540          
BLAST of SMED30005028 vs. Ensembl Human
Match: ANKRD28 (ankyrin repeat domain 28 [Source:HGNC Symbol;Acc:HGNC:29024])

HSP 1 Score: 127.872 bits (320), Expect = 3.768e-29
Identity = 75/255 (29.41%), Postives = 125/255 (49.02%), Query Frame = 2
Query:  104 FFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKT 868
             FK+E +  +D  K+ P+H A   G  EI++LLI     + A D     P+H A  +  ++ V++L+    D+NARD+  + P+H A  +        L+    ++   D+ G   LH+A  +G  E  KLL+    +I A DK D+R IH A       +VKLL+ H   +  +DK +  P+H + S      VK L+D   D+   + +   P+H+AC   +   V  L+D    + + ++ G +PL  A  +
Sbjct:   28 IFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAAS 282          

HSP 2 Score: 124.02 bits (310), Expect = 5.853e-28
Identity = 72/255 (28.24%), Postives = 127/255 (49.80%), Query Frame = 2
Query:  134 DLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGC-CTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            D N + P+H A      +  + L+    ++   D+  +  +H+A+ +GH + VKLL+S   +INA D+ DR  IH A   GH  +V LL+ H  ++  +DK  Y PLH A  +G     K L+D   D+   + +   P+H AC   +  +V  LID    +  +++    P+H + +       ++LL+ +  D+  +    + P+H+     R    + ++     I+  D+ GN+PL IA + G+E LI+ L
Sbjct:  104 DKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTL 358          

HSP 3 Score: 115.931 bits (289), Expect = 1.694e-25
Identity = 72/253 (28.46%), Postives = 121/253 (47.83%), Query Frame = 2
Query:  137 LNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            L  +  +  A   G  + V+ LI    D+   D   + P+H A+  G  + ++LL+     +NA+D     P+HRA        V +L+ H  D+ +RDK    PLH A      + A+ L+    ++   D+  +  +H A       +VKLL+    NI + DK +RR IH +      E VKLL+ H  ++  +D     P+H A ++     VK L+D   D+ E + +GN+PL +A   G + +++ L
Sbjct:    6 LRDQPSLVQAIFNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNEL 258          

HSP 4 Score: 103.99 bits (258), Expect = 7.094e-22
Identity = 74/296 (25.00%), Postives = 123/296 (41.55%), Query Frame = 2
Query:   74 RGGSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKA----------------------------------GRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIA 859
            RG +I  F            D   +R IH A   G  E+VKLL+ +  ++   DK +  P+H A+ +G    VK L+ L  D+N  + +   P+H AC +G   +VN LID    +  +++ G+ PLH+A  +                                  GR   ++ +I     I+  DK    P+H A  Y    ++  LI    +   R      P+HL+     ++  + L+    DI+  D + +  +H A      E + +L++   D  + D+FG SPL  A
Sbjct:  162 RGANINAF------------DKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYA 445          

HSP 5 Score: 93.5893 bits (231), Expect = 1.225e-18
Identity = 65/267 (24.34%), Postives = 116/267 (43.45%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVKLLI---DYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEAR----DKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLID--HKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            L ++ + K+ PIH A   G +E ++LLI   +    ++  D   Q P+  +  NGH   V  L++   +++A+D+W R  +HR    GH   V+ L+ H      RD  G  P+H +   G       L+     ++A     D      +H AC       V+LL++     +  +     P+H +         ++LID      + A D   + P+H A      E +++L+ H+  +   D  G +PL +A + G    + +L
Sbjct:  610 LVKDYILKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWACYNGHETCVELLLEQEV-FQKTEGNAFSPLHCAVINDNEGAAEMLIDTLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEML 875          

HSP 6 Score: 88.5817 bits (218), Expect = 4.204e-17
Identity = 62/244 (25.41%), Postives = 107/244 (43.85%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKT-VKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEG 880
            P+H AC  GQ  +V  LID    +   ++    P+H+A+ + H    ++LLV    D+N + +  + P+H    HG       +I     I+  DK G  PLH A + G       LI    D   R      P+H A     +   + L+    +I++ D + R  +H + +G   E + LL++   D   +D + + P+H A      + +  LV     + + D+ G +PL  A  +  +G
Sbjct:  242 PLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGSGASVNDLDERGCTPLHYAATSDTDG 485          

HSP 7 Score: 77.7962 bits (190), Expect = 9.622e-14
Identity = 68/287 (23.69%), Postives = 122/287 (42.51%), Query Frame = 2
Query:  116 EYLEREDLNKK-------RPIHHACERG----------QTEIVKLLIDYNCDI--EALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYR-PLHYACKAGRAETAKLLIDH---HCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIE----ECDQFGNSPLEIAMKTGNEGLIHIL 895
            EYL R D N           +H++   G          +T +  L+     D+  ++ ++    P+H A+ +GH + +++LV    D++ R+   R P+  A   GH   V++LI+    I  +D +  R P+H A   G +E  +LLI +      ++ +D   Q P+  +        V  L++   N++++DKW R  +H        E V  L+ H      RD   + PIHL+        +  L+     ++      D  G + L  A   G+E  + +L
Sbjct:  489 EYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYILKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWACYNGHETCVELL 775          

HSP 8 Score: 72.7886 bits (177), Expect = 2.935e-12
Identity = 64/260 (24.62%), Postives = 108/260 (41.54%), Query Frame = 2
Query:  131 EDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAG-IVKLLIDHHCNIESRDKWNRRPIHLSCSG--------CCTETVKLLIDHKCDIEARDWWDQR----PIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTG 871
            ED N   P+H A   G   ++  LI    D          P+H A+ +G     + L+S   DI+  D++ R  +H A   G+   +NLL++   D   +DK G  PLHYA      +    L+     +   D+    P+H A   +  G  ++ L+ +  N   RDK     +H S +           +ET   ++      +     D R    P+HLA      + +++LV    D++  +  G +PL++A   G
Sbjct:  335 EDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKG 594          

HSP 9 Score: 65.855 bits (159), Expect = 4.525e-10
Identity = 41/179 (22.91%), Postives = 79/179 (44.13%), Query Frame = 2
Query:   80 GSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLV-SLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCD---IESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRP-IHCACEYERAGIVKLLI 601
            G+ ++         +   D   + P+H A      E ++LL+ +N  + ++D   + P+  A++NG   TV++LV S   ++  +D      +H AC  GH     L+++   D   I + +     PLH A + G     + L+     + A D+    P + CA   + A  + L++
Sbjct:  802 GAAEMLIDTLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEMLVSSASAELTLQDNSKNTALHLACSKGHETSALLILEKITDRNLINATNAALQTPLHVAARNGLTMVVQELLGKGASVLAVDENGYTPALACAPNKDVADCLALIL 980          

HSP 10 Score: 64.6994 bits (156), Expect = 9.718e-10
Identity = 53/210 (25.24%), Postives = 93/210 (44.29%), Query Frame = 2
Query:  155 IHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLV-SLHCDI-NARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDH-HCDIEARDKWDQRPIHCAC----EYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLAC 763
            +H AC  G    V+LL++     +  +     P+H A  N ++   ++L+ +L   I NA D   R P+H A    H   + LL+ H+  + S D  G  PL  A + G+  T ++L+     ++  +D      +H AC    E     I++ + D +  I + +   + P+H++     T  V+ L+     + A D     P  LAC
Sbjct:  760 LHWACYNGHETCVELLLEQEV-FQKTEGNAFSPLHCAVINDNEGAAEMLIDTLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEMLVSSASAELTLQDNSKNTALHLACSKGHETSALLILEKITDRNL-INATNAALQTPLHVAARNGLTMVVQELLGKGASVLAVDENGYTPA-LAC 966          
BLAST of SMED30005028 vs. Ensembl Human
Match: ANKRD28 (ankyrin repeat domain 28 [Source:HGNC Symbol;Acc:HGNC:29024])

HSP 1 Score: 127.872 bits (320), Expect = 3.768e-29
Identity = 75/255 (29.41%), Postives = 125/255 (49.02%), Query Frame = 2
Query:  104 FFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKT 868
             FK+E +  +D  K+ P+H A   G  EI++LLI     + A D     P+H A  +  ++ V++L+    D+NARD+  + P+H A  +        L+    ++   D+ G   LH+A  +G  E  KLL+    +I A DK D+R IH A       +VKLL+ H   +  +DK +  P+H + S      VK L+D   D+   + +   P+H+AC   +   V  L+D    + + ++ G +PL  A  +
Sbjct:   28 IFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAAS 282          

HSP 2 Score: 124.02 bits (310), Expect = 5.853e-28
Identity = 72/255 (28.24%), Postives = 127/255 (49.80%), Query Frame = 2
Query:  134 DLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGC-CTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            D N + P+H A      +  + L+    ++   D+  +  +H+A+ +GH + VKLL+S   +INA D+ DR  IH A   GH  +V LL+ H  ++  +DK  Y PLH A  +G     K L+D   D+   + +   P+H AC   +  +V  LID    +  +++    P+H + +       ++LL+ +  D+  +    + P+H+     R    + ++     I+  D+ GN+PL IA + G+E LI+ L
Sbjct:  104 DKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTL 358          

HSP 3 Score: 115.931 bits (289), Expect = 1.694e-25
Identity = 72/253 (28.46%), Postives = 121/253 (47.83%), Query Frame = 2
Query:  137 LNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            L  +  +  A   G  + V+ LI    D+   D   + P+H A+  G  + ++LL+     +NA+D     P+HRA        V +L+ H  D+ +RDK    PLH A      + A+ L+    ++   D+  +  +H A       +VKLL+    NI + DK +RR IH +      E VKLL+ H  ++  +D     P+H A ++     VK L+D   D+ E + +GN+PL +A   G + +++ L
Sbjct:    6 LRDQPSLVQAIFNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNEL 258          

HSP 4 Score: 103.99 bits (258), Expect = 7.094e-22
Identity = 74/296 (25.00%), Postives = 123/296 (41.55%), Query Frame = 2
Query:   74 RGGSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKA----------------------------------GRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIA 859
            RG +I  F            D   +R IH A   G  E+VKLL+ +  ++   DK +  P+H A+ +G    VK L+ L  D+N  + +   P+H AC +G   +VN LID    +  +++ G+ PLH+A  +                                  GR   ++ +I     I+  DK    P+H A  Y    ++  LI    +   R      P+HL+     ++  + L+    DI+  D + +  +H A      E + +L++   D  + D+FG SPL  A
Sbjct:  162 RGANINAF------------DKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYA 445          

HSP 5 Score: 93.5893 bits (231), Expect = 1.225e-18
Identity = 65/267 (24.34%), Postives = 116/267 (43.45%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVKLLI---DYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEAR----DKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLID--HKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            L ++ + K+ PIH A   G +E ++LLI   +    ++  D   Q P+  +  NGH   V  L++   +++A+D+W R  +HR    GH   V+ L+ H      RD  G  P+H +   G       L+     ++A     D      +H AC       V+LL++     +  +     P+H +         ++LID      + A D   + P+H A      E +++L+ H+  +   D  G +PL +A + G    + +L
Sbjct:  610 LVKDYILKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWACYNGHETCVELLLEQEV-FQKTEGNAFSPLHCAVINDNEGAAEMLIDTLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEML 875          

HSP 6 Score: 88.5817 bits (218), Expect = 4.204e-17
Identity = 62/244 (25.41%), Postives = 107/244 (43.85%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKT-VKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEG 880
            P+H AC  GQ  +V  LID    +   ++    P+H+A+ + H    ++LLV    D+N + +  + P+H    HG       +I     I+  DK G  PLH A + G       LI    D   R      P+H A     +   + L+    +I++ D + R  +H + +G   E + LL++   D   +D + + P+H A      + +  LV     + + D+ G +PL  A  +  +G
Sbjct:  242 PLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGSGASVNDLDERGCTPLHYAATSDTDG 485          

HSP 7 Score: 77.7962 bits (190), Expect = 9.622e-14
Identity = 68/287 (23.69%), Postives = 122/287 (42.51%), Query Frame = 2
Query:  116 EYLEREDLNKK-------RPIHHACERG----------QTEIVKLLIDYNCDI--EALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYR-PLHYACKAGRAETAKLLIDH---HCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIE----ECDQFGNSPLEIAMKTGNEGLIHIL 895
            EYL R D N           +H++   G          +T +  L+     D+  ++ ++    P+H A+ +GH + +++LV    D++ R+   R P+  A   GH   V++LI+    I  +D +  R P+H A   G +E  +LLI +      ++ +D   Q P+  +        V  L++   N++++DKW R  +H        E V  L+ H      RD   + PIHL+        +  L+     ++      D  G + L  A   G+E  + +L
Sbjct:  489 EYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYILKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWACYNGHETCVELL 775          

HSP 8 Score: 72.7886 bits (177), Expect = 2.935e-12
Identity = 64/260 (24.62%), Postives = 108/260 (41.54%), Query Frame = 2
Query:  131 EDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAG-IVKLLIDHHCNIESRDKWNRRPIHLSCSG--------CCTETVKLLIDHKCDIEARDWWDQR----PIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTG 871
            ED N   P+H A   G   ++  LI    D          P+H A+ +G     + L+S   DI+  D++ R  +H A   G+   +NLL++   D   +DK G  PLHYA      +    L+     +   D+    P+H A   +  G  ++ L+ +  N   RDK     +H S +           +ET   ++      +     D R    P+HLA      + +++LV    D++  +  G +PL++A   G
Sbjct:  335 EDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKG 594          

HSP 9 Score: 65.855 bits (159), Expect = 4.525e-10
Identity = 41/179 (22.91%), Postives = 79/179 (44.13%), Query Frame = 2
Query:   80 GSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLV-SLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCD---IESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRP-IHCACEYERAGIVKLLI 601
            G+ ++         +   D   + P+H A      E ++LL+ +N  + ++D   + P+  A++NG   TV++LV S   ++  +D      +H AC  GH     L+++   D   I + +     PLH A + G     + L+     + A D+    P + CA   + A  + L++
Sbjct:  802 GAAEMLIDTLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEMLVSSASAELTLQDNSKNTALHLACSKGHETSALLILEKITDRNLINATNAALQTPLHVAARNGLTMVVQELLGKGASVLAVDENGYTPALACAPNKDVADCLALIL 980          

HSP 10 Score: 64.6994 bits (156), Expect = 9.718e-10
Identity = 53/210 (25.24%), Postives = 93/210 (44.29%), Query Frame = 2
Query:  155 IHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLV-SLHCDI-NARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDH-HCDIEARDKWDQRPIHCAC----EYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLAC 763
            +H AC  G    V+LL++     +  +     P+H A  N ++   ++L+ +L   I NA D   R P+H A    H   + LL+ H+  + S D  G  PL  A + G+  T ++L+     ++  +D      +H AC    E     I++ + D +  I + +   + P+H++     T  V+ L+     + A D     P  LAC
Sbjct:  760 LHWACYNGHETCVELLLEQEV-FQKTEGNAFSPLHCAVINDNEGAAEMLIDTLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEMLVSSASAELTLQDNSKNTALHLACSKGHETSALLILEKITDRNL-INATNAALQTPLHVAARNGLTMVVQELLGKGASVLAVDENGYTPA-LAC 966          
BLAST of SMED30005028 vs. Ensembl Human
Match: ANKRD44 (ankyrin repeat domain 44 [Source:HGNC Symbol;Acc:HGNC:25259])

HSP 1 Score: 125.561 bits (314), Expect = 1.426e-28
Identity = 71/255 (27.84%), Postives = 131/255 (51.37%), Query Frame = 2
Query:  134 DLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGC-CTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            D N + P+H A      +  +++I     +   D+  +  +H+A+ NGH + V LL++   +INA D+ DR  +H A   GH  +V LLI+H  ++  +DK GY PLH A   G+    K L++   +I+  + +    +H AC   +  +V  LID+  N+   +     P+H + +       ++LL+++  D+  +    + P+H+     R    + L+ +  +I+  D+ GN+PL +A + G+E LI+ L
Sbjct:   79 DKNWQTPLHVAAANKAVKCAEVIIPLLSSVNVSDRGGRTALHHAALNGHVEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASNGQINVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQPNNNGFTPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCVDKDGNTPLHVAARYGHELLINTL 333          

HSP 2 Score: 114.775 bits (286), Expect = 2.998e-25
Identity = 71/258 (27.52%), Postives = 122/258 (47.29%), Query Frame = 2
Query:  110 KREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGL 883
            K E +   D  K+ P+H A   G  EI++LLI     + A D     P+H A  +  ++ V++L+    D+NARD+  + P+H A  +       ++I     +   D+ G   LH+A   G  E   LL+    +I A DK D+R +H A       +V LLI+H   +  +DK    P+H + S      VK L++   +I+  + +    +H+AC   +   V  L+D+  ++ + +  G +PL  A  + +  L
Sbjct:    5 KTEDVNTLDSEKRTPLHVAAFLGDAEIIELLILSGARVNAKDNMWLTPLHRAVASRSEEAVQVLIKHSADVNARDKNWQTPLHVAAANKAVKCAEVIIPLLSSVNVSDRGGRTALHHAALNGHVEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASNGQINVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQPNNNGFTPLHFAAASTHGAL 262          

HSP 3 Score: 108.227 bits (269), Expect = 3.268e-23
Identity = 66/233 (28.33%), Postives = 114/233 (48.93%), Query Frame = 2
Query:  197 LLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            +LI    D+  LD   + P+H A+  G  + ++LL+     +NA+D     P+HRA        V +LI H  D+ +RDK    PLH A      + A+++I     +   D+  +  +H A       +V LL+    NI + DK +RR +H +      + V LLI+H  ++  +D     P+H A +  +   VK L++   +I+E + +GN+ L IA   G + +++ L
Sbjct:    1 MLIHKTEDVNTLDSEKRTPLHVAAFLGDAEIIELLILSGARVNAKDNMWLTPLHRAVASRSEEAVQVLIKHSADVNARDKNWQTPLHVAAANKAVKCAEVIIPLLSSVNVSDRGGRTALHHAALNGHVEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASNGQINVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNEL 233          

HSP 4 Score: 94.7449 bits (234), Expect = 5.495e-19
Identity = 63/239 (26.36%), Postives = 105/239 (43.93%), Query Frame = 2
Query:  155 IHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKT-VKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKT 868
            +H AC  GQ  +V  LIDY  ++   +     P+H+A+ + H    ++LLV+   D+N + +  + P+H    HG       LI +  +I+  DK G  PLH A + G       LI    D          P+H A     +   + L+     I++ DK+ R  +H + +G   E +KLL     D   +D   + P+H A        ++ LV    ++ E D +G + L  A  +
Sbjct:  218 LHIACYNGQDAVVNELIDYGANVNQPNNNGFTPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCVDKDGNTPLHVAARYGHELLINTLITSGADTAKCGIHSMFPLHLAALNAHSDCCRKLLSSGFEIDTPDKFGRTCLHAAAAGGNVECIKLLQSSGADFHKKDKCGRTPLHYAAANCHFHCIETLVTTGANVNETDDWGRTALHYAAAS 456          

HSP 5 Score: 90.5077 bits (223), Expect = 1.131e-17
Identity = 65/260 (25.00%), Postives = 115/260 (44.23%), Query Frame = 2
Query:  116 EYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIES---RDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDH--HCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDH-HCDIEECDQFGNSPLEIAMKTGNE 877
            E ++ +D   + P+  A   G  + V LL++   +++ +D      +H     GH++ V++L+     I  +D   R P+H A   GH+  ++ L+      E    +D  GY PLH+AC  G     ++L++  C           P+HCA   +      LL+       +  RD   R P+H +      E ++LL+ H   + A D   +  + +A    +   V ILV+    D+   D+  N+PL +A   G+E
Sbjct:  636 EAVDVKDAKGQTPLMLAVAYGHIDAVSLLLEKEANVDTVDILGCTALHRGIMTGHEECVQMLLEQEVSILCKDSRGRTPLHYAAARGHATWLSELLQMALSEEDCCFKDNQGYTPLHWACYNGNENCIEVLLEQKC-FRKFIGNPFTPLHCAIINDHGNCASLLLGAIDSSIVSCRDDKGRTPLHAAAFADHVECLQLLLRHSAPVNAVDNSGKTALMMAAENGQAGAVDILVNSAQADLTVKDKDLNTPLHLACSKGHE 894          

HSP 6 Score: 90.1225 bits (222), Expect = 1.511e-17
Identity = 73/276 (26.45%), Postives = 123/276 (44.57%), Query Frame = 2
Query:  116 EYLEREDLNKK-------RPIHHACERGQTEIVKLLID-YNCDIEALDKW-NQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYR-PLHYACKAGRAETAKLLI---DHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEEC---DQFGNSPLEIAMKTGNEGLIHIL 895
            E+L + D N           IH+A   G  + ++LL++  N   E  D    + P+H A+ NGH + +++L+    D++ RDE  R  +  A   GH+  V  LI+    I  +D +  R PLH +   G     +LL+   D+   ++ +D   Q P+  A  Y     V LL++   N+++ D      +H        E V++L++ +  I  +D   + P+H A        +  L+      E+C   D  G +PL  A   GNE  I +L
Sbjct:  491 EFLLQNDANPSIRDKEGYNSIHYAAAYGHRQCLELLLERTNSGFEESDSGATKSPLHLAAYNGHHQALEVLLQSLVDLDIRDEKGRTALDLAAFKGHTECVEALINQGASIFVKDNVTKRTPLHASVINGHTLCLRLLLEIADNPEAVDVKDAKGQTPLMLAVAYGHIDAVSLLLEKEANVDTVDILGCTALHRGIMTGHEECVQMLLEQEVSILCKDSRGRTPLHYAAARGHATWLSELLQMALSEEDCCFKDNQGYTPLHWACYNGNENCIEVL 766          

HSP 7 Score: 87.8113 bits (216), Expect = 7.459e-17
Identity = 69/268 (25.75%), Postives = 115/268 (42.91%), Query Frame = 2
Query:  128 REDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALD---KWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIE---ARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIH-LSCS-----GCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            ++++ K+ P+H +   G T  ++LL++   + EA+D      Q P+  A   GH   V LL+    +++  D      +HR    GH   V +L++    I  +D  G  PLHYA   G A     L+      E    +D     P+H AC       +++L++  C      K+   P   L C+     G C   +   ID    +  RD   + P+H A  A   E +++L+ H   +   D  G + L +A + G  G + IL
Sbjct:  604 KDNVTKRTPLHASVINGHTLCLRLLLEIADNPEAVDVKDAKGQTPLMLAVAYGHIDAVSLLLEKEANVDTVDILGCTALHRGIMTGHEECVQMLLEQEVSILCKDSRGRTPLHYAAARGHATWLSELLQMALSEEDCCFKDNQGYTPLHWACYNGNENCIEVLLEQKC----FRKFIGNPFTPLHCAIINDHGNCASLLLGAIDSSI-VSCRDDKGRTPLHAAAFADHVECLQLLLRHSAPVNAVDNSGKTALMMAAENGQAGAVDIL 866          

HSP 8 Score: 75.485 bits (184), Expect = 4.700e-13
Identity = 46/174 (26.44%), Postives = 75/174 (43.10%), Query Frame = 2
Query:  146 KRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCS 667
            K P+H     G+    + LI    +I+ +DK    P+H A++ GH+  +  L++   D          P+H A  + HS     L+    +I++ DK G   LH A   G  E  KLL     D   +DK  + P+H A        ++ L+    N+   D W R  +H + +
Sbjct:  282 KSPLHMTAVHGRFTRSQTLIQNGGEIDCVDKDGNTPLHVAARYGHELLINTLITSGADTAKCGIHSMFPLHLAALNAHSDCCRKLLSSGFEIDTPDKFGRTCLHAAAAGGNVECIKLLQSSGADFHKKDKCGRTPLHYAAANCHFHCIETLVTTGANVNETDDWGRTALHYAAA 455          

HSP 9 Score: 72.7886 bits (177), Expect = 2.582e-12
Identity = 63/276 (22.83%), Postives = 110/276 (39.86%), Query Frame = 2
Query:  134 DLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCAC-------------------EYERAGIVK---------LLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDI--EARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTG 871
            D +   P+H A   G   ++  LI    D       +  P+H A+ N H    + L+S   +I+  D++ R  +H A   G+   + LL     D   +DK G  PLHYA         + L+    ++   D W +  +H A                    E ERA  +K          L+ +  N   RDK     IH + +    + ++LL++       E+     + P+HLA      + +++L+    D++  D+ G + L++A   G
Sbjct:  311 DKDGNTPLHVAARYGHELLINTLITSGADTAKCGIHSMFPLHLAALNAHSDCCRKLLSSGFEIDTPDKFGRTCLHAAAAGGNVECIKLLQSSGADFHKKDKCGRTPLHYAAANCHFHCIETLVTTGANVNETDDWGRTALHYAAASDMDRNKTILGNAHDNSEELERARELKEKEATLCLEFLLQNDANPSIRDKEGYNSIHYAAAYGHRQCLELLLERTNSGFEESDSGATKSPLHLAAYNGHHQALEVLLQSLVDLDIRDEKGRTALDLAAFKG 586          

HSP 10 Score: 69.3218 bits (168), Expect = 3.264e-11
Identity = 65/315 (20.63%), Postives = 129/315 (40.95%), Query Frame = 2
Query:   56 CFIRAIRGGSIKLFHRFFKREY-LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQ-----------NGHKKT-----------------VKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDH-HCDIESRDKLGYR-PLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRR-PIHLSCSGCCTETVKLLI---DHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            C   A  GG+++             ++D   + P+H+A        ++ L+    ++   D W +  +HYA+            N H  +                 ++ L+    + + RD+     IH A  +GH   + LL++  +   E  D    + PLH A   G  +  ++L+    D++ RD+  +  +  A        V+ LI+   +I  +D   +R P+H S     T  ++LL+   D+   ++ +D   Q P+ LA      + V +L++   +++  D  G + L   + TG+E  + +L
Sbjct:  383 CLHAAAAGGNVECIKLLQSSGADFHKKDKCGRTPLHYAAANCHFHCIETLVTTGANVNETDDWGRTALHYAAASDMDRNKTILGNAHDNSEELERARELKEKEATLCLEFLLQNDANPSIRDKEGYNSIHYAAAYGHRQCLELLLERTNSGFEESDSGATKSPLHLAAYNGHHQALEVLLQSLVDLDIRDEKGRTALDLAAFKGHTECVEALINQGASIFVKDNVTKRTPLHASVINGHTLCLRLLLEIADNPEAVDVKDAKGQTPLMLAVAYGHIDAVSLLLEKEANVDTVDILGCTALHRGIMTGHEECVQML 697          
BLAST of SMED30005028 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 109.383 bits (272), Expect = 8.631e-24
Identity = 67/248 (27.02%), Postives = 119/248 (47.98%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            P+H A + G+T +  LL+     I++  K    P+H A+++GH + V LLV     I+A+ +    P+H A +  H      L+ H   ++        PLH A   G    AKLL+D   D  +R      P+H AC+  R  +V+LL+ +   IE+  +    P+H++        V  L+    + +      + P+HLA  A +T+ V++L+ +   ++   +   +PL IA + GN  ++ +L
Sbjct:  263 PLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILL 510          

HSP 2 Score: 105.916 bits (263), Expect = 1.047e-22
Identity = 61/229 (26.64%), Postives = 109/229 (47.60%), Query Frame = 2
Query:  131 EDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDI 817
            E +  + P+H A    QT++V++LI     ++A  +  Q P+H AS+ G+   V LL+    + NA    +  P+H A + G   +  +L+DH+ D     K G+ PLH A K G  E  +LL++    ++   K    P+H A  Y    +  LL+++  + ++  K    P+H++      E    L+  K D  A+      P+HL+      E   +L+++  D+
Sbjct:  454 ETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDV 682          

HSP 3 Score: 105.531 bits (262), Expect = 1.445e-22
Identity = 63/248 (25.40%), Postives = 120/248 (48.39%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            P+H A + GQ E+  +L+D+N D   L K    P+H AS+ G+ + V+LL+     ++   +    P+H A  + +  +  LL+++    ++  K GY PLH A K  + E A  L+    D  A+ +    P+H + +     I  LLI++  ++ ++       +HL          ++L ++  +I ++      P+H+AC+  +   VK LV++  D+ E  +   +PL  A + G+   +  L
Sbjct:  527 PLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYL 774          

HSP 4 Score: 102.834 bits (255), Expect = 7.754e-22
Identity = 75/281 (26.69%), Postives = 117/281 (41.64%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDH--KCDIEARDWW-------------------------------DQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            P+H A   G  ++V LL+     I A  K    P+H A+Q  H    + L+     ++        P+H A   GH  +  LL+D   D  SR   G+ PLH ACK  R +  +LL+ +   IEA  +    P+H A       IV  L+    N +        P+HL+     T+ V++LI +  K D +AR+                                 +  P+H+A    + E   IL+DH+ D     + G +PL +A K GN  ++ +L
Sbjct:  296 PLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLL 576          

HSP 5 Score: 101.679 bits (252), Expect = 2.092e-21
Identity = 70/266 (26.32%), Postives = 121/266 (45.49%), Query Frame = 2
Query:  122 LEREDLNKKR--PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHILNGVIYV 913
            LE +   K R   +H A ++  T    LL+    + +   K    P+H A+  GH+   +LL+    ++N +   +  P+H A + G + + NLL+     I+SR K    PLH A ++G  +   LL+     I A+ K    P+H A + +     + L+ H   ++        P+H++         KLL+D   D  +R      P+H+AC   R + V++L+ +   IE   + G +PL +A   G       +N VIY+
Sbjct:  185 LENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMG------AINIVIYL 444          

HSP 6 Score: 95.9005 bits (237), Expect = 1.034e-19
Identity = 57/248 (22.98%), Postives = 111/248 (44.76%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            P+H A + G  E+V+LL++    ++   K    P+H A+   + K   LL+       A  +    P+H A +     I + L+    D  ++ + G+ PLH + + G  E + LLI++  D+ A+       +H   + +   + ++L ++   I S+      P+H++C       VK L+++  D+  +      P+H A        V+ L+++     E    G +PL IA + G   ++  L
Sbjct:  560 PLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 7 Score: 93.2041 bits (230), Expect = 7.843e-19
Identity = 65/286 (22.73%), Postives = 125/286 (43.71%), Query Frame = 2
Query:  137 LNKKRPIHHACERGQTEIVKLLIDYNCDIEALDK---------------------------------WNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            LN   P+H AC++ + ++V+LL+ Y   IEA  +                                   + P+H A++      V++L+     ++A+    + P+H A   G++ IV LL+    +  +  +  Y PLH A K G+ E A +L+DH+ D     K    P+H A +Y    +V+LL++    ++   K    P+H++      +   LL+++    +A       P+H+A    + E    L+    D     + G +PL ++ + G++ +  +L
Sbjct:  390 LNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLL 675          

HSP 8 Score: 88.5817 bits (218), Expect = 1.946e-17
Identity = 60/250 (24.00%), Postives = 111/250 (44.40%), Query Frame = 2
Query:  146 KRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            + P+H A   G T+IV LL+    +  A  + N  P+H A++ G ++   +L+  + D     +    P+H A ++G+  +V LL++    ++   K    PLH A      + A LL+++    +A  K    P+H A +  +  I   L+    +  ++ +    P+HLS      E   LLI++  D+ A+       +HL          +IL ++  +I      G +PL +A   G   ++  L
Sbjct:  492 QTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFL 741          

HSP 9 Score: 87.4261 bits (215), Expect = 4.900e-17
Identity = 65/286 (22.73%), Postives = 119/286 (41.61%), Query Frame = 2
Query:  131 EDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLV-----------SLHC--------------------DINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            + +N   P++ A +    E+VK L+ +  +     +    P+  A Q GH + V +L+           +LH                     D+ ++  +   P+H A  +GH  +  LL++   ++  + +    PLH A K GR   A LL+     I++R K    P+HCA       +V LL+     I ++ K    P+H++  G   +  + L+ H+  ++        P+H+A +       K+L+D   D       G +PL IA K     ++ +L
Sbjct:  128 QSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGF--TPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELL 411          

HSP 10 Score: 83.5741 bits (205), Expect = 6.487e-16
Identity = 42/174 (24.14%), Postives = 82/174 (47.13%), Query Frame = 2
Query:  140 NKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLS 661
            N   P+H A ++ Q EI   L+ +  D  A  +    P+H ++Q GHK+   LL+    D+ A+       +H   +  H  +  +L ++  +I S+   GY PLH AC  G+    K L+++  D+  + +    P+H A +      V+ L+++  +   +    + P+ ++
Sbjct:  622 NGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          

HSP 11 Score: 81.6481 bits (200), Expect = 2.831e-15
Identity = 48/222 (21.62%), Postives = 99/222 (44.59%), Query Frame = 2
Query:  113 REYLER------EDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLA 760
            R  LER      E  N+  P+H A      ++  LL++     +A  K    P+H A++    +    L+    D NA+      P+H + + GH  I  LLI++  D+ ++   G   +H   +      A++L ++  +I ++      P+H AC + +  +VK L+++  ++  + + +  P+H +        V+ L+++      +    Q P+ +A
Sbjct:  574 RLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          

HSP 12 Score: 55.0694 bits (131), Expect = 3.112e-7
Identity = 45/211 (21.33%), Postives = 92/211 (43.60%), Query Frame = 2
Query:  263 ASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            A++ G  + V  L+    DIN  +      +H A + GHS +V  LI     +++  + G   LH A  AG++    +L+++  ++  +      P++ A +     +VK L+ H  N     +    P+ ++        V +L+++    + R       +H+A     T    +L+ +  + +   + G +PL IA   G+E +  +L
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVR----LPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLL 246          
BLAST of SMED30005028 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 109.383 bits (272), Expect = 8.631e-24
Identity = 67/248 (27.02%), Postives = 119/248 (47.98%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            P+H A + G+T +  LL+     I++  K    P+H A+++GH + V LLV     I+A+ +    P+H A +  H      L+ H   ++        PLH A   G    AKLL+D   D  +R      P+H AC+  R  +V+LL+ +   IE+  +    P+H++        V  L+    + +      + P+HLA  A +T+ V++L+ +   ++   +   +PL IA + GN  ++ +L
Sbjct:  263 PLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILL 510          

HSP 2 Score: 105.916 bits (263), Expect = 1.047e-22
Identity = 61/229 (26.64%), Postives = 109/229 (47.60%), Query Frame = 2
Query:  131 EDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDI 817
            E +  + P+H A    QT++V++LI     ++A  +  Q P+H AS+ G+   V LL+    + NA    +  P+H A + G   +  +L+DH+ D     K G+ PLH A K G  E  +LL++    ++   K    P+H A  Y    +  LL+++  + ++  K    P+H++      E    L+  K D  A+      P+HL+      E   +L+++  D+
Sbjct:  454 ETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDV 682          

HSP 3 Score: 105.531 bits (262), Expect = 1.445e-22
Identity = 63/248 (25.40%), Postives = 120/248 (48.39%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            P+H A + GQ E+  +L+D+N D   L K    P+H AS+ G+ + V+LL+     ++   +    P+H A  + +  +  LL+++    ++  K GY PLH A K  + E A  L+    D  A+ +    P+H + +     I  LLI++  ++ ++       +HL          ++L ++  +I ++      P+H+AC+  +   VK LV++  D+ E  +   +PL  A + G+   +  L
Sbjct:  527 PLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYL 774          

HSP 4 Score: 102.834 bits (255), Expect = 7.754e-22
Identity = 75/281 (26.69%), Postives = 117/281 (41.64%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDH--KCDIEARDWW-------------------------------DQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            P+H A   G  ++V LL+     I A  K    P+H A+Q  H    + L+     ++        P+H A   GH  +  LL+D   D  SR   G+ PLH ACK  R +  +LL+ +   IEA  +    P+H A       IV  L+    N +        P+HL+     T+ V++LI +  K D +AR+                                 +  P+H+A    + E   IL+DH+ D     + G +PL +A K GN  ++ +L
Sbjct:  296 PLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLL 576          

HSP 5 Score: 101.679 bits (252), Expect = 2.092e-21
Identity = 70/266 (26.32%), Postives = 121/266 (45.49%), Query Frame = 2
Query:  122 LEREDLNKKR--PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHILNGVIYV 913
            LE +   K R   +H A ++  T    LL+    + +   K    P+H A+  GH+   +LL+    ++N +   +  P+H A + G + + NLL+     I+SR K    PLH A ++G  +   LL+     I A+ K    P+H A + +     + L+ H   ++        P+H++         KLL+D   D  +R      P+H+AC   R + V++L+ +   IE   + G +PL +A   G       +N VIY+
Sbjct:  185 LENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMG------AINIVIYL 444          

HSP 6 Score: 95.9005 bits (237), Expect = 1.034e-19
Identity = 57/248 (22.98%), Postives = 111/248 (44.76%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            P+H A + G  E+V+LL++    ++   K    P+H A+   + K   LL+       A  +    P+H A +     I + L+    D  ++ + G+ PLH + + G  E + LLI++  D+ A+       +H   + +   + ++L ++   I S+      P+H++C       VK L+++  D+  +      P+H A        V+ L+++     E    G +PL IA + G   ++  L
Sbjct:  560 PLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 7 Score: 93.2041 bits (230), Expect = 7.843e-19
Identity = 65/286 (22.73%), Postives = 125/286 (43.71%), Query Frame = 2
Query:  137 LNKKRPIHHACERGQTEIVKLLIDYNCDIEALDK---------------------------------WNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            LN   P+H AC++ + ++V+LL+ Y   IEA  +                                   + P+H A++      V++L+     ++A+    + P+H A   G++ IV LL+    +  +  +  Y PLH A K G+ E A +L+DH+ D     K    P+H A +Y    +V+LL++    ++   K    P+H++      +   LL+++    +A       P+H+A    + E    L+    D     + G +PL ++ + G++ +  +L
Sbjct:  390 LNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLL 675          

HSP 8 Score: 88.5817 bits (218), Expect = 1.946e-17
Identity = 60/250 (24.00%), Postives = 111/250 (44.40%), Query Frame = 2
Query:  146 KRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            + P+H A   G T+IV LL+    +  A  + N  P+H A++ G ++   +L+  + D     +    P+H A ++G+  +V LL++    ++   K    PLH A      + A LL+++    +A  K    P+H A +  +  I   L+    +  ++ +    P+HLS      E   LLI++  D+ A+       +HL          +IL ++  +I      G +PL +A   G   ++  L
Sbjct:  492 QTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFL 741          

HSP 9 Score: 87.4261 bits (215), Expect = 4.900e-17
Identity = 65/286 (22.73%), Postives = 119/286 (41.61%), Query Frame = 2
Query:  131 EDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLV-----------SLHC--------------------DINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            + +N   P++ A +    E+VK L+ +  +     +    P+  A Q GH + V +L+           +LH                     D+ ++  +   P+H A  +GH  +  LL++   ++  + +    PLH A K GR   A LL+     I++R K    P+HCA       +V LL+     I ++ K    P+H++  G   +  + L+ H+  ++        P+H+A +       K+L+D   D       G +PL IA K     ++ +L
Sbjct:  128 QSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGF--TPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELL 411          

HSP 10 Score: 83.5741 bits (205), Expect = 6.487e-16
Identity = 42/174 (24.14%), Postives = 82/174 (47.13%), Query Frame = 2
Query:  140 NKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLS 661
            N   P+H A ++ Q EI   L+ +  D  A  +    P+H ++Q GHK+   LL+    D+ A+       +H   +  H  +  +L ++  +I S+   GY PLH AC  G+    K L+++  D+  + +    P+H A +      V+ L+++  +   +    + P+ ++
Sbjct:  622 NGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          

HSP 11 Score: 81.6481 bits (200), Expect = 2.831e-15
Identity = 48/222 (21.62%), Postives = 99/222 (44.59%), Query Frame = 2
Query:  113 REYLER------EDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLA 760
            R  LER      E  N+  P+H A      ++  LL++     +A  K    P+H A++    +    L+    D NA+      P+H + + GH  I  LLI++  D+ ++   G   +H   +      A++L ++  +I ++      P+H AC + +  +VK L+++  ++  + + +  P+H +        V+ L+++      +    Q P+ +A
Sbjct:  574 RLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          

HSP 12 Score: 55.0694 bits (131), Expect = 3.112e-7
Identity = 45/211 (21.33%), Postives = 92/211 (43.60%), Query Frame = 2
Query:  263 ASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            A++ G  + V  L+    DIN  +      +H A + GHS +V  LI     +++  + G   LH A  AG++    +L+++  ++  +      P++ A +     +VK L+ H  N     +    P+ ++        V +L+++    + R       +H+A     T    +L+ +  + +   + G +PL IA   G+E +  +L
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVR----LPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLL 246          
BLAST of SMED30005028 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 108.997 bits (271), Expect = 1.148e-23
Identity = 67/248 (27.02%), Postives = 119/248 (47.98%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            P+H A + G+T +  LL+     I++  K    P+H A+++GH + V LLV     I+A+ +    P+H A +  H      L+ H   ++        PLH A   G    AKLL+D   D  +R      P+H AC+  R  +V+LL+ +   IE+  +    P+H++        V  L+    + +      + P+HLA  A +T+ V++L+ +   ++   +   +PL IA + GN  ++ +L
Sbjct:  263 PLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILL 510          

HSP 2 Score: 105.531 bits (262), Expect = 1.476e-22
Identity = 61/229 (26.64%), Postives = 109/229 (47.60%), Query Frame = 2
Query:  131 EDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDI 817
            E +  + P+H A    QT++V++LI     ++A  +  Q P+H AS+ G+   V LL+    + NA    +  P+H A + G   +  +L+DH+ D     K G+ PLH A K G  E  +LL++    ++   K    P+H A  Y    +  LL+++  + ++  K    P+H++      E    L+  K D  A+      P+HL+      E   +L+++  D+
Sbjct:  454 ETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDV 682          

HSP 3 Score: 105.145 bits (261), Expect = 1.954e-22
Identity = 63/248 (25.40%), Postives = 120/248 (48.39%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            P+H A + GQ E+  +L+D+N D   L K    P+H AS+ G+ + V+LL+     ++   +    P+H A  + +  +  LL+++    ++  K GY PLH A K  + E A  L+    D  A+ +    P+H + +     I  LLI++  ++ ++       +HL          ++L ++  +I ++      P+H+AC+  +   VK LV++  D+ E  +   +PL  A + G+   +  L
Sbjct:  527 PLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYL 774          

HSP 4 Score: 102.449 bits (254), Expect = 1.141e-21
Identity = 75/281 (26.69%), Postives = 117/281 (41.64%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDH--KCDIEARDWW-------------------------------DQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            P+H A   G  ++V LL+     I A  K    P+H A+Q  H    + L+     ++        P+H A   GH  +  LL+D   D  SR   G+ PLH ACK  R +  +LL+ +   IEA  +    P+H A       IV  L+    N +        P+HL+     T+ V++LI +  K D +AR+                                 +  P+H+A    + E   IL+DH+ D     + G +PL +A K GN  ++ +L
Sbjct:  296 PLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLL 576          

HSP 5 Score: 101.293 bits (251), Expect = 2.827e-21
Identity = 70/266 (26.32%), Postives = 121/266 (45.49%), Query Frame = 2
Query:  122 LEREDLNKKR--PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHILNGVIYV 913
            LE +   K R   +H A ++  T    LL+    + +   K    P+H A+  GH+   +LL+    ++N +   +  P+H A + G + + NLL+     I+SR K    PLH A ++G  +   LL+     I A+ K    P+H A + +     + L+ H   ++        P+H++         KLL+D   D  +R      P+H+AC   R + V++L+ +   IE   + G +PL +A   G       +N VIY+
Sbjct:  185 LENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMG------AINIVIYL 444          

HSP 6 Score: 95.5153 bits (236), Expect = 1.362e-19
Identity = 57/248 (22.98%), Postives = 111/248 (44.76%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            P+H A + G  E+V+LL++    ++   K    P+H A+   + K   LL+       A  +    P+H A +     I + L+    D  ++ + G+ PLH + + G  E + LLI++  D+ A+       +H   + +   + ++L ++   I S+      P+H++C       VK L+++  D+  +      P+H A        V+ L+++     E    G +PL IA + G   ++  L
Sbjct:  560 PLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 7 Score: 92.8189 bits (229), Expect = 1.133e-18
Identity = 65/286 (22.73%), Postives = 125/286 (43.71%), Query Frame = 2
Query:  137 LNKKRPIHHACERGQTEIVKLLIDYNCDIEALDK---------------------------------WNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            LN   P+H AC++ + ++V+LL+ Y   IEA  +                                   + P+H A++      V++L+     ++A+    + P+H A   G++ IV LL+    +  +  +  Y PLH A K G+ E A +L+DH+ D     K    P+H A +Y    +V+LL++    ++   K    P+H++      +   LL+++    +A       P+H+A    + E    L+    D     + G +PL ++ + G++ +  +L
Sbjct:  390 LNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLL 675          

HSP 8 Score: 88.1965 bits (217), Expect = 2.518e-17
Identity = 60/250 (24.00%), Postives = 111/250 (44.40%), Query Frame = 2
Query:  146 KRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            + P+H A   G T+IV LL+    +  A  + N  P+H A++ G ++   +L+  + D     +    P+H A ++G+  +V LL++    ++   K    PLH A      + A LL+++    +A  K    P+H A +  +  I   L+    +  ++ +    P+HLS      E   LLI++  D+ A+       +HL          +IL ++  +I      G +PL +A   G   ++  L
Sbjct:  492 QTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFL 741          

HSP 9 Score: 87.0409 bits (214), Expect = 6.727e-17
Identity = 65/286 (22.73%), Postives = 119/286 (41.61%), Query Frame = 2
Query:  131 EDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLV-----------SLHC--------------------DINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            + +N   P++ A +    E+VK L+ +  +     +    P+  A Q GH + V +L+           +LH                     D+ ++  +   P+H A  +GH  +  LL++   ++  + +    PLH A K GR   A LL+     I++R K    P+HCA       +V LL+     I ++ K    P+H++  G   +  + L+ H+  ++        P+H+A +       K+L+D   D       G +PL IA K     ++ +L
Sbjct:  128 QSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGF--TPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELL 411          

HSP 10 Score: 83.1889 bits (204), Expect = 8.250e-16
Identity = 42/174 (24.14%), Postives = 82/174 (47.13%), Query Frame = 2
Query:  140 NKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLS 661
            N   P+H A ++ Q EI   L+ +  D  A  +    P+H ++Q GHK+   LL+    D+ A+       +H   +  H  +  +L ++  +I S+   GY PLH AC  G+    K L+++  D+  + +    P+H A +      V+ L+++  +   +    + P+ ++
Sbjct:  622 NGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          

HSP 11 Score: 81.2629 bits (199), Expect = 3.723e-15
Identity = 48/222 (21.62%), Postives = 99/222 (44.59%), Query Frame = 2
Query:  113 REYLER------EDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLA 760
            R  LER      E  N+  P+H A      ++  LL++     +A  K    P+H A++    +    L+    D NA+      P+H + + GH  I  LLI++  D+ ++   G   +H   +      A++L ++  +I ++      P+H AC + +  +VK L+++  ++  + + +  P+H +        V+ L+++      +    Q P+ +A
Sbjct:  574 RLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          

HSP 12 Score: 55.0694 bits (131), Expect = 3.660e-7
Identity = 45/211 (21.33%), Postives = 92/211 (43.60%), Query Frame = 2
Query:  263 ASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            A++ G  + V  L+    DIN  +      +H A + GHS +V  LI     +++  + G   LH A  AG++    +L+++  ++  +      P++ A +     +VK L+ H  N     +    P+ ++        V +L+++    + R       +H+A     T    +L+ +  + +   + G +PL IA   G+E +  +L
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVR----LPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLL 246          
BLAST of SMED30005028 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 108.997 bits (271), Expect = 1.148e-23
Identity = 67/248 (27.02%), Postives = 119/248 (47.98%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            P+H A + G+T +  LL+     I++  K    P+H A+++GH + V LLV     I+A+ +    P+H A +  H      L+ H   ++        PLH A   G    AKLL+D   D  +R      P+H AC+  R  +V+LL+ +   IE+  +    P+H++        V  L+    + +      + P+HLA  A +T+ V++L+ +   ++   +   +PL IA + GN  ++ +L
Sbjct:  263 PLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILL 510          

HSP 2 Score: 105.531 bits (262), Expect = 1.476e-22
Identity = 61/229 (26.64%), Postives = 109/229 (47.60%), Query Frame = 2
Query:  131 EDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDI 817
            E +  + P+H A    QT++V++LI     ++A  +  Q P+H AS+ G+   V LL+    + NA    +  P+H A + G   +  +L+DH+ D     K G+ PLH A K G  E  +LL++    ++   K    P+H A  Y    +  LL+++  + ++  K    P+H++      E    L+  K D  A+      P+HL+      E   +L+++  D+
Sbjct:  454 ETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDV 682          

HSP 3 Score: 105.145 bits (261), Expect = 1.954e-22
Identity = 63/248 (25.40%), Postives = 120/248 (48.39%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            P+H A + GQ E+  +L+D+N D   L K    P+H AS+ G+ + V+LL+     ++   +    P+H A  + +  +  LL+++    ++  K GY PLH A K  + E A  L+    D  A+ +    P+H + +     I  LLI++  ++ ++       +HL          ++L ++  +I ++      P+H+AC+  +   VK LV++  D+ E  +   +PL  A + G+   +  L
Sbjct:  527 PLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYL 774          

HSP 4 Score: 102.449 bits (254), Expect = 1.141e-21
Identity = 75/281 (26.69%), Postives = 117/281 (41.64%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDH--KCDIEARDWW-------------------------------DQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            P+H A   G  ++V LL+     I A  K    P+H A+Q  H    + L+     ++        P+H A   GH  +  LL+D   D  SR   G+ PLH ACK  R +  +LL+ +   IEA  +    P+H A       IV  L+    N +        P+HL+     T+ V++LI +  K D +AR+                                 +  P+H+A    + E   IL+DH+ D     + G +PL +A K GN  ++ +L
Sbjct:  296 PLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLL 576          

HSP 5 Score: 101.293 bits (251), Expect = 2.827e-21
Identity = 70/266 (26.32%), Postives = 121/266 (45.49%), Query Frame = 2
Query:  122 LEREDLNKKR--PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHILNGVIYV 913
            LE +   K R   +H A ++  T    LL+    + +   K    P+H A+  GH+   +LL+    ++N +   +  P+H A + G + + NLL+     I+SR K    PLH A ++G  +   LL+     I A+ K    P+H A + +     + L+ H   ++        P+H++         KLL+D   D  +R      P+H+AC   R + V++L+ +   IE   + G +PL +A   G       +N VIY+
Sbjct:  185 LENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMG------AINIVIYL 444          

HSP 6 Score: 95.5153 bits (236), Expect = 1.362e-19
Identity = 57/248 (22.98%), Postives = 111/248 (44.76%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            P+H A + G  E+V+LL++    ++   K    P+H A+   + K   LL+       A  +    P+H A +     I + L+    D  ++ + G+ PLH + + G  E + LLI++  D+ A+       +H   + +   + ++L ++   I S+      P+H++C       VK L+++  D+  +      P+H A        V+ L+++     E    G +PL IA + G   ++  L
Sbjct:  560 PLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 7 Score: 92.8189 bits (229), Expect = 1.133e-18
Identity = 65/286 (22.73%), Postives = 125/286 (43.71%), Query Frame = 2
Query:  137 LNKKRPIHHACERGQTEIVKLLIDYNCDIEALDK---------------------------------WNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            LN   P+H AC++ + ++V+LL+ Y   IEA  +                                   + P+H A++      V++L+     ++A+    + P+H A   G++ IV LL+    +  +  +  Y PLH A K G+ E A +L+DH+ D     K    P+H A +Y    +V+LL++    ++   K    P+H++      +   LL+++    +A       P+H+A    + E    L+    D     + G +PL ++ + G++ +  +L
Sbjct:  390 LNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLL 675          

HSP 8 Score: 88.1965 bits (217), Expect = 2.518e-17
Identity = 60/250 (24.00%), Postives = 111/250 (44.40%), Query Frame = 2
Query:  146 KRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            + P+H A   G T+IV LL+    +  A  + N  P+H A++ G ++   +L+  + D     +    P+H A ++G+  +V LL++    ++   K    PLH A      + A LL+++    +A  K    P+H A +  +  I   L+    +  ++ +    P+HLS      E   LLI++  D+ A+       +HL          +IL ++  +I      G +PL +A   G   ++  L
Sbjct:  492 QTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFL 741          

HSP 9 Score: 87.0409 bits (214), Expect = 6.727e-17
Identity = 65/286 (22.73%), Postives = 119/286 (41.61%), Query Frame = 2
Query:  131 EDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLV-----------SLHC--------------------DINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            + +N   P++ A +    E+VK L+ +  +     +    P+  A Q GH + V +L+           +LH                     D+ ++  +   P+H A  +GH  +  LL++   ++  + +    PLH A K GR   A LL+     I++R K    P+HCA       +V LL+     I ++ K    P+H++  G   +  + L+ H+  ++        P+H+A +       K+L+D   D       G +PL IA K     ++ +L
Sbjct:  128 QSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGF--TPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELL 411          

HSP 10 Score: 83.1889 bits (204), Expect = 8.250e-16
Identity = 42/174 (24.14%), Postives = 82/174 (47.13%), Query Frame = 2
Query:  140 NKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLS 661
            N   P+H A ++ Q EI   L+ +  D  A  +    P+H ++Q GHK+   LL+    D+ A+       +H   +  H  +  +L ++  +I S+   GY PLH AC  G+    K L+++  D+  + +    P+H A +      V+ L+++  +   +    + P+ ++
Sbjct:  622 NGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          

HSP 11 Score: 81.2629 bits (199), Expect = 3.723e-15
Identity = 48/222 (21.62%), Postives = 99/222 (44.59%), Query Frame = 2
Query:  113 REYLER------EDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLA 760
            R  LER      E  N+  P+H A      ++  LL++     +A  K    P+H A++    +    L+    D NA+      P+H + + GH  I  LLI++  D+ ++   G   +H   +      A++L ++  +I ++      P+H AC + +  +VK L+++  ++  + + +  P+H +        V+ L+++      +    Q P+ +A
Sbjct:  574 RLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          

HSP 12 Score: 55.0694 bits (131), Expect = 3.660e-7
Identity = 45/211 (21.33%), Postives = 92/211 (43.60%), Query Frame = 2
Query:  263 ASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            A++ G  + V  L+    DIN  +      +H A + GHS +V  LI     +++  + G   LH A  AG++    +L+++  ++  +      P++ A +     +VK L+ H  N     +    P+ ++        V +L+++    + R       +H+A     T    +L+ +  + +   + G +PL IA   G+E +  +L
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVR----LPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLL 246          
BLAST of SMED30005028 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 108.612 bits (270), Expect = 1.543e-23
Identity = 67/248 (27.02%), Postives = 119/248 (47.98%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            P+H A + G+T +  LL+     I++  K    P+H A+++GH + V LLV     I+A+ +    P+H A +  H      L+ H   ++        PLH A   G    AKLL+D   D  +R      P+H AC+  R  +V+LL+ +   IE+  +    P+H++        V  L+    + +      + P+HLA  A +T+ V++L+ +   ++   +   +PL IA + GN  ++ +L
Sbjct:  263 PLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILL 510          

HSP 2 Score: 105.145 bits (261), Expect = 1.855e-22
Identity = 61/229 (26.64%), Postives = 109/229 (47.60%), Query Frame = 2
Query:  131 EDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDI 817
            E +  + P+H A    QT++V++LI     ++A  +  Q P+H AS+ G+   V LL+    + NA    +  P+H A + G   +  +L+DH+ D     K G+ PLH A K G  E  +LL++    ++   K    P+H A  Y    +  LL+++  + ++  K    P+H++      E    L+  K D  A+      P+HL+      E   +L+++  D+
Sbjct:  454 ETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDV 682          

HSP 3 Score: 104.76 bits (260), Expect = 2.497e-22
Identity = 63/248 (25.40%), Postives = 120/248 (48.39%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            P+H A + GQ E+  +L+D+N D   L K    P+H AS+ G+ + V+LL+     ++   +    P+H A  + +  +  LL+++    ++  K GY PLH A K  + E A  L+    D  A+ +    P+H + +     I  LLI++  ++ ++       +HL          ++L ++  +I ++      P+H+AC+  +   VK LV++  D+ E  +   +PL  A + G+   +  L
Sbjct:  527 PLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYL 774          

HSP 4 Score: 102.064 bits (253), Expect = 1.548e-21
Identity = 75/281 (26.69%), Postives = 117/281 (41.64%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDH--KCDIEARDWW-------------------------------DQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            P+H A   G  ++V LL+     I A  K    P+H A+Q  H    + L+     ++        P+H A   GH  +  LL+D   D  SR   G+ PLH ACK  R +  +LL+ +   IEA  +    P+H A       IV  L+    N +        P+HL+     T+ V++LI +  K D +AR+                                 +  P+H+A    + E   IL+DH+ D     + G +PL +A K GN  ++ +L
Sbjct:  296 PLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLL 576          

HSP 5 Score: 100.908 bits (250), Expect = 3.804e-21
Identity = 70/266 (26.32%), Postives = 121/266 (45.49%), Query Frame = 2
Query:  122 LEREDLNKKR--PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHILNGVIYV 913
            LE +   K R   +H A ++  T    LL+    + +   K    P+H A+  GH+   +LL+    ++N +   +  P+H A + G + + NLL+     I+SR K    PLH A ++G  +   LL+     I A+ K    P+H A + +     + L+ H   ++        P+H++         KLL+D   D  +R      P+H+AC   R + V++L+ +   IE   + G +PL +A   G       +N VIY+
Sbjct:  185 LENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMG------AINIVIYL 444          

HSP 6 Score: 95.5153 bits (236), Expect = 1.684e-19
Identity = 57/248 (22.98%), Postives = 111/248 (44.76%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            P+H A + G  E+V+LL++    ++   K    P+H A+   + K   LL+       A  +    P+H A +     I + L+    D  ++ + G+ PLH + + G  E + LLI++  D+ A+       +H   + +   + ++L ++   I S+      P+H++C       VK L+++  D+  +      P+H A        V+ L+++     E    G +PL IA + G   ++  L
Sbjct:  560 PLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 7 Score: 92.4337 bits (228), Expect = 1.488e-18
Identity = 65/286 (22.73%), Postives = 125/286 (43.71%), Query Frame = 2
Query:  137 LNKKRPIHHACERGQTEIVKLLIDYNCDIEALDK---------------------------------WNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            LN   P+H AC++ + ++V+LL+ Y   IEA  +                                   + P+H A++      V++L+     ++A+    + P+H A   G++ IV LL+    +  +  +  Y PLH A K G+ E A +L+DH+ D     K    P+H A +Y    +V+LL++    ++   K    P+H++      +   LL+++    +A       P+H+A    + E    L+    D     + G +PL ++ + G++ +  +L
Sbjct:  390 LNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLL 675          

HSP 8 Score: 87.8113 bits (216), Expect = 3.251e-17
Identity = 60/250 (24.00%), Postives = 111/250 (44.40%), Query Frame = 2
Query:  146 KRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            + P+H A   G T+IV LL+    +  A  + N  P+H A++ G ++   +L+  + D     +    P+H A ++G+  +V LL++    ++   K    PLH A      + A LL+++    +A  K    P+H A +  +  I   L+    +  ++ +    P+HLS      E   LLI++  D+ A+       +HL          +IL ++  +I      G +PL +A   G   ++  L
Sbjct:  492 QTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFL 741          

HSP 9 Score: 86.6557 bits (213), Expect = 8.760e-17
Identity = 65/286 (22.73%), Postives = 119/286 (41.61%), Query Frame = 2
Query:  131 EDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLV-----------SLHC--------------------DINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            + +N   P++ A +    E+VK L+ +  +     +    P+  A Q GH + V +L+           +LH                     D+ ++  +   P+H A  +GH  +  LL++   ++  + +    PLH A K GR   A LL+     I++R K    P+HCA       +V LL+     I ++ K    P+H++  G   +  + L+ H+  ++        P+H+A +       K+L+D   D       G +PL IA K     ++ +L
Sbjct:  128 QSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGF--TPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELL 411          

HSP 10 Score: 83.1889 bits (204), Expect = 9.874e-16
Identity = 42/174 (24.14%), Postives = 82/174 (47.13%), Query Frame = 2
Query:  140 NKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLS 661
            N   P+H A ++ Q EI   L+ +  D  A  +    P+H ++Q GHK+   LL+    D+ A+       +H   +  H  +  +L ++  +I S+   GY PLH AC  G+    K L+++  D+  + +    P+H A +      V+ L+++  +   +    + P+ ++
Sbjct:  622 NGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          

HSP 11 Score: 80.8777 bits (198), Expect = 4.457e-15
Identity = 44/210 (20.95%), Postives = 95/210 (45.24%), Query Frame = 2
Query:  131 EDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLA 760
            E  N+  P+H A      ++  LL++     +A  K    P+H A++    +    L+    D NA+      P+H + + GH  I  LLI++  D+ ++   G   +H   +      A++L ++  +I ++      P+H AC + +  +VK L+++  ++  + + +  P+H +        V+ L+++      +    Q P+ +A
Sbjct:  586 EGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          

HSP 12 Score: 54.6842 bits (130), Expect = 4.392e-7
Identity = 45/211 (21.33%), Postives = 92/211 (43.60%), Query Frame = 2
Query:  263 ASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            A++ G  + V  L+    DIN  +      +H A + GHS +V  LI     +++  + G   LH A  AG++    +L+++  ++  +      P++ A +     +VK L+ H  N     +    P+ ++        V +L+++    + R       +H+A     T    +L+ +  + +   + G +PL IA   G+E +  +L
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVR----LPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLL 246          
BLAST of SMED30005028 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0334062)

HSP 1 Score: 123.635 bits (309), Expect = 5.529e-29
Identity = 69/248 (27.82%), Postives = 125/248 (50.40%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            P+H A + G+T +V LL++   +IEA  +    P+H A+++GH++ V +L+     I+A+ +    P+H A +  H     +L+ H   ++         LH A   G    AKLL+D + D  AR      P+H AC+  R  +V+LL+ H  +I +  +    P+H++    C   V  L+ H    +      + P+HLA  A +T+ ++IL+ +   ++   +   +PL IA + GN  ++ +L
Sbjct:  241 PLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLL 488          

HSP 2 Score: 112.079 bits (279), Expect = 3.574e-25
Identity = 70/266 (26.32%), Postives = 126/266 (47.37%), Query Frame = 2
Query:  122 LEREDLNKKR--PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHILNGVIYV 913
            LE +   K R   +H A ++   +   LL+D + + +   K    P+H AS  G++    LL+    D+N   + +  P+H A + G + +V+LL++   +IE++ + G  PLH A ++G  +   +L++    I A+ K    P+H A + E     ++L+ H   ++         +H++         KLL+D   D  AR      P+H+AC   R + V++L+ H   I    + G +PL +A   G       +N VIY+
Sbjct:  163 LESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMG------CMNIVIYL 422          

HSP 3 Score: 108.612 bits (270), Expect = 4.257e-24
Identity = 70/296 (23.65%), Postives = 125/296 (42.23%), Query Frame = 2
Query:   35 SNSEHYQCFIRAIRGGSIKLFHRFFKREYLEREDLNK-KRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLI-------------------------------DHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEEC 826
            SN+        A + G I +     +R  +      K    +H A   GQ E+VKLL+++N  +    +    P++ A+Q  H   V+LL+S   + +   E    P+  A + GH  +V +L+                               DH+ D+ S+   G+ PLH A   G    A LLI    D+    K +  P+H A ++ +  +V LL++   NIE++ +    P+H +      + V +L++    I A+      P+H+A   +  +  +IL+ H   ++E 
Sbjct:   40 SNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKS--GFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEV 333          

HSP 4 Score: 84.7297 bits (208), Expect = 1.782e-16
Identity = 55/244 (22.54%), Postives = 97/244 (39.75%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQN---------------------------------GHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTET 784
            P+H A   G  ++V +L++    I A  K    P+H A+Q                                  GH +  KLL+  + D NAR      P+H AC+     +V LL+ H   I +  + G  PLH A   G       L+ H    +      + P+H A    +  I+++L+ +   +++R +  + P+H++      + V LL+ H   ++A        +H+A    + E 
Sbjct:  274 PLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEV 517          

HSP 5 Score: 73.9442 bits (180), Expect = 3.728e-13
Identity = 59/277 (21.30%), Postives = 112/277 (40.43%), Query Frame = 2
Query:  164 ACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGH---------------------------------KKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            A   G  E V   +  N DI   +      +H AS++GH                                 ++ VKLL+  +  +N + +    P++ A +  H  +V LL+ +  +     + G+ PL  A + G  +   +L++     + R K     +H A + +      LL+D+  N +   K    P+H++          LLI    D+      +  P+H+A    +T  V +L++   +IE   + G +PL  A ++G+E ++ +L
Sbjct:   18 AARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLES----DTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDML 290          

HSP 6 Score: 62.3882 bits (150), Expect = 1.779e-9
Identity = 35/144 (24.31%), Postives = 66/144 (45.83%), Query Frame = 2
Query:  137 LNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACE 568
            LN   P+H AC++ + ++V+LL+ +   I A  +    P+H A+  G    V  L+      +        P+H A     + I+ +L+ +   +++R +    PLH A + G  +   LL+ H   ++A  K     +H A +
Sbjct:  368 LNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAK 511          
BLAST of SMED30005028 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303120)

HSP 1 Score: 121.709 bits (304), Expect = 7.232e-28
Identity = 69/248 (27.82%), Postives = 125/248 (50.40%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            P+H A + G+T +V LL++   +IEA  +    P+H A+++GH++ V +L+     I+A+ +    P+H A +  H     +L+ H   ++         LH A   G    AKLL+D + D  AR      P+H AC+  R  +V+LL+ H  +I +  +    P+H++    C   V  L+ H    +      + P+HLA  A +T+ ++IL+ +   ++   +   +PL IA + GN  ++ +L
Sbjct:  391 PLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLL 638          

HSP 2 Score: 110.923 bits (276), Expect = 1.418e-24
Identity = 70/266 (26.32%), Postives = 126/266 (47.37%), Query Frame = 2
Query:  122 LEREDLNKKR--PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHILNGVIYV 913
            LE +   K R   +H A ++   +   LL+D + + +   K    P+H AS  G++    LL+    D+N   + +  P+H A + G + +V+LL++   +IE++ + G  PLH A ++G  +   +L++    I A+ K    P+H A + E     ++L+ H   ++         +H++         KLL+D   D  AR      P+H+AC   R + V++L+ H   I    + G +PL +A   G       +N VIY+
Sbjct:  313 LESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMG------CMNIVIYL 572          

HSP 3 Score: 107.071 bits (266), Expect = 2.648e-23
Identity = 70/296 (23.65%), Postives = 125/296 (42.23%), Query Frame = 2
Query:   35 SNSEHYQCFIRAIRGGSIKLFHRFFKREYLEREDLNK-KRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLI-------------------------------DHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEEC 826
            SN+        A + G I +     +R  +      K    +H A   GQ E+VKLL+++N  +    +    P++ A+Q  H   V+LL+S   + +   E    P+  A + GH  +V +L+                               DH+ D+ S+   G+ PLH A   G    A LLI    D+    K +  P+H A ++ +  +V LL++   NIE++ +    P+H +      + V +L++    I A+      P+H+A   +  +  +IL+ H   ++E 
Sbjct:  190 SNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKS--GFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEV 483          

HSP 4 Score: 82.8037 bits (203), Expect = 8.968e-16
Identity = 56/251 (22.31%), Postives = 108/251 (43.03%), Query Frame = 2
Query:   68 AIRGGSIKLFHRFFKREY-LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTET----VKILVDH 805
            A R G  ++     +R   +  +  N   P+H A +    +  ++L+ +   ++ +       +H A+  GH +  KLL+  + D NAR      P+H AC+     +V LL+ H   I +  + G  PLH A   G       L+ H    +      + P+H A    +  I+++L+ +   +++R +  + P+H++      + V LL+ H   ++A        +H+A    + E      K + DH
Sbjct:  428 AARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVKDLIAKKITDH 678          

HSP 5 Score: 73.559 bits (179), Expect = 6.411e-13
Identity = 59/277 (21.30%), Postives = 112/277 (40.43%), Query Frame = 2
Query:  164 ACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGH---------------------------------KKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            A   G  E V   +  N DI   +      +H AS++GH                                 ++ VKLL+  +  +N + +    P++ A +  H  +V LL+ +  +     + G+ PL  A + G  +   +L++     + R K     +H A + +      LL+D+  N +   K    P+H++          LLI    D+      +  P+H+A    +T  V +L++   +IE   + G +PL  A ++G+E ++ +L
Sbjct:  168 AARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLES----DTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDML 440          
BLAST of SMED30005028 vs. Ensembl Fly
Match: Tnks (gene:FBgn0027508 transcript:FBtr0084890)

HSP 1 Score: 114.005 bits (284), Expect = 3.521e-25
Identity = 76/293 (25.94%), Postives = 127/293 (43.34%), Query Frame = 2
Query:    8 VILINI-FIMSNSEHYQCFIRAIRGGSIKLFHRFFKREYLEREDL--NKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRA------------ETAK---------LLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCD 814
            ++ +N+  +M+N    + F  A + G I    +    + +   D    K  P+H A   G+ E+V+ L++    I+A D+    P+H     GH + V+LL+      N  D W+  P+H A   G   +   L+ H  +   R+     PL  A +A R             E A+         LL   + +  A D     P+H A  Y R GIV++L+ +  ++ ++DK    P+H +CS    +  KLLI    ++ A D W   P+H A +  R E   +L+    D
Sbjct:   10 ILSVNLDAVMANDPLRELF-EACKTGEIAKVKKLITPQTVNARDTAGRKSTPLHFAAGYGRREVVEFLLNSGASIQACDEGGLHPLHNCCSFGHAEVVRLLLKAGASPNTTDNWNYTPLHEAASKGKVDVCLALLQHGANHTIRNSEQKTPLELADEATRPVLTGEYRKDELLEAARSGAEDRLLALLTPLNVNCHASDGRRSTPLHLAAGYNRIGIVEILLANGADVHAKDKGGLVPLHNACSYGHFDVTKLLIQAGANVNANDLWAFTPLHEAASKSRVEVCSLLLSRGAD 301          

HSP 2 Score: 108.997 bits (271), Expect = 1.059e-23
Identity = 66/257 (25.68%), Postives = 110/257 (42.80%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRP---------------------LHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIA 859
            P+H A    +  +V+ L+++  ++ A DK    P+H A   GH +  +LLV    ++N  D W   P+H A   G   I  LL+ H  D   +++ G  P                     L  A K   A   +L+     +       +  P+H A  Y      + L+++  ++ ++DK    P+H + S    +   LLI HK  + A D W   P+H A    RT+   +L+ H  D    +Q G +P+E+A
Sbjct:  523 PLHFAAGFNRVPVVQFLLEHGAEVYAADKGGLVPLHNACSYGHYEVTELLVKHGANVNVSDLWKFTPLHEAAAKGKYDICKLLLKHGADPMKKNRDGATPADLVKESDHDVAELLRGPSALLDAAKKGNLARVQRLVTPESINCRDAQGRNSTPLHLAAGYNNFECAEYLLENGADVNAQDKGGLIPLHNASSYGHLDIAALLIKHKTVVNATDKWGFTPLHEAAQKGRTQLCSLLLAHGADAYMKNQEGQTPIELA 779          

HSP 3 Score: 93.5893 bits (231), Expect = 6.755e-19
Identity = 67/264 (25.38%), Postives = 116/264 (43.94%), Query Frame = 2
Query:  149 RPIHHACERGQTEIVKLLIDYNCDIEALDKWNQR--PIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCA-----------------CEYERAG----IVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPL-EIAMKT 868
            R +  AC+ G+   VK LI     + A D   ++  P+H+A+  G ++ V+ L++    I A DE    P+H  C  GH+ +V LL+       + D   Y PLH A   G+ +    L+ H  +   R+   + P+  A                  E  R+G    ++ LL   + N  + D     P+HL+        V++L+ +  D+ A+D     P+H AC+    +  K+L+    ++   D +  +PL E A K+
Sbjct:   25 RELFEACKTGEIAKVKKLITPQT-VNARDTAGRKSTPLHFAAGYGRREVVEFLLNSGASIQACDEGGLHPLHNCCSFGHAEVVRLLLKAGASPNTTDNWNYTPLHEAASKGKVDVCLALLQHGANHTIRNSEQKTPLELADEATRPVLTGEYRKDELLEAARSGAEDRLLALLTPLNVNCHASDGRRSTPLHLAAGYNRIGIVEILLANGADVHAKDKGGLVPLHNACSYGHFDVTKLLIQAGANVNANDLWAFTPLHEAASKS 287          

HSP 4 Score: 83.9593 bits (206), Expect = 5.538e-16
Identity = 60/243 (24.69%), Postives = 114/243 (46.91%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETA-KLLIDHHCDIEARDKWDQR---PIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKT 868
            P+H A E    + +++L+     + ALD   Q P+H  +++  ++ V+LL+S   D N            A +      V  L+ +  D E+        L  A KAG  +T  ++++++   +  RD  D R   P+H A  + R  +V+ L++H   + + DK    P+H +CS    E  +LL+ H  ++   D W   P+H A    + +  K+L+ H  D  + ++ G +P ++  ++
Sbjct:  402 PLHLAAELLHYDAMEVLLKQGAKVNALDSLGQTPLHRCARD--EQAVRLLLSYAADTNIVSLEGLTAAQLASDS-----VLKLLKNPPDSETH-------LLEAAKAGDLDTVRRIVLNNPISVNCRD-LDGRHSTPLHFAAGFNRVPVVQFLLEHGAEVYAADKGGLVPLHNACSYGHYEVTELLVKHGANVNVSDLWKFTPLHEAAAKGKYDICKLLLKHGADPMKKNRDGATPADLVKES 629          

HSP 5 Score: 80.1073 bits (196), Expect = 8.913e-15
Identity = 74/322 (22.98%), Postives = 118/322 (36.65%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYAS--------------------QNGHKKT----------------------------------VKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHC-----NIESRDKWNRRP-------IHLSCSGCCTETVKLLID--HKCDIE-------------ARDWWDQRPIHLAC---NAKRTETVKILVDHHCDIEECDQFGNSPLEIAMK 865
            P+H+ C  G  E+V+LL+         D WN  P+H A+                    +N  +KT                                  + LL  L+ + +A D     P+H A  +   GIV +L+ +  D+ ++DK G  PLH AC  G  +  KLLI    ++ A D W   P+H A    R  +  LL+         N  S+   +  P       I     G C      L+D   KCD+                 +    P+HLA    + KR + +++L      + E ++   +PL +A +
Sbjct:   93 PLHNCCSFGHAEVVRLLLKAGASPNTTDNWNYTPLHEAASKGKVDVCLALLQHGANHTIRNSEQKTPLELADEATRPVLTGEYRKDELLEAARSGAEDRLLALLTPLNVNCHASDGRRSTPLHLAAGYNRIGIVEILLANGADVHAKDKGGLVPLHNACSYGHFDVTKLLIQAGANVNANDLWAFTPLHEAASKSRVEVCSLLLSRGADPTLLNCHSKSAIDAAPTRELRERIAFEYKGHC------LLDACRKCDVSRAKKLVCAEIVNFVHPYTGDTPLHLAVVSPDGKRKQLMELLTRKGSLLNEKNKAFLTPLHLAAE 408          

HSP 6 Score: 79.337 bits (194), Expect = 1.671e-14
Identity = 55/201 (27.36%), Postives = 90/201 (44.78%), Query Frame = 2
Query:  131 EDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHY--------------------ASQNGHKKTVKLLVSLHCDINARDEWDR--VPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCS 667
             DL K  P+H A  +G+ +I KLL+ +  D    ++    P                       A++ G+   V+ LV+    IN RD   R   P+H A  + +      L+++  D+ ++DK G  PLH A   G  + A LLI H   + A DKW   P+H A +  R  +  LL+ H  +   +++  + PI L+ +
Sbjct:  582 SDLWKFTPLHEAAAKGKYDICKLLLKHGADPMKKNRDGATPADLVKESDHDVAELLRGPSALLDAAKKGNLARVQRLVTPES-INCRDAQGRNSTPLHLAAGYNNFECAEYLLENGADVNAQDKGGLIPLHNASSYGHLDIAALLIKHKTVVNATDKWGFTPLHEAAQKGRTQLCSLLLAHGADAYMKNQEGQTPIELATA 781          

HSP 7 Score: 75.0998 bits (183), Expect = 2.850e-13
Identity = 57/245 (23.27%), Postives = 98/245 (40.00%), Query Frame = 2
Query:  188 IVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIE-------SRDK--------------WNRRPIHL---SCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPL 850
            ++ LL   N +  A D     P+H A+       V++L++   D++A+D+   VP+H AC +GH  +  LLI    ++ + D   + PLH A    R E   LL+    D    +   +  I  A   E    +      HC ++       SR K                  P+HL   S  G   + ++LL      +  ++     P+HLA      + +++L+     +   D  G +PL
Sbjct:  192 LLALLTPLNVNCHASDGRRSTPLHLAAGYNRIGIVEILLANGADVHAKDKGGLVPLHNACSYGHFDVTKLLIQAGANVNANDLWAFTPLHEAASKSRVEVCSLLLSRGADPTLLNCHSKSAIDAAPTRELRERIAFEYKGHCLLDACRKCDVSRAKKLVCAEIVNFVHPYTGDTPLHLAVVSPDGKRKQLMELLTRKGSLLNEKNKAFLTPLHLAAELLHYDAMEVLLKQGAKVNALDSLGQTPL 436          

HSP 8 Score: 67.3958 bits (163), Expect = 6.971e-11
Identity = 37/140 (26.43%), Postives = 62/140 (44.29%), Query Frame = 2
Query:   53 QCFIRAIRGGSIKLFHRFFKREYLEREDLNKKR--PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYAC 466
               + A + G++    R    E +   D   +   P+H A      E  + L++   D+ A DK    P+H AS  GH     LL+     +NA D+W   P+H A + G + + +LL+ H  D   +++ G  P+  A 
Sbjct:  641 SALLDAAKKGNLARVQRLVTPESINCRDAQGRNSTPLHLAAGYNNFECAEYLLENGADVNAQDKGGLIPLHNASSYGHLDIAALLIKHKTVVNATDKWGFTPLHEAAQKGRTQLCSLLLAHGADAYMKNQEGQTPIELAT 780          
BLAST of SMED30005028 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303119)

HSP 1 Score: 111.694 bits (278), Expect = 1.713e-24
Identity = 70/266 (26.32%), Postives = 126/266 (47.37%), Query Frame = 2
Query:  122 LEREDLNKKR--PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHILNGVIYV 913
            LE +   K R   +H A ++   +   LL+D + + +   K    P+H AS  G++    LL+    D+N   + +  P+H A + G + +V+LL++   +IE++ + G  PLH A ++G  +   +L++    I A+ K    P+H A + E     ++L+ H   ++         +H++         KLL+D   D  AR      P+H+AC   R + V++L+ H   I    + G +PL +A   G       +N VIY+
Sbjct:  163 LESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMG------CMNIVIYL 422          

HSP 2 Score: 110.538 bits (275), Expect = 4.021e-24
Identity = 62/251 (24.70%), Postives = 110/251 (43.82%), Query Frame = 2
Query:  143 KKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            ++ P+H A   G  +IV LL+ +   ++A  K     +H A++ G  +   +L+     ++A  +    P+H   ++GH  +  LL+    D++++ K G  PLH AC     + A LL++      A  K    P+H A    +  I   L+++     +  K    P+HLS      E   LLI+HK  +         P+HL          +IL  +  +I+   + G +PL +A   G   ++  L
Sbjct:  469 QQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFL 719          

HSP 3 Score: 109.768 bits (273), Expect = 7.624e-24
Identity = 59/248 (23.79%), Postives = 116/248 (46.77%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            P+H A    QT+I+++L+     ++A  +  Q P+H AS+ G+   V LL+     ++A  +     +H A + G   +  +LI++   +++  K G+ PLH   K G  + A+LL+    D++A+ K    P+H AC Y    +  LL++   +  +  K    P+H++      +    L+++     A       P+HL+      E   +L++H   +    + G +P+ +  +  N  +  IL
Sbjct:  439 PLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEIL 686          

HSP 4 Score: 107.842 bits (268), Expect = 2.350e-23
Identity = 70/296 (23.65%), Postives = 125/296 (42.23%), Query Frame = 2
Query:   35 SNSEHYQCFIRAIRGGSIKLFHRFFKREYLEREDLNK-KRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLI-------------------------------DHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEEC 826
            SN+        A + G I +     +R  +      K    +H A   GQ E+VKLL+++N  +    +    P++ A+Q  H   V+LL+S   + +   E    P+  A + GH  +V +L+                               DH+ D+ S+   G+ PLH A   G    A LLI    D+    K +  P+H A ++ +  +V LL++   NIE++ +    P+H +      + V +L++    I A+      P+H+A   +  +  +IL+ H   ++E 
Sbjct:   40 SNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKS--GFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEV 333          

HSP 5 Score: 107.457 bits (267), Expect = 3.854e-23
Identity = 61/248 (24.60%), Postives = 116/248 (46.77%), Query Frame = 2
Query:  155 IHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHILN 898
            +H A + GQ E+  +LI+    ++A  K    P+H  ++ GH K  +LL+    D++A+ +    P+H AC + +  +  LL++      +  K G+ PLH A +  + + A  L+++     A  K    P+H + +   A I  LLI+H   +    K    P+HL          ++L  +  +I+        P+H+A +  +   V+ L+ +  +++     G +PL    +T  +G  HI+N
Sbjct:  506 LHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLH---QTAQQGHCHIVN 750          

HSP 6 Score: 102.834 bits (255), Expect = 1.044e-21
Identity = 56/228 (24.56%), Postives = 103/228 (45.18%), Query Frame = 2
Query:   80 GSIKLFHRFFKREY-LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLA 760
            G IK+     ++E  ++ +  N   P+H AC     ++  LL++      A  K    P+H A++         L+      NA  +    P+H + + GH+ I NLLI+H   +    K G  P+H   +      A++L  +  +I+   K    P+H A  + +A +V+ L+ +  N+++       P+H +        V LL++HK +  A+    Q P+H+A
Sbjct:  546 GHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIA 773          

HSP 7 Score: 99.7525 bits (247), Expect = 8.930e-21
Identity = 61/235 (25.96%), Postives = 105/235 (44.68%), Query Frame = 2
Query:  155 IHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIA 859
            +H A   G   + KLL+D N D  A       P+H A +    K V+LL+     I+A  E    P+H A   G   IV  L+ H    +     G  PLH A +A + +  ++L+ +   ++AR +  Q P+H A       IV LL+ H   +++  K     +H++      E   +LI++   ++A       P+HL       +  ++L+    D++   + G +PL +A
Sbjct:  341 LHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVA 575          

HSP 8 Score: 98.9821 bits (245), Expect = 1.379e-20
Identity = 56/248 (22.58%), Postives = 116/248 (46.77%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            P+H A   G   IV  L+ ++   +      + P+H A++      +++L+     ++AR    + P+H A   G+  IV LL+ H   +++  K  Y  LH A K G+ E A +LI++   ++A  K    P+H   +Y    + +LL+    +++++ K    P+H++C     +   LL++      A       P+H+A    + +    L+++        + G +PL ++ + G+  + ++L
Sbjct:  406 PLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLL 653          

HSP 9 Score: 98.5969 bits (244), Expect = 1.906e-20
Identity = 61/273 (22.34%), Postives = 112/273 (41.03%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQN---------------------------------GHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTG 871
            P+H A   G  ++V +L++    I A  K    P+H A+Q                                  GH +  KLL+  + D NAR      P+H AC+     +V LL+ H   I +  + G  PLH A   G       L+ H    +      + P+H A    +  I+++L+ +   +++R +  + P+H++      + V LL+ H   ++A        +H+A    + E   +L+++   ++   + G +PL +  K G
Sbjct:  274 PLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYG 546          

HSP 10 Score: 97.4413 bits (241), Expect = 4.542e-20
Identity = 55/243 (22.63%), Postives = 114/243 (46.91%), Query Frame = 2
Query:  137 LNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMK 865
            LN   P+H AC++ + ++V+LL+ +   I A  +    P+H A+  G    V  L+      +        P+H A     + I+ +L+ +   +++R +    PLH A + G  +   LL+ H   ++A  K     +H A +  +  +  +LI++   +++  K    P+HL+      +  +LL+  + D++A+      P+H+AC+    +   +L++         + G++PL IA +
Sbjct:  368 LNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAAR 610          

HSP 11 Score: 73.9442 bits (180), Expect = 7.389e-13
Identity = 59/277 (21.30%), Postives = 112/277 (40.43%), Query Frame = 2
Query:  164 ACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGH---------------------------------KKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            A   G  E V   +  N DI   +      +H AS++GH                                 ++ VKLL+  +  +N + +    P++ A +  H  +V LL+ +  +     + G+ PL  A + G  +   +L++     + R K     +H A + +      LL+D+  N +   K    P+H++          LLI    D+      +  P+H+A    +T  V +L++   +IE   + G +PL  A ++G+E ++ +L
Sbjct:   18 AARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLES----DTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDML 290          

HSP 12 Score: 61.6178 bits (148), Expect = 4.503e-9
Identity = 31/112 (27.68%), Postives = 52/112 (46.43%), Query Frame = 2
Query:  140 NKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAG 475
            N   P+H   +     + ++L     +I+   K    P+H AS  G    V+ L+    +++A       P+H+  + GH  IVNLL++H  +  ++   G  PLH A K G
Sbjct:  666 NGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLG 777          
BLAST of SMED30005028 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0334061)

HSP 1 Score: 111.309 bits (277), Expect = 2.475e-24
Identity = 70/266 (26.32%), Postives = 126/266 (47.37%), Query Frame = 2
Query:  122 LEREDLNKKR--PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHILNGVIYV 913
            LE +   K R   +H A ++   +   LL+D + + +   K    P+H AS  G++    LL+    D+N   + +  P+H A + G + +V+LL++   +IE++ + G  PLH A ++G  +   +L++    I A+ K    P+H A + E     ++L+ H   ++         +H++         KLL+D   D  AR      P+H+AC   R + V++L+ H   I    + G +PL +A   G       +N VIY+
Sbjct:  313 LESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMG------CMNIVIYL 572          

HSP 2 Score: 110.153 bits (274), Expect = 5.800e-24
Identity = 62/251 (24.70%), Postives = 110/251 (43.82%), Query Frame = 2
Query:  143 KKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            ++ P+H A   G  +IV LL+ +   ++A  K     +H A++ G  +   +L+     ++A  +    P+H   ++GH  +  LL+    D++++ K G  PLH AC     + A LL++      A  K    P+H A    +  I   L+++     +  K    P+HLS      E   LLI+HK  +         P+HL          +IL  +  +I+   + G +PL +A   G   ++  L
Sbjct:  619 QQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFL 869          

HSP 3 Score: 108.997 bits (271), Expect = 1.314e-23
Identity = 59/248 (23.79%), Postives = 116/248 (46.77%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            P+H A    QT+I+++L+     ++A  +  Q P+H AS+ G+   V LL+     ++A  +     +H A + G   +  +LI++   +++  K G+ PLH   K G  + A+LL+    D++A+ K    P+H AC Y    +  LL++   +  +  K    P+H++      +    L+++     A       P+HL+      E   +L++H   +    + G +P+ +  +  N  +  IL
Sbjct:  589 PLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEIL 836          

HSP 4 Score: 107.071 bits (266), Expect = 4.476e-23
Identity = 61/248 (24.60%), Postives = 116/248 (46.77%), Query Frame = 2
Query:  155 IHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHILN 898
            +H A + GQ E+  +LI+    ++A  K    P+H  ++ GH K  +LL+    D++A+ +    P+H AC + +  +  LL++      +  K G+ PLH A +  + + A  L+++     A  K    P+H + +   A I  LLI+H   +    K    P+HL          ++L  +  +I+        P+H+A +  +   V+ L+ +  +++     G +PL    +T  +G  HI+N
Sbjct:  656 LHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLH---QTAQQGHCHIVN 900          

HSP 5 Score: 107.071 bits (266), Expect = 4.751e-23
Identity = 70/296 (23.65%), Postives = 125/296 (42.23%), Query Frame = 2
Query:   35 SNSEHYQCFIRAIRGGSIKLFHRFFKREYLEREDLNK-KRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLI-------------------------------DHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEEC 826
            SN+        A + G I +     +R  +      K    +H A   GQ E+VKLL+++N  +    +    P++ A+Q  H   V+LL+S   + +   E    P+  A + GH  +V +L+                               DH+ D+ S+   G+ PLH A   G    A LLI    D+    K +  P+H A ++ +  +V LL++   NIE++ +    P+H +      + V +L++    I A+      P+H+A   +  +  +IL+ H   ++E 
Sbjct:  190 SNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKS--GFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEV 483          

HSP 6 Score: 102.449 bits (254), Expect = 1.126e-21
Identity = 56/228 (24.56%), Postives = 103/228 (45.18%), Query Frame = 2
Query:   80 GSIKLFHRFFKREY-LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLA 760
            G IK+     ++E  ++ +  N   P+H AC     ++  LL++      A  K    P+H A++         L+      NA  +    P+H + + GH+ I NLLI+H   +    K G  P+H   +      A++L  +  +I+   K    P+H A  + +A +V+ L+ +  N+++       P+H +        V LL++HK +  A+    Q P+H+A
Sbjct:  696 GHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIA 923          

HSP 7 Score: 98.5969 bits (244), Expect = 2.030e-20
Identity = 62/252 (24.60%), Postives = 111/252 (44.05%), Query Frame = 2
Query:  104 FFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIA 859
             + R  ++   ++    +H A   G   + KLL+D N D  A       P+H A +    K V+LL+     I+A  E    P+H A   G   IV  L+ H    +     G  PLH A +A + +  ++L+ +   ++AR +  Q P+H A       IV LL+ H   +++  K     +H++      E   +LI++   ++A       P+HL       +  ++L+    D++   + G +PL +A
Sbjct:  474 LYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVA 725          

HSP 8 Score: 98.2117 bits (243), Expect = 2.511e-20
Identity = 56/248 (22.58%), Postives = 116/248 (46.77%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            P+H A   G   IV  L+ ++   +      + P+H A++      +++L+     ++AR    + P+H A   G+  IV LL+ H   +++  K  Y  LH A K G+ E A +LI++   ++A  K    P+H   +Y    + +LL+    +++++ K    P+H++C     +   LL++      A       P+H+A    + +    L+++        + G +PL ++ + G+  + ++L
Sbjct:  556 PLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLL 803          

HSP 9 Score: 97.4413 bits (241), Expect = 5.042e-20
Identity = 61/273 (22.34%), Postives = 112/273 (41.03%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQN---------------------------------GHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTG 871
            P+H A   G  ++V +L++    I A  K    P+H A+Q                                  GH +  KLL+  + D NAR      P+H AC+     +V LL+ H   I +  + G  PLH A   G       L+ H    +      + P+H A    +  I+++L+ +   +++R +  + P+H++      + V LL+ H   ++A        +H+A    + E   +L+++   ++   + G +PL +  K G
Sbjct:  424 PLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYG 696          

HSP 10 Score: 96.2857 bits (238), Expect = 8.837e-20
Identity = 55/243 (22.63%), Postives = 114/243 (46.91%), Query Frame = 2
Query:  137 LNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMK 865
            LN   P+H AC++ + ++V+LL+ +   I A  +    P+H A+  G    V  L+      +        P+H A     + I+ +L+ +   +++R +    PLH A + G  +   LL+ H   ++A  K     +H A +  +  +  +LI++   +++  K    P+HL+      +  +LL+  + D++A+      P+H+AC+    +   +L++         + G++PL IA +
Sbjct:  518 LNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAAR 760          

HSP 11 Score: 73.559 bits (179), Expect = 9.191e-13
Identity = 59/277 (21.30%), Postives = 112/277 (40.43%), Query Frame = 2
Query:  164 ACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGH---------------------------------KKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            A   G  E V   +  N DI   +      +H AS++GH                                 ++ VKLL+  +  +N + +    P++ A +  H  +V LL+ +  +     + G+ PL  A + G  +   +L++     + R K     +H A + +      LL+D+  N +   K    P+H++          LLI    D+      +  P+H+A    +T  V +L++   +IE   + G +PL  A ++G+E ++ +L
Sbjct:  168 AARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLES----DTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDML 440          

HSP 12 Score: 60.8474 bits (146), Expect = 6.515e-9
Identity = 31/112 (27.68%), Postives = 52/112 (46.43%), Query Frame = 2
Query:  140 NKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAG 475
            N   P+H   +     + ++L     +I+   K    P+H AS  G    V+ L+    +++A       P+H+  + GH  IVNLL++H  +  ++   G  PLH A K G
Sbjct:  816 NGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLG 927          
BLAST of SMED30005028 vs. Ensembl Zebrafish
Match: ankrd52a (ankyrin repeat domain 52a [Source:NCBI gene;Acc:553206])

HSP 1 Score: 127.487 bits (319), Expect = 2.882e-29
Identity = 73/266 (27.44%), Postives = 134/266 (50.38%), Query Frame = 2
Query:   86 IKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGL 883
            +KLF    K++ +   D  ++ P+H A   G   I+ LLI    ++ A D     P+H A+ + +++ V LL+    D+ ARD++ + P+H A  +  +  V  L+ H   +   D+ G  PLH+A ++G  E  KLL++   ++ A DK D++PIH A       +VKLL+    +   +DK    P+H + +    + VK L+ +  +I+  + +    +H+AC   +      LV+   ++ + +  G +PL +A  + N  L
Sbjct:   24 VKLF--LHKKDEVNALDQERRTPLHAAAWLGDVHIMDLLISAGANVNAKDHVWLTPLHRAAASRNERAVGLLLRKGADVTARDKYWQTPLHIAAANRATRCVETLLPHVSSLNMADRTGRAPLHHAAQSGYQEMVKLLLNKGANLSASDKKDRQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLHAAAASGHVDVVKYLLRNGAEIDEPNAFGNTALHVACYTGQEAVANELVNRGANVNQPNHRGYTPLHLAAVSTNGAL 287          

HSP 2 Score: 121.709 bits (304), Expect = 1.604e-27
Identity = 73/250 (29.20%), Postives = 124/250 (49.60%), Query Frame = 2
Query:  134 DLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGL 883
            +++ + P+  A      + VKL +    ++ ALD+  + P+H A+  G    + LL+S   ++NA+D     P+HRA    +   V LL+    D+ +RDK    PLH A         + L+ H   +   D+  + P+H A +     +VKLL++   N+ + DK +R+PIH +      E VKLL+    D   +D     P+H A  +   + VK L+ +  +I+E + FGN+ L +A  TG E +
Sbjct:    5 NISDQPPLVQAIFNRNADEVKLFLHKKDEVNALDQERRTPLHAAAWLGDVHIMDLLISAGANVNAKDHVWLTPLHRAAASRNERAVGLLLRKGADVTARDKYWQTPLHIAAANRATRCVETLLPHVSSLNMADRTGRAPLHHAAQSGYQEMVKLLLNKGANLSASDKKDRQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLHAAAASGHVDVVKYLLRNGAEIDEPNAFGNTALHVACYTGQEAV 254          

HSP 3 Score: 101.679 bits (252), Expect = 2.859e-21
Identity = 78/347 (22.48%), Postives = 134/347 (38.62%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPI---------------------------------HRACEHGHSGIVN----------------------------------LLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHC-------------------------------------NIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPL 850
            L   D   + P+HHA + G  E+VKLL++   ++ A DK +++PIH+A+  GH + VKLLVS   D + +D+    P+                                 H AC  G   + N                                  LL+++  D+  + K G  PLH A   GR   +++LI +  +I+  D++   P+H A +Y    ++  L+ +                                       +I + D + R  +H + SG   E + LL+    D+  +D + + P+H A    R + V +LV    ++ E D+ G +PL
Sbjct:  133 LNMADRTGRAPLHHAAQSGYQEMVKLLLNKGANLSASDKKDRQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLHAAAASGHVDVVKYLLRNGAEIDEPNAFGNTALHVACYTGQEAVANELVNRGANVNQPNHRGYTPLHLAAVSTNGALCLELLVNNGADVNMQSKEGKSPLHMAAIHGRFTRSQILIQNGGEIDCVDRYGNTPLHVAAKYGHELLISTLMTNGADTASFETSDKQIVCVFAGQLYSIVLSMSKEHVLSAGFDINTPDNFGRTCLHAAASGGNIECLNLLLSSGADMNKKDKFGRTPLHYAAANGRYQCVVVLVGAGAEVNERDRSGCTPL 479          

HSP 4 Score: 77.0258 bits (188), Expect = 8.990e-14
Identity = 64/250 (25.60%), Postives = 112/250 (44.80%), Query Frame = 2
Query:  134 DLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQR----PIHYASQNGHKKTVKLLVSLH-CDINARDEWDRVPIHRACEHGHSGIVNLLIDHH-CD--IESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDH-HCNIESRDKWNRRPIHLSCSGC---CTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSP 847
            D   +  +H A   G  +I+  L+      +  D    R    P H+A+ +GH+  +++L+ L  C I   + +   P+H A  +GHSG   LL++   C+  +  RD  G  PLH A  A      +L++    DI+A D   +  +  A +Y ++G V LL+     ++   D      +HL+CS     C   +   I +   I A +   Q P+H+A        V+ L++    +   D+ G++P
Sbjct:  731 DFQGRSALHLAASCGHADILSNLLSAADHSQPQDPLTDRHGYTPAHWAAYHGHEDCLEVLLELKPCSIQEGNPF--TPLHCALINGHSGSAELLLESSVCNSLVNIRDAKGRTPLHAAAVAEDVAGLQLVLRQGADIDAVDHSGRSALMVAADYGQSGAVALLLHRAKADLSLLDVNKNTALHLACSKAHEMCAMLILKEIHNPILINATNSMLQMPLHIAARNGLATVVQALLNRGATVLAVDEEGHTP 978          

HSP 5 Score: 76.6406 bits (187), Expect = 1.387e-13
Identity = 66/311 (21.22%), Postives = 123/311 (39.55%), Query Frame = 2
Query:  146 KRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLV-------------------------------------SLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCAC----------------------EYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDI--EARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            K P+H A   G+    ++LI    +I+ +D++   P+H A++ GH+  +  L+                                     S   DIN  D + R  +H A   G+   +NLL+    D+  +DK G  PLHYA   GR +   +L+    ++  RD+    P+H +                       E E    V+ L+D+  +    +      +H + +    + ++LL++   +   +        P+HLA  +   E V +L++    ++ CD  G S L +A + G+   + +L
Sbjct:  307 KSPLHMAAIHGRFTRSQILIQNGGEIDCVDRYGNTPLHVAAKYGHELLISTLMTNGADTASFETSDKQIVCVFAGQLYSIVLSMSKEHVLSAGFDINTPDNFGRTCLHAAASGGNIECLNLLLSSGADMNKKDKFGRTPLHYAAANGRYQCVVVLVGAGAEVNERDRSGCTPLHYSAASTAFCRTDRPHASTHQNQEDGEKESFLCVEHLLDNGADPCLCNTKGYSAVHYAAAHGNKQNLELLLEMCFNTLGDKESNGSISPLHLAVESGHWECVTVLIESGACVDVCDPVGRSVLYLASQRGHSRCVELL 617          

HSP 6 Score: 76.2554 bits (186), Expect = 1.775e-13
Identity = 67/268 (25.00%), Postives = 120/268 (44.78%), Query Frame = 2
Query:  125 EREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCD---INARDEWDRVPIHRACEHGHSGIVNLLI--DHHCD-IESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQR----PIHLACNAKRTETVKILVD-HHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            ++E      P+H A E G  E V +LI+    ++  D   +  ++ ASQ GH + V+LL+S          R +W   P+H A  +GHS  + +L+  +   D +   D  G  PL  A   G  +   LL++     + +D+  +  +H      R   +  L+ H+ ++ SRD   R  +HL+ S    + +  L+      + +D    R    P H A      + +++L++   C I+E + F  +PL  A+  G+ G   +L
Sbjct:  559 DKESNGSISPLHLAVESGHWECVTVLIESGACVDVCDPVGRSVLYLASQRGHSRCVELLLSQSASCLLAEHRSKWG--PLHVAAANGHSECLRMLLCSEGGADLVNVTDAEGQTPLMLAVLGGHTDCVHLLLERGACPDMKDRRGRTALHRGAVMGREDCLTALLSHNVSVLSRDFQGRSALHLAASCGHADILSNLLSAADHSQPQDPLTDRHGYTPAHWAAYHGHEDCLEVLLELKPCSIQEGNPF--TPLHCALINGHSGSAELL 822          

HSP 7 Score: 75.8702 bits (185), Expect = 2.122e-13
Identity = 65/269 (24.16%), Postives = 118/269 (43.87%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVKLLI--DYNCD-IEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQR----PIHCACEYERAGIVKLLID-HHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHK-CD--IEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            L  E  +K  P+H A   G +E +++L+  +   D +   D   Q P+  A   GH   V LL+      + +D   R  +HR    G    +  L+ H+  + SRD  G   LH A   G A+    L+      + +D    R    P H A  +     +++L++   C+I+  + +   P+H +     + + +LL++   C+  +  RD   + P+H A  A+    +++++    DI+  D  G S L +A   G  G + +L
Sbjct:  625 LLAEHRSKWGPLHVAAANGHSECLRMLLCSEGGADLVNVTDAEGQTPLMLAVLGGHTDCVHLLLERGACPDMKDRRGRTALHRGAVMGREDCLTALLSHNVSVLSRDFQGRSALHLAASCGHADILSNLLSAADHSQPQDPLTDRHGYTPAHWAAYHGHEDCLEVLLELKPCSIQEGNPFT--PLHCALINGHSGSAELLLESSVCNSLVNIRDAKGRTPLHAAAVAEDVAGLQLVLRQGADIDAVDHSGRSALMVAADYGQSGAVALL 891          

HSP 8 Score: 59.6918 bits (143), Expect = 1.927e-8
Identity = 66/293 (22.53%), Postives = 123/293 (41.98%), Query Frame = 2
Query:   56 CFIRAIRGGSIKLFHRFFKREY-LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGI---VNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQ---RPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCD---IEARDWWDQRPIHLACNAKRTETVKILV--DHHCD-IEECDQFGNSPLEIAMKTGNEGLIHIL 895
            C   A  GG+I+  +        + ++D   + P+H+A   G+ + V +L+    ++   D+    P+HY++ +          +  C    R +      H+  E G       V  L+D+  D    +  GY  +HYA   G  +  +LL++  C     DK       P+H A E      V +LI+    ++  D   R  ++L+     +  V+LL+         E R  W   P+H+A     +E +++L+  +   D +   D  G +PL +A+  G+   +H+L
Sbjct:  412 CLHAAASGGNIECLNLLLSSGADMNKKDKFGRTPLHYAAANGRYQCVVVLVGAGAEVNERDRSGCTPLHYSAAS----------TAFC----RTDRPHASTHQNQEDGEKESFLCVEHLLDNGADPCLCNTKGYSAVHYAAAHGNKQNLELLLE-MCFNTLGDKESNGSISPLHLAVESGHWECVTVLIESGACVDVCDPVGRSVLYLASQRGHSRCVELLLSQSASCLLAEHRSKWG--PLHVAAANGHSECLRMLLCSEGGADLVNVTDAEGQTPLMLAVLGGHTDCVHLL 687          
BLAST of SMED30005028 vs. Ensembl Zebrafish
Match: ankrd52a (ankyrin repeat domain 52a [Source:NCBI gene;Acc:553206])

HSP 1 Score: 127.487 bits (319), Expect = 3.212e-29
Identity = 73/266 (27.44%), Postives = 134/266 (50.38%), Query Frame = 2
Query:   86 IKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGL 883
            +KLF    K++ +   D  ++ P+H A   G   I+ LLI    ++ A D     P+H A+ + +++ V LL+    D+ ARD++ + P+H A  +  +  V  L+ H   +   D+ G  PLH+A ++G  E  KLL++   ++ A DK D++PIH A       +VKLL+    +   +DK    P+H + +    + VK L+ +  +I+  + +    +H+AC   +      LV+   ++ + +  G +PL +A  + N  L
Sbjct:   24 VKLF--LHKKDEVNALDQERRTPLHAAAWLGDVHIMDLLISAGANVNAKDHVWLTPLHRAAASRNERAVGLLLRKGADVTARDKYWQTPLHIAAANRATRCVETLLPHVSSLNMADRTGRAPLHHAAQSGYQEMVKLLLNKGANLSASDKKDRQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLHAAAASGHVDVVKYLLRNGAEIDEPNAFGNTALHVACYTGQEAVANELVNRGANVNQPNHRGYTPLHLAAVSTNGAL 287          

HSP 2 Score: 121.709 bits (304), Expect = 1.944e-27
Identity = 73/250 (29.20%), Postives = 124/250 (49.60%), Query Frame = 2
Query:  134 DLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGL 883
            +++ + P+  A      + VKL +    ++ ALD+  + P+H A+  G    + LL+S   ++NA+D     P+HRA    +   V LL+    D+ +RDK    PLH A         + L+ H   +   D+  + P+H A +     +VKLL++   N+ + DK +R+PIH +      E VKLL+    D   +D     P+H A  +   + VK L+ +  +I+E + FGN+ L +A  TG E +
Sbjct:    5 NISDQPPLVQAIFNRNADEVKLFLHKKDEVNALDQERRTPLHAAAWLGDVHIMDLLISAGANVNAKDHVWLTPLHRAAASRNERAVGLLLRKGADVTARDKYWQTPLHIAAANRATRCVETLLPHVSSLNMADRTGRAPLHHAAQSGYQEMVKLLLNKGANLSASDKKDRQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLHAAAASGHVDVVKYLLRNGAEIDEPNAFGNTALHVACYTGQEAV 254          

HSP 3 Score: 102.064 bits (253), Expect = 2.177e-21
Identity = 78/346 (22.54%), Postives = 137/346 (39.60%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPI---------------------------------HRACEHGHSGIVN----------------------------------LLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSC----SGCCTETVKL--------------LIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHILNGV 904
            L   D   + P+HHA + G  E+VKLL++   ++ A DK +++PIH+A+  GH + VKLLVS   D + +D+    P+                                 H AC  G   + N                                  LL+++  D+  + K G  PLH A   GR   +++LI +  +I+  D++   P+H A +Y    ++  L+ +  +   +      P+HL+     S CC + +                ++    DI   D + +  +H A +    E + +L+    D+ + D+FG +PL  A   G    + +L G 
Sbjct:  133 LNMADRTGRAPLHHAAQSGYQEMVKLLLNKGANLSASDKKDRQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLHAAAASGHVDVVKYLLRNGAEIDEPNAFGNTALHVACYTGQEAVANELVNRGANVNQPNHRGYTPLHLAAVSTNGALCLELLVNNGADVNMQSKEGKSPLHMAAIHGRFTRSQILIQNGGEIDCVDRYGNTPLHVAAKYGHELLISTLMTNGADTARQGIHGMFPLHLAVLYGSSDCCRKLLSSGQLYSIVLSMSKEHVLSAGFDINTPDNFGRTCLHAAASGGNIECLNLLLSSGADMNKKDKFGRTPLHYAAANGRYQCVVVLVGA 478          

HSP 4 Score: 80.1073 bits (196), Expect = 1.043e-14
Identity = 56/261 (21.46%), Postives = 113/261 (43.30%), Query Frame = 2
Query:  104 FFKREYLEREDLNKKRPIHHACERGQTEI------------VKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPL 850
            +  +E +  E +N+   ++    RG T +            ++LL++   D+    K  + P+H A+ +G     ++L+    +I+  D +   P+H A ++GH  +++ L+ +  D   +   G  PLH A   G ++  + L+                I  +   E       ++    +I + D + R  +H + SG   E + LL+    D+  +D + + P+H A    R + V +LV    ++ E D+ G +PL
Sbjct:  248 YTGQEAVANELVNRGANVNQPNHRGYTPLHLAAVSTNGALCLELLVNNGADVNMQSKEGKSPLHMAAIHGRFTRSQILIQNGGEIDCVDRYGNTPLHVAAKYGHELLISTLMTNGADTARQGIHGMFPLHLAVLYGSSDCCRKLL---------SSGQLYSIVLSMSKEH------VLSAGFDINTPDNFGRTCLHAAASGGNIECLNLLLSSGADMNKKDKFGRTPLHYAAANGRYQCVVVLVGAGAEVNERDRSGCTPL 493          

HSP 5 Score: 77.0258 bits (188), Expect = 9.843e-14
Identity = 64/250 (25.60%), Postives = 112/250 (44.80%), Query Frame = 2
Query:  134 DLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQR----PIHYASQNGHKKTVKLLVSLH-CDINARDEWDRVPIHRACEHGHSGIVNLLIDHH-CD--IESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDH-HCNIESRDKWNRRPIHLSCSGC---CTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSP 847
            D   +  +H A   G  +I+  L+      +  D    R    P H+A+ +GH+  +++L+ L  C I   + +   P+H A  +GHSG   LL++   C+  +  RD  G  PLH A  A      +L++    DI+A D   +  +  A +Y ++G V LL+     ++   D      +HL+CS     C   +   I +   I A +   Q P+H+A        V+ L++    +   D+ G++P
Sbjct:  745 DFQGRSALHLAASCGHADILSNLLSAADHSQPQDPLTDRHGYTPAHWAAYHGHEDCLEVLLELKPCSIQEGNPF--TPLHCALINGHSGSAELLLESSVCNSLVNIRDAKGRTPLHAAAVAEDVAGLQLVLRQGADIDAVDHSGRSALMVAADYGQSGAVALLLHRAKADLSLLDVNKNTALHLACSKAHEMCAMLILKEIHNPILINATNSMLQMPLHIAARNGLATVVQALLNRGATVLAVDEEGHTP 992          

HSP 6 Score: 76.2554 bits (186), Expect = 1.682e-13
Identity = 67/268 (25.00%), Postives = 120/268 (44.78%), Query Frame = 2
Query:  125 EREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCD---INARDEWDRVPIHRACEHGHSGIVNLLI--DHHCD-IESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQR----PIHLACNAKRTETVKILVD-HHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            ++E      P+H A E G  E V +LI+    ++  D   +  ++ ASQ GH + V+LL+S          R +W   P+H A  +GHS  + +L+  +   D +   D  G  PL  A   G  +   LL++     + +D+  +  +H      R   +  L+ H+ ++ SRD   R  +HL+ S    + +  L+      + +D    R    P H A      + +++L++   C I+E + F  +PL  A+  G+ G   +L
Sbjct:  573 DKESNGSISPLHLAVESGHWECVTVLIESGACVDVCDPVGRSVLYLASQRGHSRCVELLLSQSASCLLAEHRSKWG--PLHVAAANGHSECLRMLLCSEGGADLVNVTDAEGQTPLMLAVLGGHTDCVHLLLERGACPDMKDRRGRTALHRGAVMGREDCLTALLSHNVSVLSRDFQGRSALHLAASCGHADILSNLLSAADHSQPQDPLTDRHGYTPAHWAAYHGHEDCLEVLLELKPCSIQEGNPF--TPLHCALINGHSGSAELL 836          

HSP 7 Score: 75.8702 bits (185), Expect = 2.189e-13
Identity = 65/269 (24.16%), Postives = 118/269 (43.87%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVKLLI--DYNCD-IEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQR----PIHCACEYERAGIVKLLID-HHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHK-CD--IEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            L  E  +K  P+H A   G +E +++L+  +   D +   D   Q P+  A   GH   V LL+      + +D   R  +HR    G    +  L+ H+  + SRD  G   LH A   G A+    L+      + +D    R    P H A  +     +++L++   C+I+  + +   P+H +     + + +LL++   C+  +  RD   + P+H A  A+    +++++    DI+  D  G S L +A   G  G + +L
Sbjct:  639 LLAEHRSKWGPLHVAAANGHSECLRMLLCSEGGADLVNVTDAEGQTPLMLAVLGGHTDCVHLLLERGACPDMKDRRGRTALHRGAVMGREDCLTALLSHNVSVLSRDFQGRSALHLAASCGHADILSNLLSAADHSQPQDPLTDRHGYTPAHWAAYHGHEDCLEVLLELKPCSIQEGNPFT--PLHCALINGHSGSAELLLESSVCNSLVNIRDAKGRTPLHAAAVAEDVAGLQLVLRQGADIDAVDHSGRSALMVAADYGQSGAVALL 905          

HSP 8 Score: 71.2478 bits (173), Expect = 5.345e-12
Identity = 67/325 (20.62%), Postives = 125/325 (38.46%), Query Frame = 2
Query:  146 KRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVS---------------LHC------------------------------------DINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCAC----------------------EYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDI--EARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            K P+H A   G+    ++LI    +I+ +D++   P+H A++ GH+  +  L++               LH                                     DIN  D + R  +H A   G+   +NLL+    D+  +DK G  PLHYA   GR +   +L+    ++  RD+    P+H +                       E E    V+ L+D+  +    +      +H + +    + ++LL++   +   +        P+HLA  +   E V +L++    ++ CD  G S L +A + G+   + +L
Sbjct:  307 KSPLHMAAIHGRFTRSQILIQNGGEIDCVDRYGNTPLHVAAKYGHELLISTLMTNGADTARQGIHGMFPLHLAVLYGSSDCCRKLLSSGQLYSIVLSMSKEHVLSAGFDINTPDNFGRTCLHAAASGGNIECLNLLLSSGADMNKKDKFGRTPLHYAAANGRYQCVVVLVGAGAEVNERDRSGCTPLHYSAASTAFCRTDRPHASTHQNQEDGEKESFLCVEHLLDNGADPCLCNTKGYSAVHYAAAHGNKQNLELLLEMCFNTLGDKESNGSISPLHLAVESGHWECVTVLIESGACVDVCDPVGRSVLYLASQRGHSRCVELL 631          

HSP 9 Score: 60.8474 bits (146), Expect = 8.786e-9
Identity = 55/235 (23.40%), Postives = 103/235 (43.83%), Query Frame = 2
Query:  191 VKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDR--VPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCD---IEARDKWDQRPIHCACEYERAGIVKLLIDHHCN---IESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTG 871
            V+ L+D   D    +      +HYA+ +G+K+ ++LL+ +  +     E +    P+H A E GH   V +LI+    ++  D +G   L+ A + G +   +LL+         E R KW   P+H A     +  +++L+        +   D   + P+ L+  G  T+ V LL++     + +D   +  +H      R + +  L+ H+  +   D  G S L +A   G
Sbjct:  527 VEHLLDNGADPCLCNTKGYSAVHYAAAHGNKQNLELLLEMCFNTLGDKESNGSISPLHLAVESGHWECVTVLIESGACVDVCDPVGRSVLYLASQRGHSRCVELLLSQSASCLLAEHRSKWG--PLHVAAANGHSECLRMLLCSEGGADLVNVTDAEGQTPLMLAVLGGHTDCVHLLLERGACPDMKDRRGRTALHRGAVMGREDCLTALLSHNVSVLSRDFQGRSALHLAASCG 759          
BLAST of SMED30005028 vs. Ensembl Zebrafish
Match: ankrd28b (ankyrin repeat domain 28b [Source:ZFIN;Acc:ZDB-GENE-070622-4])

HSP 1 Score: 125.176 bits (313), Expect = 1.400e-28
Identity = 72/249 (28.92%), Postives = 123/249 (49.40%), Query Frame = 2
Query:  104 FFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPL 850
             FK+E +  +D  K+ P+H A   G  EI++LLI     + A D     P+H A  +  ++ V++L+    D+NARD+  + P+H A  +        L+    ++   D+ G   LH+A  +G  E  +LL+    +I A DK D+R IH A       +VKLL+ H   +  +DK    P+H + S      VK L+D   D+   + +   P+H+AC   +   V  L++   ++ + ++ G +PL
Sbjct:   28 IFKKEDVNVQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDNKWLTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHVAAANKAVRCAEALVPLLSNVNVSDRAGRTALHHAAFSGHLEMVRLLLSRGANINAFDKKDRRAIHWAAYMGHMEVVKLLVSHGAEVPCKDKKAYTPLHAAASSGMISVVKYLLDMGVDMNEPNAYGNTPLHVACYNGQDVVVNELIECGANVNQVNEKGFAPL 276          

HSP 2 Score: 124.405 bits (311), Expect = 2.322e-28
Identity = 73/258 (28.29%), Postives = 128/258 (49.61%), Query Frame = 2
Query:  134 DLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCS----GCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            D N + P+H A         + L+    ++   D+  +  +H+A+ +GH + V+LL+S   +INA D+ DR  IH A   GH  +V LL+ H  ++  +DK  Y PLH A  +G     K L+D   D+   + +   P+H AC   +  +V  LI+   N+   ++    P+H + +      C E   LL+ +  D+  +    + P+H+     R    + ++ +  +I+  D+ GN+PL IA + G+E LI+ L
Sbjct:  104 DKNWQTPLHVAAANKAVRCAEALVPLLSNVNVSDRAGRTALHHAAFSGHLEMVRLLLSRGANINAFDKKDRRAIHWAAYMGHMEVVKLLVSHGAEVPCKDKKAYTPLHAAASSGMISVVKYLLDMGVDMNEPNAYGNTPLHVACYNGQDVVVNELIECGANVNQVNEKGFAPLHFTAASRHGALCLE---LLVGNGADVNIKSKDGKTPLHMTAIHGRFSRSQAIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTL 358          

HSP 3 Score: 112.849 bits (281), Expect = 9.531e-25
Identity = 68/235 (28.94%), Postives = 114/235 (48.51%), Query Frame = 2
Query:  191 VKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            V+ LI    D+   D   + P+H A+  G  + ++LL+     +NA+D     P+HRA        V +L+ H  D+ +RDK    PLH A        A+ L+    ++   D+  +  +H A       +V+LL+    NI + DK +RR IH +      E VKLL+ H  ++  +D     P+H A ++     VK L+D   D+ E + +GN+PL +A   G + +++ L
Sbjct:   24 VRSLIFKKEDVNVQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDNKWLTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHVAAANKAVRCAEALVPLLSNVNVSDRAGRTALHHAAFSGHLEMVRLLLSRGANINAFDKKDRRAIHWAAYMGHMEVVKLLVSHGAEVPCKDKKAYTPLHAAASSGMISVVKYLLDMGVDMNEPNAYGNTPLHVACYNGQDVVVNEL 258          

HSP 4 Score: 100.908 bits (250), Expect = 4.291e-21
Identity = 79/322 (24.53%), Postives = 127/322 (39.44%), Query Frame = 2
Query:   74 RGGSIKLFHRFFK------REYLERE------DLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVN----------------------------------LLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHILNG 901
            R G   L H  F       R  L R       D   +R IH A   G  E+VKLL+ +  ++   DK    P+H A+ +G    VK L+ +  D+N  + +   P+H AC +G   +VN                                  LL+ +  D+  + K G  PLH     GR   ++ +I +  +I+  DK    P+H A  Y    ++  LI +  +   R      P+HL+     ++  + L+    DI+  D + +  +H A      E + +L++   D    D FG +PL  A    N   +  L G
Sbjct:  138 RAGRTALHHAAFSGHLEMVRLLLSRGANINAFDKKDRRAIHWAAYMGHMEVVKLLVSHGAEVPCKDKKAYTPLHAAASSGMISVVKYLLDMGVDMNEPNAYGNTPLHVACYNGQDVVVNELIECGANVNQVNEKGFAPLHFTAASRHGALCLELLVGNGADVNIKSKDGKTPLHMTAIHGRFSRSQAIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTLITNGADTAKRGVHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNRKDSFGRTPLHYAAANCNYQCLFALVG 459          

HSP 5 Score: 95.9005 bits (237), Expect = 1.441e-19
Identity = 72/288 (25.00%), Postives = 117/288 (40.62%), Query Frame = 2
Query:  143 KKRPIHHACERGQTEIVKLLI---DYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESR-------------------------------------DKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLID--HHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDH-HCDIEECDQFGNSPLEIAMKTGNE 877
            K+ PIH A   G +E ++LLI   D    ++  D   Q P+  +   GH   V  L++   +++A+D+W R  +HR    GH   V  L+ H      R                                     D  GY PLH+AC  G     ++L++        +     P+HCA   +  G V+LLI+      + + D  NR P+H +      E ++LL+ H   +   D   + P+ +A    +T  V++LV     D+   D   N+ L +A   G+E
Sbjct:  617 KRTPIHAAATNGHSECLRLLIGNADLQSAVDIQDGIGQTPLMLSVLGGHTDCVYSLINKGANVDAKDKWGRTALHRGAVTGHEECVEALLQHSASFMVRDCRGRSPVHLASACGHVGVLGGLLHAAQSVESIPVITDHQGYTPLHWACYNGHDTCVEVLLEQEL-FHKTEGNPFSPLHCAVINDNEGAVELLIETLSPVIVNANDSKNRTPLHAAAFTDHVECLQLLLGHNAQVNCVDAGGKTPLMMAAENGQTNAVEVLVSSAKADLTLQDANKNTALHLACSKGHE 903          

HSP 6 Score: 90.8929 bits (224), Expect = 5.625e-18
Identity = 61/244 (25.00%), Postives = 112/244 (45.90%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKT-VKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEG 880
            P+H AC  GQ  +V  LI+   ++  +++    P+H+ + + H    ++LLV    D+N + +  + P+H    HG       +I +  +I+  DK G  PLH A + G       LI +  D   R      P+H A     +   + L+    +I++ D + R  +H + +G   E + LL++   D   +D + + P+H A      + +  LV    ++ E D+ G +PL  A  +  +G
Sbjct:  242 PLHVACYNGQDVVVNELIECGANVNQVNEKGFAPLHFTAASRHGALCLELLVGNGADVNIKSKDGKTPLHMTAIHGRFSRSQAIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTLITNGADTAKRGVHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNRKDSFGRTPLHYAAANCNYQCLFALVGSGANVNELDKRGCTPLHYAAASDADG 485          

HSP 7 Score: 87.0409 bits (214), Expect = 8.019e-17
Identity = 78/309 (25.24%), Postives = 134/309 (43.37%), Query Frame = 2
Query:   47 HYQCFIRAIRGGSIKLFHRFFKREYLEREDLNKK--RPIHHACER-GQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVS----------LHCDI-NARDEWDRV-PIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQR-PIHCACEYERAGIVKLLI---DHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHILNGVIYVS 916
            +YQC    +  G+                +L+K+   P+H+A       + ++ L+  + +    D      +HYAS  GH+  ++L+ S             DI N  D    V P+H A  HGH   + +L+    D++ R   G+ PL  A   G  E   +LI+    I  +D   +R PIH A     +  ++LLI   D    ++ +D   + P+ LS  G  T+ V  LI+   +++A+D W +  +H        E V+ L+ H       D  G SP+ +A   G+ G   +L G+++ +
Sbjct:  450 NYQCLFALVGSGA-------------NVNELDKRGCTPLHYAAASDADGKCLEYLLRNDANPGIRDNQGYNAVHYASAYGHRLCLELIASETPLDVLMETSGTDILNDSDVLAPVSPLHLAAYHGHHQALEVLVQSLLDLDVRTAQGHTPLDLAAFKGHVECVDVLINQGASILVKDYTLKRTPIHAAATNGHSECLRLLIGNADLQSAVDIQDGIGQTPLMLSVLGGHTDCVYSLINKGANVDAKDKWGRTALHRGAVTGHEECVEALLQHSASFMVRDCRGRSPVHLASACGHVG---VLGGLLHAA 742          

HSP 8 Score: 68.9366 bits (167), Expect = 2.713e-11
Identity = 62/260 (23.85%), Postives = 108/260 (41.54%), Query Frame = 2
Query:  131 EDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAG-IVKLLIDHHCNIESRDKWNRRPIHLSCSG---CCTETV--KLLIDHKCDIEARDWWDQ-------RPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTG 871
            ED N   P+H A   G   ++  LI    D          P+H A+ +G     + L+S   DI+  D++ R  +H A   G+   +NLL++   D   +D  G  PLHYA      +    L+    ++   DK    P+H A   +  G  ++ L+ +  N   RD      +H + +     C E +  +  +D   +    D  +         P+HLA      + +++LV    D++     G++PL++A   G
Sbjct:  335 EDKNGNTPLHIAARYGHELLINTLITNGADTAKRGVHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNRKDSFGRTPLHYAAANCNYQCLFALVGSGANVNELDKRGCTPLHYAAASDADGKCLEYLLRNDANPGIRDNQGYNAVHYASAYGHRLCLELIASETPLDVLMETSGTDILNDSDVLAPVSPLHLAAYHGHHQALEVLVQSLLDLDVRTAQGHTPLDLAAFKG 594          

HSP 9 Score: 65.0846 bits (157), Expect = 4.253e-10
Identity = 43/179 (24.02%), Postives = 78/179 (43.58%), Query Frame = 2
Query:   80 GSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLV-SLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCD---IESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRP-IHCACEYERAGIVKLLI 601
            G+++L         +   D   + P+H A      E ++LL+ +N  +  +D   + P+  A++NG    V++LV S   D+  +D      +H AC  GH     L+++   D   I S +     PLH A + G     + L+     + A D+    P + CA   + A  + L++
Sbjct:  802 GAVELLIETLSPVIVNANDSKNRTPLHAAAFTDHVECLQLLLGHNAQVNCVDAGGKTPLMMAAENGQTNAVEVLVSSAKADLTLQDANKNTALHLACSKGHETSALLILEKITDRNLINSTNAALQTPLHVAARNGLTVVVQELLAKGASVLAVDENGYTPALACAPNKDVADCLALIL 980          

HSP 10 Score: 64.6994 bits (156), Expect = 5.629e-10
Identity = 59/241 (24.48%), Postives = 98/241 (40.66%), Query Frame = 2
Query:   59 FIRAIRGGSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCA---CEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCS----GCCTETVKLLIDHKCDIEARDWWDQRPIHLA 760
            F  A R G++ L         +  +  + K P+H     G+    + +I    +I+  DK    P+H A++ GH+  +  L++   D   R      P+H A   G S     L+    DI++ D  G   LH A   G  E   LL++   D   +D + + P+H A   C Y+    +  L+    N+   DK    P+H + +    G C E    L+ +  +   RD      +H A
Sbjct:  278 FTAASRHGALCLELLVGNGADVNIKSKDGKTPLHMTAIHGRFSRSQAIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTLITNGADTAKRGVHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNRKDSFGRTPLHYAAANCNYQ---CLFALVGSGANVNELDKRGCTPLHYAAASDADGKCLE---YLLRNDANPGIRDNQGYNAVHYA 512          
BLAST of SMED30005028 vs. Ensembl Zebrafish
Match: ankrd28b (ankyrin repeat domain 28b [Source:ZFIN;Acc:ZDB-GENE-070622-4])

HSP 1 Score: 125.176 bits (313), Expect = 1.400e-28
Identity = 72/249 (28.92%), Postives = 123/249 (49.40%), Query Frame = 2
Query:  104 FFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPL 850
             FK+E +  +D  K+ P+H A   G  EI++LLI     + A D     P+H A  +  ++ V++L+    D+NARD+  + P+H A  +        L+    ++   D+ G   LH+A  +G  E  +LL+    +I A DK D+R IH A       +VKLL+ H   +  +DK    P+H + S      VK L+D   D+   + +   P+H+AC   +   V  L++   ++ + ++ G +PL
Sbjct:   28 IFKKEDVNVQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDNKWLTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHVAAANKAVRCAEALVPLLSNVNVSDRAGRTALHHAAFSGHLEMVRLLLSRGANINAFDKKDRRAIHWAAYMGHMEVVKLLVSHGAEVPCKDKKAYTPLHAAASSGMISVVKYLLDMGVDMNEPNAYGNTPLHVACYNGQDVVVNELIECGANVNQVNEKGFAPL 276          

HSP 2 Score: 124.405 bits (311), Expect = 2.322e-28
Identity = 73/258 (28.29%), Postives = 128/258 (49.61%), Query Frame = 2
Query:  134 DLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCS----GCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            D N + P+H A         + L+    ++   D+  +  +H+A+ +GH + V+LL+S   +INA D+ DR  IH A   GH  +V LL+ H  ++  +DK  Y PLH A  +G     K L+D   D+   + +   P+H AC   +  +V  LI+   N+   ++    P+H + +      C E   LL+ +  D+  +    + P+H+     R    + ++ +  +I+  D+ GN+PL IA + G+E LI+ L
Sbjct:  104 DKNWQTPLHVAAANKAVRCAEALVPLLSNVNVSDRAGRTALHHAAFSGHLEMVRLLLSRGANINAFDKKDRRAIHWAAYMGHMEVVKLLVSHGAEVPCKDKKAYTPLHAAASSGMISVVKYLLDMGVDMNEPNAYGNTPLHVACYNGQDVVVNELIECGANVNQVNEKGFAPLHFTAASRHGALCLE---LLVGNGADVNIKSKDGKTPLHMTAIHGRFSRSQAIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTL 358          

HSP 3 Score: 112.849 bits (281), Expect = 9.531e-25
Identity = 68/235 (28.94%), Postives = 114/235 (48.51%), Query Frame = 2
Query:  191 VKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            V+ LI    D+   D   + P+H A+  G  + ++LL+     +NA+D     P+HRA        V +L+ H  D+ +RDK    PLH A        A+ L+    ++   D+  +  +H A       +V+LL+    NI + DK +RR IH +      E VKLL+ H  ++  +D     P+H A ++     VK L+D   D+ E + +GN+PL +A   G + +++ L
Sbjct:   24 VRSLIFKKEDVNVQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDNKWLTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHVAAANKAVRCAEALVPLLSNVNVSDRAGRTALHHAAFSGHLEMVRLLLSRGANINAFDKKDRRAIHWAAYMGHMEVVKLLVSHGAEVPCKDKKAYTPLHAAASSGMISVVKYLLDMGVDMNEPNAYGNTPLHVACYNGQDVVVNEL 258          

HSP 4 Score: 100.908 bits (250), Expect = 4.291e-21
Identity = 79/322 (24.53%), Postives = 127/322 (39.44%), Query Frame = 2
Query:   74 RGGSIKLFHRFFK------REYLERE------DLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVN----------------------------------LLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHILNG 901
            R G   L H  F       R  L R       D   +R IH A   G  E+VKLL+ +  ++   DK    P+H A+ +G    VK L+ +  D+N  + +   P+H AC +G   +VN                                  LL+ +  D+  + K G  PLH     GR   ++ +I +  +I+  DK    P+H A  Y    ++  LI +  +   R      P+HL+     ++  + L+    DI+  D + +  +H A      E + +L++   D    D FG +PL  A    N   +  L G
Sbjct:  138 RAGRTALHHAAFSGHLEMVRLLLSRGANINAFDKKDRRAIHWAAYMGHMEVVKLLVSHGAEVPCKDKKAYTPLHAAASSGMISVVKYLLDMGVDMNEPNAYGNTPLHVACYNGQDVVVNELIECGANVNQVNEKGFAPLHFTAASRHGALCLELLVGNGADVNIKSKDGKTPLHMTAIHGRFSRSQAIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTLITNGADTAKRGVHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNRKDSFGRTPLHYAAANCNYQCLFALVG 459          

HSP 5 Score: 95.9005 bits (237), Expect = 1.441e-19
Identity = 72/288 (25.00%), Postives = 117/288 (40.62%), Query Frame = 2
Query:  143 KKRPIHHACERGQTEIVKLLI---DYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESR-------------------------------------DKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLID--HHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDH-HCDIEECDQFGNSPLEIAMKTGNE 877
            K+ PIH A   G +E ++LLI   D    ++  D   Q P+  +   GH   V  L++   +++A+D+W R  +HR    GH   V  L+ H      R                                     D  GY PLH+AC  G     ++L++        +     P+HCA   +  G V+LLI+      + + D  NR P+H +      E ++LL+ H   +   D   + P+ +A    +T  V++LV     D+   D   N+ L +A   G+E
Sbjct:  617 KRTPIHAAATNGHSECLRLLIGNADLQSAVDIQDGIGQTPLMLSVLGGHTDCVYSLINKGANVDAKDKWGRTALHRGAVTGHEECVEALLQHSASFMVRDCRGRSPVHLASACGHVGVLGGLLHAAQSVESIPVITDHQGYTPLHWACYNGHDTCVEVLLEQEL-FHKTEGNPFSPLHCAVINDNEGAVELLIETLSPVIVNANDSKNRTPLHAAAFTDHVECLQLLLGHNAQVNCVDAGGKTPLMMAAENGQTNAVEVLVSSAKADLTLQDANKNTALHLACSKGHE 903          

HSP 6 Score: 90.8929 bits (224), Expect = 5.625e-18
Identity = 61/244 (25.00%), Postives = 112/244 (45.90%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKT-VKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEG 880
            P+H AC  GQ  +V  LI+   ++  +++    P+H+ + + H    ++LLV    D+N + +  + P+H    HG       +I +  +I+  DK G  PLH A + G       LI +  D   R      P+H A     +   + L+    +I++ D + R  +H + +G   E + LL++   D   +D + + P+H A      + +  LV    ++ E D+ G +PL  A  +  +G
Sbjct:  242 PLHVACYNGQDVVVNELIECGANVNQVNEKGFAPLHFTAASRHGALCLELLVGNGADVNIKSKDGKTPLHMTAIHGRFSRSQAIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTLITNGADTAKRGVHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNRKDSFGRTPLHYAAANCNYQCLFALVGSGANVNELDKRGCTPLHYAAASDADG 485          

HSP 7 Score: 87.0409 bits (214), Expect = 8.019e-17
Identity = 78/309 (25.24%), Postives = 134/309 (43.37%), Query Frame = 2
Query:   47 HYQCFIRAIRGGSIKLFHRFFKREYLEREDLNKK--RPIHHACER-GQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVS----------LHCDI-NARDEWDRV-PIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQR-PIHCACEYERAGIVKLLI---DHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHILNGVIYVS 916
            +YQC    +  G+                +L+K+   P+H+A       + ++ L+  + +    D      +HYAS  GH+  ++L+ S             DI N  D    V P+H A  HGH   + +L+    D++ R   G+ PL  A   G  E   +LI+    I  +D   +R PIH A     +  ++LLI   D    ++ +D   + P+ LS  G  T+ V  LI+   +++A+D W +  +H        E V+ L+ H       D  G SP+ +A   G+ G   +L G+++ +
Sbjct:  450 NYQCLFALVGSGA-------------NVNELDKRGCTPLHYAAASDADGKCLEYLLRNDANPGIRDNQGYNAVHYASAYGHRLCLELIASETPLDVLMETSGTDILNDSDVLAPVSPLHLAAYHGHHQALEVLVQSLLDLDVRTAQGHTPLDLAAFKGHVECVDVLINQGASILVKDYTLKRTPIHAAATNGHSECLRLLIGNADLQSAVDIQDGIGQTPLMLSVLGGHTDCVYSLINKGANVDAKDKWGRTALHRGAVTGHEECVEALLQHSASFMVRDCRGRSPVHLASACGHVG---VLGGLLHAA 742          

HSP 8 Score: 68.9366 bits (167), Expect = 2.713e-11
Identity = 62/260 (23.85%), Postives = 108/260 (41.54%), Query Frame = 2
Query:  131 EDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAG-IVKLLIDHHCNIESRDKWNRRPIHLSCSG---CCTETV--KLLIDHKCDIEARDWWDQ-------RPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTG 871
            ED N   P+H A   G   ++  LI    D          P+H A+ +G     + L+S   DI+  D++ R  +H A   G+   +NLL++   D   +D  G  PLHYA      +    L+    ++   DK    P+H A   +  G  ++ L+ +  N   RD      +H + +     C E +  +  +D   +    D  +         P+HLA      + +++LV    D++     G++PL++A   G
Sbjct:  335 EDKNGNTPLHIAARYGHELLINTLITNGADTAKRGVHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNRKDSFGRTPLHYAAANCNYQCLFALVGSGANVNELDKRGCTPLHYAAASDADGKCLEYLLRNDANPGIRDNQGYNAVHYASAYGHRLCLELIASETPLDVLMETSGTDILNDSDVLAPVSPLHLAAYHGHHQALEVLVQSLLDLDVRTAQGHTPLDLAAFKG 594          

HSP 9 Score: 65.0846 bits (157), Expect = 4.253e-10
Identity = 43/179 (24.02%), Postives = 78/179 (43.58%), Query Frame = 2
Query:   80 GSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLV-SLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCD---IESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRP-IHCACEYERAGIVKLLI 601
            G+++L         +   D   + P+H A      E ++LL+ +N  +  +D   + P+  A++NG    V++LV S   D+  +D      +H AC  GH     L+++   D   I S +     PLH A + G     + L+     + A D+    P + CA   + A  + L++
Sbjct:  802 GAVELLIETLSPVIVNANDSKNRTPLHAAAFTDHVECLQLLLGHNAQVNCVDAGGKTPLMMAAENGQTNAVEVLVSSAKADLTLQDANKNTALHLACSKGHETSALLILEKITDRNLINSTNAALQTPLHVAARNGLTVVVQELLAKGASVLAVDENGYTPALACAPNKDVADCLALIL 980          

HSP 10 Score: 64.6994 bits (156), Expect = 5.629e-10
Identity = 59/241 (24.48%), Postives = 98/241 (40.66%), Query Frame = 2
Query:   59 FIRAIRGGSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCA---CEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCS----GCCTETVKLLIDHKCDIEARDWWDQRPIHLA 760
            F  A R G++ L         +  +  + K P+H     G+    + +I    +I+  DK    P+H A++ GH+  +  L++   D   R      P+H A   G S     L+    DI++ D  G   LH A   G  E   LL++   D   +D + + P+H A   C Y+    +  L+    N+   DK    P+H + +    G C E    L+ +  +   RD      +H A
Sbjct:  278 FTAASRHGALCLELLVGNGADVNIKSKDGKTPLHMTAIHGRFSRSQAIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTLITNGADTAKRGVHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNRKDSFGRTPLHYAAANCNYQ---CLFALVGSGANVNELDKRGCTPLHYAAASDADGKCLE---YLLRNDANPGIRDNQGYNAVHYA 512          
BLAST of SMED30005028 vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 121.324 bits (303), Expect = 2.532e-27
Identity = 63/248 (25.40%), Postives = 118/248 (47.58%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            P+H A   G  E+ + L+  N  ++A  K +Q P+H A++ GHK+ VKLL+    + ++       P+H A   GH+    +L+D +       K G+ PLH ACK G+ +  +LL++   +  A  K    P+H A  +    +VKLL+    +  S  +     +H++      E    L+ +  +  +       P+HLA    + + V +L+    ++   ++ G +PL +  + G+ G+  +L
Sbjct:  381 PLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADML 628          

HSP 2 Score: 118.627 bits (296), Expect = 1.746e-26
Identity = 71/277 (25.63%), Postives = 133/277 (48.01%), Query Frame = 2
Query:   68 AIRGGSIKLFHRFF-KREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            A R G +++      +   L+ +  N   PIH A +    + V+ L+ YN +I+ +   +  P+H A+  GH + VK+L+      NAR      P+H AC+  H   ++LL+ H   +E+  + G  PLH A   G     K L+       A +   + P+H A       + + L+ ++  ++++ K ++ P+H +      E VKLL++HK + ++       P+H+A      +T +IL+D +    +  + G +PL +A K G   ++ +L
Sbjct:  220 AARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELL 496          

HSP 3 Score: 118.242 bits (295), Expect = 2.256e-26
Identity = 73/277 (26.35%), Postives = 128/277 (46.21%), Query Frame = 2
Query:   68 AIRGGSIKLFHRFFKR-EYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            A R G++ +      R   ++ +  ++  P+H A   G   +V++L+D    ++A  K    PIH A+Q  H   V+ L+  + +I+        P+H A   GH  +V +L+D      +R   G+ PLH ACK     +  LL+ H   +EA  +    P+H A       IVK L+    +  + +     P+H++      E  + L+ +   ++A+   DQ P+H A      E VK+L++H  + +     G++PL IA + G+     IL
Sbjct:  187 ASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRIL 463          

HSP 4 Score: 112.849 bits (281), Expect = 9.739e-25
Identity = 65/267 (24.34%), Postives = 119/267 (44.57%), Query Frame = 2
Query:  101 RFFKREYLEREDLNKK--RPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            R    E  ++  + KK   P+H AC+ G+ ++V+LL++   +  A  K    P+H A  + +   VKLLVS     ++        +H A +     + + L+ +  +  S    G  PLH A + G+ +   LLI    ++   +K    P+H   +    GI  +L+    ++ +  +    P+H++C     + VK L+  +  + ++      P+H A     T+ V +L+ H     E    G SPL IA + G   +I +L
Sbjct:  461 RILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 727          

HSP 5 Score: 108.997 bits (271), Expect = 1.726e-23
Identity = 63/243 (25.93%), Postives = 112/243 (46.09%), Query Frame = 2
Query:  137 LNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMK 865
            LN   P+H AC++     + LL+ ++  +EA+ +    P+H A+  GH   VK L+      NA +     P+H A   GH  +   L+ ++  ++++ K    PLH A + G  E  KLL++H  + ++       P+H A     A   ++L+D +       K    P+H++C     + V+LL++   +  A       P+H+A +    + VK+LV          + G + L IA K
Sbjct:  310 LNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAK 552          

HSP 6 Score: 106.686 bits (265), Expect = 7.609e-23
Identity = 61/248 (24.60%), Postives = 106/248 (42.74%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            P+H A   G  +  ++L+D N     + K    P+H A + G    V+LL+    + NA  +    P+H A  H +  +V LL+       S  + GY  LH A K  + E A  L+ +  +  +       P+H A +  +  +V LLI    N+   +K    P+HL           +L+     + A       P+H+AC+    + VK L+     +    + G +PL  A + G+  ++ +L
Sbjct:  447 PLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLL 694          

HSP 7 Score: 102.834 bits (255), Expect = 1.078e-21
Identity = 61/237 (25.74%), Postives = 112/237 (47.26%), Query Frame = 2
Query:  155 IHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMK 865
            +H A   GQ ++V  LI+Y  ++ A  +    P++ A+Q  H + VK L+    + +   E    P+  A + GH  +V LLI++     ++ K+    LH A +     TA +L+ +  + +   K    P+H A  YE   + +LL++   N+    K    P+H++        V+LL+D    I+A+   +  P+H A        V+IL+D    ++   + G SP+ +A +
Sbjct:   23 LHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINY----GTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQ 255          

HSP 8 Score: 99.7525 bits (247), Expect = 9.787e-21
Identity = 64/281 (22.78%), Postives = 119/281 (42.35%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSG----CCTE-----------------------------TVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            P+  A ++G   +V LLI+Y        K     +H A++N   +T  +L+    + +   +    P+H A  + +  +  LL++   ++    K G  PLH A + G     +LL+D    I+A+ K +  P+HCA       +V++L+D    ++++ K    PIH++  G    C  +                              VK+L+D      AR      P+H+AC      ++ +L+ H   +E   + G +PL +A   G+  ++  L
Sbjct:   88 PLAVALQQGHENVVALLINYGTK----GKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSL 364          

HSP 9 Score: 95.9005 bits (237), Expect = 1.725e-19
Identity = 59/242 (24.38%), Postives = 113/242 (46.69%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCA--CEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTG 871
            P+H A       + +LL++   ++    K    P+H AS+ G+   V+LL+     I+A+ + +  P+H A  +GH  +V +L+D    ++++ K G  P+H A +    +  + L+ ++ +I+        P+H A  C + R  +VK+L+D      +R      P+H++C      ++ LL+ H   +EA       P+H+A        VK L+         +    +PL +A + G
Sbjct:  150 PLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHR--MVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAG 389          
BLAST of SMED30005028 vs. Ensembl Xenopus
Match: rev1 (REV1, DNA directed polymerase [Source:Xenbase;Acc:XB-GENE-968197])

HSP 1 Score: 127.487 bits (319), Expect = 3.847e-29
Identity = 74/260 (28.46%), Postives = 126/260 (48.46%), Query Frame = 2
Query:  104 FFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGL 883
             FK+E +  +D  K+ P+H A   G  EI++LLI     + A D     P+H A  +  +  V++L+    D+NARD+  + P+H A  +        L+    ++   D+ G   LH+A  +G  E   LL+    +I A DK D+R IH A       +VKLL+ H   +  +DK +  P+H + S      +K L+D   D+   + +   P+H+AC   +   V  L+D   ++ + ++ G +PL  A  + +  L
Sbjct:   55 IFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEDAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIKYLLDLGVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGAL 314          

HSP 2 Score: 124.79 bits (312), Expect = 2.787e-28
Identity = 73/255 (28.63%), Postives = 129/255 (50.59%), Query Frame = 2
Query:  134 DLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGC-CTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            D N + P+H A      +  + L+    ++   D+  +  +H+A+ +GH + V LL+S   +INA D+ DR  IH A   GH  +V LL+ H  ++  +DK  Y PLH A  +G     K L+D   D+   + +   P+H AC   +  +V  LID   N+   ++    P+H + +       ++LL+ +  D+  +    + P+H+     R    +I++ +  +I+  D+ GN+PL IA + G+E LI+ L
Sbjct:  131 DKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIKYLLDLGVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQIIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTL 385          

HSP 3 Score: 116.701 bits (291), Expect = 9.025e-26
Identity = 70/248 (28.23%), Postives = 119/248 (47.98%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            P+  A   G  + V+ LI    D+   D   + P+H A+  G  + ++LL+     +NA+D     P+HRA        V +L+ H  D+ +RDK    PLH A      + A+ L+    ++   D+  +  +H A       +V LL+    NI + DK +RR IH +      E VKLL+ H  ++  +D     P+H A ++     +K L+D   D+ E + +GN+PL +A   G + +++ L
Sbjct:   38 PLVQAIFNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEDAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIKYLLDLGVDMNESNAYGNTPLHVACYNGQDVVVNEL 285          

HSP 4 Score: 114.005 bits (284), Expect = 6.291e-25
Identity = 74/313 (23.64%), Postives = 131/313 (41.85%), Query Frame = 2
Query:   68 AIRGGSIKLFHRFFKR-EYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKA----------------------------------GRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHILNG 901
            A   G +++      R   +   D   +R IH A   G  E+VKLL+ +  ++   DK +  P+H A+ +G    +K L+ L  D+N  + +   P+H AC +G   +VN LID   ++   ++ G+ PLH+A  +                                  GR   ++++I +  +I+  DK    P+H A  Y    ++  LI    +   R      P+HL+     ++  + L+    DI+  D + +  +H A      E + +L+    D  + D+FG +PL  A    N   +  L G
Sbjct:  174 AAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIKYLLDLGVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQIIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTLITSRADTSKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTHDDFGRTCLHAAAAGGNLECLNLLLSTGADFNKKDKFGRTPLHYAAANCNYQCLFALVG 486          

HSP 5 Score: 102.834 bits (255), Expect = 1.629e-21
Identity = 63/244 (25.82%), Postives = 111/244 (45.49%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKT-VKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEG 880
            P+H AC  GQ  +V  LID   ++  +++    P+H+A+ + H    ++LLV    D+N + +  + P+H    HG      ++I +  +I+  DK G  PLH A + G       LI    D   R      P+H A     +   + L+    +I++ D + R  +H + +G   E + LL+    D   +D + + P+H A      + +  LV     + + D+ G SPL  A  +  +G
Sbjct:  269 PLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQIIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTLITSRADTSKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTHDDFGRTCLHAAAAGGNLECLNLLLSTGADFNKKDKFGRTPLHYAAANCNYQCLFALVGSGASVNDLDERGCSPLHYAATSDTDG 512          

HSP 6 Score: 96.2857 bits (238), Expect = 1.550e-19
Identity = 72/267 (26.97%), Postives = 120/267 (44.94%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEAL----DKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEA----RDKWDQRPIHCACEYERAGIVKLLIDHHC------NIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDH-HCDIEECDQFGNSPLEIAMKTGNE 877
            L ++ + K+ PIH A   G +E ++LLI  N D++A     D   Q P+  +  NGH + V  L++   +++A+D+W R  +HR    GH   V  L+ H+ +   RD  G  P+H A   G       L+     ++      D     P+H AC       V+LL++         N  S       P+H +      E ++LL+ H   + A D   + P+ +A    +T  V++LV     D+   D+  N+ L +A   G+E
Sbjct:  637 LVKDYVVKRTPIHSAAINGHSECLRLLIG-NADVQAAVDIHDGNGQTPLMLSVLNGHTECVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVEALLQHNANFLLRDCRGRTPIHLAAACGHIGVLSALLQTAISVDVVPAIADNHGYTPLHWACYNGHDACVELLLEQEVFQKMEGNSFSPLHCAVTPLHAAAFTDHIECLQLLLSHNAQVNAVDSTGKTPLMMAAENGQTSAVEVLVSSAKADLTLQDKNKNTALHLACSKGHE 902          

HSP 7 Score: 92.4337 bits (228), Expect = 2.908e-18
Identity = 64/272 (23.53%), Postives = 123/272 (45.22%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQR-PIHYASQNGHKKTVKLLVS---LHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIES----RDKWNRRPIHLSCSGCCTETVKLLIDHKC--DIEARDWWDQ----RPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            L+  +   + P+  A  +G  E V +LI+    I   D   +R PIH A+ NGH + ++LL+    +   ++  D   + P+  +  +GH+  V  L++   +++++DK G   LH     G  E  + L+ H+ +   RD   + PIH A      G++  L+    +++      D     P+H +C       V+LL++ +    +E   +        P+H A      E +++L+ H+  +   D  G +PL +A + G    + +L
Sbjct:  603 LDVRNSTGRTPLDLAAFKGHVECVDVLINQGASILVKDYVVKRTPIHSAAINGHSECLRLLIGNADVQAAVDIHDGNGQTPLMLSVLNGHTECVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVEALLQHNANFLLRDCRGRTPIHLAAACGHIGVLSALLQTAISVDVVPAIADNHGYTPLHWACYNGHDACVELLLEQEVFQKMEGNSFSPLHCAVTPLHAAAFTDHIECLQLLLSHNAQVNAVDSTGKTPLMMAAENGQTSAVEVL 874          

HSP 8 Score: 87.4261 bits (215), Expect = 9.637e-17
Identity = 72/287 (25.09%), Postives = 122/287 (42.51%), Query Frame = 2
Query:  116 EYLEREDLNKK-------RPIHHACERGQTEIVKLL-----IDYNCDIEALDKWNQ-------RPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYR-PLHYACKAGRAETAKLLI---DHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEE----CDQFGNSPLEIAMKTGNEGLIHIL 895
            EYL R D N           +H+A   G    ++L+     +D   +    D  N         P+H A+ +GH + +++LV    D++ R+   R P+  A   GH   V++LI+    I  +D +  R P+H A   G +E  +LLI   D    ++  D   Q P+  +        V  L++   N++++DKW R  +H        E V+ L+ H  +   RD   + PIHLA        +  L+     ++      D  G +PL  A   G++  + +L
Sbjct:  516 EYLLRNDANPGIRDKHGYNAVHYAAAYGHRLCLELIARETPLDVLMETSGTDMLNDAETRAPISPLHLAAYHGHHQALEVLVQSLLDLDVRNSTGRTPLDLAAFKGHVECVDVLINQGASILVKDYVVKRTPIHSAAINGHSECLRLLIGNADVQAAVDIHDGNGQTPLMLSVLNGHTECVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVEALLQHNANFLLRDCRGRTPIHLAAACGHIGVLSALLQTAISVDVVPAIADNHGYTPLHWACYNGHDACVELL 802          

HSP 9 Score: 80.4925 bits (197), Expect = 1.123e-14
Identity = 63/260 (24.23%), Postives = 108/260 (41.54%), Query Frame = 2
Query:  131 EDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAG-IVKLLIDHHCNIESRDKWNRRPIHLSCSG---CCTETV--KLLIDHKCDIEARDWWDQ-------RPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTG 871
            ED N   P+H A   G   ++  LI    D          P+H A+ +G     + L+S   DI+  D++ R  +H A   G+   +NLL+    D   +DK G  PLHYA      +    L+     +   D+    P+H A   +  G  ++ L+ +  N   RDK     +H + +     C E +  +  +D   +    D  +         P+HLA      + +++LV    D++  +  G +PL++A   G
Sbjct:  362 EDKNGNTPLHIAARYGHELLINTLITSRADTSKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTHDDFGRTCLHAAAAGGNLECLNLLLSTGADFNKKDKFGRTPLHYAAANCNYQCLFALVGSGASVNDLDERGCSPLHYAATSDTDGKCLEYLLRNDANPGIRDKHGYNAVHYAAAYGHRLCLELIARETPLDVLMETSGTDMLNDAETRAPISPLHLAAYHGHHQALEVLVQSLLDLDVRNSTGRTPLDLAAFKG 621          

HSP 10 Score: 72.0182 bits (175), Expect = 4.173e-12
Identity = 53/213 (24.88%), Postives = 90/213 (42.25%), Query Frame = 2
Query:  146 KRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCA---CEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCS----GCCTETVKLLIDHKCDIEARDWWDQRPIHLAC 763
            K P+H     G+    +++I    +I+  DK    P+H A++ GH+  +  L++   D + R      P+H A   G S     L+    DI++ D  G   LH A   G  E   LL+    D   +DK+ + P+H A   C Y+    +  L+    ++   D+    P+H + +    G C E    L+ +  +   RD      +H A 
Sbjct:  334 KTPLHMTAIHGRFSRSQIIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTLITSRADTSKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTHDDFGRTCLHAAAAGGNLECLNLLLSTGADFNKKDKFGRTPLHYAAANCNYQ---CLFALVGSGASVNDLDERGCSPLHYAATSDTDGKCLE---YLLRNDANPGIRDKHGYNAVHYAA 540          

HSP 11 Score: 65.4698 bits (158), Expect = 4.901e-10
Identity = 49/186 (26.34%), Postives = 84/186 (45.16%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQR----------PIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDH-HCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCD---IEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCS 667
            P+H AC  G    V+LL++     E   K              P+H A+   H + ++LL+S +  +NA D   + P+  A E+G +  V +L+     D+  +DK     LH AC  G   +A L+++   D   I A +   Q P+H A       +V+ L+    ++ + D+    P  L+C+
Sbjct:  786 PLHWACYNGHDACVELLLEQ----EVFQKMEGNSFSPLHCAVTPLHAAAFTDHIECLQLLLSHNAQVNAVDSTGKTPLMMAAENGQTSAVEVLVSSAKADLTLQDKNKNTALHLACSKGHETSALLILEQITDRNLINATNSALQTPLHVAARNGLTVVVQELLGKGASVLAVDENGYTPA-LACA 966          

HSP 12 Score: 53.5286 bits (127), Expect = 2.167e-6
Identity = 32/110 (29.09%), Postives = 52/110 (47.27%), Query Frame = 2
Query:  134 DLNKKRPIHHACERGQTEIVKLLIDY-NCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCD---INARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRP 451
            D   K P+  A E GQT  V++L+     D+   DK     +H A   GH+ +  L++    D   INA +   + P+H A  +G + +V  L+     + + D+ GY P
Sbjct:  852 DSTGKTPLMMAAENGQTSAVEVLVSSAKADLTLQDKNKNTALHLACSKGHETSALLILEQITDRNLINATNSALQTPLHVAARNGLTVVVQELLGKGASVLAVDENGYTP 961          
BLAST of SMED30005028 vs. Ensembl Xenopus
Match: rev1 (REV1, DNA directed polymerase [Source:Xenbase;Acc:XB-GENE-968197])

HSP 1 Score: 127.487 bits (319), Expect = 4.112e-29
Identity = 74/260 (28.46%), Postives = 126/260 (48.46%), Query Frame = 2
Query:  104 FFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGL 883
             FK+E +  +D  K+ P+H A   G  EI++LLI     + A D     P+H A  +  +  V++L+    D+NARD+  + P+H A  +        L+    ++   D+ G   LH+A  +G  E   LL+    +I A DK D+R IH A       +VKLL+ H   +  +DK +  P+H + S      +K L+D   D+   + +   P+H+AC   +   V  L+D   ++ + ++ G +PL  A  + +  L
Sbjct:   30 IFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEDAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIKYLLDLGVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGAL 289          

HSP 2 Score: 124.79 bits (312), Expect = 2.736e-28
Identity = 73/255 (28.63%), Postives = 129/255 (50.59%), Query Frame = 2
Query:  134 DLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGC-CTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            D N + P+H A      +  + L+    ++   D+  +  +H+A+ +GH + V LL+S   +INA D+ DR  IH A   GH  +V LL+ H  ++  +DK  Y PLH A  +G     K L+D   D+   + +   P+H AC   +  +V  LID   N+   ++    P+H + +       ++LL+ +  D+  +    + P+H+     R    +I++ +  +I+  D+ GN+PL IA + G+E LI+ L
Sbjct:  106 DKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIKYLLDLGVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQIIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTL 360          

HSP 3 Score: 116.316 bits (290), Expect = 9.913e-26
Identity = 70/250 (28.00%), Postives = 120/250 (48.00%), Query Frame = 2
Query:  146 KRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            + P+  A   G  + V+ LI    D+   D   + P+H A+  G  + ++LL+     +NA+D     P+HRA        V +L+ H  D+ +RDK    PLH A      + A+ L+    ++   D+  +  +H A       +V LL+    NI + DK +RR IH +      E VKLL+ H  ++  +D     P+H A ++     +K L+D   D+ E + +GN+PL +A   G + +++ L
Sbjct:   11 QPPLVQAIFNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEDAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIKYLLDLGVDMNESNAYGNTPLHVACYNGQDVVVNEL 260          

HSP 4 Score: 108.612 bits (270), Expect = 2.527e-23
Identity = 68/272 (25.00%), Postives = 114/272 (41.91%), Query Frame = 2
Query:  131 EDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGI-VNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSC-------------SGCCTETVKLLID-HKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHILNG 901
            +D     P+H A   G   ++K L+D   D+   + +   P+H A  NG    V  L+    ++N  +E    P+H A    H  + + LL+ +  D+  + K G  PLH     GR   ++++I +  +I+  DK    P+H A  Y    ++  LI    +   R      P+HL+              SGC   ++KL       DI+  D + +  +H A      E + +L+    D  + D+FG +PL  A    N   +  L G
Sbjct:  204 KDKKSYTPLHAAASSGMISVIKYLLDLGVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQIIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTLITSRADTSKRGIHGMFPLHLAALSGFSDCCRKLLSSGCIRSSIKLFFSLEGFDIDTHDDFGRTCLHAAAAGGNLECLNLLLSTGADFNKKDKFGRTPLHYAAANCNYQCLFALVG 475          

HSP 5 Score: 100.908 bits (250), Expect = 5.771e-21
Identity = 68/268 (25.37%), Postives = 121/268 (45.15%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEAL----DKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEA----RDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLID--HKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            L ++ + K+ PIH A   G +E ++LLI  N D++A     D   Q P+  +  NGH + V  L++   +++A+D+W R  +HR    GH   V  L+ H+ +   RD  G  P+H A   G       L+     ++      D     P+H AC       V+LL++     +  +  +  P+H +         ++LID      + + D   + P+H A      E +++L+ H+  +   D  G +PL +A + G    + +L
Sbjct:  617 LVKDYVVKRTPIHSAAINGHSECLRLLIG-NADVQAAVDIHDGNGQTPLMLSVLNGHTECVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVEALLQHNANFLLRDCRGRTPIHLAAACGHIGVLSALLQTAISVDVVPAIADNHGYTPLHWACYNGHDACVELLLEQEV-FQKMEGNSFSPLHCAVINDNEGAAEMLIDTLGTSIVNSVDSKGRTPLHAAAFTDHIECLQLLLSHNAQVNAVDSTGKTPLMMAAENGQTSAVEVL 882          

HSP 6 Score: 89.7373 bits (221), Expect = 1.630e-17
Identity = 72/279 (25.81%), Postives = 124/279 (44.44%), Query Frame = 2
Query:  116 EYLEREDLNKK-------RPIHHACERGQTEIVKLLIDYNCDIEALDKWNQR----PIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYR-PLHYACKAGRAETAKLLI---DHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEE----CDQFGNSPLEIAMKTGNEGLIHIL 895
            EYL R D N           +H+A   G    ++LL++ +   + L+    R    P+H A+ +GH + +++LV    D++ R+   R P+  A   GH   V++LI+    I  +D +  R P+H A   G +E  +LLI   D    ++  D   Q P+  +        V  L++   N++++DKW R  +H        E V+ L+ H  +   RD   + PIHLA        +  L+     ++      D  G +PL  A   G++  + +L
Sbjct:  505 EYLLRNDANPGIRDKHGYNAVHYAAAYGHRLCLELLMETS-GTDMLNDAETRAPISPLHLAAYHGHHQALEVLVQSLLDLDVRNSTGRTPLDLAAFKGHVECVDVLINQGASILVKDYVVKRTPIHSAAINGHSECLRLLIGNADVQAAVDIHDGNGQTPLMLSVLNGHTECVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVEALLQHNANFLLRDCRGRTPIHLAAACGHIGVLSALLQTAISVDVVPAIADNHGYTPLHWACYNGHDACVELL 782          

HSP 7 Score: 86.2705 bits (212), Expect = 1.816e-16
Identity = 66/295 (22.37%), Postives = 120/295 (40.68%), Query Frame = 2
Query:  134 DLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIES----RDKLGYRPLHYACKAGRAETAKLLIDH--------------HCDI--------------------EARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDH-KCDIEARDWWDQ------------------RPIHLACNAKRTETVKILVDHHCDIEECDQFGNSP 847
            D N + P+  +   G TE V  L++   +++A DKW +  +H  +  GH++ V+ L+  + +   RD   R PIH A   GH G+++ L+     ++      D  GY PLH+AC  G     +LL++               HC +                     + D   + P+H A   +    ++LL+ H+  + + D   + P+ ++     T  V++L+   K D+  +D                      RP+H+A     T  V+ L+     +   D+ G +P
Sbjct:  657 DGNGQTPLMLSVLNGHTECVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVEALLQHNANFLLRDCRGRTPIHLAAACGHIGVLSALLQTAISVDVVPAIADNHGYTPLHWACYNGHDACVELLLEQEVFQKMEGNSFSPLHCAVINDNEGAAEMLIDTLGTSIVNSVDSKGRTPLHAAAFTDHIECLQLLLSHNAQVNAVDSTGKTPLMMAAENGQTSAVEVLVSSAKADLTLQDKNKNTALHLACSKYLLLGILSCRPLHVAARNGLTVVVQELLGKGASVLAVDENGYTP 951          

HSP 8 Score: 78.9518 bits (193), Expect = 3.554e-14
Identity = 62/277 (22.38%), Postives = 108/277 (38.99%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKT-VKLLVSLHCDINAR---------------------------------DEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEG 880
            P+H AC  GQ  +V  LID   ++  +++    P+H+A+ + H    ++LLV    D+N +                                 D+    P+H A  +GH  ++N LI    D   R   G  PLH A  +G ++  + L+   C                    R+ I         +I++ D + R  +H + +G   E + LL+    D   +D + + P+H A      + +  LV     + + D+ G SPL  A  +  +G
Sbjct:  244 PLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQIIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTLITSRADTSKRGIHGMFPLHLAALSGFSDCCRKLLSSGC-------------------IRSSIKLFFSLEGFDIDTHDDFGRTCLHAAAAGGNLECLNLLLSTGADFNKKDKFGRTPLHYAAANCNYQCLFALVGSGASVNDLDERGCSPLHYAATSDTDG 501          

HSP 9 Score: 78.9518 bits (193), Expect = 3.903e-14
Identity = 65/265 (24.53%), Postives = 110/265 (41.51%), Query Frame = 2
Query:  131 EDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGH-------------KKTVKLLVSLH-CDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAG-IVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPI---HLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTG 871
            ED N   P+H A   G   ++  LI    D          P+H A+ +G              + ++KL  SL   DI+  D++ R  +H A   G+   +NLL+    D   +DK G  PLHYA      +    L+     +   D+    P+H A   +  G  ++ L+ +  N   RDK     +H + +      ++LL++        D   + PI   HLA      + +++LV    D++  +  G +PL++A   G
Sbjct:  337 EDKNGNTPLHIAARYGHELLINTLITSRADTSKRGIHGMFPLHLAALSGFSDCCRKLLSSGCIRSSIKLFFSLEGFDIDTHDDFGRTCLHAAAAGGNLECLNLLLSTGADFNKKDKFGRTPLHYAAANCNYQCLFALVGSGASVNDLDERGCSPLHYAATSDTDGKCLEYLLRNDANPGIRDKHGYNAVHYAAAYGHRLCLELLMETSGTDMLNDAETRAPISPLHLAAYHGHHQALEVLVQSLLDLDVRNSTGRTPLDLAAFKG 601          

HSP 10 Score: 56.9954 bits (136), Expect = 1.976e-7
Identity = 43/188 (22.87%), Postives = 81/188 (43.09%), Query Frame = 2
Query:  104 FFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDY--NCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDH-HCDIESRDK------------------LGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRP-IHCACEYERAGIVKLLI 601
              ++E  ++ + N   P+H A         ++LID      + ++D   + P+H A+   H + ++LL+S +  +NA D   + P+  A E+G +  V +L+     D+  +DK                  L  RPLH A + G     + L+     + A D+    P + CA   + A  + L++
Sbjct:  782 LLEQEVFQKMEGNSFSPLHCAVINDNEGAAEMLIDTLGTSIVNSVDSKGRTPLHAAAFTDHIECLQLLLSHNAQVNAVDSTGKTPLMMAAENGQTSAVEVLVSSAKADLTLQDKNKNTALHLACSKYLLLGILSCRPLHVAARNGLTVVVQELLGKGASVLAVDENGYTPALACAPNKDVADCLALIL 969          
BLAST of SMED30005028 vs. Ensembl Xenopus
Match: rev1 (REV1, DNA directed polymerase [Source:Xenbase;Acc:XB-GENE-968197])

HSP 1 Score: 127.487 bits (319), Expect = 4.130e-29
Identity = 74/260 (28.46%), Postives = 126/260 (48.46%), Query Frame = 2
Query:  104 FFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGL 883
             FK+E +  +D  K+ P+H A   G  EI++LLI     + A D     P+H A  +  +  V++L+    D+NARD+  + P+H A  +        L+    ++   D+ G   LH+A  +G  E   LL+    +I A DK D+R IH A       +VKLL+ H   +  +DK +  P+H + S      +K L+D   D+   + +   P+H+AC   +   V  L+D   ++ + ++ G +PL  A  + +  L
Sbjct:   55 IFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEDAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIKYLLDLGVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGAL 314          

HSP 2 Score: 124.79 bits (312), Expect = 2.989e-28
Identity = 73/255 (28.63%), Postives = 129/255 (50.59%), Query Frame = 2
Query:  134 DLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGC-CTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            D N + P+H A      +  + L+    ++   D+  +  +H+A+ +GH + V LL+S   +INA D+ DR  IH A   GH  +V LL+ H  ++  +DK  Y PLH A  +G     K L+D   D+   + +   P+H AC   +  +V  LID   N+   ++    P+H + +       ++LL+ +  D+  +    + P+H+     R    +I++ +  +I+  D+ GN+PL IA + G+E LI+ L
Sbjct:  131 DKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIKYLLDLGVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQIIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTL 385          

HSP 3 Score: 116.316 bits (290), Expect = 1.024e-25
Identity = 70/248 (28.23%), Postives = 119/248 (47.98%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            P+  A   G  + V+ LI    D+   D   + P+H A+  G  + ++LL+     +NA+D     P+HRA        V +L+ H  D+ +RDK    PLH A      + A+ L+    ++   D+  +  +H A       +V LL+    NI + DK +RR IH +      E VKLL+ H  ++  +D     P+H A ++     +K L+D   D+ E + +GN+PL +A   G + +++ L
Sbjct:   38 PLVQAIFNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEDAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIKYLLDLGVDMNESNAYGNTPLHVACYNGQDVVVNEL 285          

HSP 4 Score: 113.62 bits (283), Expect = 7.129e-25
Identity = 74/313 (23.64%), Postives = 131/313 (41.85%), Query Frame = 2
Query:   68 AIRGGSIKLFHRFFKR-EYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKA----------------------------------GRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHILNG 901
            A   G +++      R   +   D   +R IH A   G  E+VKLL+ +  ++   DK +  P+H A+ +G    +K L+ L  D+N  + +   P+H AC +G   +VN LID   ++   ++ G+ PLH+A  +                                  GR   ++++I +  +I+  DK    P+H A  Y    ++  LI    +   R      P+HL+     ++  + L+    DI+  D + +  +H A      E + +L+    D  + D+FG +PL  A    N   +  L G
Sbjct:  174 AAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIKYLLDLGVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQIIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTLITSRADTSKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTHDDFGRTCLHAAAAGGNLECLNLLLSTGADFNKKDKFGRTPLHYAAANCNYQCLFALVG 486          

HSP 5 Score: 102.834 bits (255), Expect = 1.703e-21
Identity = 63/244 (25.82%), Postives = 111/244 (45.49%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKT-VKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEG 880
            P+H AC  GQ  +V  LID   ++  +++    P+H+A+ + H    ++LLV    D+N + +  + P+H    HG      ++I +  +I+  DK G  PLH A + G       LI    D   R      P+H A     +   + L+    +I++ D + R  +H + +G   E + LL+    D   +D + + P+H A      + +  LV     + + D+ G SPL  A  +  +G
Sbjct:  269 PLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQIIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTLITSRADTSKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTHDDFGRTCLHAAAAGGNLECLNLLLSTGADFNKKDKFGRTPLHYAAANCNYQCLFALVGSGASVNDLDERGCSPLHYAATSDTDG 512          

HSP 6 Score: 102.834 bits (255), Expect = 1.732e-21
Identity = 77/296 (26.01%), Postives = 128/296 (43.24%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEAL----DKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESR-------------------------------------DKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCN--IESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDH-HCDIEECDQFGNSPLEIAMKTGNE 877
            L ++ + K+ PIH A   G +E ++LLI  N D++A     D   Q P+  +  NGH + V  L++   +++A+D+W R  +HR    GH   V  L+ H+ +   R                                     D  GY PLH+AC  G     +LL++     +  +     P+HCA   +  G  ++LID      + S D   R P+H +      E ++LL+ H   + A D   + P+ +A    +T  V++LV     D+   D+  N+ L +A   G+E
Sbjct:  637 LVKDYVVKRTPIHSAAINGHSECLRLLIG-NADVQAAVDIHDGNGQTPLMLSVLNGHTECVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVEALLQHNANFLLRDCRGRTPIHLAAACGHIGVLSALLQTAISVDVVPAIADNHGYTPLHWACYNGHDACVELLLEQEV-FQKMEGNSFSPLHCAVINDNEGAAEMLIDTLGTSIVNSVDSKGRTPLHAAAFTDHIECLQLLLSHNAQVNAVDSTGKTPLMMAAENGQTSAVEVLVSSAKADLTLQDKNKNTALHLACSKGHE 930          

HSP 7 Score: 87.0409 bits (214), Expect = 1.240e-16
Identity = 72/287 (25.09%), Postives = 122/287 (42.51%), Query Frame = 2
Query:  116 EYLEREDLNKK-------RPIHHACERGQTEIVKLL-----IDYNCDIEALDKWNQ-------RPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYR-PLHYACKAGRAETAKLLI---DHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEE----CDQFGNSPLEIAMKTGNEGLIHIL 895
            EYL R D N           +H+A   G    ++L+     +D   +    D  N         P+H A+ +GH + +++LV    D++ R+   R P+  A   GH   V++LI+    I  +D +  R P+H A   G +E  +LLI   D    ++  D   Q P+  +        V  L++   N++++DKW R  +H        E V+ L+ H  +   RD   + PIHLA        +  L+     ++      D  G +PL  A   G++  + +L
Sbjct:  516 EYLLRNDANPGIRDKHGYNAVHYAAAYGHRLCLELIARETPLDVLMETSGTDMLNDAETRAPISPLHLAAYHGHHQALEVLVQSLLDLDVRNSTGRTPLDLAAFKGHVECVDVLINQGASILVKDYVVKRTPIHSAAINGHSECLRLLIGNADVQAAVDIHDGNGQTPLMLSVLNGHTECVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVEALLQHNANFLLRDCRGRTPIHLAAACGHIGVLSALLQTAISVDVVPAIADNHGYTPLHWACYNGHDACVELL 802          

HSP 8 Score: 80.4925 bits (197), Expect = 1.280e-14
Identity = 63/260 (24.23%), Postives = 108/260 (41.54%), Query Frame = 2
Query:  131 EDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAG-IVKLLIDHHCNIESRDKWNRRPIHLSCSG---CCTETV--KLLIDHKCDIEARDWWDQ-------RPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTG 871
            ED N   P+H A   G   ++  LI    D          P+H A+ +G     + L+S   DI+  D++ R  +H A   G+   +NLL+    D   +DK G  PLHYA      +    L+     +   D+    P+H A   +  G  ++ L+ +  N   RDK     +H + +     C E +  +  +D   +    D  +         P+HLA      + +++LV    D++  +  G +PL++A   G
Sbjct:  362 EDKNGNTPLHIAARYGHELLINTLITSRADTSKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTHDDFGRTCLHAAAAGGNLECLNLLLSTGADFNKKDKFGRTPLHYAAANCNYQCLFALVGSGASVNDLDERGCSPLHYAATSDTDGKCLEYLLRNDANPGIRDKHGYNAVHYAAAYGHRLCLELIARETPLDVLMETSGTDMLNDAETRAPISPLHLAAYHGHHQALEVLVQSLLDLDVRNSTGRTPLDLAAFKG 621          

HSP 9 Score: 73.1738 bits (178), Expect = 1.913e-12
Identity = 48/194 (24.74%), Postives = 91/194 (46.91%), Query Frame = 2
Query:  104 FFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDY--NCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDH-HCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCD---IEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCS 667
              ++E  ++ + N   P+H A         ++LID      + ++D   + P+H A+   H + ++LL+S +  +NA D   + P+  A E+G +  V +L+     D+  +DK     LH AC  G   +A L+++   D   I A +   Q P+H A       +V+ L+    ++ + D+    P  L+C+
Sbjct:  802 LLEQEVFQKMEGNSFSPLHCAVINDNEGAAEMLIDTLGTSIVNSVDSKGRTPLHAAAFTDHIECLQLLLSHNAQVNAVDSTGKTPLMMAAENGQTSAVEVLVSSAKADLTLQDKNKNTALHLACSKGHETSALLILEQITDRNLINATNSALQTPLHVAARNGLTVVVQELLGKGASVLAVDENGYTPA-LACA 994          

HSP 10 Score: 72.4034 bits (176), Expect = 4.180e-12
Identity = 53/213 (24.88%), Postives = 90/213 (42.25%), Query Frame = 2
Query:  146 KRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCA---CEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCS----GCCTETVKLLIDHKCDIEARDWWDQRPIHLAC 763
            K P+H     G+    +++I    +I+  DK    P+H A++ GH+  +  L++   D + R      P+H A   G S     L+    DI++ D  G   LH A   G  E   LL+    D   +DK+ + P+H A   C Y+    +  L+    ++   D+    P+H + +    G C E    L+ +  +   RD      +H A 
Sbjct:  334 KTPLHMTAIHGRFSRSQIIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTLITSRADTSKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTHDDFGRTCLHAAAAGGNLECLNLLLSTGADFNKKDKFGRTPLHYAAANCNYQ---CLFALVGSGASVNDLDERGCSPLHYAATSDTDGKCLE---YLLRNDANPGIRDKHGYNAVHYAA 540          

HSP 11 Score: 65.855 bits (159), Expect = 3.705e-10
Identity = 42/179 (23.46%), Postives = 79/179 (44.13%), Query Frame = 2
Query:   80 GSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLV-SLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCD---IESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRP-IHCACEYERAGIVKLLI 601
            G+ ++         +   D   + P+H A      E ++LL+ +N  + A+D   + P+  A++NG    V++LV S   D+  +D+     +H AC  GH     L+++   D   I + +     PLH A + G     + L+     + A D+    P + CA   + A  + L++
Sbjct:  829 GAAEMLIDTLGTSIVNSVDSKGRTPLHAAAFTDHIECLQLLLSHNAQVNAVDSTGKTPLMMAAENGQTSAVEVLVSSAKADLTLQDKNKNTALHLACSKGHETSALLILEQITDRNLINATNSALQTPLHVAARNGLTVVVQELLGKGASVLAVDENGYTPALACAPNKDVADCLALIL 1007          
BLAST of SMED30005028 vs. Ensembl Xenopus
Match: rev1 (REV1, DNA directed polymerase [Source:Xenbase;Acc:XB-GENE-968197])

HSP 1 Score: 127.487 bits (319), Expect = 4.160e-29
Identity = 74/260 (28.46%), Postives = 126/260 (48.46%), Query Frame = 2
Query:  104 FFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGL 883
             FK+E +  +D  K+ P+H A   G  EI++LLI     + A D     P+H A  +  +  V++L+    D+NARD+  + P+H A  +        L+    ++   D+ G   LH+A  +G  E   LL+    +I A DK D+R IH A       +VKLL+ H   +  +DK +  P+H + S      +K L+D   D+   + +   P+H+AC   +   V  L+D   ++ + ++ G +PL  A  + +  L
Sbjct:   28 IFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEDAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIKYLLDLGVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGAL 287          

HSP 2 Score: 124.79 bits (312), Expect = 2.863e-28
Identity = 73/255 (28.63%), Postives = 129/255 (50.59%), Query Frame = 2
Query:  134 DLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGC-CTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            D N + P+H A      +  + L+    ++   D+  +  +H+A+ +GH + V LL+S   +INA D+ DR  IH A   GH  +V LL+ H  ++  +DK  Y PLH A  +G     K L+D   D+   + +   P+H AC   +  +V  LID   N+   ++    P+H + +       ++LL+ +  D+  +    + P+H+     R    +I++ +  +I+  D+ GN+PL IA + G+E LI+ L
Sbjct:  104 DKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIKYLLDLGVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQIIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTL 358          

HSP 3 Score: 116.316 bits (290), Expect = 1.081e-25
Identity = 70/248 (28.23%), Postives = 119/248 (47.98%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            P+  A   G  + V+ LI    D+   D   + P+H A+  G  + ++LL+     +NA+D     P+HRA        V +L+ H  D+ +RDK    PLH A      + A+ L+    ++   D+  +  +H A       +V LL+    NI + DK +RR IH +      E VKLL+ H  ++  +D     P+H A ++     +K L+D   D+ E + +GN+PL +A   G + +++ L
Sbjct:   11 PLVQAIFNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEDAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIKYLLDLGVDMNESNAYGNTPLHVACYNGQDVVVNEL 258          

HSP 4 Score: 114.005 bits (284), Expect = 6.350e-25
Identity = 74/313 (23.64%), Postives = 131/313 (41.85%), Query Frame = 2
Query:   68 AIRGGSIKLFHRFFKR-EYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKA----------------------------------GRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHILNG 901
            A   G +++      R   +   D   +R IH A   G  E+VKLL+ +  ++   DK +  P+H A+ +G    +K L+ L  D+N  + +   P+H AC +G   +VN LID   ++   ++ G+ PLH+A  +                                  GR   ++++I +  +I+  DK    P+H A  Y    ++  LI    +   R      P+HL+     ++  + L+    DI+  D + +  +H A      E + +L+    D  + D+FG +PL  A    N   +  L G
Sbjct:  147 AAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIKYLLDLGVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQIIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTLITSRADTSKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTHDDFGRTCLHAAAAGGNLECLNLLLSTGADFNKKDKFGRTPLHYAAANCNYQCLFALVG 459          

HSP 5 Score: 102.834 bits (255), Expect = 1.576e-21
Identity = 63/244 (25.82%), Postives = 111/244 (45.49%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKT-VKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEG 880
            P+H AC  GQ  +V  LID   ++  +++    P+H+A+ + H    ++LLV    D+N + +  + P+H    HG      ++I +  +I+  DK G  PLH A + G       LI    D   R      P+H A     +   + L+    +I++ D + R  +H + +G   E + LL+    D   +D + + P+H A      + +  LV     + + D+ G SPL  A  +  +G
Sbjct:  242 PLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQIIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTLITSRADTSKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTHDDFGRTCLHAAAAGGNLECLNLLLSTGADFNKKDKFGRTPLHYAAANCNYQCLFALVGSGASVNDLDERGCSPLHYAATSDTDG 485          

HSP 6 Score: 102.834 bits (255), Expect = 1.603e-21
Identity = 77/296 (26.01%), Postives = 128/296 (43.24%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEAL----DKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESR-------------------------------------DKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCN--IESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDH-HCDIEECDQFGNSPLEIAMKTGNE 877
            L ++ + K+ PIH A   G +E ++LLI  N D++A     D   Q P+  +  NGH + V  L++   +++A+D+W R  +HR    GH   V  L+ H+ +   R                                     D  GY PLH+AC  G     +LL++     +  +     P+HCA   +  G  ++LID      + S D   R P+H +      E ++LL+ H   + A D   + P+ +A    +T  V++LV     D+   D+  N+ L +A   G+E
Sbjct:  610 LVKDYVVKRTPIHSAAINGHSECLRLLIG-NADVQAAVDIHDGNGQTPLMLSVLNGHTECVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVEALLQHNANFLLRDCRGRTPIHLAAACGHIGVLSALLQTAISVDVVPAIADNHGYTPLHWACYNGHDACVELLLEQEV-FQKMEGNSFSPLHCAVINDNEGAAEMLIDTLGTSIVNSVDSKGRTPLHAAAFTDHIECLQLLLSHNAQVNAVDSTGKTPLMMAAENGQTSAVEVLVSSAKADLTLQDKNKNTALHLACSKGHE 903          

HSP 7 Score: 87.4261 bits (215), Expect = 1.006e-16
Identity = 72/287 (25.09%), Postives = 122/287 (42.51%), Query Frame = 2
Query:  116 EYLEREDLNKK-------RPIHHACERGQTEIVKLL-----IDYNCDIEALDKWNQ-------RPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYR-PLHYACKAGRAETAKLLI---DHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEE----CDQFGNSPLEIAMKTGNEGLIHIL 895
            EYL R D N           +H+A   G    ++L+     +D   +    D  N         P+H A+ +GH + +++LV    D++ R+   R P+  A   GH   V++LI+    I  +D +  R P+H A   G +E  +LLI   D    ++  D   Q P+  +        V  L++   N++++DKW R  +H        E V+ L+ H  +   RD   + PIHLA        +  L+     ++      D  G +PL  A   G++  + +L
Sbjct:  489 EYLLRNDANPGIRDKHGYNAVHYAAAYGHRLCLELIARETPLDVLMETSGTDMLNDAETRAPISPLHLAAYHGHHQALEVLVQSLLDLDVRNSTGRTPLDLAAFKGHVECVDVLINQGASILVKDYVVKRTPIHSAAINGHSECLRLLIGNADVQAAVDIHDGNGQTPLMLSVLNGHTECVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVEALLQHNANFLLRDCRGRTPIHLAAACGHIGVLSALLQTAISVDVVPAIADNHGYTPLHWACYNGHDACVELL 775          

HSP 8 Score: 80.4925 bits (197), Expect = 1.142e-14
Identity = 63/260 (24.23%), Postives = 108/260 (41.54%), Query Frame = 2
Query:  131 EDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAG-IVKLLIDHHCNIESRDKWNRRPIHLSCSG---CCTETV--KLLIDHKCDIEARDWWDQ-------RPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTG 871
            ED N   P+H A   G   ++  LI    D          P+H A+ +G     + L+S   DI+  D++ R  +H A   G+   +NLL+    D   +DK G  PLHYA      +    L+     +   D+    P+H A   +  G  ++ L+ +  N   RDK     +H + +     C E +  +  +D   +    D  +         P+HLA      + +++LV    D++  +  G +PL++A   G
Sbjct:  335 EDKNGNTPLHIAARYGHELLINTLITSRADTSKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTHDDFGRTCLHAAAAGGNLECLNLLLSTGADFNKKDKFGRTPLHYAAANCNYQCLFALVGSGASVNDLDERGCSPLHYAATSDTDGKCLEYLLRNDANPGIRDKHGYNAVHYAAAYGHRLCLELIARETPLDVLMETSGTDMLNDAETRAPISPLHLAAYHGHHQALEVLVQSLLDLDVRNSTGRTPLDLAAFKG 594          

HSP 9 Score: 73.1738 bits (178), Expect = 2.244e-12
Identity = 48/194 (24.74%), Postives = 91/194 (46.91%), Query Frame = 2
Query:  104 FFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDY--NCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDH-HCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCD---IEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCS 667
              ++E  ++ + N   P+H A         ++LID      + ++D   + P+H A+   H + ++LL+S +  +NA D   + P+  A E+G +  V +L+     D+  +DK     LH AC  G   +A L+++   D   I A +   Q P+H A       +V+ L+    ++ + D+    P  L+C+
Sbjct:  775 LLEQEVFQKMEGNSFSPLHCAVINDNEGAAEMLIDTLGTSIVNSVDSKGRTPLHAAAFTDHIECLQLLLSHNAQVNAVDSTGKTPLMMAAENGQTSAVEVLVSSAKADLTLQDKNKNTALHLACSKGHETSALLILEQITDRNLINATNSALQTPLHVAARNGLTVVVQELLGKGASVLAVDENGYTPA-LACA 967          

HSP 10 Score: 72.4034 bits (176), Expect = 4.035e-12
Identity = 53/213 (24.88%), Postives = 90/213 (42.25%), Query Frame = 2
Query:  146 KRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCA---CEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCS----GCCTETVKLLIDHKCDIEARDWWDQRPIHLAC 763
            K P+H     G+    +++I    +I+  DK    P+H A++ GH+  +  L++   D + R      P+H A   G S     L+    DI++ D  G   LH A   G  E   LL+    D   +DK+ + P+H A   C Y+    +  L+    ++   D+    P+H + +    G C E    L+ +  +   RD      +H A 
Sbjct:  307 KTPLHMTAIHGRFSRSQIIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTLITSRADTSKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTHDDFGRTCLHAAAAGGNLECLNLLLSTGADFNKKDKFGRTPLHYAAANCNYQ---CLFALVGSGASVNDLDERGCSPLHYAATSDTDGKCLE---YLLRNDANPGIRDKHGYNAVHYAA 513          

HSP 11 Score: 65.855 bits (159), Expect = 3.965e-10
Identity = 42/179 (23.46%), Postives = 79/179 (44.13%), Query Frame = 2
Query:   80 GSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLV-SLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCD---IESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRP-IHCACEYERAGIVKLLI 601
            G+ ++         +   D   + P+H A      E ++LL+ +N  + A+D   + P+  A++NG    V++LV S   D+  +D+     +H AC  GH     L+++   D   I + +     PLH A + G     + L+     + A D+    P + CA   + A  + L++
Sbjct:  802 GAAEMLIDTLGTSIVNSVDSKGRTPLHAAAFTDHIECLQLLLSHNAQVNAVDSTGKTPLMMAAENGQTSAVEVLVSSAKADLTLQDKNKNTALHLACSKGHETSALLILEQITDRNLINATNSALQTPLHVAARNGLTVVVQELLGKGASVLAVDENGYTPALACAPNKDVADCLALIL 980          
BLAST of SMED30005028 vs. Ensembl Xenopus
Match: rev1 (REV1, DNA directed polymerase [Source:Xenbase;Acc:XB-GENE-968197])

HSP 1 Score: 127.487 bits (319), Expect = 4.268e-29
Identity = 74/260 (28.46%), Postives = 126/260 (48.46%), Query Frame = 2
Query:  104 FFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGL 883
             FK+E +  +D  K+ P+H A   G  EI++LLI     + A D     P+H A  +  +  V++L+    D+NARD+  + P+H A  +        L+    ++   D+ G   LH+A  +G  E   LL+    +I A DK D+R IH A       +VKLL+ H   +  +DK +  P+H + S      +K L+D   D+   + +   P+H+AC   +   V  L+D   ++ + ++ G +PL  A  + +  L
Sbjct:   28 IFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEDAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIKYLLDLGVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGAL 287          

HSP 2 Score: 124.405 bits (311), Expect = 3.146e-28
Identity = 73/255 (28.63%), Postives = 129/255 (50.59%), Query Frame = 2
Query:  134 DLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGC-CTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            D N + P+H A      +  + L+    ++   D+  +  +H+A+ +GH + V LL+S   +INA D+ DR  IH A   GH  +V LL+ H  ++  +DK  Y PLH A  +G     K L+D   D+   + +   P+H AC   +  +V  LID   N+   ++    P+H + +       ++LL+ +  D+  +    + P+H+     R    +I++ +  +I+  D+ GN+PL IA + G+E LI+ L
Sbjct:  104 DKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIKYLLDLGVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQIIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTL 358          

HSP 3 Score: 117.857 bits (294), Expect = 3.839e-26
Identity = 71/253 (28.06%), Postives = 122/253 (48.22%), Query Frame = 2
Query:  137 LNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            L ++ P+  A   G  + V+ LI    D+   D   + P+H A+  G  + ++LL+     +NA+D     P+HRA        V +L+ H  D+ +RDK    PLH A      + A+ L+    ++   D+  +  +H A       +V LL+    NI + DK +RR IH +      E VKLL+ H  ++  +D     P+H A ++     +K L+D   D+ E + +GN+PL +A   G + +++ L
Sbjct:    6 LREQPPLVQAIFNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEDAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIKYLLDLGVDMNESNAYGNTPLHVACYNGQDVVVNEL 258          

HSP 4 Score: 113.62 bits (283), Expect = 7.471e-25
Identity = 74/313 (23.64%), Postives = 131/313 (41.85%), Query Frame = 2
Query:   68 AIRGGSIKLFHRFFKR-EYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKA----------------------------------GRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHILNG 901
            A   G +++      R   +   D   +R IH A   G  E+VKLL+ +  ++   DK +  P+H A+ +G    +K L+ L  D+N  + +   P+H AC +G   +VN LID   ++   ++ G+ PLH+A  +                                  GR   ++++I +  +I+  DK    P+H A  Y    ++  LI    +   R      P+HL+     ++  + L+    DI+  D + +  +H A      E + +L+    D  + D+FG +PL  A    N   +  L G
Sbjct:  147 AAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIKYLLDLGVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQIIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTLITSRADTSKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTHDDFGRTCLHAAAAGGNLECLNLLLSTGADFNKKDKFGRTPLHYAAANCNYQCLFALVG 459          

HSP 5 Score: 102.834 bits (255), Expect = 1.616e-21
Identity = 77/296 (26.01%), Postives = 128/296 (43.24%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEAL----DKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESR-------------------------------------DKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCN--IESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDH-HCDIEECDQFGNSPLEIAMKTGNE 877
            L ++ + K+ PIH A   G +E ++LLI  N D++A     D   Q P+  +  NGH + V  L++   +++A+D+W R  +HR    GH   V  L+ H+ +   R                                     D  GY PLH+AC  G     +LL++     +  +     P+HCA   +  G  ++LID      + S D   R P+H +      E ++LL+ H   + A D   + P+ +A    +T  V++LV     D+   D+  N+ L +A   G+E
Sbjct:  610 LVKDYVVKRTPIHSAAINGHSECLRLLIG-NADVQAAVDIHDGNGQTPLMLSVLNGHTECVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVEALLQHNANFLLRDCRGRTPIHLAAACGHIGVLSALLQTAISVDVVPAIADNHGYTPLHWACYNGHDACVELLLEQEV-FQKMEGNSFSPLHCAVINDNEGAAEMLIDTLGTSIVNSVDSKGRTPLHAAAFTDHIECLQLLLSHNAQVNAVDSTGKTPLMMAAENGQTSAVEVLVSSAKADLTLQDKNKNTALHLACSKGHE 903          

HSP 6 Score: 102.449 bits (254), Expect = 1.885e-21
Identity = 63/244 (25.82%), Postives = 111/244 (45.49%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKT-VKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEG 880
            P+H AC  GQ  +V  LID   ++  +++    P+H+A+ + H    ++LLV    D+N + +  + P+H    HG      ++I +  +I+  DK G  PLH A + G       LI    D   R      P+H A     +   + L+    +I++ D + R  +H + +G   E + LL+    D   +D + + P+H A      + +  LV     + + D+ G SPL  A  +  +G
Sbjct:  242 PLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQIIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTLITSRADTSKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTHDDFGRTCLHAAAAGGNLECLNLLLSTGADFNKKDKFGRTPLHYAAANCNYQCLFALVGSGASVNDLDERGCSPLHYAATSDTDG 485          

HSP 7 Score: 87.0409 bits (214), Expect = 1.245e-16
Identity = 72/287 (25.09%), Postives = 122/287 (42.51%), Query Frame = 2
Query:  116 EYLEREDLNKK-------RPIHHACERGQTEIVKLL-----IDYNCDIEALDKWNQ-------RPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYR-PLHYACKAGRAETAKLLI---DHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEE----CDQFGNSPLEIAMKTGNEGLIHIL 895
            EYL R D N           +H+A   G    ++L+     +D   +    D  N         P+H A+ +GH + +++LV    D++ R+   R P+  A   GH   V++LI+    I  +D +  R P+H A   G +E  +LLI   D    ++  D   Q P+  +        V  L++   N++++DKW R  +H        E V+ L+ H  +   RD   + PIHLA        +  L+     ++      D  G +PL  A   G++  + +L
Sbjct:  489 EYLLRNDANPGIRDKHGYNAVHYAAAYGHRLCLELIARETPLDVLMETSGTDMLNDAETRAPISPLHLAAYHGHHQALEVLVQSLLDLDVRNSTGRTPLDLAAFKGHVECVDVLINQGASILVKDYVVKRTPIHSAAINGHSECLRLLIGNADVQAAVDIHDGNGQTPLMLSVLNGHTECVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVEALLQHNANFLLRDCRGRTPIHLAAACGHIGVLSALLQTAISVDVVPAIADNHGYTPLHWACYNGHDACVELL 775          

HSP 8 Score: 80.4925 bits (197), Expect = 1.298e-14
Identity = 63/260 (24.23%), Postives = 108/260 (41.54%), Query Frame = 2
Query:  131 EDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAG-IVKLLIDHHCNIESRDKWNRRPIHLSCSG---CCTETV--KLLIDHKCDIEARDWWDQ-------RPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTG 871
            ED N   P+H A   G   ++  LI    D          P+H A+ +G     + L+S   DI+  D++ R  +H A   G+   +NLL+    D   +DK G  PLHYA      +    L+     +   D+    P+H A   +  G  ++ L+ +  N   RDK     +H + +     C E +  +  +D   +    D  +         P+HLA      + +++LV    D++  +  G +PL++A   G
Sbjct:  335 EDKNGNTPLHIAARYGHELLINTLITSRADTSKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTHDDFGRTCLHAAAAGGNLECLNLLLSTGADFNKKDKFGRTPLHYAAANCNYQCLFALVGSGASVNDLDERGCSPLHYAATSDTDGKCLEYLLRNDANPGIRDKHGYNAVHYAAAYGHRLCLELIARETPLDVLMETSGTDMLNDAETRAPISPLHLAAYHGHHQALEVLVQSLLDLDVRNSTGRTPLDLAAFKG 594          

HSP 9 Score: 73.1738 bits (178), Expect = 2.010e-12
Identity = 48/194 (24.74%), Postives = 91/194 (46.91%), Query Frame = 2
Query:  104 FFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDY--NCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDH-HCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCD---IEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCS 667
              ++E  ++ + N   P+H A         ++LID      + ++D   + P+H A+   H + ++LL+S +  +NA D   + P+  A E+G +  V +L+     D+  +DK     LH AC  G   +A L+++   D   I A +   Q P+H A       +V+ L+    ++ + D+    P  L+C+
Sbjct:  775 LLEQEVFQKMEGNSFSPLHCAVINDNEGAAEMLIDTLGTSIVNSVDSKGRTPLHAAAFTDHIECLQLLLSHNAQVNAVDSTGKTPLMMAAENGQTSAVEVLVSSAKADLTLQDKNKNTALHLACSKGHETSALLILEQITDRNLINATNSALQTPLHVAARNGLTVVVQELLGKGASVLAVDENGYTPA-LACA 967          

HSP 10 Score: 72.0182 bits (175), Expect = 4.393e-12
Identity = 53/213 (24.88%), Postives = 90/213 (42.25%), Query Frame = 2
Query:  146 KRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCA---CEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCS----GCCTETVKLLIDHKCDIEARDWWDQRPIHLAC 763
            K P+H     G+    +++I    +I+  DK    P+H A++ GH+  +  L++   D + R      P+H A   G S     L+    DI++ D  G   LH A   G  E   LL+    D   +DK+ + P+H A   C Y+    +  L+    ++   D+    P+H + +    G C E    L+ +  +   RD      +H A 
Sbjct:  307 KTPLHMTAIHGRFSRSQIIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTLITSRADTSKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTHDDFGRTCLHAAAAGGNLECLNLLLSTGADFNKKDKFGRTPLHYAAANCNYQ---CLFALVGSGASVNDLDERGCSPLHYAATSDTDGKCLE---YLLRNDANPGIRDKHGYNAVHYAA 513          

HSP 11 Score: 65.855 bits (159), Expect = 3.865e-10
Identity = 42/179 (23.46%), Postives = 79/179 (44.13%), Query Frame = 2
Query:   80 GSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLV-SLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCD---IESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRP-IHCACEYERAGIVKLLI 601
            G+ ++         +   D   + P+H A      E ++LL+ +N  + A+D   + P+  A++NG    V++LV S   D+  +D+     +H AC  GH     L+++   D   I + +     PLH A + G     + L+     + A D+    P + CA   + A  + L++
Sbjct:  802 GAAEMLIDTLGTSIVNSVDSKGRTPLHAAAFTDHIECLQLLLSHNAQVNAVDSTGKTPLMMAAENGQTSAVEVLVSSAKADLTLQDKNKNTALHLACSKGHETSALLILEQITDRNLINATNSALQTPLHVAARNGLTVVVQELLGKGASVLAVDENGYTPALACAPNKDVADCLALIL 980          
BLAST of SMED30005028 vs. Ensembl Mouse
Match: Ankrd28 (ankyrin repeat domain 28 [Source:MGI Symbol;Acc:MGI:2145661])

HSP 1 Score: 129.028 bits (323), Expect = 9.288e-30
Identity = 75/255 (29.41%), Postives = 126/255 (49.41%), Query Frame = 2
Query:  104 FFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKT 868
             FK+E +  +D  K+ P+H A   G  EI++LLI     + A D     P+H A  +  ++ V++L+    D+NARD+  + P+H A  +        L+    ++   D+ G   LH+A  +G  E  KLL+    +I A DK D+R IH A       +VKLL+ H   +  +DK +  P+H + S      VK L+D   D+   + +   P+H+AC   +   V  L+D   ++ + ++ G +PL  A  +
Sbjct:   58 IFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEEAVQILLKHSADVNARDKNWQTPLHIAAANKAVKCAESLVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAAS 312          

HSP 2 Score: 126.716 bits (317), Expect = 4.774e-29
Identity = 73/255 (28.63%), Postives = 128/255 (50.20%), Query Frame = 2
Query:  134 DLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGC-CTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            D N + P+H A      +  + L+    ++   D+  +  +H+A+ +GH + VKLL+S   +INA D+ DR  IH A   GH  +V LL+ H  ++  +DK  Y PLH A  +G     K L+D   D+   + +   P+H AC   +  +V  LID   N+  +++    P+H + +       ++LL+ +  D+  +    + P+H+     R    + ++     I+  D+ GN+PL IA + G+E LI+ L
Sbjct:  134 DKNWQTPLHIAAANKAVKCAESLVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTL 388          

HSP 3 Score: 115.546 bits (288), Expect = 1.594e-25
Identity = 71/245 (28.98%), Postives = 118/245 (48.16%), Query Frame = 2
Query:  161 HACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
             A   G  + V+ LI    D+   D   + P+H A+  G  + ++LL+     +NA+D     P+HRA        V +L+ H  D+ +RDK    PLH A      + A+ L+    ++   D+  +  +H A       +VKLL+    NI + DK +RR IH +      E VKLL+ H  ++  +D     P+H A ++     VK L+D   D+ E + +GN+PL +A   G + +++ L
Sbjct:   44 QAIFNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEEAVQILLKHSADVNARDKNWQTPLHIAAANKAVKCAESLVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNEL 288          

HSP 4 Score: 105.916 bits (263), Expect = 1.544e-22
Identity = 74/296 (25.00%), Postives = 124/296 (41.89%), Query Frame = 2
Query:   74 RGGSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKA----------------------------------GRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIA 859
            RG +I  F            D   +R IH A   G  E+VKLL+ +  ++   DK +  P+H A+ +G    VK L+ L  D+N  + +   P+H AC +G   +VN LID   ++  +++ G+ PLH+A  +                                  GR   ++ +I     I+  DK    P+H A  Y    ++  LI    +   R      P+HL+     ++  + L+    DI+  D + +  +H A      E + +L++   D  + D+FG SPL  A
Sbjct:  192 RGANINAF------------DKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYA 475          

HSP 5 Score: 92.4337 bits (228), Expect = 2.146e-18
Identity = 64/260 (24.62%), Postives = 111/260 (42.69%), Query Frame = 2
Query:  143 KKRPIHHACERGQTEIVKLLI---DYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEAR----DKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDH--KCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            K+ PIH A   G +E ++LLI   +    ++  D   Q P+  +  NGH   V  L++   +++A+D+W R  +HR    GH   V+ L+ H      RD  G  P+H +   G       L+     ++A     D      +H AC       V+LL++     +  D     P+H +         ++LID      + A D   + P+H A      E +++L+  +  +   D  G +PL +A + G    + +L
Sbjct:  647 KRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSATSVDANPAVVDNHGYTALHWACYNGHETCVELLLEQDV-FQKIDGNAFSPLHCAVINDNEGAAEMLIDSLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSQNAQVNSADSTGKTPLMMAAENGQTNTVEML 905          

HSP 6 Score: 90.5077 bits (223), Expect = 8.823e-18
Identity = 62/244 (25.41%), Postives = 108/244 (44.26%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKT-VKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEG 880
            P+H AC  GQ  +V  LID   ++   ++    P+H+A+ + H    ++LLV    D+N + +  + P+H    HG       +I     I+  DK G  PLH A + G       LI    D   R      P+H A     +   + L+    +I++ D + R  +H + +G   E + LL++   D   +D + + P+H A      + +  LV     + + D+ G +PL  A  +  +G
Sbjct:  272 PLHVACYNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGSGASVNDLDERGCTPLHYAATSDTDG 515          

HSP 7 Score: 77.7962 bits (190), Expect = 6.978e-14
Identity = 68/287 (23.69%), Postives = 122/287 (42.51%), Query Frame = 2
Query:  116 EYLEREDLNKK-------RPIHHACERG----------QTEIVKLLIDYNCDI--EALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYR-PLHYACKAGRAETAKLLIDH---HCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEE----CDQFGNSPLEIAMKTGNEGLIHIL 895
            EYL R D N           +H++   G          +T +  L+     D+  ++ ++    P+H A+ +GH + +++LV    D++ R+   R P+  A   GH   V++LI+    I  +D +  R P+H A   G +E  +LLI +      ++ +D   Q P+  +        V  L++   N++++DKW R  +H        E V  L+ H      RD   + PIHL+        +  L+     ++      D  G + L  A   G+E  + +L
Sbjct:  519 EYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYVLKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSATSVDANPAVVDNHGYTALHWACYNGHETCVELL 805          

HSP 8 Score: 72.7886 bits (177), Expect = 2.126e-12
Identity = 64/260 (24.62%), Postives = 108/260 (41.54%), Query Frame = 2
Query:  131 EDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAG-IVKLLIDHHCNIESRDKWNRRPIHLSCSG--------CCTETVKLLIDHKCDIEARDWWDQR----PIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTG 871
            ED N   P+H A   G   ++  LI    D          P+H A+ +G     + L+S   DI+  D++ R  +H A   G+   +NLL++   D   +DK G  PLHYA      +    L+     +   D+    P+H A   +  G  ++ L+ +  N   RDK     +H S +           +ET   ++      +     D R    P+HLA      + +++LV    D++  +  G +PL++A   G
Sbjct:  365 EDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKG 624          

HSP 9 Score: 70.4774 bits (171), Expect = 1.086e-11
Identity = 56/210 (26.67%), Postives = 95/210 (45.24%), Query Frame = 2
Query:  155 IHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLV-SLHCDI-NARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDH-HCDIEARDKWDQRPIHCAC----EYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLAC 763
            +H AC  G    V+LL++ +   + +D     P+H A  N ++   ++L+ SL   I NA D   R P+H A    H   + LL+  +  + S D  G  PL  A + G+  T ++L+     D+  +DK     +H AC    E     I++ + D +  I + +   + P+H++     T  V+ L+     + A D     P  LAC
Sbjct:  790 LHWACYNGHETCVELLLEQDV-FQKIDGNAFSPLHCAVINDNEGAAEMLIDSLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSQNAQVNSADSTGKTPLMMAAENGQTNTVEMLVSSASADLTLQDKSKNTALHLACGKGHETSALLILEKITDRNL-INATNAALQTPLHVAARNGLTMVVQELLGKGASVLAVDENGYTPA-LAC 996          

HSP 10 Score: 65.4698 bits (158), Expect = 3.592e-10
Identity = 42/179 (23.46%), Postives = 78/179 (43.58%), Query Frame = 2
Query:   80 GSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLV-SLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCD---IESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRP-IHCACEYERAGIVKLLI 601
            G+ ++         +   D   + P+H A      E ++LL+  N  + + D   + P+  A++NG   TV++LV S   D+  +D+     +H AC  GH     L+++   D   I + +     PLH A + G     + L+     + A D+    P + CA   + A  + L++
Sbjct:  832 GAAEMLIDSLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSQNAQVNSADSTGKTPLMMAAENGQTNTVEMLVSSASADLTLQDKSKNTALHLACGKGHETSALLILEKITDRNLINATNAALQTPLHVAARNGLTMVVQELLGKGASVLAVDENGYTPALACAPNKDVADCLALIL 1010          
BLAST of SMED30005028 vs. Ensembl Mouse
Match: Ankrd28 (ankyrin repeat domain 28 [Source:MGI Symbol;Acc:MGI:2145661])

HSP 1 Score: 129.028 bits (323), Expect = 9.400e-30
Identity = 75/255 (29.41%), Postives = 126/255 (49.41%), Query Frame = 2
Query:  104 FFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKT 868
             FK+E +  +D  K+ P+H A   G  EI++LLI     + A D     P+H A  +  ++ V++L+    D+NARD+  + P+H A  +        L+    ++   D+ G   LH+A  +G  E  KLL+    +I A DK D+R IH A       +VKLL+ H   +  +DK +  P+H + S      VK L+D   D+   + +   P+H+AC   +   V  L+D   ++ + ++ G +PL  A  +
Sbjct:   28 IFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEEAVQILLKHSADVNARDKNWQTPLHIAAANKAVKCAESLVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAAS 282          

HSP 2 Score: 127.102 bits (318), Expect = 4.364e-29
Identity = 73/255 (28.63%), Postives = 128/255 (50.20%), Query Frame = 2
Query:  134 DLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGC-CTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            D N + P+H A      +  + L+    ++   D+  +  +H+A+ +GH + VKLL+S   +INA D+ DR  IH A   GH  +V LL+ H  ++  +DK  Y PLH A  +G     K L+D   D+   + +   P+H AC   +  +V  LID   N+  +++    P+H + +       ++LL+ +  D+  +    + P+H+     R    + ++     I+  D+ GN+PL IA + G+E LI+ L
Sbjct:  104 DKNWQTPLHIAAANKAVKCAESLVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTL 358          

HSP 3 Score: 115.546 bits (288), Expect = 1.452e-25
Identity = 72/253 (28.46%), Postives = 121/253 (47.83%), Query Frame = 2
Query:  137 LNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            L  +  +  A   G  + V+ LI    D+   D   + P+H A+  G  + ++LL+     +NA+D     P+HRA        V +L+ H  D+ +RDK    PLH A      + A+ L+    ++   D+  +  +H A       +VKLL+    NI + DK +RR IH +      E VKLL+ H  ++  +D     P+H A ++     VK L+D   D+ E + +GN+PL +A   G + +++ L
Sbjct:    6 LRDQPSLVQAIFNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEEAVQILLKHSADVNARDKNWQTPLHIAAANKAVKCAESLVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNEL 258          

HSP 4 Score: 105.916 bits (263), Expect = 1.412e-22
Identity = 74/296 (25.00%), Postives = 124/296 (41.89%), Query Frame = 2
Query:   74 RGGSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKA----------------------------------GRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIA 859
            RG +I  F            D   +R IH A   G  E+VKLL+ +  ++   DK +  P+H A+ +G    VK L+ L  D+N  + +   P+H AC +G   +VN LID   ++  +++ G+ PLH+A  +                                  GR   ++ +I     I+  DK    P+H A  Y    ++  LI    +   R      P+HL+     ++  + L+    DI+  D + +  +H A      E + +L++   D  + D+FG SPL  A
Sbjct:  162 RGANINAF------------DKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYA 445          

HSP 5 Score: 92.4337 bits (228), Expect = 2.185e-18
Identity = 70/288 (24.31%), Postives = 122/288 (42.36%), Query Frame = 2
Query:  143 KKRPIHHACERGQTEIVKLLI---DYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDR---------------------------------VPIHRACEHGHSGIVNLLIDHHCDIESR----DKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDH--HCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDH-HCDIEECDQFGNSPLEIAMKTGNE 877
            K+ PIH A   G +E ++LLI   +    ++  D   Q P+  +  NGH   V  L++   +++A+D+W R                                  PIH +   GH G++  L+     +++     D  GY  LH+AC  G     +LL++     +  D     P+HCA   +  G  ++LID      + + D   R P+H +      E ++LL+     + + D   + P+ +A    +T TV++LV     D+   D+  N+ L +A   G+E
Sbjct:  617 KRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSATSVDANPAVVDNHGYTALHWACYNGHETCVELLLEQDV-FQKIDGNAFSPLHCAVINDNEGAAEMLIDSLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSQNAQVNSADSTGKTPLMMAAENGQTNTVEMLVSSASADLTLQDKSKNTALHLACGKGHE 903          

HSP 6 Score: 90.5077 bits (223), Expect = 7.909e-18
Identity = 62/244 (25.41%), Postives = 108/244 (44.26%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKT-VKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEG 880
            P+H AC  GQ  +V  LID   ++   ++    P+H+A+ + H    ++LLV    D+N + +  + P+H    HG       +I     I+  DK G  PLH A + G       LI    D   R      P+H A     +   + L+    +I++ D + R  +H + +G   E + LL++   D   +D + + P+H A      + +  LV     + + D+ G +PL  A  +  +G
Sbjct:  242 PLHVACYNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGSGASVNDLDERGCTPLHYAATSDTDG 485          

HSP 7 Score: 77.7962 bits (190), Expect = 6.119e-14
Identity = 68/287 (23.69%), Postives = 122/287 (42.51%), Query Frame = 2
Query:  116 EYLEREDLNKK-------RPIHHACERG----------QTEIVKLLIDYNCDI--EALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYR-PLHYACKAGRAETAKLLIDH---HCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEE----CDQFGNSPLEIAMKTGNEGLIHIL 895
            EYL R D N           +H++   G          +T +  L+     D+  ++ ++    P+H A+ +GH + +++LV    D++ R+   R P+  A   GH   V++LI+    I  +D +  R P+H A   G +E  +LLI +      ++ +D   Q P+  +        V  L++   N++++DKW R  +H        E V  L+ H      RD   + PIHL+        +  L+     ++      D  G + L  A   G+E  + +L
Sbjct:  489 EYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYVLKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSATSVDANPAVVDNHGYTALHWACYNGHETCVELL 775          

HSP 8 Score: 72.7886 bits (177), Expect = 2.067e-12
Identity = 64/260 (24.62%), Postives = 108/260 (41.54%), Query Frame = 2
Query:  131 EDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAG-IVKLLIDHHCNIESRDKWNRRPIHLSCSG--------CCTETVKLLIDHKCDIEARDWWDQR----PIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTG 871
            ED N   P+H A   G   ++  LI    D          P+H A+ +G     + L+S   DI+  D++ R  +H A   G+   +NLL++   D   +DK G  PLHYA      +    L+     +   D+    P+H A   +  G  ++ L+ +  N   RDK     +H S +           +ET   ++      +     D R    P+HLA      + +++LV    D++  +  G +PL++A   G
Sbjct:  335 EDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKG 594          

HSP 9 Score: 70.4774 bits (171), Expect = 1.084e-11
Identity = 56/210 (26.67%), Postives = 95/210 (45.24%), Query Frame = 2
Query:  155 IHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLV-SLHCDI-NARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDH-HCDIEARDKWDQRPIHCAC----EYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLAC 763
            +H AC  G    V+LL++ +   + +D     P+H A  N ++   ++L+ SL   I NA D   R P+H A    H   + LL+  +  + S D  G  PL  A + G+  T ++L+     D+  +DK     +H AC    E     I++ + D +  I + +   + P+H++     T  V+ L+     + A D     P  LAC
Sbjct:  760 LHWACYNGHETCVELLLEQDV-FQKIDGNAFSPLHCAVINDNEGAAEMLIDSLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSQNAQVNSADSTGKTPLMMAAENGQTNTVEMLVSSASADLTLQDKSKNTALHLACGKGHETSALLILEKITDRNL-INATNAALQTPLHVAARNGLTMVVQELLGKGASVLAVDENGYTPA-LAC 966          

HSP 10 Score: 65.4698 bits (158), Expect = 4.147e-10
Identity = 42/179 (23.46%), Postives = 78/179 (43.58%), Query Frame = 2
Query:   80 GSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLV-SLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCD---IESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRP-IHCACEYERAGIVKLLI 601
            G+ ++         +   D   + P+H A      E ++LL+  N  + + D   + P+  A++NG   TV++LV S   D+  +D+     +H AC  GH     L+++   D   I + +     PLH A + G     + L+     + A D+    P + CA   + A  + L++
Sbjct:  802 GAAEMLIDSLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSQNAQVNSADSTGKTPLMMAAENGQTNTVEMLVSSASADLTLQDKSKNTALHLACGKGHETSALLILEKITDRNLINATNAALQTPLHVAARNGLTMVVQELLGKGASVLAVDENGYTPALACAPNKDVADCLALIL 980          
BLAST of SMED30005028 vs. Ensembl Mouse
Match: Ankrd44 (ankyrin repeat domain 44 [Source:MGI Symbol;Acc:MGI:3045243])

HSP 1 Score: 126.331 bits (316), Expect = 7.155e-29
Identity = 71/255 (27.84%), Postives = 131/255 (51.37%), Query Frame = 2
Query:  134 DLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGC-CTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            D N + P+H A      +  +++I     +   D+  +  +H+A+ NGH + V LL++   +INA D+ DR  +H A   GH  +V LLI+H  ++  +DK GY PLH A   G+    K L++   +I+  + +    +H AC   +  +V  LID+  N+   +     P+H + +       ++LL+++  D+  +    + P+H+     R    + L+ +  +I+  D+ GN+PL +A + G+E LI+ L
Sbjct:  104 DKNWQTPLHVAAANKAVKCAEVIIPLLSSVNVSDRGGRTALHHAALNGHMEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASNGQISVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQPNNSGFTPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCVDKDGNTPLHVAARHGHELLINTL 358          

HSP 2 Score: 117.087 bits (292), Expect = 4.289e-26
Identity = 71/251 (28.29%), Postives = 124/251 (49.40%), Query Frame = 2
Query:  143 KKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            ++ P+  A   G  E +++LI    D+ ALD   + P+H A+  G  + ++LL+     +NA+D     P+HRA        V +LI H  D+ +RDK    PLH A      + A+++I     +   D+  +  +H A       +V LL+    NI + DK +RR +H +      + V LLI+H  ++  +D     P+H A +  +   VK L++   +I+E + +GN+ L IA   G + +++ L
Sbjct:    8 EQPPLVQAIFSGDPEEIRMLIHKTEDVNALDSEKRTPLHVAAFLGDAEIIELLILSGARVNAKDNMWLTPLHRAVASRSEEAVQVLIKHSADVNARDKNWQTPLHVAAANKAVKCAEVIIPLLSSVNVSDRGGRTALHHAALNGHMEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASNGQISVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNEL 258          

HSP 3 Score: 115.546 bits (288), Expect = 1.422e-25
Identity = 74/276 (26.81%), Postives = 128/276 (46.38%), Query Frame = 2
Query:   59 FIRAIRGGSIKLFHRFF-KREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGL 883
             ++AI  G  +       K E +   D  K+ P+H A   G  EI++LLI     + A D     P+H A  +  ++ V++L+    D+NARD+  + P+H A  +       ++I     +   D+ G   LH+A   G  E   LL+    +I A DK D+R +H A       +V LLI+H   +  +DK    P+H + S      VK L++   +I+  + +    +H+AC   +   V  L+D+  ++ + +  G +PL  A  + +  L
Sbjct:   12 LVQAIFSGDPEEIRMLIHKTEDVNALDSEKRTPLHVAAFLGDAEIIELLILSGARVNAKDNMWLTPLHRAVASRSEEAVQVLIKHSADVNARDKNWQTPLHVAAANKAVKCAEVIIPLLSSVNVSDRGGRTALHHAALNGHMEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASNGQISVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQPNNSGFTPLHFAAASTHGAL 287          

HSP 4 Score: 91.2781 bits (225), Expect = 4.873e-18
Identity = 67/260 (25.77%), Postives = 116/260 (44.62%), Query Frame = 2
Query:  116 EYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIES---RDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDH--HCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDH-HCDIEECDQFGNSPLEIAMKTGNE 877
            E ++ +D   + P+  A   G  + V LL++   +++A+D      +H     GH++ V++L+     I  +D   R P+H A   GH+  +N L+      E    +D  GY PLH+AC  G     ++L++  C           P+HCA          LL+       +  RD   R  +H +  G   E ++LL+ H   + A D   +  + +A    +   V ILV+    D+   D+  N+PL +A+  G+E
Sbjct:  679 EVVDVKDAKGQTPLMLAVAYGHIDAVSLLLEKEANVDAVDIVGCTALHRGIMTGHEECVQMLLEQEASILCKDSRGRTPLHYAAARGHATWLNELLQIALSEEDCCLKDNQGYTPLHWACYNGNENCIEVLLEQKC-FRKFIGNPFTPLHCAIINGHESCASLLLGAIDPSIVSCRDDKGRTTLHAAAFGDHAECLQLLLRHDAQVNAVDNSGKTALMMAAENGQAGAVDILVNSAQADLTVKDKDLNTPLHLAISKGHE 937          

HSP 5 Score: 82.8037 bits (203), Expect = 1.945e-15
Identity = 78/355 (21.97%), Postives = 141/355 (39.72%), Query Frame = 2
Query:   11 ILINIFIMSNSEHYQCFI-------------------RAIRGGSIKLFHRFFKREYLEREDLNKKRP-------IHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRAC----------------------------EHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDH-HCDIEARDKWD-QRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQR-PIHLACNAKRTETVKILV---DHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            +LIN  I S ++  +C I                   + +  G        F  E++         P       +H A   G  E +KLL     D    DK  + P+HYA+ N H   +K LV+   ++N  D+W R  +H A                             E   +  +  L+ +  +   RDK GY  +HYA   G  +  +LL++  +   E  D    + P+H A        +++L+    +++ RD+  R  ++L+     TE V+ L++    I  +D   +R P+H +     T  +++L+   D+   ++  D  G +PL +A+  G+   + +L
Sbjct:  353 LLINTLITSGADTAKCGIHSMFPLHLAALNAHSDCCRKLLSSGQKYSIVSLFSNEHVLSAGFEIDTPDTFGRTCLHAAAAGGNVECIKLLQSSGADFHKKDKCGRTPLHYAAANCHFHCIKALVTTGANVNETDDWGRTALHYAAASDMDRNKMILGNAHDNSEELERAREVKEKDAALCLEFLLQNDANPSIRDKEGYNSIHYAAAYGHRQCLELLLERTNTGFEESDGGALKSPLHLAAYNGHHQALEVLLQSLVDLDIRDEKGRTALYLAAFKGHTECVEALVNQGASIFVKDNVTKRTPLHASVINGHTLCLRLLLETADNPEVVDVKDAKGQTPLMLAVAYGHIDAVSLL 707          

HSP 6 Score: 71.633 bits (174), Expect = 4.152e-12
Identity = 60/278 (21.58%), Postives = 102/278 (36.69%), Query Frame = 2
Query:  155 IHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKT-VKLLVSLHCDINAR---------------------------------DEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYAC-------------KAGRAETAKLLIDHHC-----DIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQ 832
            +H AC  GQ  +V  LIDY  ++   +     P+H+A+ + H    ++LLV+   D+N +                                 D+    P+H A  HGH  ++N LI    D          PLH A                 +     L  + H      +I+  D + +  +H A        +KLL     +   +DK  R P+H + + C    +K L+    ++   D W +  +H A  +       IL + H + EE ++
Sbjct:  243 LHIACYNGQDAVVNELIDYGANVNQPNNSGFTPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCVDKDGNTPLHVAARHGHELLINTLITSGADTAKCGIHSMFPLHLAALNAHSDCCRKLLSSGQKYSIVSLFSNEHVLSAGFEIDTPDTFGRTCLHAAAAGGNVECIKLLQSSGADFHKKDKCGRTPLHYAAANCHFHCIKALVTTGANVNETDDWGRTALHYAAASDMDRNKMILGNAHDNSEELER 520          

HSP 7 Score: 70.8626 bits (172), Expect = 8.774e-12
Identity = 49/192 (25.52%), Postives = 79/192 (41.15%), Query Frame = 2
Query:  146 KRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHS-------------GIVNLLIDHHC-----DIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCS 667
            K P+H     G+    + LI    +I+ +DK    P+H A+++GH+  +  L++   D          P+H A  + HS              IV+L  + H      +I++ D  G   LH A   G  E  KLL     D   +DK  + P+H A        +K L+    N+   D W R  +H + +
Sbjct:  307 KSPLHMTAVHGRFTRSQTLIQNGGEIDCVDKDGNTPLHVAARHGHELLINTLITSGADTAKCGIHSMFPLHLAALNAHSDCCRKLLSSGQKYSIVSLFSNEHVLSAGFEIDTPDTFGRTCLHAAAAGGNVECIKLLQSSGADFHKKDKCGRTPLHYAAANCHFHCIKALVTTGANVNETDDWGRTALHYAAA 498          

HSP 8 Score: 63.5438 bits (153), Expect = 1.526e-9
Identity = 67/294 (22.79%), Postives = 108/294 (36.73%), Query Frame = 2
Query:  134 DLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHK-------------KTVKLLVSLHC-----DINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCAC-------------------EYERAGIVK---------LLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDH-KCDIEARDWWD-QRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTG 871
            D +   P+H A   G   ++  LI    D       +  P+H A+ N H                V L  + H      +I+  D + R  +H A   G+   + LL     D   +DK G  PLHYA         K L+    ++   D W +  +H A                    E ERA  VK          L+ +  N   RDK     IH + +    + ++LL++      E  D    + P+HLA      + +++L+    D++  D+ G + L +A   G
Sbjct:  336 DKDGNTPLHVAARHGHELLINTLITSGADTAKCGIHSMFPLHLAALNAHSDCCRKLLSSGQKYSIVSLFSNEHVLSAGFEIDTPDTFGRTCLHAAAAGGNVECIKLLQSSGADFHKKDKCGRTPLHYAAANCHFHCIKALVTTGANVNETDDWGRTALHYAAASDMDRNKMILGNAHDNSEELERAREVKEKDAALCLEFLLQNDANPSIRDKEGYNSIHYAAAYGHRQCLELLLERTNTGFEESDGGALKSPLHLAAYNGHHQALEVLLQSLVDLDIRDEKGRTALYLAAFKG 629          

HSP 9 Score: 53.5286 bits (127), Expect = 1.611e-6
Identity = 48/182 (26.37%), Postives = 78/182 (42.86%), Query Frame = 2
Query:  140 NKKRPIHHACERGQTEIVKLLIDY--NCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDH-HCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCD---IEARDKWDQRPIHCACEYERAGIV-KLLIDHHCNI-----ESRDKWNRRP 649
            N   P+H A   G      LL+       +   D   +  +H A+   H + ++LL+     +NA D   +  +  A E+G +G V++L++    D+  +DK    PLH A   G  + A L++D   D   I A++   Q P+H A       +V +LL    C +      SR    R P
Sbjct:  821 NPFTPLHCAIINGHESCASLLLGAIDPSIVSCRDDKGRTTLHAAAFGDHAECLQLLLRHDAQVNAVDNSGKTALMMAAENGQAGAVDILVNSAQADLTVKDKDLNTPLHLAISKGHEKCALLILDKIQDESLINAKNSALQTPLHIAARNGLKVVVEELLAKGACVLAVDENASRSNGPRSP 1002          
BLAST of SMED30005028 vs. Ensembl Mouse
Match: Ankrd44 (ankyrin repeat domain 44 [Source:MGI Symbol;Acc:MGI:3045243])

HSP 1 Score: 125.946 bits (315), Expect = 7.829e-29
Identity = 71/255 (27.84%), Postives = 131/255 (51.37%), Query Frame = 2
Query:  134 DLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGC-CTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            D N + P+H A      +  +++I     +   D+  +  +H+A+ NGH + V LL++   +INA D+ DR  +H A   GH  +V LLI+H  ++  +DK GY PLH A   G+    K L++   +I+  + +    +H AC   +  +V  LID+  N+   +     P+H + +       ++LL+++  D+  +    + P+H+     R    + L+ +  +I+  D+ GN+PL +A + G+E LI+ L
Sbjct:  104 DKNWQTPLHVAAANKAVKCAEVIIPLLSSVNVSDRGGRTALHHAALNGHMEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASNGQISVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQPNNSGFTPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCVDKDGNTPLHVAARHGHELLINTL 358          

HSP 2 Score: 117.087 bits (292), Expect = 4.471e-26
Identity = 71/251 (28.29%), Postives = 124/251 (49.40%), Query Frame = 2
Query:  143 KKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            ++ P+  A   G  E +++LI    D+ ALD   + P+H A+  G  + ++LL+     +NA+D     P+HRA        V +LI H  D+ +RDK    PLH A      + A+++I     +   D+  +  +H A       +V LL+    NI + DK +RR +H +      + V LLI+H  ++  +D     P+H A +  +   VK L++   +I+E + +GN+ L IA   G + +++ L
Sbjct:    8 EQPPLVQAIFSGDPEEIRMLIHKTEDVNALDSEKRTPLHVAAFLGDAEIIELLILSGARVNAKDNMWLTPLHRAVASRSEEAVQVLIKHSADVNARDKNWQTPLHVAAANKAVKCAEVIIPLLSSVNVSDRGGRTALHHAALNGHMEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASNGQISVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNEL 258          

HSP 3 Score: 115.546 bits (288), Expect = 1.397e-25
Identity = 74/276 (26.81%), Postives = 128/276 (46.38%), Query Frame = 2
Query:   59 FIRAIRGGSIKLFHRFF-KREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGL 883
             ++AI  G  +       K E +   D  K+ P+H A   G  EI++LLI     + A D     P+H A  +  ++ V++L+    D+NARD+  + P+H A  +       ++I     +   D+ G   LH+A   G  E   LL+    +I A DK D+R +H A       +V LLI+H   +  +DK    P+H + S      VK L++   +I+  + +    +H+AC   +   V  L+D+  ++ + +  G +PL  A  + +  L
Sbjct:   12 LVQAIFSGDPEEIRMLIHKTEDVNALDSEKRTPLHVAAFLGDAEIIELLILSGARVNAKDNMWLTPLHRAVASRSEEAVQVLIKHSADVNARDKNWQTPLHVAAANKAVKCAEVIIPLLSSVNVSDRGGRTALHHAALNGHMEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASNGQISVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQPNNSGFTPLHFAAASTHGAL 287          

HSP 4 Score: 93.9745 bits (232), Expect = 6.717e-19
Identity = 63/239 (26.36%), Postives = 104/239 (43.51%), Query Frame = 2
Query:  155 IHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKT-VKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKT 868
            +H AC  GQ  +V  LIDY  ++   +     P+H+A+ + H    ++LLV+   D+N + +  + P+H    HG       LI +  +I+  DK G  PLH A + G       LI    D          P+H A     +   + L+     I++ D + R  +H + +G   E +KLL     D   +D   + P+H A        +K LV    ++ E D +G + L  A  +
Sbjct:  243 LHIACYNGQDAVVNELIDYGANVNQPNNSGFTPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCVDKDGNTPLHVAARHGHELLINTLITSGADTAKCGIHSMFPLHLAALNAHSDCCRKLLSSGFEIDTPDTFGRTCLHAAAAGGNVECIKLLQSSGADFHKKDKCGRTPLHYAAANCHFHCIKALVTTGANVNETDDWGRTALHYAAAS 481          

HSP 5 Score: 91.2781 bits (225), Expect = 4.859e-18
Identity = 67/260 (25.77%), Postives = 116/260 (44.62%), Query Frame = 2
Query:  116 EYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIES---RDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDH--HCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDH-HCDIEECDQFGNSPLEIAMKTGNE 877
            E ++ +D   + P+  A   G  + V LL++   +++A+D      +H     GH++ V++L+     I  +D   R P+H A   GH+  +N L+      E    +D  GY PLH+AC  G     ++L++  C           P+HCA          LL+       +  RD   R  +H +  G   E ++LL+ H   + A D   +  + +A    +   V ILV+    D+   D+  N+PL +A+  G+E
Sbjct:  661 EVVDVKDAKGQTPLMLAVAYGHIDAVSLLLEKEANVDAVDIVGCTALHRGIMTGHEECVQMLLEQEASILCKDSRGRTPLHYAAARGHATWLNELLQIALSEEDCCLKDNQGYTPLHWACYNGNENCIEVLLEQKC-FRKFIGNPFTPLHCAIINGHESCASLLLGAIDPSIVSCRDDKGRTTLHAAAFGDHAECLQLLLRHDAQVNAVDNSGKTALMMAAENGQAGAVDILVNSAQADLTVKDKDLNTPLHLAISKGHE 919          

HSP 6 Score: 87.8113 bits (216), Expect = 4.773e-17
Identity = 72/276 (26.09%), Postives = 124/276 (44.93%), Query Frame = 2
Query:  116 EYLEREDLNKK-------RPIHHACERGQTEIVKLLID-YNCDIEALDKWN-QRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYR-PLHYACKAGRAETAKLLI---DHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEEC---DQFGNSPLEIAMKTGNEGLIHIL 895
            E+L + D N           IH+A   G  + ++LL++  N   E  D    + P+H A+ NGH + +++L+    D++ RDE  R  ++ A   GH+  V  L++    I  +D +  R PLH +   G     +LL+   D+   ++ +D   Q P+  A  Y     V LL++   N+++ D      +H        E V++L++ +  I  +D   + P+H A        +  L+      E+C   D  G +PL  A   GNE  I +L
Sbjct:  516 EFLLQNDANPSIRDKEGYNSIHYAAAYGHRQCLELLLERTNTGFEESDGGALKSPLHLAAYNGHHQALEVLLQSLVDLDIRDEKGRTALYLAAFKGHTECVEALVNQGASIFVKDNVTKRTPLHASVINGHTLCLRLLLETADNPEVVDVKDAKGQTPLMLAVAYGHIDAVSLLLEKEANVDAVDIVGCTALHRGIMTGHEECVQMLLEQEASILCKDSRGRTPLHYAAARGHATWLNELLQIALSEEDCCLKDNQGYTPLHWACYNGNENCIEVL 791          

HSP 7 Score: 75.0998 bits (183), Expect = 3.972e-13
Identity = 46/174 (26.44%), Postives = 75/174 (43.10%), Query Frame = 2
Query:  146 KRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCS 667
            K P+H     G+    + LI    +I+ +DK    P+H A+++GH+  +  L++   D          P+H A  + HS     L+    +I++ D  G   LH A   G  E  KLL     D   +DK  + P+H A        +K L+    N+   D W R  +H + +
Sbjct:  307 KSPLHMTAVHGRFTRSQTLIQNGGEIDCVDKDGNTPLHVAARHGHELLINTLITSGADTAKCGIHSMFPLHLAALNAHSDCCRKLLSSGFEIDTPDTFGRTCLHAAAAGGNVECIKLLQSSGADFHKKDKCGRTPLHYAAANCHFHCIKALVTTGANVNETDDWGRTALHYAAA 480          

HSP 8 Score: 73.1738 bits (178), Expect = 1.510e-12
Identity = 66/276 (23.91%), Postives = 108/276 (39.13%), Query Frame = 2
Query:  134 DLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCAC-------------------EYERAGIVK---------LLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDH-KCDIEARDWWD-QRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTG 871
            D +   P+H A   G   ++  LI    D       +  P+H A+ N H    + L+S   +I+  D + R  +H A   G+   + LL     D   +DK G  PLHYA         K L+    ++   D W +  +H A                    E ERA  VK          L+ +  N   RDK     IH + +    + ++LL++      E  D    + P+HLA      + +++L+    D++  D+ G + L +A   G
Sbjct:  336 DKDGNTPLHVAARHGHELLINTLITSGADTAKCGIHSMFPLHLAALNAHSDCCRKLLSSGFEIDTPDTFGRTCLHAAAAGGNVECIKLLQSSGADFHKKDKCGRTPLHYAAANCHFHCIKALVTTGANVNETDDWGRTALHYAAASDMDRNKMILGNAHDNSEELERAREVKEKDAALCLEFLLQNDANPSIRDKEGYNSIHYAAAYGHRQCLELLLERTNTGFEESDGGALKSPLHLAAYNGHHQALEVLLQSLVDLDIRDEKGRTALYLAAFKG 611          

HSP 9 Score: 70.0922 bits (170), Expect = 1.203e-11
Identity = 65/315 (20.63%), Postives = 130/315 (41.27%), Query Frame = 2
Query:   56 CFIRAIRGGSIKLFHRFFKREY-LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQ-----------NGHKKT-----------------VKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDH-HCDIESRDKLGYR-PLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRR-PIHLSCSGCCTETVKLLI---DHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            C   A  GG+++             ++D   + P+H+A        +K L+    ++   D W +  +HYA+            N H  +                 ++ L+    + + RD+     IH A  +GH   + LL++  +   E  D    + PLH A   G  +  ++L+    D++ RD+  +  ++ A        V+ L++   +I  +D   +R P+H S     T  ++LL+   D+   ++ +D   Q P+ LA      + V +L++   +++  D  G + L   + TG+E  + +L
Sbjct:  408 CLHAAAAGGNVECIKLLQSSGADFHKKDKCGRTPLHYAAANCHFHCIKALVTTGANVNETDDWGRTALHYAAASDMDRNKMILGNAHDNSEELERAREVKEKDAALCLEFLLQNDANPSIRDKEGYNSIHYAAAYGHRQCLELLLERTNTGFEESDGGALKSPLHLAAYNGHHQALEVLLQSLVDLDIRDEKGRTALYLAAFKGHTECVEALVNQGASIFVKDNVTKRTPLHASVINGHTLCLRLLLETADNPEVVDVKDAKGQTPLMLAVAYGHIDAVSLLLEKEANVDAVDIVGCTALHRGIMTGHEECVQML 722          

HSP 10 Score: 53.5286 bits (127), Expect = 1.577e-6
Identity = 48/182 (26.37%), Postives = 78/182 (42.86%), Query Frame = 2
Query:  140 NKKRPIHHACERGQTEIVKLLIDY--NCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDH-HCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCD---IEARDKWDQRPIHCACEYERAGIV-KLLIDHHCNI-----ESRDKWNRRP 649
            N   P+H A   G      LL+       +   D   +  +H A+   H + ++LL+     +NA D   +  +  A E+G +G V++L++    D+  +DK    PLH A   G  + A L++D   D   I A++   Q P+H A       +V +LL    C +      SR    R P
Sbjct:  803 NPFTPLHCAIINGHESCASLLLGAIDPSIVSCRDDKGRTTLHAAAFGDHAECLQLLLRHDAQVNAVDNSGKTALMMAAENGQAGAVDILVNSAQADLTVKDKDLNTPLHLAISKGHEKCALLILDKIQDESLINAKNSALQTPLHIAARNGLKVVVEELLAKGACVLAVDENASRSNGPRSP 984          
BLAST of SMED30005028 vs. Ensembl Mouse
Match: Tnks (tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase [Source:MGI Symbol;Acc:MGI:1341087])

HSP 1 Score: 121.709 bits (304), Expect = 2.480e-27
Identity = 80/290 (27.59%), Postives = 127/290 (43.79%), Query Frame = 2
Query:   59 FIRAIRGGSIKLFHRFFKREYLEREDL--NKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRA------------ETAK---------LLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIA 859
             + A R G +    R      +  +D+   K  P+H A   G+ ++V+ L+    ++ A D     P+H A   GH + V LL+    D NARD W+  P+H A   G   +  +L+ H  D   R+  G   L  A  + +A            E A+         LL   + +  A D     P+H A  Y R  IV+LL+ H  ++ ++DK    P+H +CS    E  +LL+ H   + A D W   P+H A +  R E   +L+ H  D    +  G S +++A
Sbjct:  179 LLEACRNGDVSRVKRLVDAANVNAKDMAGRKSSPLHFAAGFGRKDVVEHLLQMGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLADPSAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMA 468          

HSP 2 Score: 107.071 bits (266), Expect = 6.334e-23
Identity = 72/291 (24.74%), Postives = 122/291 (41.92%), Query Frame = 2
Query:   59 FIRAIRGGSIKLFHRFFKREYLEREDLNKK--RPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKW----------------------DQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIA 859
             + A + G ++   +    + +   DL  +   P+H A    +  +V+ L+ +  D+ A DK    P+H A   GH +  +LLV     +N  D W   P+H A   G   I  LL+ H  D   +++ G  PL    K G  +   LL      ++A  K                       +  P+H A  Y    + + L++H  ++ ++DK    P+H + S    +   LLI +   + A D W   P+H A    RT+   +L+ H  D    +Q G +PL++A
Sbjct:  647 LLEASKAGDLETVKQLCSPQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDL-VKEGDTDIQDLLRGDAALLDAAKKGCLARVQKLCTPENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQEGQTPLDLA 936          

HSP 3 Score: 102.834 bits (255), Expect = 1.356e-21
Identity = 73/254 (28.74%), Postives = 123/254 (48.43%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHC----DIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHILNG 901
            P+H A ER   +++++L  +   + ALD   Q  +H A+  GH +T +LL+S   D         +    A + G+  +  +L +    + + D + YR L  A KAG  ET K L         D+E R      P+H A  Y R  +V+ L+ H  ++ ++DK    P+H +CS    E  +LL+ H   +   D W   P+H A    + E  K+L+ H  D  + ++ GN+PL++ +K G+  +  +L G
Sbjct:  554 PLHVAAERAHNDVMEVLHKHGAKMNALDSLGQTALHRAALAGHLQTCRLLLSYGSD----PSIISLQGFTAAQMGNEAVQQILSE-STPMRTSD-VDYRLLE-ASKAGDLETVKQLCSPQNVNCRDLEGRHST---PLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDL-VKEGDTDIQDLLRG 796          

HSP 4 Score: 93.5893 bits (231), Expect = 8.604e-19
Identity = 65/266 (24.44%), Postives = 113/266 (42.48%), Query Frame = 2
Query:  164 ACERGQTEIVKLL-IDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYER---------------------AGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            A + G  E VK L    N +   L+  +  P+H+A+       V+ L+    D++A+D+   VP+H AC +GH  +  LL+ H   +   D   + PLH A   G+ E  KLL+ H  D   +++    P+    E +                      A + KL    + N       N  P+HL+      E  + L++H  D+ A+D     P+H A +    +   +L+ ++  +   D++  +PL  A + G   L  +L
Sbjct:  650 ASKAGDLETVKQLCSPQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDLVKEGDTDIQDLLRGDAALLDAAKKGCLARVQKLCTPENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALL 915          

HSP 5 Score: 71.2478 bits (173), Expect = 6.841e-12
Identity = 38/121 (31.40%), Postives = 63/121 (52.07%), Query Frame = 2
Query:  242 NQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLID 604
            N  P+H A+   + +  + L+    D+NA+D+   +P+H A  +GH  I  LLI ++  + + DK  + PLH A + GR +   LL+ H  D   +++  Q P+  A   +   I  LLID
Sbjct:  830 NSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQEGQTPLDLATADD---IRALLID 947          
BLAST of SMED30005028 vs. UniProt/SwissProt
Match: sp|Q505D1|ANR28_MOUSE (Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus OX=10090 GN=Ankrd28 PE=1 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 6.576e-29
Identity = 75/255 (29.41%), Postives = 126/255 (49.41%), Query Frame = 2
Query:  104 FFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKT 868
             FK+E +  +D  K+ P+H A   G  EI++LLI     + A D     P+H A  +  ++ V++L+    D+NARD+  + P+H A  +        L+    ++   D+ G   LH+A  +G  E  KLL+    +I A DK D+R IH A       +VKLL+ H   +  +DK +  P+H + S      VK L+D   D+   + +   P+H+AC   +   V  L+D   ++ + ++ G +PL  A  +
Sbjct:   28 IFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEEAVQILLKHSADVNARDKNWQTPLHIAAANKAVKCAESLVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAAS 282          

HSP 2 Score: 127.102 bits (318), Expect = 3.053e-28
Identity = 73/255 (28.63%), Postives = 128/255 (50.20%), Query Frame = 2
Query:  134 DLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGC-CTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            D N + P+H A      +  + L+    ++   D+  +  +H+A+ +GH + VKLL+S   +INA D+ DR  IH A   GH  +V LL+ H  ++  +DK  Y PLH A  +G     K L+D   D+   + +   P+H AC   +  +V  LID   N+  +++    P+H + +       ++LL+ +  D+  +    + P+H+     R    + ++     I+  D+ GN+PL IA + G+E LI+ L
Sbjct:  104 DKNWQTPLHIAAANKAVKCAESLVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTL 358          

HSP 3 Score: 115.546 bits (288), Expect = 1.016e-24
Identity = 72/253 (28.46%), Postives = 121/253 (47.83%), Query Frame = 2
Query:  137 LNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            L  +  +  A   G  + V+ LI    D+   D   + P+H A+  G  + ++LL+     +NA+D     P+HRA        V +L+ H  D+ +RDK    PLH A      + A+ L+    ++   D+  +  +H A       +VKLL+    NI + DK +RR IH +      E VKLL+ H  ++  +D     P+H A ++     VK L+D   D+ E + +GN+PL +A   G + +++ L
Sbjct:    6 LRDQPSLVQAIFNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEEAVQILLKHSADVNARDKNWQTPLHIAAANKAVKCAESLVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNEL 258          

HSP 4 Score: 105.916 bits (263), Expect = 9.878e-22
Identity = 74/296 (25.00%), Postives = 124/296 (41.89%), Query Frame = 2
Query:   74 RGGSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKA----------------------------------GRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIA 859
            RG +I  F            D   +R IH A   G  E+VKLL+ +  ++   DK +  P+H A+ +G    VK L+ L  D+N  + +   P+H AC +G   +VN LID   ++  +++ G+ PLH+A  +                                  GR   ++ +I     I+  DK    P+H A  Y    ++  LI    +   R      P+HL+     ++  + L+    DI+  D + +  +H A      E + +L++   D  + D+FG SPL  A
Sbjct:  162 RGANINAF------------DKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYA 445          

HSP 5 Score: 92.4337 bits (228), Expect = 1.528e-17
Identity = 70/288 (24.31%), Postives = 122/288 (42.36%), Query Frame = 2
Query:  143 KKRPIHHACERGQTEIVKLLI---DYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDR---------------------------------VPIHRACEHGHSGIVNLLIDHHCDIESR----DKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDH--HCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDH-HCDIEECDQFGNSPLEIAMKTGNE 877
            K+ PIH A   G +E ++LLI   +    ++  D   Q P+  +  NGH   V  L++   +++A+D+W R                                  PIH +   GH G++  L+     +++     D  GY  LH+AC  G     +LL++     +  D     P+HCA   +  G  ++LID      + + D   R P+H +      E ++LL+     + + D   + P+ +A    +T TV++LV     D+   D+  N+ L +A   G+E
Sbjct:  617 KRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSATSVDANPAVVDNHGYTALHWACYNGHETCVELLLEQDV-FQKIDGNAFSPLHCAVINDNEGAAEMLIDSLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSQNAQVNSADSTGKTPLMMAAENGQTNTVEMLVSSASADLTLQDKSKNTALHLACGKGHE 903          

HSP 6 Score: 90.5077 bits (223), Expect = 5.532e-17
Identity = 62/244 (25.41%), Postives = 108/244 (44.26%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKT-VKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEG 880
            P+H AC  GQ  +V  LID   ++   ++    P+H+A+ + H    ++LLV    D+N + +  + P+H    HG       +I     I+  DK G  PLH A + G       LI    D   R      P+H A     +   + L+    +I++ D + R  +H + +G   E + LL++   D   +D + + P+H A      + +  LV     + + D+ G +PL  A  +  +G
Sbjct:  242 PLHVACYNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGSGASVNDLDERGCTPLHYAATSDTDG 485          

HSP 7 Score: 77.7962 bits (190), Expect = 4.280e-13
Identity = 68/287 (23.69%), Postives = 122/287 (42.51%), Query Frame = 2
Query:  116 EYLEREDLNKK-------RPIHHACERG----------QTEIVKLLIDYNCDI--EALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYR-PLHYACKAGRAETAKLLIDH---HCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEE----CDQFGNSPLEIAMKTGNEGLIHIL 895
            EYL R D N           +H++   G          +T +  L+     D+  ++ ++    P+H A+ +GH + +++LV    D++ R+   R P+  A   GH   V++LI+    I  +D +  R P+H A   G +E  +LLI +      ++ +D   Q P+  +        V  L++   N++++DKW R  +H        E V  L+ H      RD   + PIHL+        +  L+     ++      D  G + L  A   G+E  + +L
Sbjct:  489 EYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYVLKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSATSVDANPAVVDNHGYTALHWACYNGHETCVELL 775          

HSP 8 Score: 72.7886 bits (177), Expect = 1.446e-11
Identity = 64/260 (24.62%), Postives = 108/260 (41.54%), Query Frame = 2
Query:  131 EDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAG-IVKLLIDHHCNIESRDKWNRRPIHLSCSG--------CCTETVKLLIDHKCDIEARDWWDQR----PIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTG 871
            ED N   P+H A   G   ++  LI    D          P+H A+ +G     + L+S   DI+  D++ R  +H A   G+   +NLL++   D   +DK G  PLHYA      +    L+     +   D+    P+H A   +  G  ++ L+ +  N   RDK     +H S +           +ET   ++      +     D R    P+HLA      + +++LV    D++  +  G +PL++A   G
Sbjct:  335 EDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKG 594          

HSP 9 Score: 70.4774 bits (171), Expect = 7.582e-11
Identity = 56/210 (26.67%), Postives = 95/210 (45.24%), Query Frame = 2
Query:  155 IHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLV-SLHCDI-NARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDH-HCDIEARDKWDQRPIHCAC----EYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLAC 763
            +H AC  G    V+LL++ +   + +D     P+H A  N ++   ++L+ SL   I NA D   R P+H A    H   + LL+  +  + S D  G  PL  A + G+  T ++L+     D+  +DK     +H AC    E     I++ + D +  I + +   + P+H++     T  V+ L+     + A D     P  LAC
Sbjct:  760 LHWACYNGHETCVELLLEQDV-FQKIDGNAFSPLHCAVINDNEGAAEMLIDSLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSQNAQVNSADSTGKTPLMMAAENGQTNTVEMLVSSASADLTLQDKSKNTALHLACGKGHETSALLILEKITDRNL-INATNAALQTPLHVAARNGLTMVVQELLGKGASVLAVDENGYTPA-LAC 966          

HSP 10 Score: 65.4698 bits (158), Expect = 2.901e-9
Identity = 42/179 (23.46%), Postives = 78/179 (43.58%), Query Frame = 2
Query:   80 GSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLV-SLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCD---IESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRP-IHCACEYERAGIVKLLI 601
            G+ ++         +   D   + P+H A      E ++LL+  N  + + D   + P+  A++NG   TV++LV S   D+  +D+     +H AC  GH     L+++   D   I + +     PLH A + G     + L+     + A D+    P + CA   + A  + L++
Sbjct:  802 GAAEMLIDSLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSQNAQVNSADSTGKTPLMMAAENGQTNTVEMLVSSASADLTLQDKSKNTALHLACGKGHETSALLILEKITDRNLINATNAALQTPLHVAARNGLTMVVQELLGKGASVLAVDENGYTPALACAPNKDVADCLALIL 980          
BLAST of SMED30005028 vs. UniProt/SwissProt
Match: sp|Q5UPG5|YL093_MIMIV (Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_L93 PE=4 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 1.429e-28
Identity = 80/271 (29.52%), Postives = 128/271 (47.23%), Query Frame = 2
Query:   62 IRAIRGGSIKLFHRFFKREY-LEREDLNKKRPIHHACERGQT----EIVKLLIDYNCDIEALDK--WNQRPI--HYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSG----IVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAG----IVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEE 823
            I +    +I        R+  + ++D   K     AC+   T    + VKLL++   +I+ LD   W    I   YA+   + KT+KLL+    D N +D+     +  AC++ ++     I+ LL+D   DI + +  G+  L +ACK    E  KLL+D + DI A+DK     +  AC+Y        I+KLL+D   +I + +      +  +C     E +KLL+D   DI A+D     P+  AC     ET+K+L+D   DI E
Sbjct:  149 INSNESSTIATVKLLLNRDADINKKDNQGKNSFMWACQYSNTTSNIKTVKLLLNRGSNIDELDNNGWTALMIACKYANTTSNIKTIKLLLDRGADTNIKDKIGLTALMLACKYANTPNSIEIIKLLLDKGADINTGNGEGWTALMFACKYANIEAIKLLLDKNADINAKDKIGLTALMLACKYANTPNSIEIIKLLLDKGADINTGNGEGWTALMFACKYANIEAIKLLLDKNADINAKDKDGWTPLMFACVYANIETIKLLLDKRADINE 419          

HSP 2 Score: 106.686 bits (265), Expect = 5.596e-23
Identity = 80/293 (27.30%), Postives = 123/293 (41.98%), Query Frame = 2
Query:  176 GQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKK----TVKLLVSLHCDINARDEWDRVPIHRACEHGHSG-----------------------------------------IVNLLIDHHCDIESRDKLGYRPLHYACKAGRA----ETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCT----ETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            G T+IVKLL+DY+  I+  D+     + YAS N ++     TVKLL++   DIN +D   +     AC++ ++                                           + LL+D   D   +DK+G   L  ACK        E  KLL+D   DI   +      +  AC+Y     +KLL+D + +I ++DK     + L+C    T    E +KLL+D   DI   +      +  AC     E +K+L+D + DI   D+ G +PL  A    N   I +L
Sbjct:  118 GSTDIVKLLLDYDAKIDISDEDGWTALMYASINSNESSTIATVKLLLNRDADINKKDNQGKNSFMWACQYSNTTSNIKTVKLLLNRGSNIDELDNNGWTALMIACKYANTTSNIKTIKLLLDRGADTNIKDKIGLTALMLACKYANTPNSIEIIKLLLDKGADINTGNGEGWTALMFACKYANIEAIKLLLDKNADINAKDKIGLTALMLACKYANTPNSIEIIKLLLDKGADINTGNGEGWTALMFACKYANIEAIKLLLDKNADINAKDKDGWTPLMFACVYANIETIKLL 410          
BLAST of SMED30005028 vs. UniProt/SwissProt
Match: sp|O15084|ANR28_HUMAN (Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens OX=9606 GN=ANKRD28 PE=1 SV=5)

HSP 1 Score: 127.872 bits (320), Expect = 1.809e-28
Identity = 75/255 (29.41%), Postives = 125/255 (49.02%), Query Frame = 2
Query:  104 FFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKT 868
             FK+E +  +D  K+ P+H A   G  EI++LLI     + A D     P+H A  +  ++ V++L+    D+NARD+  + P+H A  +        L+    ++   D+ G   LH+A  +G  E  KLL+    +I A DK D+R IH A       +VKLL+ H   +  +DK +  P+H + S      VK L+D   D+   + +   P+H+AC   +   V  L+D    + + ++ G +PL  A  +
Sbjct:   28 IFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAAS 282          

HSP 2 Score: 124.02 bits (310), Expect = 2.811e-27
Identity = 72/255 (28.24%), Postives = 127/255 (49.80%), Query Frame = 2
Query:  134 DLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGC-CTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            D N + P+H A      +  + L+    ++   D+  +  +H+A+ +GH + VKLL+S   +INA D+ DR  IH A   GH  +V LL+ H  ++  +DK  Y PLH A  +G     K L+D   D+   + +   P+H AC   +  +V  LID    +  +++    P+H + +       ++LL+ +  D+  +    + P+H+     R    + ++     I+  D+ GN+PL IA + G+E LI+ L
Sbjct:  104 DKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTL 358          

HSP 3 Score: 115.931 bits (289), Expect = 8.134e-25
Identity = 72/253 (28.46%), Postives = 121/253 (47.83%), Query Frame = 2
Query:  137 LNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            L  +  +  A   G  + V+ LI    D+   D   + P+H A+  G  + ++LL+     +NA+D     P+HRA        V +L+ H  D+ +RDK    PLH A      + A+ L+    ++   D+  +  +H A       +VKLL+    NI + DK +RR IH +      E VKLL+ H  ++  +D     P+H A ++     VK L+D   D+ E + +GN+PL +A   G + +++ L
Sbjct:    6 LRDQPSLVQAIFNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNEL 258          

HSP 4 Score: 103.99 bits (258), Expect = 3.407e-21
Identity = 74/296 (25.00%), Postives = 123/296 (41.55%), Query Frame = 2
Query:   74 RGGSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKA----------------------------------GRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIA 859
            RG +I  F            D   +R IH A   G  E+VKLL+ +  ++   DK +  P+H A+ +G    VK L+ L  D+N  + +   P+H AC +G   +VN LID    +  +++ G+ PLH+A  +                                  GR   ++ +I     I+  DK    P+H A  Y    ++  LI    +   R      P+HL+     ++  + L+    DI+  D + +  +H A      E + +L++   D  + D+FG SPL  A
Sbjct:  162 RGANINAF------------DKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYA 445          

HSP 5 Score: 93.5893 bits (231), Expect = 5.885e-18
Identity = 65/267 (24.34%), Postives = 116/267 (43.45%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVKLLI---DYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEAR----DKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLID--HKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            L ++ + K+ PIH A   G +E ++LLI   +    ++  D   Q P+  +  NGH   V  L++   +++A+D+W R  +HR    GH   V+ L+ H      RD  G  P+H +   G       L+     ++A     D      +H AC       V+LL++     +  +     P+H +         ++LID      + A D   + P+H A      E +++L+ H+  +   D  G +PL +A + G    + +L
Sbjct:  610 LVKDYILKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWACYNGHETCVELLLEQEV-FQKTEGNAFSPLHCAVINDNEGAAEMLIDTLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEML 875          

HSP 6 Score: 88.5817 bits (218), Expect = 2.019e-16
Identity = 62/244 (25.41%), Postives = 107/244 (43.85%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKT-VKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEG 880
            P+H AC  GQ  +V  LID    +   ++    P+H+A+ + H    ++LLV    D+N + +  + P+H    HG       +I     I+  DK G  PLH A + G       LI    D   R      P+H A     +   + L+    +I++ D + R  +H + +G   E + LL++   D   +D + + P+H A      + +  LV     + + D+ G +PL  A  +  +G
Sbjct:  242 PLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGSGASVNDLDERGCTPLHYAATSDTDG 485          

HSP 7 Score: 77.7962 bits (190), Expect = 4.621e-13
Identity = 68/287 (23.69%), Postives = 122/287 (42.51%), Query Frame = 2
Query:  116 EYLEREDLNKK-------RPIHHACERG----------QTEIVKLLIDYNCDI--EALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYR-PLHYACKAGRAETAKLLIDH---HCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIE----ECDQFGNSPLEIAMKTGNEGLIHIL 895
            EYL R D N           +H++   G          +T +  L+     D+  ++ ++    P+H A+ +GH + +++LV    D++ R+   R P+  A   GH   V++LI+    I  +D +  R P+H A   G +E  +LLI +      ++ +D   Q P+  +        V  L++   N++++DKW R  +H        E V  L+ H      RD   + PIHL+        +  L+     ++      D  G + L  A   G+E  + +L
Sbjct:  489 EYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYILKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWACYNGHETCVELL 775          

HSP 8 Score: 72.7886 bits (177), Expect = 1.409e-11
Identity = 64/260 (24.62%), Postives = 108/260 (41.54%), Query Frame = 2
Query:  131 EDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAG-IVKLLIDHHCNIESRDKWNRRPIHLSCSG--------CCTETVKLLIDHKCDIEARDWWDQR----PIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTG 871
            ED N   P+H A   G   ++  LI    D          P+H A+ +G     + L+S   DI+  D++ R  +H A   G+   +NLL++   D   +DK G  PLHYA      +    L+     +   D+    P+H A   +  G  ++ L+ +  N   RDK     +H S +           +ET   ++      +     D R    P+HLA      + +++LV    D++  +  G +PL++A   G
Sbjct:  335 EDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKG 594          

HSP 9 Score: 65.855 bits (159), Expect = 2.173e-9
Identity = 41/179 (22.91%), Postives = 79/179 (44.13%), Query Frame = 2
Query:   80 GSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLV-SLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCD---IESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRP-IHCACEYERAGIVKLLI 601
            G+ ++         +   D   + P+H A      E ++LL+ +N  + ++D   + P+  A++NG   TV++LV S   ++  +D      +H AC  GH     L+++   D   I + +     PLH A + G     + L+     + A D+    P + CA   + A  + L++
Sbjct:  802 GAAEMLIDTLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEMLVSSASAELTLQDNSKNTALHLACSKGHETSALLILEKITDRNLINATNAALQTPLHVAARNGLTMVVQELLGKGASVLAVDENGYTPALACAPNKDVADCLALIL 980          

HSP 10 Score: 64.6994 bits (156), Expect = 4.667e-9
Identity = 53/210 (25.24%), Postives = 93/210 (44.29%), Query Frame = 2
Query:  155 IHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLV-SLHCDI-NARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDH-HCDIEARDKWDQRPIHCAC----EYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLAC 763
            +H AC  G    V+LL++     +  +     P+H A  N ++   ++L+ +L   I NA D   R P+H A    H   + LL+ H+  + S D  G  PL  A + G+  T ++L+     ++  +D      +H AC    E     I++ + D +  I + +   + P+H++     T  V+ L+     + A D     P  LAC
Sbjct:  760 LHWACYNGHETCVELLLEQEV-FQKTEGNAFSPLHCAVINDNEGAAEMLIDTLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEMLVSSASAELTLQDNSKNTALHLACSKGHETSALLILEKITDRNL-INATNAALQTPLHVAARNGLTMVVQELLGKGASVLAVDENGYTPA-LAC 966          
BLAST of SMED30005028 vs. UniProt/SwissProt
Match: sp|Q502K3|ANR52_DANRE (Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio OX=7955 GN=ankrd52 PE=2 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 2.225e-28
Identity = 73/266 (27.44%), Postives = 134/266 (50.38%), Query Frame = 2
Query:   86 IKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGL 883
            +KLF    K++ +   D  ++ P+H A   G   I+ LLI    ++ A D     P+H A+ + +++ V LL+    D+ ARD++ + P+H A  +  +  V  L+ H   +   D+ G  PLH+A ++G  E  KLL++   ++ A DK D++PIH A       +VKLL+    +   +DK    P+H + +    + VK L+ +  +I+  + +    +H+AC   +      LV+   ++ + +  G +PL +A  + N  L
Sbjct:   24 VKLF--LHKKDEVNALDQERRTPLHAAAWLGDVHIMDLLISAGANVNAKDHVWLTPLHRAAASRNERAVGLLLRKGADVTARDKYWQTPLHIAAANRATRCVETLLPHVSSLNMADRTGRAPLHHAAQSGYQEMVKLLLNKGANLSASDKKDRQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLHAAAASGHVDVVKYLLRNGAEIDEPNAFGNTALHVACYTGQEAVANELVNRGANVNQPNHRGYTPLHLAAVSTNGAL 287          

HSP 2 Score: 121.709 bits (304), Expect = 1.313e-26
Identity = 73/250 (29.20%), Postives = 124/250 (49.60%), Query Frame = 2
Query:  134 DLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGL 883
            +++ + P+  A      + VKL +    ++ ALD+  + P+H A+  G    + LL+S   ++NA+D     P+HRA    +   V LL+    D+ +RDK    PLH A         + L+ H   +   D+  + P+H A +     +VKLL++   N+ + DK +R+PIH +      E VKLL+    D   +D     P+H A  +   + VK L+ +  +I+E + FGN+ L +A  TG E +
Sbjct:    5 NISDQPPLVQAIFNRNADEVKLFLHKKDEVNALDQERRTPLHAAAWLGDVHIMDLLISAGANVNAKDHVWLTPLHRAAASRNERAVGLLLRKGADVTARDKYWQTPLHIAAANRATRCVETLLPHVSSLNMADRTGRAPLHHAAQSGYQEMVKLLLNKGANLSASDKKDRQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLHAAAASGHVDVVKYLLRNGAEIDEPNAFGNTALHVACYTGQEAV 254          

HSP 3 Score: 102.064 bits (253), Expect = 1.588e-20
Identity = 75/325 (23.08%), Postives = 130/325 (40.00%), Query Frame = 2
Query:   86 IKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVN----------------------------------LLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSC----SGCCTETVKL--------------LIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHILNGV 904
            +KL     K   L   D   ++PIH A   G  E+VKLL+    D    DK    P+H A+ +GH   VK L+    +I+  + +    +H AC  G   + N                                  LL+++  D+  + K G  PLH A   GR   +++LI +  +I+  D++   P+H A +Y    ++  L+ +  +   +      P+HL+     S CC + +                ++    DI   D + +  +H A +    E + +L+    D+ + D+FG +PL  A   G    + +L G 
Sbjct:  156 VKLL--LNKGANLSASDKKDRQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLHAAAASGHVDVVKYLLRNGAEIDEPNAFGNTALHVACYTGQEAVANELVNRGANVNQPNHRGYTPLHLAAVSTNGALCLELLVNNGADVNMQSKEGKSPLHMAAIHGRFTRSQILIQNGGEIDCVDRYGNTPLHVAAKYGHELLISTLMTNGADTARQGIHGMFPLHLAVLYGSSDCCRKLLSSGQLYSIVLSMSKEHVLSAGFDINTPDNFGRTCLHAAASGGNIECLNLLLSSGADMNKKDKFGRTPLHYAAANGRYQCVVVLVGA 478          

HSP 4 Score: 80.1073 bits (196), Expect = 7.544e-14
Identity = 56/261 (21.46%), Postives = 113/261 (43.30%), Query Frame = 2
Query:  104 FFKREYLEREDLNKKRPIHHACERGQTEI------------VKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPL 850
            +  +E +  E +N+   ++    RG T +            ++LL++   D+    K  + P+H A+ +G     ++L+    +I+  D +   P+H A ++GH  +++ L+ +  D   +   G  PLH A   G ++  + L+                I  +   E       ++    +I + D + R  +H + SG   E + LL+    D+  +D + + P+H A    R + V +LV    ++ E D+ G +PL
Sbjct:  248 YTGQEAVANELVNRGANVNQPNHRGYTPLHLAAVSTNGALCLELLVNNGADVNMQSKEGKSPLHMAAIHGRFTRSQILIQNGGEIDCVDRYGNTPLHVAAKYGHELLISTLMTNGADTARQGIHGMFPLHLAVLYGSSDCCRKLL---------SSGQLYSIVLSMSKEH------VLSAGFDINTPDNFGRTCLHAAASGGNIECLNLLLSSGADMNKKDKFGRTPLHYAAANGRYQCVVVLVGAGAEVNERDRSGCTPL 493          

HSP 5 Score: 77.0258 bits (188), Expect = 7.182e-13
Identity = 64/250 (25.60%), Postives = 112/250 (44.80%), Query Frame = 2
Query:  134 DLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQR----PIHYASQNGHKKTVKLLVSLH-CDINARDEWDRVPIHRACEHGHSGIVNLLIDHH-CD--IESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDH-HCNIESRDKWNRRPIHLSCSGC---CTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSP 847
            D   +  +H A   G  +I+  L+      +  D    R    P H+A+ +GH+  +++L+ L  C I   + +   P+H A  +GHSG   LL++   C+  +  RD  G  PLH A  A      +L++    DI+A D   +  +  A +Y ++G V LL+     ++   D      +HL+CS     C   +   I +   I A +   Q P+H+A        V+ L++    +   D+ G++P
Sbjct:  745 DFQGRSALHLAASCGHADILSNLLSAADHSQPQDPLTDRHGYTPAHWAAYHGHEDCLEVLLELKPCSIQEGNPF--TPLHCALINGHSGSAELLLESSVCNSLVNIRDAKGRTPLHAAAVAEDVAGLQLVLRQGADIDAVDHSGRSALMVAADYGQSGAVALLLHRAKADLSLLDVNKNTALHLACSKAHEMCAMLILKEIHNPILINATNSMLQMPLHIAARNGLATVVQALLNRGATVLAVDEEGHTP 992          

HSP 6 Score: 76.2554 bits (186), Expect = 1.325e-12
Identity = 67/268 (25.00%), Postives = 120/268 (44.78%), Query Frame = 2
Query:  125 EREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCD---INARDEWDRVPIHRACEHGHSGIVNLLI--DHHCD-IESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQR----PIHLACNAKRTETVKILVD-HHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            ++E      P+H A E G  E V +LI+    ++  D   +  ++ ASQ GH + V+LL+S          R +W   P+H A  +GHS  + +L+  +   D +   D  G  PL  A   G  +   LL++     + +D+  +  +H      R   +  L+ H+ ++ SRD   R  +HL+ S    + +  L+      + +D    R    P H A      + +++L++   C I+E + F  +PL  A+  G+ G   +L
Sbjct:  573 DKESNGSISPLHLAVESGHWECVTVLIESGVCVDVCDPVGRSVLYLASQRGHSRCVELLLSQSASCLLAEHRSKWG--PLHVAAANGHSECLRMLLCSEGGADLVNVTDAEGQTPLMLAVLGGHTDCVHLLLERGACPDMKDRRGRTALHRGAVMGREDCLTALLSHNVSVLSRDFQGRSALHLAASCGHADILSNLLSAADHSQPQDPLTDRHGYTPAHWAAYHGHEDCLEVLLELKPCSIQEGNPF--TPLHCALINGHSGSAELL 836          

HSP 7 Score: 75.8702 bits (185), Expect = 1.597e-12
Identity = 65/269 (24.16%), Postives = 118/269 (43.87%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVKLLI--DYNCD-IEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQR----PIHCACEYERAGIVKLLID-HHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHK-CD--IEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            L  E  +K  P+H A   G +E +++L+  +   D +   D   Q P+  A   GH   V LL+      + +D   R  +HR    G    +  L+ H+  + SRD  G   LH A   G A+    L+      + +D    R    P H A  +     +++L++   C+I+  + +   P+H +     + + +LL++   C+  +  RD   + P+H A  A+    +++++    DI+  D  G S L +A   G  G + +L
Sbjct:  639 LLAEHRSKWGPLHVAAANGHSECLRMLLCSEGGADLVNVTDAEGQTPLMLAVLGGHTDCVHLLLERGACPDMKDRRGRTALHRGAVMGREDCLTALLSHNVSVLSRDFQGRSALHLAASCGHADILSNLLSAADHSQPQDPLTDRHGYTPAHWAAYHGHEDCLEVLLELKPCSIQEGNPFT--PLHCALINGHSGSAELLLESSVCNSLVNIRDAKGRTPLHAAAVAEDVAGLQLVLRQGADIDAVDHSGRSALMVAADYGQSGAVALL 905          

HSP 8 Score: 71.2478 bits (173), Expect = 4.174e-11
Identity = 67/325 (20.62%), Postives = 125/325 (38.46%), Query Frame = 2
Query:  146 KRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVS---------------LHC------------------------------------DINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCAC----------------------EYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDI--EARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            K P+H A   G+    ++LI    +I+ +D++   P+H A++ GH+  +  L++               LH                                     DIN  D + R  +H A   G+   +NLL+    D+  +DK G  PLHYA   GR +   +L+    ++  RD+    P+H +                       E E    V+ L+D+  +    +      +H + +    + ++LL++   +   +        P+HLA  +   E V +L++    ++ CD  G S L +A + G+   + +L
Sbjct:  307 KSPLHMAAIHGRFTRSQILIQNGGEIDCVDRYGNTPLHVAAKYGHELLISTLMTNGADTARQGIHGMFPLHLAVLYGSSDCCRKLLSSGQLYSIVLSMSKEHVLSAGFDINTPDNFGRTCLHAAASGGNIECLNLLLSSGADMNKKDKFGRTPLHYAAANGRYQCVVVLVGAGAEVNERDRSGCTPLHYSAASTAFCRTDRPHASTHQNQEDGEKESFLCVEHLLDNGADPCLCNTKGYSAVHYAAAHGNKQNLELLLEMCFNTLGDKESNGSISPLHLAVESGHWECVTVLIESGVCVDVCDPVGRSVLYLASQRGHSRCVELL 631          

HSP 9 Score: 60.8474 bits (146), Expect = 7.038e-8
Identity = 55/235 (23.40%), Postives = 103/235 (43.83%), Query Frame = 2
Query:  191 VKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDR--VPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCD---IEARDKWDQRPIHCACEYERAGIVKLLIDHHCN---IESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTG 871
            V+ L+D   D    +      +HYA+ +G+K+ ++LL+ +  +     E +    P+H A E GH   V +LI+    ++  D +G   L+ A + G +   +LL+         E R KW   P+H A     +  +++L+        +   D   + P+ L+  G  T+ V LL++     + +D   +  +H      R + +  L+ H+  +   D  G S L +A   G
Sbjct:  527 VEHLLDNGADPCLCNTKGYSAVHYAAAHGNKQNLELLLEMCFNTLGDKESNGSISPLHLAVESGHWECVTVLIESGVCVDVCDPVGRSVLYLASQRGHSRCVELLLSQSASCLLAEHRSKWG--PLHVAAANGHSECLRMLLCSEGGADLVNVTDAEGQTPLMLAVLGGHTDCVHLLLERGACPDMKDRRGRTALHRGAVMGREDCLTALLSHNVSVLSRDFQGRSALHLAASCG 759          
BLAST of SMED30005028 vs. UniProt/SwissProt
Match: sp|B2RXR6|ANR44_MOUSE (Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus OX=10090 GN=Ankrd44 PE=1 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 5.476e-28
Identity = 71/255 (27.84%), Postives = 131/255 (51.37%), Query Frame = 2
Query:  134 DLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGC-CTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            D N + P+H A      +  +++I     +   D+  +  +H+A+ NGH + V LL++   +INA D+ DR  +H A   GH  +V LLI+H  ++  +DK GY PLH A   G+    K L++   +I+  + +    +H AC   +  +V  LID+  N+   +     P+H + +       ++LL+++  D+  +    + P+H+     R    + L+ +  +I+  D+ GN+PL +A + G+E LI+ L
Sbjct:  104 DKNWQTPLHVAAANKAVKCAEVIIPLLSSVNVSDRGGRTALHHAALNGHMEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASNGQISVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQPNNSGFTPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCVDKDGNTPLHVAARHGHELLINTL 358          

HSP 2 Score: 117.087 bits (292), Expect = 3.127e-25
Identity = 71/251 (28.29%), Postives = 124/251 (49.40%), Query Frame = 2
Query:  143 KKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            ++ P+  A   G  E +++LI    D+ ALD   + P+H A+  G  + ++LL+     +NA+D     P+HRA        V +LI H  D+ +RDK    PLH A      + A+++I     +   D+  +  +H A       +V LL+    NI + DK +RR +H +      + V LLI+H  ++  +D     P+H A +  +   VK L++   +I+E + +GN+ L IA   G + +++ L
Sbjct:    8 EQPPLVQAIFSGDPEEIRMLIHKTEDVNALDSEKRTPLHVAAFLGDAEIIELLILSGARVNAKDNMWLTPLHRAVASRSEEAVQVLIKHSADVNARDKNWQTPLHVAAANKAVKCAEVIIPLLSSVNVSDRGGRTALHHAALNGHMEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASNGQISVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNEL 258          

HSP 3 Score: 115.546 bits (288), Expect = 9.773e-25
Identity = 74/276 (26.81%), Postives = 128/276 (46.38%), Query Frame = 2
Query:   59 FIRAIRGGSIKLFHRFF-KREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGL 883
             ++AI  G  +       K E +   D  K+ P+H A   G  EI++LLI     + A D     P+H A  +  ++ V++L+    D+NARD+  + P+H A  +       ++I     +   D+ G   LH+A   G  E   LL+    +I A DK D+R +H A       +V LLI+H   +  +DK    P+H + S      VK L++   +I+  + +    +H+AC   +   V  L+D+  ++ + +  G +PL  A  + +  L
Sbjct:   12 LVQAIFSGDPEEIRMLIHKTEDVNALDSEKRTPLHVAAFLGDAEIIELLILSGARVNAKDNMWLTPLHRAVASRSEEAVQVLIKHSADVNARDKNWQTPLHVAAANKAVKCAEVIIPLLSSVNVSDRGGRTALHHAALNGHMEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASNGQISVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQPNNSGFTPLHFAAASTHGAL 287          

HSP 4 Score: 93.9745 bits (232), Expect = 4.699e-18
Identity = 63/239 (26.36%), Postives = 104/239 (43.51%), Query Frame = 2
Query:  155 IHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKT-VKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKT 868
            +H AC  GQ  +V  LIDY  ++   +     P+H+A+ + H    ++LLV+   D+N + +  + P+H    HG       LI +  +I+  DK G  PLH A + G       LI    D          P+H A     +   + L+     I++ D + R  +H + +G   E +KLL     D   +D   + P+H A        +K LV    ++ E D +G + L  A  +
Sbjct:  243 LHIACYNGQDAVVNELIDYGANVNQPNNSGFTPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCVDKDGNTPLHVAARHGHELLINTLITSGADTAKCGIHSMFPLHLAALNAHSDCCRKLLSSGFEIDTPDTFGRTCLHAAAAGGNVECIKLLQSSGADFHKKDKCGRTPLHYAAANCHFHCIKALVTTGANVNETDDWGRTALHYAAAS 481          

HSP 5 Score: 91.2781 bits (225), Expect = 3.399e-17
Identity = 67/260 (25.77%), Postives = 116/260 (44.62%), Query Frame = 2
Query:  116 EYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIES---RDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDH--HCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDH-HCDIEECDQFGNSPLEIAMKTGNE 877
            E ++ +D   + P+  A   G  + V LL++   +++A+D      +H     GH++ V++L+     I  +D   R P+H A   GH+  +N L+      E    +D  GY PLH+AC  G     ++L++  C           P+HCA          LL+       +  RD   R  +H +  G   E ++LL+ H   + A D   +  + +A    +   V ILV+    D+   D+  N+PL +A+  G+E
Sbjct:  661 EVVDVKDAKGQTPLMLAVAYGHIDAVSLLLEKEANVDAVDIVGCTALHRGIMTGHEECVQMLLEQEASILCKDSRGRTPLHYAAARGHATWLNELLQIALSEEDCCLKDNQGYTPLHWACYNGNENCIEVLLEQKC-FRKFIGNPFTPLHCAIINGHESCASLLLGAIDPSIVSCRDDKGRTTLHAAAFGDHAECLQLLLRHDAQVNAVDNSGKTALMMAAENGQAGAVDILVNSAQADLTVKDKDLNTPLHLAISKGHE 919          

HSP 6 Score: 87.8113 bits (216), Expect = 3.339e-16
Identity = 72/276 (26.09%), Postives = 124/276 (44.93%), Query Frame = 2
Query:  116 EYLEREDLNKK-------RPIHHACERGQTEIVKLLID-YNCDIEALDKWN-QRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYR-PLHYACKAGRAETAKLLI---DHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEEC---DQFGNSPLEIAMKTGNEGLIHIL 895
            E+L + D N           IH+A   G  + ++LL++  N   E  D    + P+H A+ NGH + +++L+    D++ RDE  R  ++ A   GH+  V  L++    I  +D +  R PLH +   G     +LL+   D+   ++ +D   Q P+  A  Y     V LL++   N+++ D      +H        E V++L++ +  I  +D   + P+H A        +  L+      E+C   D  G +PL  A   GNE  I +L
Sbjct:  516 EFLLQNDANPSIRDKEGYNSIHYAAAYGHRQCLELLLERTNTGFEESDGGALKSPLHLAAYNGHHQALEVLLQSLVDLDIRDEKGRTALYLAAFKGHTECVEALVNQGASIFVKDNVTKRTPLHASVINGHTLCLRLLLETADNPEVVDVKDAKGQTPLMLAVAYGHIDAVSLLLEKEANVDAVDIVGCTALHRGIMTGHEECVQMLLEQEASILCKDSRGRTPLHYAAARGHATWLNELLQIALSEEDCCLKDNQGYTPLHWACYNGNENCIEVL 791          

HSP 7 Score: 75.0998 bits (183), Expect = 2.779e-12
Identity = 46/174 (26.44%), Postives = 75/174 (43.10%), Query Frame = 2
Query:  146 KRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCS 667
            K P+H     G+    + LI    +I+ +DK    P+H A+++GH+  +  L++   D          P+H A  + HS     L+    +I++ D  G   LH A   G  E  KLL     D   +DK  + P+H A        +K L+    N+   D W R  +H + +
Sbjct:  307 KSPLHMTAVHGRFTRSQTLIQNGGEIDCVDKDGNTPLHVAARHGHELLINTLITSGADTAKCGIHSMFPLHLAALNAHSDCCRKLLSSGFEIDTPDTFGRTCLHAAAAGGNVECIKLLQSSGADFHKKDKCGRTPLHYAAANCHFHCIKALVTTGANVNETDDWGRTALHYAAA 480          

HSP 8 Score: 73.1738 bits (178), Expect = 1.057e-11
Identity = 66/276 (23.91%), Postives = 108/276 (39.13%), Query Frame = 2
Query:  134 DLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCAC-------------------EYERAGIVK---------LLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDH-KCDIEARDWWD-QRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTG 871
            D +   P+H A   G   ++  LI    D       +  P+H A+ N H    + L+S   +I+  D + R  +H A   G+   + LL     D   +DK G  PLHYA         K L+    ++   D W +  +H A                    E ERA  VK          L+ +  N   RDK     IH + +    + ++LL++      E  D    + P+HLA      + +++L+    D++  D+ G + L +A   G
Sbjct:  336 DKDGNTPLHVAARHGHELLINTLITSGADTAKCGIHSMFPLHLAALNAHSDCCRKLLSSGFEIDTPDTFGRTCLHAAAAGGNVECIKLLQSSGADFHKKDKCGRTPLHYAAANCHFHCIKALVTTGANVNETDDWGRTALHYAAASDMDRNKMILGNAHDNSEELERAREVKEKDAALCLEFLLQNDANPSIRDKEGYNSIHYAAAYGHRQCLELLLERTNTGFEESDGGALKSPLHLAAYNGHHQALEVLLQSLVDLDIRDEKGRTALYLAAFKG 611          

HSP 9 Score: 70.0922 bits (170), Expect = 8.417e-11
Identity = 65/315 (20.63%), Postives = 130/315 (41.27%), Query Frame = 2
Query:   56 CFIRAIRGGSIKLFHRFFKREY-LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQ-----------NGHKKT-----------------VKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDH-HCDIESRDKLGYR-PLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRR-PIHLSCSGCCTETVKLLI---DHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            C   A  GG+++             ++D   + P+H+A        +K L+    ++   D W +  +HYA+            N H  +                 ++ L+    + + RD+     IH A  +GH   + LL++  +   E  D    + PLH A   G  +  ++L+    D++ RD+  +  ++ A        V+ L++   +I  +D   +R P+H S     T  ++LL+   D+   ++ +D   Q P+ LA      + V +L++   +++  D  G + L   + TG+E  + +L
Sbjct:  408 CLHAAAAGGNVECIKLLQSSGADFHKKDKCGRTPLHYAAANCHFHCIKALVTTGANVNETDDWGRTALHYAAASDMDRNKMILGNAHDNSEELERAREVKEKDAALCLEFLLQNDANPSIRDKEGYNSIHYAAAYGHRQCLELLLERTNTGFEESDGGALKSPLHLAAYNGHHQALEVLLQSLVDLDIRDEKGRTALYLAAFKGHTECVEALVNQGASIFVKDNVTKRTPLHASVINGHTLCLRLLLETADNPEVVDVKDAKGQTPLMLAVAYGHIDAVSLLLEKEANVDAVDIVGCTALHRGIMTGHEECVQML 722          
BLAST of SMED30005028 vs. TrEMBL
Match: A0A1X7T5X6 (Uncharacterized protein OS=Amphimedon queenslandica OX=400682 PE=4 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 3.228e-49
Identity = 106/265 (40.00%), Postives = 170/265 (64.15%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVK-LLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVS-LHCDINARDEWDRVPIHRACEHGHSGIV-NLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDH-HCDIEARDKWDQRPIHCACEYERAGIVK-LLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDH-KCDIEARDWWDQRPIHLACNAKRTETVK-ILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            +E ED +K RP+H+ACE G  +IV+ L+ID +CD+ A  +    P+HYA + GH + VK+L +   C++ A   ++  P+H+ACE G+  IV +L+I+ HCD+ ++D++GY PLHYAC+ G  ET K+L +H  C+IEA+D W+ RP+H ACE     IV+ L+ID HC++ +       P+H +C     E VK+L +H +C++EA   ++ RP+H AC +   + V+ +++D HCD+   D+ G +PL  A + G+   + IL
Sbjct:  479 IEAEDYSKDRPLHNACESGNVDIVRHLVIDKHCDVNAKGRIGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVINKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAKDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVIDKHCDVNAKDRIGYTPLHYACEKGHFETVKIL 743          

HSP 2 Score: 200.675 bits (509), Expect = 1.131e-48
Identity = 106/265 (40.00%), Postives = 168/265 (63.40%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVK-LLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVS-LHCDINARDEWDRVPIHRACEHGHSGIV-NLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDH-HCDIEARDKWDQRPIHCACEYERAGIVK-LLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDH-KCDIEARDWWDQRPIHLACNAKRTETVK-ILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            +E ED    RP+H ACE G  +IV+ L+ID +CD+ A+      P+HYA + GH + VK+L +   C++ A   ++  P+H+ACE G+  IV +L+I+ HCD+ ++D++GY PLHYAC+ G  ET K+L +H  C+IEA D W+ RP+H ACE     IV+ L+ID HC++ ++ +    P+H +C     E VK+L +H +C+IEA D+   RP+H AC +   + V+ +++D HCD+    + G +PL  A + G+  ++ IL
Sbjct:  275 IEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVINKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAKGRNGYTPLHYACEKGHFEIVKILTNHPQCNIEAEDYSKDRPLHNACESGNVDIVRHLVIDKHCDVNAKGRIGYTPLHYACEKGHFEIVKIL 539          

HSP 3 Score: 193.741 bits (491), Expect = 1.746e-46
Identity = 106/265 (40.00%), Postives = 165/265 (62.26%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVK-LLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVS-LHCDINARDEWDRVPIHRACEHGHSGIV-NLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDH-HCDIEARDKWDQRPIHCACEYERAGIVK-LLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDH-KCDIEARDWWDQRPIHLACNAKRTETVKILV-DHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            +E +D    RP+H ACE G  +IV+ L+ID +CD+ A+      P+HYA + GH + VK+L +   C++ A   ++  P+H+ACE G+  IV +L+ID HCD+ ++D++GY PLHYAC+ G  ET K+L +H  C+IEA D W+ RP+H ACE     IV+ L+ID HC++ ++ +    P+H +C     E VK L +H +C+ +A D  D RP+H AC ++  + V+ LV D H D+    + G +PL  A + G+  ++ IL
Sbjct:  615 IEAKDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVIDKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAKGRNGYTPLHYACEKGHFEIVKFLTNHPQCNTKAEDVCDDRPLHKACKSRNVDIVRYLVIDKHRDVNAKGRDGYTPLHYACEKGHFEIVKIL 879          

HSP 4 Score: 187.963 bits (476), Expect = 1.109e-44
Identity = 103/265 (38.87%), Postives = 162/265 (61.13%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVK-LLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVS-LHCDINARDEWDRVPIHRACEHGHSGIVN-LLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDH-HCDIEARDKWDQRPIHCACEYERAGIVK-LLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDH-KCDIEARDWWDQRPIHLACNAKRTETVK-ILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            +E E     RP+H ACE G  +IV+ L+ID +CD+ A+      P+HYA + GH + VK+L +   C++ A   ++  P+H+ACE G+  IV+ L+ID HCD+ ++ K GY PLHYAC+ G  E  K+L +H  C+IEA D W+ RP+H ACE     IV+ L+ID HC++ +       P+H +C     E VK+L +H +C++EA   ++ RP+H AC +   + V+ ++++ HCD+   D+ G +PL  A + G+   + IL
Sbjct:  139 IEVEGSFNDRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGNFNDRPLHKACESGNVDIVHHLVIDKHCDVNAKGKDGYTPLHYACEKGHFEIVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVINKHCDVNAKDRIGYTPLHYACEKGHFETVKIL 403          

HSP 5 Score: 187.578 bits (475), Expect = 1.744e-44
Identity = 107/265 (40.38%), Postives = 160/265 (60.38%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVK-LLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVS-LHCDINARDEWDRVPIHRACEHGHSGIV-NLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDH-HCDIEARDKWDQRPIHCACEYERAGIVK-LLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDH-KCDIEARDWWDQRPIHLACNAKRTETVKILV-DHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            LE E     RP+H ACE G  +IV+ L+ID +CD+ A D+    P+HYA + GH +TVK+L +   C+I A D W+  P+H+ACE G+  IV +L+ID HCD+ ++ + GY PLHYAC+ G  E  K L +H  C+ +A D  D RP+H AC+     IV+ L+ID H ++ ++ +    P+H +C     E VK+L +H +C+ EA D +D R +H AC   R + V+ LV D H D+    + G +PL  A + G+  ++ IL
Sbjct:  683 LEAEGSFNDRPLHKACESGNVDIVRHLVIDKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAKGRNGYTPLHYACEKGHFEIVKFLTNHPQCNTKAEDVCDDRPLHKACKSRNVDIVRYLVIDKHRDVNAKGRDGYTPLHYACEKGHFEIVKILTNHPQCNTEAEDVYDDRSLHKACEFGRLDIVRYLVIDKHRDVNAKGRNGYTPLHYACEKGHFEIVKIL 947          

HSP 6 Score: 184.882 bits (468), Expect = 9.857e-44
Identity = 103/265 (38.87%), Postives = 160/265 (60.38%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIV-KLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVS-LHCDINARDEWDRVPIHRACEHGHSGIV-NLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDH-HCDIEARDKWDQRPIHCACEYERAGIV-KLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDH-KCDIEARDWWDQRPIHLACNAKRTETVK-ILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            +E ED +  RP+H ACE G  +IV  L+ID +C++ A  +    P+HYA + GH + VK+L +   C+I     ++  P+H+ACE G+  IV +L+ID HCD+ +    GY PLHYAC+ G  E  K+L +H  C++EA   ++ RP+H ACE     IV  L+ID HC++ ++ K    P+H +C     E VK+L +H +C+IEA D W+ RP+H AC +   + V+ +++D HCD+      G +PL  A + G+  ++ IL
Sbjct:   71 IEVEDNSNDRPLHKACESGNVDIVCHLVIDKHCNVNAKGRNGYTPLHYACEKGHFEIVKILTNHPQCNIEVEGSFNDRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGNFNDRPLHKACESGNVDIVHHLVIDKHCDVNAKGKDGYTPLHYACEKGHFEIVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKIL 335          

HSP 7 Score: 152.525 bits (384), Expect = 1.302e-33
Identity = 88/225 (39.11%), Postives = 137/225 (60.89%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVK-LLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVS-LHCDINARDEWDRVPIHRACEHGHSGIVN-LLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDH-HCDIEARDKWDQRPIHCACEYERAGIVK-LLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDH-KCDIEARDWWDQRPIHLACNAKRT 778
            +E ED    RP+H ACE G  +IV+ L+ID +CD+ A  +    P+HYA + GH + VK L +   C+  A D  D  P+H+AC+  +  IV  L+ID H D+ ++ + GY PLHYAC+ G  E  K+L +H  C+ EA D +D R +H ACE+ R  IV+ L+ID H ++ ++ +    P+H +C     E VK+L +H +C+IEA +  ++ P+HLA  ++ +
Sbjct:  751 IEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAKGRNGYTPLHYACEKGHFEIVKFLTNHPQCNTKAEDVCDDRPLHKACKSRNVDIVRYLVIDKHRDVNAKGRDGYTPLHYACEKGHFEIVKILTNHPQCNTEAEDVYDDRSLHKACEFGRLDIVRYLVIDKHRDVNAKGRNGYTPLHYACEKGHFEIVKILTNHPQCNIEAENNDNKWPLHLAIRSRSS 975          

HSP 8 Score: 142.51 bits (358), Expect = 1.891e-30
Identity = 91/241 (37.76%), Postives = 131/241 (54.36%), Query Frame = 2
Query:  191 VKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVK-LLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDH-HCDIESRDKLGYRPLHYACKAGRAETA-KLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDH-HCNIESRDKWNRRPIHLSCSGCCTETVK-LLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDH-HCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            +KLL DY  D        +R + YA +  +   V+ L++  HCD+NA+      P+H ACE G   IV +L DH  C+IE  D    RPLH AC++G  +    L+ID HC++ A+ +    P+H ACE     IVK+L +H  CNIE    +N RP+H +C     + V+ L+ID  CD+ A  W    P+H AC     E VKIL +H  C++E    F + PL  A ++GN  ++H L
Sbjct:    1 MKLLNDYFED--------RRSLVYACKFRNVDIVRHLVIDKHCDVNAKGRNGYTPLHYACEEGCFEIVRILTDHPQCNIEVEDNSNDRPLHKACESGNVDIVCHLVIDKHCNVNAKGRNGYTPLHYACEKGHFEIVKILTNHPQCNIEVEGSFNDRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGNFNDRPLHKACESGNVDIVHHL 233          
BLAST of SMED30005028 vs. TrEMBL
Match: A0A1Y1VDP1 (ANK_REP_REGION domain-containing protein OS=Piromyces finnis OX=1754191 GN=BCR36DRAFT_582404 PE=4 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 3.147e-48
Identity = 91/258 (35.27%), Postives = 151/258 (58.53%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            +E+ED     P++ ACE+    IVKLLI+   D+E  DK+   P++ A +  ++  VKLL+    D+N +D++  +P++ ACE G+  IV LLI +  D+E  DK GY PL+ AC+       KLLI++  D+E  DK+   P++ ACE     IVKLLI++  ++   D +   P++++C       VKLLI++  D+   D +   P+++AC       VK+L+++  D+ + D+FG+ PL IA +  NE ++ +L
Sbjct:  211 VEKEDKFGYLPLNIACEKNNENIVKLLIENGADVEKEDKFGHLPLNIACEKSNENIVKLLIENEADVNKKDKFGHLPLNIACEKGNENIVKLLIKNGADVEKEDKFGYIPLNIACEKSNENIVKLLIENGADVEKEDKFGYLPLNIACEKNNENIVKLLIENGADVNKIDDYGHLPLNIACEKSNENIVKLLIENGADVNKIDDYGHLPLNIACEKSNENIVKLLIENEADVNKKDKFGHLPLNIACEKSNENIVKLL 468          

HSP 2 Score: 187.963 bits (476), Expect = 3.869e-47
Identity = 92/259 (35.52%), Postives = 148/259 (57.14%), Query Frame = 2
Query:  134 DLNKKR-----PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            D+NKK      P++ ACE+    IVKLLI    D+    K+   P++ A +  ++  VKLL+    D+   DE+  +P++ ACE  +  IV LLI++  D+E  DK GY PL+ AC+       KLLI++  D+E  DK+   P++ ACE     IVKLLI++  ++  +DK+   P++++C       VKLLI +  D+E  D +   P+++AC       VK+L+++  D+E+ D+FG  PL IA +  NE ++ +L
Sbjct:  111 DVNKKDKFGHLPLNIACEKSNENIVKLLIKNGADVNKKGKFRYLPLNIACKKSNENIVKLLIKNGADVEKEDEFGYIPLNIACEKSNENIVKLLIENGADVEKEDKFGYLPLNIACEKNNENIVKLLIENGADVEKEDKFGHLPLNIACEKSNENIVKLLIENEADVNKKDKFGHLPLNIACEKGNENIVKLLIKNGADVEKEDKFGYIPLNIACEKSNENIVKLLIENGADVEKEDKFGYLPLNIACEKNNENIVKLL 369          

HSP 3 Score: 186.037 bits (471), Expect = 1.739e-46
Identity = 88/258 (34.11%), Postives = 150/258 (58.14%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            +E+ED     P++ ACE+    IVKLLI+   D+   DK+   P++ A + G++  VKLL+    D+   D++  +P++ ACE  +  IV LLI++  D+E  DK GY PL+ AC+       KLLI++  D+   D +   P++ ACE     IVKLLI++  ++   D +   P++++C       VKLLI+++ D+  +D +   P+++AC       VK+L+++  D+E+ D+FG+ PL IA +  NE ++ +L
Sbjct:  244 VEKEDKFGHLPLNIACEKSNENIVKLLIENEADVNKKDKFGHLPLNIACEKGNENIVKLLIKNGADVEKEDKFGYIPLNIACEKSNENIVKLLIENGADVEKEDKFGYLPLNIACEKNNENIVKLLIENGADVNKIDDYGHLPLNIACEKSNENIVKLLIENGADVNKIDDYGHLPLNIACEKSNENIVKLLIENEADVNKKDKFGHLPLNIACEKSNENIVKLLIENGADVEKEDKFGHLPLNIACEKNNENIVKLL 501          

HSP 4 Score: 185.652 bits (470), Expect = 2.397e-46
Identity = 89/258 (34.50%), Postives = 150/258 (58.14%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            +E+ED     P++ ACE+    IVKLLI+   D+E  DK+   P++ A +  ++  VKLL+    D+   D++  +P++ ACE  +  IV LLI++  D+  +DK G+ PL+ AC+ G     KLLI +  D+E  DK+   P++ ACE     IVKLLI++  ++E  DK+   P++++C       VKLLI++  D+   D +   P+++AC       VK+L+++  D+ + D +G+ PL IA +  NE ++ +L
Sbjct:  178 VEKEDEFGYIPLNIACEKSNENIVKLLIENGADVEKEDKFGYLPLNIACEKNNENIVKLLIENGADVEKEDKFGHLPLNIACEKSNENIVKLLIENEADVNKKDKFGHLPLNIACEKGNENIVKLLIKNGADVEKEDKFGYIPLNIACEKSNENIVKLLIENGADVEKEDKFGYLPLNIACEKNNENIVKLLIENGADVNKIDDYGHLPLNIACEKSNENIVKLLIENGADVNKIDDYGHLPLNIACEKSNENIVKLL 435          

HSP 5 Score: 183.726 bits (465), Expect = 9.687e-46
Identity = 85/248 (34.27%), Postives = 146/248 (58.87%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            P++ AC++    IVKLLI+   D+   DK+   P++ A +  ++  VKLL+    D+N + ++  +P++ AC+  +  IV LLI +  D+E  D+ GY PL+ AC+       KLLI++  D+E  DK+   P++ ACE     IVKLLI++  ++E  DK+   P++++C       VKLLI+++ D+  +D +   P+++AC       VK+L+ +  D+E+ D+FG  PL IA +  NE ++ +L
Sbjct:   89 PLNIACKKNNENIVKLLIENGADVNKKDKFGHLPLNIACEKSNENIVKLLIKNGADVNKKGKFRYLPLNIACKKSNENIVKLLIKNGADVEKEDEFGYIPLNIACEKSNENIVKLLIENGADVEKEDKFGYLPLNIACEKNNENIVKLLIENGADVEKEDKFGHLPLNIACEKSNENIVKLLIENEADVNKKDKFGHLPLNIACEKGNENIVKLLIKNGADVEKEDKFGYIPLNIACEKSNENIVKLL 336          

HSP 6 Score: 183.726 bits (465), Expect = 1.137e-45
Identity = 90/259 (34.75%), Postives = 149/259 (57.53%), Query Frame = 2
Query:  134 DLNKKR-----PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            D+NKK      P++ ACE+    IVKLLI+   D    D++   P++ A +  ++  VKLL+    D+N +D++  +P++ ACE  +  IV LLI +  D+  + K  Y PL+ ACK       KLLI +  D+E  D++   P++ ACE     IVKLLI++  ++E  DK+   P++++C       VKLLI++  D+E  D +   P+++AC       VK+L+++  D+ + D+FG+ PL IA + GNE ++ +L
Sbjct:   45 DVNKKDKYKYLPLNIACEKSNENIVKLLIENGADANKKDEFGYLPLNIACKKNNENIVKLLIENGADVNKKDKFGHLPLNIACEKSNENIVKLLIKNGADVNKKGKFRYLPLNIACKKSNENIVKLLIKNGADVEKEDEFGYIPLNIACEKSNENIVKLLIENGADVEKEDKFGYLPLNIACEKNNENIVKLLIENGADVEKEDKFGHLPLNIACEKSNENIVKLLIENEADVNKKDKFGHLPLNIACEKGNENIVKLL 303          

HSP 7 Score: 181.415 bits (459), Expect = 5.643e-45
Identity = 88/259 (33.98%), Postives = 149/259 (57.53%), Query Frame = 2
Query:  134 DLNKKR-----PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            D+NKK      P++ AC++    IVKLLI    D+E  D++   P++ A +  ++  VKLL+    D+   D++  +P++ ACE  +  IV LLI++  D+E  DK G+ PL+ AC+       KLLI++  D+  +DK+   P++ ACE     IVKLLI +  ++E  DK+   P++++C       VKLLI++  D+E  D +   P+++AC       VK+L+++  D+ + D +G+ PL IA +  NE ++ +L
Sbjct:  144 DVNKKGKFRYLPLNIACKKSNENIVKLLIKNGADVEKEDEFGYIPLNIACEKSNENIVKLLIENGADVEKEDKFGYLPLNIACEKNNENIVKLLIENGADVEKEDKFGHLPLNIACEKSNENIVKLLIENEADVNKKDKFGHLPLNIACEKGNENIVKLLIKNGADVEKEDKFGYIPLNIACEKSNENIVKLLIENGADVEKEDKFGYLPLNIACEKNNENIVKLLIENGADVNKIDDYGHLPLNIACEKSNENIVKLL 402          

HSP 8 Score: 170.629 bits (431), Expect = 2.580e-41
Identity = 81/250 (32.40%), Postives = 144/250 (57.60%), Query Frame = 2
Query:  152 PIHHACER--GQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            P++ A +      EIVK+L++   D+   DK+   P++ A +  ++  VKLL+    D N +DE+  +P++ AC+  +  IV LLI++  D+  +DK G+ PL+ AC+       KLLI +  D+  + K+   P++ AC+     IVKLLI +  ++E  D++   P++++C       VKLLI++  D+E  D +   P+++AC       VK+L+++  D+E+ D+FG+ PL IA +  NE ++ +L
Sbjct:   21 PLNFAIKNIENNEEIVKILVENGADVNKKDKYKYLPLNIACEKSNENIVKLLIENGADANKKDEFGYLPLNIACKKNNENIVKLLIENGADVNKKDKFGHLPLNIACEKSNENIVKLLIKNGADVNKKGKFRYLPLNIACKKSNENIVKLLIKNGADVEKEDEFGYIPLNIACEKSNENIVKLLIENGADVEKEDKFGYLPLNIACEKNNENIVKLLIENGADVEKEDKFGHLPLNIACEKSNENIVKLL 270          

HSP 9 Score: 163.31 bits (412), Expect = 7.251e-39
Identity = 77/228 (33.77%), Postives = 132/228 (57.89%), Query Frame = 2
Query:  218 DIEALDKWNQRPIHYASQN--GHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            DI   +K    P+++A +N   +++ VK+LV    D+N +D++  +P++ ACE  +  IV LLI++  D   +D+ GY PL+ ACK       KLLI++  D+  +DK+   P++ ACE     IVKLLI +  ++  + K+   P++++C       VKLLI +  D+E  D +   P+++AC       VK+L+++  D+E+ D+FG  PL IA +  NE ++ +L
Sbjct:   10 DINGFNKNGYLPLNFAIKNIENNEEIVKILVENGADVNKKDKYKYLPLNIACEKSNENIVKLLIENGADANKKDEFGYLPLNIACKKNNENIVKLLIENGADVNKKDKFGHLPLNIACEKSNENIVKLLIKNGADVNKKGKFRYLPLNIACKKSNENIVKLLIKNGADVEKEDEFGYIPLNIACEKSNENIVKLLIENGADVEKEDKFGYLPLNIACEKNNENIVKLL 237          

HSP 10 Score: 159.458 bits (402), Expect = 1.425e-37
Identity = 78/233 (33.48%), Postives = 130/233 (55.79%), Query Frame = 2
Query:  134 DLNKKR-----PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDI 817
            D+NKK      P++ ACE+G   IVKLLI    D+E  DK+   P++ A +  ++  VKLL+    D+   D++  +P++ ACE  +  IV LLI++  D+   D  G+ PL+ AC+       KLLI++  D+   D +   P++ ACE     IVKLLI++  ++  +DK+   P++++C       VKLLI++  D+E  D +   P+++AC       VK+L+ +  D+
Sbjct:  276 DVNKKDKFGHLPLNIACEKGNENIVKLLIKNGADVEKEDKFGYIPLNIACEKSNENIVKLLIENGADVEKEDKFGYLPLNIACEKNNENIVKLLIENGADVNKIDDYGHLPLNIACEKSNENIVKLLIENGADVNKIDDYGHLPLNIACEKSNENIVKLLIENEADVNKKDKFGHLPLNIACEKSNENIVKLLIENGADVEKEDKFGHLPLNIACEKNNENIVKLLIKNGADV 508          

HSP 11 Score: 143.665 bits (361), Expect = 3.195e-32
Identity = 70/202 (34.65%), Postives = 116/202 (57.43%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEAR 727
            +E+ED     P++ ACE+    IVKLLI+   D+E  DK+   P++ A +  ++  VKLL+    D+N  D++  +P++ ACE  +  IV LLI++  D+   D  G+ PL+ AC+       KLLI++  D+  +DK+   P++ ACE     IVKLLI++  ++E  DK+   P++++C       VKLLI +  D+  +
Sbjct:  310 VEKEDKFGYIPLNIACEKSNENIVKLLIENGADVEKEDKFGYLPLNIACEKNNENIVKLLIENGADVNKIDDYGHLPLNIACEKSNENIVKLLIENGADVNKIDDYGHLPLNIACEKSNENIVKLLIENEADVNKKDKFGHLPLNIACEKSNENIVKLLIENGADVEKEDKFGHLPLNIACEKNNENIVKLLIKNGADVNKK 511          
BLAST of SMED30005028 vs. TrEMBL
Match: A0A1V5PQL8 (Phosphocholine transferase AnkX OS=bacterium ADurb.Bin363 OX=1866927 GN=ankX_1 PE=4 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 1.518e-45
Identity = 90/251 (35.86%), Postives = 142/251 (56.57%), Query Frame = 2
Query:  146 KRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAM-KTGNEGLIHIL 895
            K P++ A + G+ ++V+LLID    I + D   + P+H ASQNG K  V+LL+    DI +RD   + P++ AC++G   +V LLID   ++  +D     PLH+A + G  E  +LLID   DI +RD   + P++ AC+  R G+V+LLI     I  +D   +  +H +C   C E V+LLID   D+   D   + PI+LA    R ET ++L+    D+   D  G +PL++A  K+G+E ++ +L
Sbjct:  162 KTPLYLAAQNGRKDVVELLIDKGSKISSTDNTEKTPLHLASQNGRKDVVELLIDKGADITSRDSDGKTPLYLACQNGRKNVVELLIDKGSEVNFKDNTAKTPLHWASQNGCKEVVELLIDKGADITSRDSDGKTPLYLACQSGRKGVVELLISKGSEINIKDNAGKTSLHWACQNGCKEVVELLIDKGSDVNFEDKTGRTPIYLAVQYGRIETAELLLSKDADVNVKDNNGVTPLKLAQDKSGSE-MVELL 411          

HSP 2 Score: 166.777 bits (421), Expect = 9.786e-41
Identity = 86/258 (33.33%), Postives = 140/258 (54.26%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            +  +D + K P++ A + G+ E  ++LI    +I   D   + P+H+A+QNG K+ V LL+S   DI  +D   + P++ A ++G   +V LLID    I S D     PLH A + GR +  +LLID   DI +RD   + P++ AC+  R  +V+LLID    +  +D   + P+H +    C E V+LLID   DI +RD   + P++LAC + R   V++L+    +I   D  G + L  A + G + ++ +L
Sbjct:   88 VNSKDCDGKTPLYLAAQNGRKEATEILIKEGAEINIGDNTGKTPLHWAAQNGRKEIVDLLISKGADITIKDCEGKTPLYLAAQNGRKDVVELLIDKGSKISSTDNTEKTPLHLASQNGRKDVVELLIDKGADITSRDSDGKTPLYLACQNGRKNVVELLIDKGSEVNFKDNTAKTPLHWASQNGCKEVVELLIDKGADITSRDSDGKTPLYLACQSGRKGVVELLISKGSEINIKDNAGKTSLHWACQNGCKEVVELL 345          

HSP 3 Score: 163.696 bits (413), Expect = 1.082e-39
Identity = 96/296 (32.43%), Postives = 154/296 (52.03%), Query Frame = 2
Query:   20 NIFIMSNSEHYQCFIRAIRGGSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDY----NCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            NI  +S SE +  FI+   G   KL     K   L     + + P+H A   G+ E+V LLID        + + D   + P++ A+QNG K+  ++L+    +IN  D   + P+H A ++G   IV+LLI    DI  +D  G  PL+ A + GR +  +LLID    I + D  ++ P+H A +  R  +V+LLID   +I SRD   + P++L+C       V+LLID   ++  +D   + P+H A      E V++L+D   DI   D  G +PL +A ++G +G++ +L
Sbjct:   20 NILTVSASEIFD-FIK--NGEVTKLKELLEKNPDLVNVIEDNRIPLHEAAISGRREVVDLLIDLLISRGASVNSKDCDGKTPLYLAAQNGRKEATEILIKEGAEINIGDNTGKTPLHWAAQNGRKEIVDLLISKGADITIKDCEGKTPLYLAAQNGRKDVVELLIDKGSKISSTDNTEKTPLHLASQNGRKDVVELLIDKGADITSRDSDGKTPLYLACQNGRKNVVELLIDKGSEVNFKDNTAKTPLHWASQNGCKEVVELLIDKGADITSRDSDGKTPLYLACQSGRKGVVELL 312          

HSP 4 Score: 148.673 bits (374), Expect = 1.380e-34
Identity = 78/229 (34.06%), Postives = 124/229 (54.15%), Query Frame = 2
Query:  110 KREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKIL 796
            K   +   D  +K P+H A + G+ ++V+LLID   DI + D   + P++ A QNG K  V+LL+    ++N +D   + P+H A ++G   +V LLID   DI SRD  G  PL+ AC++GR    +LLI    +I  +D   +  +H AC+     +V+LLID   ++   DK  R PI+L+      ET +LL+    D+  +D     P+ LA +   +E V++L
Sbjct:  183 KGSKISSTDNTEKTPLHLASQNGRKDVVELLIDKGADITSRDSDGKTPLYLACQNGRKNVVELLIDKGSEVNFKDNTAKTPLHWASQNGCKEVVELLIDKGADITSRDSDGKTPLYLACQSGRKGVVELLISKGSEINIKDNAGKTSLHWACQNGCKEVVELLIDKGSDVNFEDKTGRTPIYLAVQYGRIETAELLLSKDADVNVKDNNGVTPLKLAQDKSGSEMVELL 411          
BLAST of SMED30005028 vs. TrEMBL
Match: A0A5A8DVR9 (ANK_REP_REGION domain-containing protein OS=Cafeteria roenbergensis OX=33653 GN=FNF27_06991 PE=4 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 1.058e-44
Identity = 104/292 (35.62%), Postives = 151/292 (51.71%), Query Frame = 2
Query:   20 NIFIMSNSEHYQCFIRAIRGGSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            NI          C + A RG    +     +   +E  D     P H A   GQT +V+LL+D   +IEA D+W + P H A+  GHK  ++ L+    ++ A D W   P H A   GH   V LLID   +IE+ D  G   L  A   G   T +LLID   +IEA D+  + P H A   +R  +V+LL+D   NIE+ D+W R P HL+ S     TV+LL+D   +IEA D W + P HLA +A R + V++L+D   +IE  D++G +P  +A   G + ++ +L
Sbjct:   61 NIEATDEWGRTPCHVAAWRGHKDLVQLLLDRGANIEATDEWDLAPCHLAAGEGQTNVVQLLLDRGANIEATDEWGRSPCHEAASAGHKDALQHLLDCGANVEATDRWGHKPCHLAAWKGHEDSVRLLIDRGANIEAADNDGDTALTLAAWNGHVNTVRLLIDRGANIEAADELGRTPCHLAASADRKDMVRLLLDRGANIEAADEWGRTPCHLAASADRKVTVRLLLDRGANIEAADKWGRTPCHLAASAGRKDMVRLLLDRGANIEATDEWGRTPCHLAASAGRKDMVRLL 352          

HSP 2 Score: 182.185 bits (461), Expect = 1.385e-43
Identity = 104/294 (35.37%), Postives = 153/294 (52.04%), Query Frame = 2
Query:   20 NIFIMSNSEHYQCFIRAIRG--GSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            N+       H  C + A +G   S++L     +   +E  D +    +  A   G    V+LLID   +IEA D+  + P H A+    K  V+LL+    +I A DEW R P H A        V LL+D   +IE+ DK G  P H A  AGR +  +LL+D   +IEA D+W + P H A    R  +V+LL+D   NIE+ D+ +R P HL+ S  C  TV+LLID   +IEA D   + P HLA +A R + V++L+D   +IE  D+ G +P  +A   G + ++ +L
Sbjct:  160 NVEATDRWGHKPCHLAAWKGHEDSVRLL--IDRGANIEAADNDGDTALTLAAWNGHVNTVRLLIDRGANIEAADELGRTPCHLAASADRKDMVRLLLDRGANIEAADEWGRTPCHLAASADRKVTVRLLLDRGANIEAADKWGRTPCHLAASAGRKDMVRLLLDRGANIEATDEWGRTPCHLAASAGRKDMVRLLLDRGANIEATDESSRTPCHLAASADCKVTVRLLIDRGANIEAADELGRTPCHLAASADRKDMVRLLLDRGANIEAADESGLTPCHLAASAGRKDMVRLL 451          

HSP 3 Score: 179.104 bits (453), Expect = 1.411e-42
Identity = 103/292 (35.27%), Postives = 152/292 (52.05%), Query Frame = 2
Query:   20 NIFIMSNSEHYQCFIRAIRGGSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            NI     S    C + A  G    +     +   +E  D +   P H A   G+ ++V+LL+D   +IEA D+ ++ P H A+    K  V+LL+    +I A DEW R P H A   GH   V LLID   +IE+ DK G  P H A  AGR +  +LL+D   +IEA D+W +   H      R   V+LLID   NIE+ D+W R P HL+      ++V+LLID   +IEA D W + P HLA      ++V++L+D   +IE  D++G +P  +A   G++  + +L
Sbjct:  424 NIEAADESGLTPCHLAASAGRKDMVRLLLDRGANIEATDESGLTPCHLAASAGRKDMVRLLLDRGANIEAADESSRTPCHLAASADRKDMVRLLIDRGANIEAADEWGRTPCHLAAWKGHEDSVRLLIDRGANIEAADKSGLTPCHLAASAGRKDMVRLLLDRGANIEATDEWGRTLCHVFTWMCRKDAVRLLIDRGANIEATDEWGRTPCHLAAWKGHEDSVRLLIDRGANIEAADNWGRTPCHLAAWKGHEDSVRLLIDRGANIEAADKWGRTPCHLAAWKGHKDSVRLL 715          

HSP 4 Score: 177.563 bits (449), Expect = 4.827e-42
Identity = 96/283 (33.92%), Postives = 147/283 (51.94%), Query Frame = 2
Query:   20 NIFIMSNSEHYQCFIRAIRGGSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKT 868
            NI      +   C + A  G +  +     +   +E  D   + P H A   G  + ++ L+D   ++EA D+W  +P H A+  GH+ +V+LL+    +I A D      +  A  +GH   V LLID   +IE+ D+LG  P H A  A R +  +LL+D   +IEA D+W + P H A   +R   V+LL+D   NIE+ DKW R P HL+ S    + V+LL+D   +IEA D W + P HLA +A R + V++L+D   +IE  D+   +P  +A   
Sbjct:   94 NIEATDEWDLAPCHLAAGEGQTNVVQLLLDRGANIEATDEWGRSPCHEAASAGHKDALQHLLDCGANVEATDRWGHKPCHLAAWKGHEDSVRLLIDRGANIEAADNDGDTALTLAAWNGHVNTVRLLIDRGANIEAADELGRTPCHLAASADRKDMVRLLLDRGANIEAADEWGRTPCHLAASADRKVTVRLLLDRGANIEAADKWGRTPCHLAASAGRKDMVRLLLDRGANIEATDEWGRTPCHLAASAGRKDMVRLLLDRGANIEATDESSRTPCHLAASA 376          

HSP 5 Score: 174.866 bits (442), Expect = 3.862e-41
Identity = 103/292 (35.27%), Postives = 146/292 (50.00%), Query Frame = 2
Query:   20 NIFIMSNSEHYQCFIRAIRGGSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            NI          C   A  G    L H       +E  D    +P H A  +G  + V+LLID   +IEA D      +  A+ NGH  TV+LL+    +I A DE  R P H A       +V LL+D   +IE+ D+ G  P H A  A R  T +LL+D   +IEA DKW + P H A    R  +V+LL+D   NIE+ D+W R P HL+ S    + V+LL+D   +IEA D   + P HLA +A    TV++L+D   +IE  D+ G +P  +A     + ++ +L
Sbjct:  127 NIEATDEWGRSPCHEAASAGHKDALQHLLDCGANVEATDRWGHKPCHLAAWKGHEDSVRLLIDRGANIEAADNDGDTALTLAAWNGHVNTVRLLIDRGANIEAADELGRTPCHLAASADRKDMVRLLLDRGANIEAADEWGRTPCHLAASADRKVTVRLLLDRGANIEAADKWGRTPCHLAASAGRKDMVRLLLDRGANIEATDEWGRTPCHLAASAGRKDMVRLLLDRGANIEATDESSRTPCHLAASADCKVTVRLLIDRGANIEAADELGRTPCHLAASADRKDMVRLL 418          

HSP 6 Score: 173.711 bits (439), Expect = 7.226e-41
Identity = 100/294 (34.01%), Postives = 153/294 (52.04%), Query Frame = 2
Query:   20 NIFIMSNSEHYQCFIRAIRG--GSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            NI    N       + A  G   +++L     +   +E  D   + P H A    + ++V+LL+D   +IEA D+W + P H A+    K TV+LL+    +I A D+W R P H A   G   +V LL+D   +IE+ D+ G  P H A  AGR +  +LL+D   +IEA D+  + P H A   +    V+LLID   NIE+ D+  R P HL+ S    + V+LL+D   +IEA D     P HLA +A R + V++L+D   +IE  D+ G +P  +A   G + ++ +L
Sbjct:  193 NIEAADNDGDTALTLAAWNGHVNTVRLL--IDRGANIEAADELGRTPCHLAASADRKDMVRLLLDRGANIEAADEWGRTPCHLAASADRKVTVRLLLDRGANIEAADKWGRTPCHLAASAGRKDMVRLLLDRGANIEATDEWGRTPCHLAASAGRKDMVRLLLDRGANIEATDESSRTPCHLAASADCKVTVRLLIDRGANIEAADELGRTPCHLAASADRKDMVRLLLDRGANIEAADESGLTPCHLAASAGRKDMVRLLLDRGANIEATDESGLTPCHLAASAGRKDMVRLL 484          

HSP 7 Score: 171.014 bits (432), Expect = 5.448e-40
Identity = 95/258 (36.82%), Postives = 141/258 (54.65%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            +E  D   + P H A   G+ ++V+LL+D   +IEA D+W + P H A+  G K  V+LL+    +I A DE  R P H A        V LLID   +IE+ D+LG  P H A  A R +  +LL+D   +IEA D+    P H A    R  +V+LL+D   NIE+ D+    P HL+ S    + V+LL+D   +IEA D   + P HLA +A R + V++L+D   +IE  D++G +P  +A   G+E  + +L
Sbjct:  293 IEAADKWGRTPCHLAASAGRKDMVRLLLDRGANIEATDEWGRTPCHLAASAGRKDMVRLLLDRGANIEATDESSRTPCHLAASADCKVTVRLLIDRGANIEAADELGRTPCHLAASADRKDMVRLLLDRGANIEAADESGLTPCHLAASAGRKDMVRLLLDRGANIEATDESGLTPCHLAASAGRKDMVRLLLDRGANIEAADESSRTPCHLAASADRKDMVRLLIDRGANIEAADEWGRTPCHLAAWKGHEDSVRLL 550          

HSP 8 Score: 168.703 bits (426), Expect = 3.273e-39
Identity = 98/292 (33.56%), Postives = 150/292 (51.37%), Query Frame = 2
Query:   20 NIFIMSNSEHYQCFIRAIRGGSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            NI          C + A  G    +     +   +E  D   + P H A   G+ ++V+LL+D   +IEA D+ ++ P H A+    K TV+LL+    +I A DE  R P H A       +V LL+D   +IE+ D+ G  P H A  AGR +  +LL+D   +IEA D+    P H A    R  +V+LL+D   NIE+ D+ +R P HL+ S    + V+LLID   +IEA D W + P HLA      ++V++L+D   +IE  D+ G +P  +A   G + ++ +L
Sbjct:  292 NIEAADKWGRTPCHLAASAGRKDMVRLLLDRGANIEATDEWGRTPCHLAASAGRKDMVRLLLDRGANIEATDESSRTPCHLAASADCKVTVRLLIDRGANIEAADELGRTPCHLAASADRKDMVRLLLDRGANIEAADESGLTPCHLAASAGRKDMVRLLLDRGANIEATDESGLTPCHLAASAGRKDMVRLLLDRGANIEAADESSRTPCHLAASADRKDMVRLLIDRGANIEAADEWGRTPCHLAAWKGHEDSVRLLIDRGANIEAADKSGLTPCHLAASAGRKDMVRLL 583          

HSP 9 Score: 165.622 bits (418), Expect = 3.373e-38
Identity = 92/258 (35.66%), Postives = 136/258 (52.71%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            +E  D   + P H A    +   V+LL+D   +IEA DKW + P H A+  G K  V+LL+    +I A DEW R P H A   G   +V LL+D   +IE+ D+    P H A  A    T +LLID   +IEA D+  + P H A   +R  +V+LL+D   NIE+ D+    P HL+ S    + V+LL+D   +IEA D     P HLA +A R + V++L+D   +IE  D+   +P  +A     + ++ +L
Sbjct:  260 IEAADEWGRTPCHLAASADRKVTVRLLLDRGANIEAADKWGRTPCHLAASAGRKDMVRLLLDRGANIEATDEWGRTPCHLAASAGRKDMVRLLLDRGANIEATDESSRTPCHLAASADCKVTVRLLIDRGANIEAADELGRTPCHLAASADRKDMVRLLLDRGANIEAADESGLTPCHLAASAGRKDMVRLLLDRGANIEATDESGLTPCHLAASAGRKDMVRLLLDRGANIEAADESSRTPCHLAASADRKDMVRLL 517          

HSP 10 Score: 160.999 bits (406), Expect = 1.011e-36
Identity = 95/275 (34.55%), Postives = 139/275 (50.55%), Query Frame = 2
Query:   20 NIFIMSNSEHYQCFIRAIRGGSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNS 844
            NI          C + A  G    +     +   +E  D + + P H A        V+LLID   +IEA D+  + P H A+    K  V+LL+    +I A DE    P H A   G   +V LL+D   +IE+ D+ G  P H A  AGR +  +LL+D   +IEA D+  + P H A   +R  +V+LLID   NIE+ D+W R P HL+      ++V+LLID   +IEA D     P HLA +A R + V++L+D   +IE  D++G +
Sbjct:  325 NIEATDEWGRTPCHLAASAGRKDMVRLLLDRGANIEATDESSRTPCHLAASADCKVTVRLLIDRGANIEAADELGRTPCHLAASADRKDMVRLLLDRGANIEAADESGLTPCHLAASAGRKDMVRLLLDRGANIEATDESGLTPCHLAASAGRKDMVRLLLDRGANIEAADESSRTPCHLAASADRKDMVRLLIDRGANIEAADEWGRTPCHLAAWKGHEDSVRLLIDRGANIEAADKSGLTPCHLAASAGRKDMVRLLLDRGANIEATDEWGRT 599          

HSP 11 Score: 156.762 bits (395), Expect = 2.341e-35
Identity = 95/292 (32.53%), Postives = 143/292 (48.97%), Query Frame = 2
Query:   20 NIFIMSNSEHYQCFIRAIRGGSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            NI     S    C + A     + +     +   +E  D   + P H A    + ++V+LL+D   +IEA D+    P H A+  G K  V+LL+    +I A DE    P H A   G   +V LL+D   +IE+ D+    P H A  A R +  +LLID   +IEA D+W + P H A        V+LLID   NIE+ DK    P HL+ S    + V+LL+D   +IEA D W +   H+     R + V++L+D   +IE  D++G +P  +A   G+E  + +L
Sbjct:  358 NIEATDESSRTPCHLAASADCKVTVRLLIDRGANIEAADELGRTPCHLAASADRKDMVRLLLDRGANIEAADESGLTPCHLAASAGRKDMVRLLLDRGANIEATDESGLTPCHLAASAGRKDMVRLLLDRGANIEAADESSRTPCHLAASADRKDMVRLLIDRGANIEAADEWGRTPCHLAAWKGHEDSVRLLIDRGANIEAADKSGLTPCHLAASAGRKDMVRLLLDRGANIEATDEWGRTLCHVFTWMCRKDAVRLLIDRGANIEATDEWGRTPCHLAAWKGHEDSVRLL 649          

HSP 12 Score: 139.043 bits (349), Expect = 8.101e-30
Identity = 79/244 (32.38%), Postives = 121/244 (49.59%), Query Frame = 2
Query:  164 ACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            A   G    V   +D   D+ A     + P H A+  GHK  V+LL+    +I A DEW R P H A   GH  +V LL+D   +IE+ D+    P H A   G+    +LL+D   +IEA D+W + P H A        ++ L+D   N+E+ D+W  +P HL+      ++V+LLID   +IEA D      + LA       TV++L+D   +IE  D+ G +P  +A     + ++ +L
Sbjct:   10 AITAGDLTKVARALDRGQDVNARLSSGRTPCHVAAMLGHKDLVQLLLDRDANIEATDEWGRTPCHVAAWRGHKDLVQLLLDRGANIEATDEWDLAPCHLAAGEGQTNVVQLLLDRGANIEATDEWGRSPCHEAASAGHKDALQHLLDCGANVEATDRWGHKPCHLAAWKGHEDSVRLLIDRGANIEAADNDGDTALTLAAWNGHVNTVRLLIDRGANIEAADELGRTPCHLAASADRKDMVRLL 253          
BLAST of SMED30005028 vs. TrEMBL
Match: A0A5A8DXK5 (ANK_REP_REGION domain-containing protein OS=Cafeteria roenbergensis OX=33653 GN=FNF27_06991 PE=4 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 3.966e-44
Identity = 101/268 (37.69%), Postives = 145/268 (54.10%), Query Frame = 2
Query:   92 LFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            L  R    E  +  DL    P H A   GQT +V+LL+D   +IEA D+W + P H A+  GHK  ++ L+    ++ A D W   P H A   GH   V LLID   +IE+ D  G   L  A   G   T +LLID   +IEA D+  + P H A   +R  +V+LL+D   NIE+ D+W R P HL+ S     TV+LL+D   +IEA D W + P HLA +A R + V++L+D   +IE  D++G +P  +A   G + ++ +L
Sbjct:  121 LLDRGANIEATDEWDLA---PCHLAAGEGQTNVVQLLLDRGANIEATDEWGRSPCHEAASAGHKDALQHLLDCGANVEATDRWGHKPCHLAAWKGHEDSVRLLIDRGANIEAADNDGDTALTLAAWNGHVNTVRLLIDRGANIEAADELGRTPCHLAASADRKDMVRLLLDRGANIEAADEWGRTPCHLAASADRKVTVRLLLDRGANIEAADKWGRTPCHLAASAGRKDMVRLLLDRGANIEATDEWGRTPCHLAASAGRKDMVRLL 385          

HSP 2 Score: 181.8 bits (460), Expect = 2.631e-43
Identity = 104/294 (35.37%), Postives = 153/294 (52.04%), Query Frame = 2
Query:   20 NIFIMSNSEHYQCFIRAIRG--GSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            N+       H  C + A +G   S++L     +   +E  D +    +  A   G    V+LLID   +IEA D+  + P H A+    K  V+LL+    +I A DEW R P H A        V LL+D   +IE+ DK G  P H A  AGR +  +LL+D   +IEA D+W + P H A    R  +V+LL+D   NIE+ D+ +R P HL+ S  C  TV+LLID   +IEA D   + P HLA +A R + V++L+D   +IE  D+ G +P  +A   G + ++ +L
Sbjct:  193 NVEATDRWGHKPCHLAAWKGHEDSVRLL--IDRGANIEAADNDGDTALTLAAWNGHVNTVRLLIDRGANIEAADELGRTPCHLAASADRKDMVRLLLDRGANIEAADEWGRTPCHLAASADRKVTVRLLLDRGANIEAADKWGRTPCHLAASAGRKDMVRLLLDRGANIEATDEWGRTPCHLAASAGRKDMVRLLLDRGANIEATDESSRTPCHLAASADCKVTVRLLIDRGANIEAADELGRTPCHLAASADRKDMVRLLLDRGANIEAADESGLTPCHLAASAGRKDMVRLL 484          

HSP 3 Score: 178.718 bits (452), Expect = 2.214e-42
Identity = 103/292 (35.27%), Postives = 152/292 (52.05%), Query Frame = 2
Query:   20 NIFIMSNSEHYQCFIRAIRGGSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            NI     S    C + A  G    +     +   +E  D +   P H A   G+ ++V+LL+D   +IEA D+ ++ P H A+    K  V+LL+    +I A DEW R P H A   GH   V LLID   +IE+ DK G  P H A  AGR +  +LL+D   +IEA D+W +   H      R   V+LLID   NIE+ D+W R P HL+      ++V+LLID   +IEA D W + P HLA      ++V++L+D   +IE  D++G +P  +A   G++  + +L
Sbjct:  457 NIEAADESGLTPCHLAASAGRKDMVRLLLDRGANIEATDESGLTPCHLAASAGRKDMVRLLLDRGANIEAADESSRTPCHLAASADRKDMVRLLIDRGANIEAADEWGRTPCHLAAWKGHEDSVRLLIDRGANIEAADKSGLTPCHLAASAGRKDMVRLLLDRGANIEATDEWGRTLCHVFTWMCRKDAVRLLIDRGANIEATDEWGRTPCHLAAWKGHEDSVRLLIDRGANIEAADNWGRTPCHLAAWKGHEDSVRLLIDRGANIEAADKWGRTPCHLAAWKGHKDSVRLL 748          

HSP 4 Score: 177.178 bits (448), Expect = 8.605e-42
Identity = 96/283 (33.92%), Postives = 147/283 (51.94%), Query Frame = 2
Query:   20 NIFIMSNSEHYQCFIRAIRGGSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKT 868
            NI      +   C + A  G +  +     +   +E  D   + P H A   G  + ++ L+D   ++EA D+W  +P H A+  GH+ +V+LL+    +I A D      +  A  +GH   V LLID   +IE+ D+LG  P H A  A R +  +LL+D   +IEA D+W + P H A   +R   V+LL+D   NIE+ DKW R P HL+ S    + V+LL+D   +IEA D W + P HLA +A R + V++L+D   +IE  D+   +P  +A   
Sbjct:  127 NIEATDEWDLAPCHLAAGEGQTNVVQLLLDRGANIEATDEWGRSPCHEAASAGHKDALQHLLDCGANVEATDRWGHKPCHLAAWKGHEDSVRLLIDRGANIEAADNDGDTALTLAAWNGHVNTVRLLIDRGANIEAADELGRTPCHLAASADRKDMVRLLLDRGANIEAADEWGRTPCHLAASADRKVTVRLLLDRGANIEAADKWGRTPCHLAASAGRKDMVRLLLDRGANIEATDEWGRTPCHLAASAGRKDMVRLLLDRGANIEATDESSRTPCHLAASA 409          

HSP 5 Score: 174.481 bits (441), Expect = 6.629e-41
Identity = 103/292 (35.27%), Postives = 146/292 (50.00%), Query Frame = 2
Query:   20 NIFIMSNSEHYQCFIRAIRGGSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            NI          C   A  G    L H       +E  D    +P H A  +G  + V+LLID   +IEA D      +  A+ NGH  TV+LL+    +I A DE  R P H A       +V LL+D   +IE+ D+ G  P H A  A R  T +LL+D   +IEA DKW + P H A    R  +V+LL+D   NIE+ D+W R P HL+ S    + V+LL+D   +IEA D   + P HLA +A    TV++L+D   +IE  D+ G +P  +A     + ++ +L
Sbjct:  160 NIEATDEWGRSPCHEAASAGHKDALQHLLDCGANVEATDRWGHKPCHLAAWKGHEDSVRLLIDRGANIEAADNDGDTALTLAAWNGHVNTVRLLIDRGANIEAADELGRTPCHLAASADRKDMVRLLLDRGANIEAADEWGRTPCHLAASADRKVTVRLLLDRGANIEAADKWGRTPCHLAASAGRKDMVRLLLDRGANIEATDEWGRTPCHLAASAGRKDMVRLLLDRGANIEATDESSRTPCHLAASADCKVTVRLLIDRGANIEAADELGRTPCHLAASADRKDMVRLL 451          

HSP 6 Score: 173.326 bits (438), Expect = 1.225e-40
Identity = 94/258 (36.43%), Postives = 142/258 (55.04%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            +E  D   + P H A    + ++V+LL+D   +IEA D+W + P H A+    K TV+LL+    +I A D+W R P H A   G   +V LL+D   +IE+ D+ G  P H A  AGR +  +LL+D   +IEA D+  + P H A   +    V+LLID   NIE+ D+  R P HL+ S    + V+LL+D   +IEA D     P HLA +A R + V++L+D   +IE  D+ G +P  +A   G + ++ +L
Sbjct:  260 IEAADELGRTPCHLAASADRKDMVRLLLDRGANIEAADEWGRTPCHLAASADRKVTVRLLLDRGANIEAADKWGRTPCHLAASAGRKDMVRLLLDRGANIEATDEWGRTPCHLAASAGRKDMVRLLLDRGANIEATDESSRTPCHLAASADCKVTVRLLIDRGANIEAADELGRTPCHLAASADRKDMVRLLLDRGANIEAADESGLTPCHLAASAGRKDMVRLLLDRGANIEATDESGLTPCHLAASAGRKDMVRLL 517          

HSP 7 Score: 172.555 bits (436), Expect = 2.729e-40
Identity = 104/320 (32.50%), Postives = 158/320 (49.38%), Query Frame = 2
Query:   38 NSEHYQCFIRAIRGGSIKLFHRFFKREY-LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCA----------------CEYERA-----------------GIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            +S    C + A+ G    L      R+  +E  D   + P H A  RG  ++V+LL+D   +IEA D+W + P H ++  GHK  ++LL+    +I A DEWD  P H A   G + +V LL+D   +IE+ D+ G  P H A  AG  +  + L+D   ++EA D+W  +P H A                   E A                   V+LLID   NIE+ D+  R P HL+ S    + V+LL+D   +IEA D W + P HLA +A R  TV++L+D   +IE  D++G +P  +A   G + ++ +L
Sbjct:   34 SSGRTPCHVAAMLGHK-DLVQLLLDRDANIEATDEWGRTPCHVAAWRGHKDLVQLLLDRGANIEATDEWCRTPCHLSASAGHKDALQLLLDRGANIEATDEWDLAPCHLAAGEGQTNVVQLLLDRGANIEATDEWGRSPCHEAASAGHKDALQHLLDCGANVEATDRWGHKPCHLAAWKGHEDSVRLLIDRGANIEAADNDGDTALTLAAWNGHVNTVRLLIDRGANIEAADELGRTPCHLAASADRKDMVRLLLDRGANIEAADEWGRTPCHLAASADRKVTVRLLLDRGANIEAADKWGRTPCHLAASAGRKDMVRLL 352          

HSP 8 Score: 170.629 bits (431), Expect = 8.900e-40
Identity = 95/258 (36.82%), Postives = 141/258 (54.65%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            +E  D   + P H A   G+ ++V+LL+D   +IEA D+W + P H A+  G K  V+LL+    +I A DE  R P H A        V LLID   +IE+ D+LG  P H A  A R +  +LL+D   +IEA D+    P H A    R  +V+LL+D   NIE+ D+    P HL+ S    + V+LL+D   +IEA D   + P HLA +A R + V++L+D   +IE  D++G +P  +A   G+E  + +L
Sbjct:  326 IEAADKWGRTPCHLAASAGRKDMVRLLLDRGANIEATDEWGRTPCHLAASAGRKDMVRLLLDRGANIEATDESSRTPCHLAASADCKVTVRLLIDRGANIEAADELGRTPCHLAASADRKDMVRLLLDRGANIEAADESGLTPCHLAASAGRKDMVRLLLDRGANIEATDESGLTPCHLAASAGRKDMVRLLLDRGANIEAADESSRTPCHLAASADRKDMVRLLIDRGANIEAADEWGRTPCHLAAWKGHEDSVRLL 583          

HSP 9 Score: 168.318 bits (425), Expect = 5.251e-39
Identity = 98/292 (33.56%), Postives = 150/292 (51.37%), Query Frame = 2
Query:   20 NIFIMSNSEHYQCFIRAIRGGSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            NI          C + A  G    +     +   +E  D   + P H A   G+ ++V+LL+D   +IEA D+ ++ P H A+    K TV+LL+    +I A DE  R P H A       +V LL+D   +IE+ D+ G  P H A  AGR +  +LL+D   +IEA D+    P H A    R  +V+LL+D   NIE+ D+ +R P HL+ S    + V+LLID   +IEA D W + P HLA      ++V++L+D   +IE  D+ G +P  +A   G + ++ +L
Sbjct:  325 NIEAADKWGRTPCHLAASAGRKDMVRLLLDRGANIEATDEWGRTPCHLAASAGRKDMVRLLLDRGANIEATDESSRTPCHLAASADCKVTVRLLIDRGANIEAADELGRTPCHLAASADRKDMVRLLLDRGANIEAADESGLTPCHLAASAGRKDMVRLLLDRGANIEATDESGLTPCHLAASAGRKDMVRLLLDRGANIEAADESSRTPCHLAASADRKDMVRLLIDRGANIEAADEWGRTPCHLAAWKGHEDSVRLLIDRGANIEAADKSGLTPCHLAASAGRKDMVRLL 616          

HSP 10 Score: 165.236 bits (417), Expect = 5.254e-38
Identity = 92/258 (35.66%), Postives = 136/258 (52.71%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            +E  D   + P H A    +   V+LL+D   +IEA DKW + P H A+  G K  V+LL+    +I A DEW R P H A   G   +V LL+D   +IE+ D+    P H A  A    T +LLID   +IEA D+  + P H A   +R  +V+LL+D   NIE+ D+    P HL+ S    + V+LL+D   +IEA D     P HLA +A R + V++L+D   +IE  D+   +P  +A     + ++ +L
Sbjct:  293 IEAADEWGRTPCHLAASADRKVTVRLLLDRGANIEAADKWGRTPCHLAASAGRKDMVRLLLDRGANIEATDEWGRTPCHLAASAGRKDMVRLLLDRGANIEATDESSRTPCHLAASADCKVTVRLLIDRGANIEAADELGRTPCHLAASADRKDMVRLLLDRGANIEAADESGLTPCHLAASAGRKDMVRLLLDRGANIEATDESGLTPCHLAASAGRKDMVRLLLDRGANIEAADESSRTPCHLAASADRKDMVRLL 550          

HSP 11 Score: 162.925 bits (411), Expect = 2.972e-37
Identity = 92/283 (32.51%), Postives = 142/283 (50.18%), Query Frame = 2
Query:   50 YQCFIRAIRGGSIKLFHRFFKREYLEREDLNKKR-PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
               F  AI  G +    R   R       L+  R P H A   G  ++V+LL+D + +IEA D+W + P H A+  GHK  V+LL+    +I A DEW R P H +   GH   + LL+D   +IE+ D+    P H A   G+    +LL+D   +IEA D+W + P H A        ++ L+D   N+E+ D+W  +P HL+      ++V+LLID   +IEA D      + LA       TV++L+D   +IE  D+ G +P  +A     + ++ +L
Sbjct:    4 VTAFEAAITAGDLTKVARALDRGQDVNARLSSGRTPCHVAAMLGHKDLVQLLLDRDANIEATDEWGRTPCHVAAWRGHKDLVQLLLDRGANIEATDEWCRTPCHLSASAGHKDALQLLLDRGANIEATDEWDLAPCHLAAGEGQTNVVQLLLDRGANIEATDEWGRSPCHEAASAGHKDALQHLLDCGANVEATDRWGHKPCHLAAWKGHEDSVRLLIDRGANIEAADNDGDTALTLAAWNGHVNTVRLLIDRGANIEAADELGRTPCHLAASADRKDMVRLL 286          

HSP 12 Score: 160.614 bits (405), Expect = 1.633e-36
Identity = 95/275 (34.55%), Postives = 139/275 (50.55%), Query Frame = 2
Query:   20 NIFIMSNSEHYQCFIRAIRGGSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNS 844
            NI          C + A  G    +     +   +E  D + + P H A        V+LLID   +IEA D+  + P H A+    K  V+LL+    +I A DE    P H A   G   +V LL+D   +IE+ D+ G  P H A  AGR +  +LL+D   +IEA D+  + P H A   +R  +V+LLID   NIE+ D+W R P HL+      ++V+LLID   +IEA D     P HLA +A R + V++L+D   +IE  D++G +
Sbjct:  358 NIEATDEWGRTPCHLAASAGRKDMVRLLLDRGANIEATDESSRTPCHLAASADCKVTVRLLIDRGANIEAADELGRTPCHLAASADRKDMVRLLLDRGANIEAADESGLTPCHLAASAGRKDMVRLLLDRGANIEATDESGLTPCHLAASAGRKDMVRLLLDRGANIEAADESSRTPCHLAASADRKDMVRLLIDRGANIEAADEWGRTPCHLAAWKGHEDSVRLLIDRGANIEAADKSGLTPCHLAASAGRKDMVRLLLDRGANIEATDEWGRT 632          

HSP 13 Score: 156.377 bits (394), Expect = 3.180e-35
Identity = 95/292 (32.53%), Postives = 143/292 (48.97%), Query Frame = 2
Query:   20 NIFIMSNSEHYQCFIRAIRGGSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            NI     S    C + A     + +     +   +E  D   + P H A    + ++V+LL+D   +IEA D+    P H A+  G K  V+LL+    +I A DE    P H A   G   +V LL+D   +IE+ D+    P H A  A R +  +LLID   +IEA D+W + P H A        V+LLID   NIE+ DK    P HL+ S    + V+LL+D   +IEA D W +   H+     R + V++L+D   +IE  D++G +P  +A   G+E  + +L
Sbjct:  391 NIEATDESSRTPCHLAASADCKVTVRLLIDRGANIEAADELGRTPCHLAASADRKDMVRLLLDRGANIEAADESGLTPCHLAASAGRKDMVRLLLDRGANIEATDESGLTPCHLAASAGRKDMVRLLLDRGANIEAADESSRTPCHLAASADRKDMVRLLIDRGANIEAADEWGRTPCHLAAWKGHEDSVRLLIDRGANIEAADKSGLTPCHLAASAGRKDMVRLLLDRGANIEATDEWGRTLCHVFTWMCRKDAVRLLIDRGANIEATDEWGRTPCHLAAWKGHEDSVRLL 682          
BLAST of SMED30005028 vs. Ensembl Cavefish
Match: ankrd44 (ankyrin repeat domain 44 [Source:ZFIN;Acc:ZDB-GENE-070912-605])

HSP 1 Score: 125.176 bits (313), Expect = 9.565e-29
Identity = 70/255 (27.45%), Postives = 127/255 (49.80%), Query Frame = 2
Query:  134 DLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGC-CTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            D N + P+H A         +++I     +   D+  +  +H+A+ NGH + V LL+S   +INA D+ D   +H A   GH  +V LL+D   ++  +DK GY PLH A   G+    K L++   +I+  + +    +H AC   +  +V  LID+  N+   +     P+H + +       ++ L+++  D+  +    + P+H+     R    + L+ +  +I+  D+ GN+PL IA + G+E LI+ L
Sbjct:  100 DKNWQTPLHVAAANKALRCAEVIIPLLSSVNVSDRGGRTALHHAALNGHTEMVSLLLSKGANINAFDKKDGRALHWAAYMGHLDVVCLLVDQGAEVSCKDKRGYTPLHAAASNGQINVVKHLLNLSVEIDEANAFGNTALHVACFNGQDAVVSELIDYGANVSQPNNKGFTPLHFAAASTHGALCLEFLVNNGADVNVQSRDGKSPLHMTAVHGRFTRSQTLIQNGGEIDSVDKDGNTPLHIAARYGHELLINTL 354          

HSP 2 Score: 113.62 bits (283), Expect = 4.251e-25
Identity = 70/249 (28.11%), Postives = 120/249 (48.19%), Query Frame = 2
Query:  140 NKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLI 886
            + K P+  A   G  E +++LI  + DI ALD   + P+H A+  G  + ++LL+     +NA+D     P+HRA        V +LI H  D+ +RDK    PLH A        A+++I     +   D+  +  +H A       +V LL+    NI + DK + R +H +      + V LL+D   ++  +D     P+H A +  +   VK L++   +I+E + FGN+ L +A   G + ++
Sbjct:    3 DAKPPLLQAIFNGDPEEIRMLIFKSEDINALDAEKRTPLHAAAFLGDAEIIELLILSGARVNAKDNMWLTPLHRAVASRSEEAVRVLIRHSADVNARDKNWQTPLHVAAANKALRCAEVIIPLLSSVNVSDRGGRTALHHAALNGHTEMVSLLLSKGANINAFDKKDGRALHWAAYMGHLDVVCLLVDQGAEVSCKDKRGYTPLHAAASNGQINVVKHLLNLSVEIDEANAFGNTALHVACFNGQDAVV 251          

HSP 3 Score: 85.5001 bits (210), Expect = 2.133e-16
Identity = 72/297 (24.24%), Postives = 127/297 (42.76%), Query Frame = 2
Query:   35 SNSEHYQCFIRAIRGGS-IKLFHRFFKRE--YLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDI-------NARDEWD----RVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQR-PIHCACEYERAGIVKLLI-DHHCN--IESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTG 871
            + S H+QC    +  G+ I    ++ +    Y    DL+++  +    E+     ++ L+         DK     +HYA+  GH+         HC         N +DE +    R P+H A  HGH+  + +L+  HC+++  D++G   L  A   G  + A  L++H     +RD    R PIH A        V+LL+ D  C   +E+ D   + P+ L+  G   + V LL++ +  ++  D      +HL     + E V+ L++    +   D  G + L +A   G
Sbjct:  448 AASRHFQCLETLVSCGTCINATDQWGRSALHYAAASDLDRR--LQAEKEKEAALCLEFLLKSGATASLKDKQGYSAVHYAAAYGHR---------HCLELLLEREENHQDEMESSSTRSPLHLAAYHGHAQALEVLLQGHCEVDQGDEVGRTALALAALRGHTDCALTLLNHGASPRSRDSGRGRTPIHLAVMNGHTSCVRLLLEDSDCADLVEAADSQGQTPLMLAVVGGHVDAVSLLLEREASVDTADHQGLTALHLGLLCGQEECVQCLLEQEASVLLGDSKGRTALHLAAARG 733          

HSP 4 Score: 78.9518 bits (193), Expect = 1.810e-14
Identity = 61/264 (23.11%), Postives = 114/264 (43.18%), Query Frame = 2
Query:  146 KRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVK------------LLVSLHCDINARDEWDRVPIHRACEHGH----SGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKW-NRRPIHLSCSGCCTETVKLLI-DHKCD--IEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNE 877
            + P+H+A      + ++ L+     I A D+W +  +HYA+ +   + ++             L+      + +D+     +H A  +GH      ++    +H  ++ES       PLH A   G A+  ++L+  HC+++  D+  +  +  A           L++H  +  SRD    R PIHL+     T  V+LL+ D  C   +EA D   Q P+ LA      + V +L++    ++  D  G + L + +  G E
Sbjct:  441 RTPLHYAAASRHFQCLETLVSCGTCINATDQWGRSALHYAAASDLDRRLQAEKEKEAALCLEFLLKSGATASLKDKQGYSAVHYAAAYGHRHCLELLLEREENHQDEMESSST--RSPLHLAAYHGHAQALEVLLQGHCEVDQGDEVGRTALALAALRGHTDCALTLLNHGASPRSRDSGRGRTPIHLAVMNGHTSCVRLLLEDSDCADLVEAADSQGQTPLMLAVVGGHVDAVSLLLEREASVDTADHQGLTALHLGLLCGQE 702          

HSP 5 Score: 77.411 bits (189), Expect = 5.767e-14
Identity = 58/226 (25.66%), Postives = 99/226 (43.81%), Query Frame = 2
Query:  242 NQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDK-LGYRPLHYACKAGRAETAKLLI-DHHCD--IEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEEC----DQFGNSPLEIAMKTGNEGLIHIL 895
             + P+H A+ +GH + +++L+  HC+++  DE  R  +  A   GH+     L++H     SRD   G  P+H A   G     +LL+ D  C   +EA D   Q P+  A        V LL++   ++++ D      +HL       E V+ L++ +  +   D   +  +HLA        +  L+   C         D  G +PL  A   G+EG + +L
Sbjct:  553 TRSPLHLAAYHGHAQALEVLLQGHCEVDQGDEVGRTALALAALRGHTDCALTLLNHGASPRSRDSGRGRTPIHLAVMNGHTSCVRLLLEDSDCADLVEAADSQGQTPLMLAVVGGHVDAVSLLLEREASVDTADHQGLTALHLGLLCGQEECVQCLLEQEASVLLGDSKGRTALHLAAARGHASWLSELLSIACSEPPTPPLRDNQGYTPLHWACYNGHEGCVEVL 778          

HSP 6 Score: 71.633 bits (174), Expect = 3.555e-12
Identity = 68/302 (22.52%), Postives = 118/302 (39.07%), Query Frame = 2
Query:   35 SNSEHYQCFIRAIRGGSIKLFHRFFKREY-LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCD----INARDEWDRVPIHRACEHGHSGIVNLLIDH--------------HC------DIESRDKLGY------RPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSP 847
            ++S+     + A+ GG +       +RE  ++  D      +H     GQ E V+ L++    +   D   +  +H A+  GH   +  L+S+ C        RD     P+H AC +GH G V +L++               HC       +E   K+         PLH A  AG  +  +LL+ H   ++A D+  +  +  A E    G+V + I+H  +I      N          C  ++  + I               P+HLA ++   +TVK L+     ++  D+ G  P
Sbjct:  652 ADSQGQTPLMLAVVGGHVDAVSLLLEREASVDTADHQGLTALHLGLLCGQEECVQCLLEQEASVLLGDSKGRTALHLAAARGHASWLSELLSIACSEPPTPPLRDNQGYTPLHWACYNGHEGCVEVLLEQKGCRCFDGNPFTPLHCAVYVFFSVEKSGKMNTDVIFCRAPLHAAAFAGNVDCVQLLLAHDAPVDAVDQSGRSALMMAAERGAVGVVGMNINHQPHIIYLLTVNP-----GGENCILKSFVMFIYFS------------PLHLAAHSGLKQTVKELLSRGASVQVLDENGVCP 936          

HSP 7 Score: 68.5514 bits (166), Expect = 2.934e-11
Identity = 59/246 (23.98%), Postives = 100/246 (40.65%), Query Frame = 2
Query:  155 IHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKT-VKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCD-IEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWD------QRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKT 868
            +H AC  GQ  +V  LIDY  ++   +     P+H+A+ + H    ++ LV+   D+N +    + P+H    HG       LI +  +I+S DK G  PLH A + G       LI    D           P+H A     A   + L+     I++ D   R  +H + +G     + + +     +             + P+H A  ++  + ++ LV     I   DQ+G S L  A  +
Sbjct:  239 LHVACFNGQDAVVSELIDYGANVSQPNNKGFTPLHFAAASTHGALCLEFLVNNGADVNVQSRDGKSPLHMTAVHGRFTRSQTLIQNGGEIDSVDKDGNTPLHIAARYGHELLINTLITSGADCTRCVGVHGMFPLHLAALNAHADCCRKLLSSGFQIDTPDSLGRTCLH-AAAGSADRLLCVCVCVCVCMCVCMGVCAYIHDYRTPLHYAAASRHFQCLETLVSCGTCINATDQWGRSALHYAAAS 483          

HSP 8 Score: 67.3958 bits (163), Expect = 7.479e-11
Identity = 58/219 (26.48%), Postives = 91/219 (41.55%), Query Frame = 2
Query:  344 RVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSG----CC-----------------------------TETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLI-HILN 898
            + P+ +A  +G    + +LI    DI + D     PLH A   G AE  +LLI     + A+D     P+H A        V++LI H  ++ +RDK  + P+H++ +     C                              TE V LL+    +I A D  D R +H A      + V +LVD   ++   D+ G +PL  A   G   ++ H+LN
Sbjct:    5 KPPLLQAIFNGDPEEIRMLIFKSEDINALDAEKRTPLHAAAFLGDAEIIELLILSGARVNAKDNMWLTPLHRAVASRSEEAVRVLIRHSADVNARDKNWQTPLHVAAANKALRCAEVIIPLLSSVNVSDRGGRTALHHAALNGHTEMVSLLLSKGANINAFDKKDGRALHWAAYMGHLDVVCLLVDQGAEVSCKDKRGYTPLHAAASNGQINVVKHLLN 223          

HSP 9 Score: 65.0846 bits (157), Expect = 3.342e-10
Identity = 61/299 (20.40%), Postives = 117/299 (39.13%), Query Frame = 2
Query:  140 NKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCD-INARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLG-------------------------------------YR-PLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCAC------------EYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSG----CCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTG 871
            + K P+H     G+    + LI    +I+++DK    P+H A++ GH+  +  L++   D           P+H A  + H+     L+     I++ D LG                                     YR PLHYA  +   +  + L+     I A D+W +  +H A             E E A  ++ L+        +DK     +H + +     C    ++   +H+ ++E+     + P+HLA      + +++L+  HC++++ D+ G + L +A   G
Sbjct:  301 DGKSPLHMTAVHGRFTRSQTLIQNGGEIDSVDKDGNTPLHIAARYGHELLINTLITSGADCTRCVGVHGMFPLHLAALNAHADCCRKLLSSGFQIDTPDSLGRTCLHAAAGSADRLLCVCVCVCVCMCVCMGVCAYIHDYRTPLHYAAASRHFQCLETLVSCGTCINATDQWGRSALHYAAASDLDRRLQAEKEKEAALCLEFLLKSGATASLKDKQGYSAVHYAAAYGHRHCLELLLEREENHQDEMESSS--TRSPLHLAAYHGHAQALEVLLQGHCEVDQGDEVGRTALALAALRG 597          
BLAST of SMED30005028 vs. Ensembl Cavefish
Match: ankrd44 (ankyrin repeat domain 44 [Source:ZFIN;Acc:ZDB-GENE-070912-605])

HSP 1 Score: 124.79 bits (312), Expect = 1.416e-28
Identity = 70/255 (27.45%), Postives = 127/255 (49.80%), Query Frame = 2
Query:  134 DLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGC-CTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            D N + P+H A         +++I     +   D+  +  +H+A+ NGH + V LL+S   +INA D+ D   +H A   GH  +V LL+D   ++  +DK GY PLH A   G+    K L++   +I+  + +    +H AC   +  +V  LID+  N+   +     P+H + +       ++ L+++  D+  +    + P+H+     R    + L+ +  +I+  D+ GN+PL IA + G+E LI+ L
Sbjct:  104 DKNWQTPLHVAAANKALRCAEVIIPLLSSVNVSDRGGRTALHHAALNGHTEMVSLLLSKGANINAFDKKDGRALHWAAYMGHLDVVCLLVDQGAEVSCKDKRGYTPLHAAASNGQINVVKHLLNLSVEIDEANAFGNTALHVACFNGQDAVVSELIDYGANVSQPNNKGFTPLHFAAASTHGALCLEFLVNNGADVNVQSRDGKSPLHMTAVHGRFTRSQTLIQNGGEIDSVDKDGNTPLHIAARYGHELLINTL 358          

HSP 2 Score: 111.694 bits (278), Expect = 1.548e-24
Identity = 70/250 (28.00%), Postives = 120/250 (48.00%), Query Frame = 2
Query:  137 LNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLI 886
            L  + P+  A   G  E +++LI  + DI ALD   + P+H A+  G  + ++LL+     +NA+D     P+HRA        V +LI H  D+ +RDK    PLH A        A+++I     +   D+  +  +H A       +V LL+    NI + DK + R +H +      + V LL+D   ++  +D     P+H A +  +   VK L++   +I+E + FGN+ L +A   G + ++
Sbjct:    6 LVDQPPLLQAIFNGDPEEIRMLIFKSEDINALDAEKRTPLHAAAFLGDAEIIELLILSGARVNAKDNMWLTPLHRAVASRSEEAVRVLIRHSADVNARDKNWQTPLHVAAANKALRCAEVIIPLLSSVNVSDRGGRTALHHAALNGHTEMVSLLLSKGANINAFDKKDGRALHWAAYMGHLDVVCLLVDQGAEVSCKDKRGYTPLHAAASNGQINVVKHLLNLSVEIDEANAFGNTALHVACFNGQDAVV 255          

HSP 3 Score: 104.76 bits (260), Expect = 2.365e-22
Identity = 68/227 (29.96%), Postives = 109/227 (48.02%), Query Frame = 2
Query:  221 IEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLI-HILN 898
            +  L   +Q P+  A  NG  + +++L+    DINA D   R P+H A   G + I+ LLI     + ++D +   PLH A  +   E  ++LI H  D+ ARDK  Q P+H A   +     +++I    ++   D+  R  +H +     TE V LL+    +I A D  D R +H A      + V +LVD   ++   D+ G +PL  A   G   ++ H+LN
Sbjct:    1 MAVLKLVDQPPLLQAIFNGDPEEIRMLIFKSEDINALDAEKRTPLHAAAFLGDAEIIELLILSGARVNAKDNMWLTPLHRAVASRSEEAVRVLIRHSADVNARDKNWQTPLHVAAANKALRCAEVIIPLLSSVNVSDRGGRTALHHAALNGHTEMVSLLLSKGANINAFDKKDGRALHWAAYMGHLDVVCLLVDQGAEVSCKDKRGYTPLHAAASNGQINVVKHLLN 227          

HSP 4 Score: 91.6633 bits (226), Expect = 2.270e-18
Identity = 74/278 (26.62%), Postives = 121/278 (43.53%), Query Frame = 2
Query:  155 IHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRAC------------EHGHSGI-----------VNLLIDHHCDIESRDKLGYRPLHYACKAG----RAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQR-PIHLACNAKRTETVKILV-DHHCD--IEECDQFGNSPLEIAMKTGNEGLIHIL 895
            +H A   G  E VKLL+    D    DK  + P+HYA+ + H + ++ LVS    INA D+W R  +H A             E    G+           +  L+        +DK GY  +HYA   G         +   +H  ++E+     + P+H A  +  A  +++L+  HC ++  D+  R  + L+     T+    L++H     +RD    R PIHLA     T  V++L+ D  C   +E  D  G +PL +A+  G+   + +L
Sbjct:  427 LHAAAAGGNVECVKLLLSSGSDHNRTDKHGRTPLHYAAASRHFQCLETLVSCGTCINATDQWGRSALHYAAASDLDRRRRVALEPESPGVQAEKEKEAALCLEFLLKSGATASLKDKQGYSAVHYAAAYGHRHCLELLLEREENHQDEMESSST--RSPLHLAAYHGHAQALEVLLQGHCEVDQGDEVGRTALALAALRGHTDCALTLLNHGASPRSRDSGRGRTPIHLAVMNGHTSCVRLLLEDSDCADLVEAADSQGQTPLMLAVVGGHVDAVSLL 702          

HSP 5 Score: 86.2705 bits (212), Expect = 1.145e-16
Identity = 74/317 (23.34%), Postives = 132/317 (41.64%), Query Frame = 2
Query:   35 SNSEHYQCFIRAIRGGSIKLFHRFFKREY-LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCD----INARDEWDRVPIHRACEHGHSGIVNLLIDH--------------HCDI-----------------------ESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVK-LLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCD---IEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSP 847
            ++S+     + A+ GG +       +RE  ++  D      +H     GQ E V+ L++    +   D   +  +H A+  GH   +  L+S+ C        RD     P+H AC +GH G V +L++               HC +                       +SRD+    PLH A  AG  +  +LL+ H   ++A D+  +  +  A E    G+V+ LL     ++   D+     +HL+CS    +   L+++   D   ++A +   Q P+HLA ++   +TVK L+     ++  D+ G  P
Sbjct:  679 ADSQGQTPLMLAVVGGHVDAVSLLLEREASVDTADHQGLTALHLGLLCGQEECVQCLLEQEASVLLGDSKGRTALHLAAARGHASWLSELLSIACSEPPTPPLRDNQGYTPLHWACYNGHEGCVEVLLEQKGCRCFDGNPFTPLHCAVVNDHESCATLLLEAMGSEIVTCKDSRDR---APLHAAAFAGNVDCVQLLLAHDAPVDAVDQSGRSALMMAAERGAVGVVEALLTSASADLSLTDQKGNTALHLACSKGKEDCALLILEKLPDTTIVKATNSALQTPLHLAAHSGLKQTVKELLSRGASVQVLDENGVCP 992          

HSP 6 Score: 83.1889 bits (204), Expect = 1.172e-15
Identity = 69/266 (25.94%), Postives = 107/266 (40.23%), Query Frame = 2
Query:  125 EREDLNKKRPIHHACERGQTEIVKLLI-DYNCD--IEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCD----IEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCD--IEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
             R+    + PIH A   G T  V+LL+ D +C   +EA D   Q P+  A   GH   V LL+     ++  D      +H     G    V  L++    +   D  G   LH A   G A     L+   C        RD     P+H AC     G V++L++        D     P+H +          LL++      +  +D  D+ P+H A  A   + V++L+ H   ++  DQ G S L +A + G  G++  L
Sbjct:  641 SRDSGRGRTPIHLAVMNGHTSCVRLLLEDSDCADLVEAADSQGQTPLMLAVVGGHVDAVSLLLEREASVDTADHQGLTALHLGLLCGQEECVQCLLEQEASVLLGDSKGRTALHLAAARGHASWLSELLSIACSEPPTPPLRDNQGYTPLHWACYNGHEGCVEVLLEQK-GCRCFDGNPFTPLHCAVVNDHESCATLLLEAMGSEIVTCKDSRDRAPLHAAAFAGNVDCVQLLLAHDAPVDAVDQSGRSALMMAAERGAVGVVEAL 905          

HSP 7 Score: 77.411 bits (189), Expect = 5.837e-14
Identity = 70/306 (22.88%), Postives = 124/306 (40.52%), Query Frame = 2
Query:   56 CFIRAIRGGSIKLFHRFFKREYL-EREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYAS-------------------QNGHKKTVKL----LVSLHCDINARDEWDRVPIHRACEHGH----SGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKW-NRRPIHLSCSGCCTETVKLLI-DHKCD--IEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNE 877
            C   A  GG+++             R D + + P+H+A      + ++ L+     I A D+W +  +HYA+                   Q   +K   L    L+      + +D+     +H A  +GH      ++    +H  ++ES       PLH A   G A+  ++L+  HC+++  D+  +  +  A           L++H  +  SRD    R PIHL+     T  V+LL+ D  C   +EA D   Q P+ LA      + V +L++    ++  D  G + L + +  G E
Sbjct:  426 CLHAAAAGGNVECVKLLLSSGSDHNRTDKHGRTPLHYAAASRHFQCLETLVSCGTCINATDQWGRSALHYAAASDLDRRRRVALEPESPGVQAEKEKEAALCLEFLLKSGATASLKDKQGYSAVHYAAAYGHRHCLELLLEREENHQDEMESSST--RSPLHLAAYHGHAQALEVLLQGHCEVDQGDEVGRTALALAALRGHTDCALTLLNHGASPRSRDSGRGRTPIHLAVMNGHTSCVRLLLEDSDCADLVEAADSQGQTPLMLAVVGGHVDAVSLLLEREASVDTADHQGLTALHLGLLCGQE 729          

HSP 8 Score: 71.2478 bits (173), Expect = 4.250e-12
Identity = 56/250 (22.40%), Postives = 105/250 (42.00%), Query Frame = 2
Query:  125 EREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEW-DRVPIHRACEHGHSGIVNLLI-DHHCD--IESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSC----SGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPL 850
            E E  + + P+H A   G  + +++L+  +C+++  D+  +  +  A+  GH      L++      +RD    R PIH A  +GH+  V LL+ D  C   +E+ D  G  PL  A   G  +   LL++    ++  D      +H      +   V+ L++   ++   D   R  +HL+     +   +E + +          RD     P+H AC       V++L++     + C  F  +P 
Sbjct:  574 EMESSSTRSPLHLAAYHGHAQALEVLLQGHCEVDQGDEVGRTALALAALRGHTDCALTLLNHGASPRSRDSGRGRTPIHLAVMNGHTSCVRLLLEDSDCADLVEAADSQGQTPLMLAVVGGHVDAVSLLLEREASVDTADHQGLTALHLGLLCGQEECVQCLLEQEASVLLGDSKGRTALHLAAARGHASWLSELLSIACSEPPTPPLRDNQGYTPLHWACYNGHEGCVEVLLEQ----KGCRCFDGNPF 819          

HSP 9 Score: 67.781 bits (164), Expect = 5.265e-11
Identity = 65/272 (23.90%), Postives = 102/272 (37.50%), Query Frame = 2
Query:  155 IHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKT-VKLLVSLHCDINARD---------------------------EWDRV------PIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKT 868
            +H AC  GQ  +V  LIDY  ++   +     P+H+A+ + H    ++ LV+   D+N +                            E D V      P+H A  +GH  ++N LI    D   R   G  PLH A     A+  + L+             +  I C    +        ID      + D   R  +H + +G   E VKLL+    D    D   + P+H A  ++  + ++ LV     I   DQ+G S L  A  +
Sbjct:  243 LHVACFNGQDAVVSELIDYGANVSQPNNKGFTPLHFAAASTHGALCLEFLVNNGADVNVQSRDGKSPLHMTAVHGRFTRSQTLIQNGGEIDSVDKDGNTPLHIAARYGHELLINTLITSGADCTRRGVHGMFPLHLAALNAHADCCRKLL---------SSGRRYSIICPLSNDSVLCAGFQID------TPDSLGRTCLHAAAAGGNVECVKLLLSSGSDHNRTDKHGRTPLHYAAASRHFQCLETLVSCGTCINATDQWGRSALHYAAAS 499          

HSP 10 Score: 67.3958 bits (163), Expect = 7.589e-11
Identity = 67/309 (21.68%), Postives = 118/309 (38.19%), Query Frame = 2
Query:  101 RFFKREYL-------EREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVS----------LHCD--------INARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIH------------CACEYERAGI-----------VKLLIDHHCNIESRDKWNRRPIHLSCSG----CCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTG 871
            RF + + L       +  D +   P+H A   G   ++  LI    D          P+H A+ N H    + L+S          L  D        I+  D   R  +H A   G+   V LL+    D    DK G  PLHYA  +   +  + L+     I A D+W +  +H             A E E  G+           ++ L+        +DK     +H + +     C    ++   +H+ ++E+     + P+HLA      + +++L+  HC++++ D+ G + L +A   G
Sbjct:  318 RFTRSQTLIQNGGEIDSVDKDGNTPLHIAARYGHELLINTLITSGADCTRRGVHGMFPLHLAALNAHADCCRKLLSSGRRYSIICPLSNDSVLCAGFQIDTPDSLGRTCLHAAAAGGNVECVKLLLSSGSDHNRTDKHGRTPLHYAAASRHFQCLETLVSCGTCINATDQWGRSALHYAAASDLDRRRRVALEPESPGVQAEKEKEAALCLEFLLKSGATASLKDKQGYSAVHYAAAYGHRHCLELLLEREENHQDEMESSST--RSPLHLAAYHGHAQALEVLLQGHCEVDQGDEVGRTALALAALRG 624          

HSP 11 Score: 65.0846 bits (157), Expect = 4.083e-10
Identity = 46/194 (23.71%), Postives = 78/194 (40.21%), Query Frame = 2
Query:  140 NKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHH------------------CDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCS 667
            + K P+H     G+    + LI    +I+++DK    P+H A++ GH+  +  L++   D   R      P+H A  + H+     L+                       I++ D LG   LH A   G  E  KLL+    D    DK  + P+H A        ++ L+     I + D+W R  +H + +
Sbjct:  305 DGKSPLHMTAVHGRFTRSQTLIQNGGEIDSVDKDGNTPLHIAARYGHELLINTLITSGADCTRRGVHGMFPLHLAALNAHADCCRKLLSSGRRYSIICPLSNDSVLCAGFQIDTPDSLGRTCLHAAAAGGNVECVKLLLSSGSDHNRTDKHGRTPLHYAAASRHFQCLETLVSCGTCINATDQWGRSALHYAAA 498          
BLAST of SMED30005028 vs. Ensembl Cavefish
Match: ank1a (ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GENE-041010-44])

HSP 1 Score: 123.25 bits (308), Expect = 5.770e-28
Identity = 66/255 (25.88%), Postives = 119/255 (46.67%), Query Frame = 2
Query:  131 EDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
             ++  + P+H A   G  E+ + L+     ++A  K +Q  +H A++ GHK+ VKLL+    + N+       P+H A   GH+  V +L+D +       K G+ PLH A K G+ + A+LL++   +  A  K    P+H A  +    +V LL+    +  S  +    P+H++      E    L+ +     A       P+HLA    R + V +L+    ++   ++ G +PL +  + G+ G+  IL
Sbjct:  405 SNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLHIASKQNQVEVASSLLQYGASANAESLQGVTPLHLAAQEGRADMVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADIL 659          

HSP 2 Score: 122.479 bits (306), Expect = 1.013e-27
Identity = 67/248 (27.02%), Postives = 111/248 (44.76%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            P+H A   G T+ V++L+D N     + K    P+H A++ G     +LL+    + NA  +    P+H A  H +  +VNLL+       S  + GY PLH A K  + E A  L+ +     A       P+H A +  RA +V LLI    N+   +K    P+HL           +L+     + A       P+H+AC+    + VK L+    ++    + G +PL  A + G+  ++ +L
Sbjct:  478 PLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLHIASKQNQVEVASSLLQYGASANAESLQGVTPLHLAAQEGRADMVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNGKTRAGYTPLHQAAQQGHTDIVTLL 725          

HSP 3 Score: 114.39 bits (285), Expect = 3.596e-25
Identity = 69/277 (24.91%), Postives = 131/277 (47.29%), Query Frame = 2
Query:   68 AIRGGSIKLFHRFF-KREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            A R G +++      +   ++ +  N   PIH A +    + V+ L+ YN +I+ +   +  P+H A+  GH +  K+L+      N R      P+H AC+  H  +++LL+ H   +E+  + G  PLH A   G     K+L+       A +   + P+H A       + + L+ +   ++++ K ++  +H +      E VKLL++HK +  +       P+H+A     T+TV+IL+D +    +  + G +PL +A K G   +  +L
Sbjct:  251 AARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELL 527          

HSP 4 Score: 111.309 bits (277), Expect = 3.154e-24
Identity = 72/285 (25.26%), Postives = 121/285 (42.46%), Query Frame = 2
Query:  140 NKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEH---------------------------------GHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            N   P+H A  RG   +V+LL+D    I+A  K    P+H A++NGH + +++L+     I A+ +    PIH A +                                  GH  +  +L+D      +R   G+ PLH ACK        LL+ H   +EA  +    P+H A       IVK+L+    +  + +     P+H++      E  + L+ +   ++A+   DQ  +H A      E VK+L++H  +       G++PL IA + G+   + IL
Sbjct:  210 NGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRIL 494          

HSP 5 Score: 106.686 bits (265), Expect = 7.290e-23
Identity = 66/286 (23.08%), Postives = 124/286 (43.36%), Query Frame = 2
Query:  137 LNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLV----------------------SLHCD-----------INARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            LN   P+H AC++    ++ LL+ ++  +EA+ +    P+H AS  GH   VK+L+                      + HC+           ++A+ + D+  +H A   GH  +V LL++H  +  S    G+ PLH A + G  +T ++L+D +       K    P+H A +Y +  + +LL++   N  +  K    P+H++      + V LL+       +       P+H+A    + E    L+ +          G +PL +A + G   ++ +L
Sbjct:  341 LNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLHIASKQNQVEVASSLLQYGASANAESLQGVTPLHLAAQEGRADMVSLL 626          

HSP 6 Score: 100.523 bits (249), Expect = 6.501e-21
Identity = 44/156 (28.21%), Postives = 74/156 (47.44%), Query Frame = 2
Query:  140 NKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDH 607
            N   P+H A ++ Q E+   L+ Y     A       P+H A+Q G    V LL+S   ++N  ++    P+H   + GH GI ++L+     + +  ++GY PLH AC  G  +  K L+    ++  + +    P+H A +     IV LL+ H
Sbjct:  573 NGYTPLHIASKQNQVEVASSLLQYGASANAESLQGVTPLHLAAQEGRADMVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNGKTRAGYTPLHQAAQQGHTDIVTLLLKH 728          

HSP 7 Score: 96.6709 bits (239), Expect = 9.063e-20
Identity = 70/327 (21.41%), Postives = 124/327 (37.92%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLV-------------------------SLHCDINAR-----------DEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSG----CCTETV-----------------------------KLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            LE         +H A   GQ ++V  L++Y  ++ A  +    P++ A+Q  H + VK L+                          L+   NA                  P+H A  + +  +  LL++   ++    K G  PLH A + G     +LL+D    I+A+ K +  P+HCA       I+++L+D    I+++ K    PIH++  G    C  + +                             K+L+D       R      P+H+AC       + +L+ H   +E   + G +PL +A   G+  ++ IL
Sbjct:   69 LETTTKKGNTALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEVKPSAVSLANSYSFPLYLSTNASHITLKNVCSFITATGFTPLHIAAHYENLNVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKIL 395          

HSP 8 Score: 95.5153 bits (236), Expect = 1.758e-19
Identity = 60/242 (24.79%), Postives = 112/242 (46.28%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCA--CEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTG 871
            P+H A       + +LL++   ++    K    P+H AS+ G+   V+LL+     I+A+ + +  P+H A  +GH  I+ +L+D    I+++ K G  P+H A +    +  + L+ ++ +I+        P+H A  C + R  + K+L+D      +R      P+H++C       + LL+ H   +EA       P+H+A        VKIL+         +    +PL +A + G
Sbjct:  181 PLHIAAHYENLNVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHR--MAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAG 420          

HSP 9 Score: 93.5893 bits (231), Expect = 7.205e-19
Identity = 47/189 (24.87%), Postives = 80/189 (42.33%), Query Frame = 2
Query:  140 NKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDH 706
            N   P+H A      ++V LL+       +  +    P+H AS+    +    L+      NA       P+H A + G + +V+LLI    ++   +K G  PLH   + G    A +L+     + A  +    P+H AC Y    +VK L+    N+  + +    P+H +     T+ V LL+ H
Sbjct:  540 NGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLHIASKQNQVEVASSLLQYGASANAESLQGVTPLHLAAQEGRADMVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNGKTRAGYTPLHQAAQQGHTDIVTLLLKH 728          

HSP 10 Score: 80.4925 bits (197), Expect = 7.912e-15
Identity = 36/126 (28.57%), Postives = 60/126 (47.62%), Query Frame = 2
Query:  131 EDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDH 508
            E L    P+H A + G+ ++V LLI    ++   +K    P+H  +Q GH     +LV     + A       P+H AC +G+  +V  L+    ++  + + GY PLH A + G  +   LL+ H
Sbjct:  603 ESLQGVTPLHLAAQEGRADMVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNGKTRAGYTPLHQAAQQGHTDIVTLLLKH 728          

HSP 11 Score: 63.1586 bits (152), Expect = 1.694e-9
Identity = 41/198 (20.71%), Postives = 89/198 (44.95%), Query Frame = 2
Query:  317 DINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGC-----CTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            DIN  ++     +H A + GH  +V  L+ +   +E+  K G   LH A  AG+ +    L+++  ++ A+ +    P++ A +     +VK L+++  N     +     + L+ S        T    + + + C       +   P+H+A + +     ++L++   ++    + G +PL IA + GN  ++ +L
Sbjct:   35 DINTANQNGLNGLHLASKEGHVKMVLELLHNGVVLETTTKKGNTALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEVKPSAVSLANSYSFPLYLSTNASHITLKNVCSFITATGFT--PLHIAAHYENLNVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLL 230          
BLAST of SMED30005028 vs. Ensembl Cavefish
Match: ENSAMXT00000048191.1 (pep primary_assembly:Astyanax_mexicanus-2.0:15:3100273:3104460:1 gene:ENSAMXG00000036724.1 transcript:ENSAMXT00000048191.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.775 bits (286), Expect = 1.405e-27
Identity = 66/257 (25.68%), Postives = 125/257 (48.64%), Query Frame = 2
Query:  113 REYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGL 883
            +    R D  ++ P+H A   G   I+ LLI    ++ A D     P+H A+ + +++ V LL+    D+ ARD++ +  +H A  +  +   + L+ H   +   D+ G   LH+A ++G  E  KLL++    + A DK +++PIH A       +VKLL+    +   +DK    P+H + +    + VK L+ +  +I+  + +    +H+AC   +      LV+   ++ + +  G +PL +A  + N  L
Sbjct:   17 QAIFNRNDQERRTPLHAAAWLGDVHIMDLLISAGANVNAKDHVWLTPLHRAAASRNERAVGLLLRKGADVTARDKFWQTALHIAAANRATRCADTLLPHISSLNIADRTGRAALHHAAQSGCQEMVKLLLNKGASLSASDKKERQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLHAAAASGHVDVVKYLLRNGAEIDEPNAFGNTALHVACYMGQEAVANELVNRGANVNQPNNRGYTPLHLAAVSTNGAL 273          

HSP 2 Score: 102.834 bits (255), Expect = 1.699e-23
Identity = 67/239 (28.03%), Postives = 113/239 (47.28%), Query Frame = 2
Query:  179 QTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            Q  +V+ + + N      D+  + P+H A+  G    + LL+S   ++NA+D     P+HRA    +   V LL+    D+ +RDK     LH A        A  L+ H   +   D+  +  +H A +     +VKLL++   ++ + DK  R+PIH +      E VKLL+    D   +D     P+H A  +   + VK L+ +  +I+E + FGN+ L +A   G E + + L
Sbjct:   12 QPPLVQAIFNRN------DQERRTPLHAAAWLGDVHIMDLLISAGANVNAKDHVWLTPLHRAAASRNERAVGLLLRKGADVTARDKFWQTALHIAAANRATRCADTLLPHISSLNIADRTGRAALHHAAQSGCQEMVKLLLNKGASLSASDKKERQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLHAAAASGHVDVVKYLLRNGAEIDEPNAFGNTALHVACYMGQEAVANEL 244          

HSP 3 Score: 76.6406 bits (187), Expect = 1.146e-14
Identity = 43/148 (29.05%), Postives = 71/148 (47.97%), Query Frame = 2
Query:  110 KREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYAC-KAGRAETAKLLIDHHCDIEARDKWDQRP 550
            K   L   D  +++PIH A   G  E+VKLL+    D    DK    P+H A+ +GH   VK L+    +I+  + +    +H AC  G   + N L++   ++   +  GY PLH A      A   +LL+++  D+  +  W+ +P
Sbjct:  148 KGASLSASDKKERQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLHAAAASGHVDVVKYLLRNGAEIDEPNAFGNTALHVACYMGQEAVANELVNRGANVNQPNNRGYTPLHLAAVSTNGALCLELLVNNGADVNMQ-VWENQP 294          
BLAST of SMED30005028 vs. Ensembl Cavefish
Match: tnksa (tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase a [Source:ZFIN;Acc:ZDB-GENE-030131-7450])

HSP 1 Score: 119.013 bits (297), Expect = 2.367e-27
Identity = 79/293 (26.96%), Postives = 128/293 (43.69%), Query Frame = 2
Query:   50 YQCFIRAIRGGSIKLFHRFFKREYLEREDL--NKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRA------------ETAK---------LLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIA 859
            ++    A R G +    R      +  +D+   K  P+H A   G+ ++V+ L+    ++ A D     P+H A   GH + V LL+    D N+RD W+  P+H A   G   +  +L+ H  D   R+  G   L  A  + +A            E A+         LL   + +  A D     P+H A  Y R  IV+LL+ H  ++ ++DK    P+H +CS    E  +LL+ H   + A D W   P+H A +  R E   +L+ H  D    +  G S +++A
Sbjct:  127 FRELFEACRNGDVSRVKRLVDSVNVNAKDMAGRKSTPLHFAAGFGRKDVVEHLLQTGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNSRDNWNYTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLADPSAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMA 419          
BLAST of SMED30005028 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 128.257 bits (321), Expect = 2.018e-30
Identity = 67/238 (28.15%), Postives = 112/238 (47.06%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMK 865
            P+H A   GQ E+VK L+     +    + +Q P+H AS+ G  + V+LL+    D NA       P++ A   GH  + +LL+++  DI    K G+ PLH A K GR E A LL++ +   + + K    P+H A  Y+   +  LL+D   +  S  K    P+H++      E  K+L++   +          P+HLA      + V +L+  H  I    + G + + +A +
Sbjct:  446 PLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQ 683          

HSP 2 Score: 119.013 bits (297), Expect = 1.620e-27
Identity = 70/252 (27.78%), Postives = 121/252 (48.02%), Query Frame = 2
Query:  140 NKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            N   P+H A +RG   +VKLL+D    I+   +    P+H A+++GH+K +++L+     I A+ +    P+H A +  H   V LL+     ++        PLH A   G    AKLL+D   +  AR      P+H AC+  R  +++LL+ H  +I +  +    PIH++        V+LL+ +     A +   + P+H+A  A + E VK L+     +    +   +PL IA + G   ++ +L
Sbjct:  244 NGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLL 495          

HSP 3 Score: 110.538 bits (275), Expect = 7.369e-25
Identity = 71/288 (24.65%), Postives = 125/288 (43.40%), Query Frame = 2
Query:  137 LNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINA---RDEW------------------------------DRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHILNG 901
            LN   P+H AC++ + ++++LL+ +   I    +    PIH AS  GH   V+LL+      NA   R E                               D+ P+H A   G + IV LL+    D  +    G  PL++A + G  + A LL+++  DI    K    P+H A +Y R  +  LL++ + + + + K    P+H++      +   LL+D      +       P+H+A    + E  K+L++   +     Q G +PL +A + G+  ++ +L G
Sbjct:  375 LNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLG 662          

HSP 4 Score: 108.612 bits (270), Expect = 2.885e-24
Identity = 65/256 (25.39%), Postives = 111/256 (43.36%), Query Frame = 2
Query:  128 REDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            RED   + P+H A   G+ EIV+LL+    D  A       P+++AS+ GH     LL+    DI+   +    P+H A ++G   +  LL++ +   + + K G  PLH A      + A LL+D      +  K    P+H A +  +  + K+L++         +    P+HL+      + V LL+     I          +HLA    +    +IL  H  D+    +   +PL +A   GN  +++ L
Sbjct:  474 RED---QTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFL 726          

HSP 5 Score: 107.457 bits (267), Expect = 6.573e-24
Identity = 62/252 (24.60%), Postives = 112/252 (44.44%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHILNGVI 907
            P++ A   G  ++  LL++   DI  + K    P+H AS+ G  +   LL+  +   + + +    P+H A  + H  +  LL+D      S  K GY PLH A K  + E  K+L++   +     +    P+H A +   A +V LL+  H +I    K     +HL+         ++L  HK D+         P+H+A +    + V  L+ +   +    + G +PL  A + G+    H++N ++
Sbjct:  512 PLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGH---THVVNALL 760          

HSP 6 Score: 105.145 bits (261), Expect = 3.382e-23
Identity = 70/279 (25.09%), Postives = 130/279 (46.59%), Query Frame = 2
Query:  122 LEREDLNKKR--PIHHACERGQTEIVKLLI--DYNCDIEALDKWNQR------PIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL--NGVIYVSCN 922
            LE +   K R   +H A  +  T    LL+  ++N D+ +    NQ       P+H A+  G+     LL++L   ++        P+H A + G++ +V LL+D    I+++ + G  PLH A ++G  +  ++L++    I A+ K    P+H A + E    V+LL+     ++        P+H++         KLL+D   +  AR      P+H+AC   R + +++L+ H   I    + G +P+ +A   G+  ++ +L  NG    + N
Sbjct:  162 LESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATN 440          

HSP 7 Score: 103.219 bits (256), Expect = 1.234e-22
Identity = 65/269 (24.16%), Postives = 118/269 (43.87%), Query Frame = 2
Query:   68 AIRGGSIKLFHRFFKREY-LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTG 871
            A R G  K+     +R+  +  +  N   P+H A +      V+LL+     ++ +      P+H A+  GH +  KLL+    + NAR      P+H AC+     ++ LL+ H   I +  + G  P+H A   G     +LL+ +     A +   + P+H A    +  +VK L+     +  + + ++ P+H++      E V+LL+    D  A       P++ A      +   +L+++  DI    + G +PL IA K G
Sbjct:  285 AARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYG 553          

HSP 8 Score: 98.2117 bits (243), Expect = 4.949e-21
Identity = 64/275 (23.27%), Postives = 126/275 (45.82%), Query Frame = 2
Query:   68 AIRGGSIKLFHRFFKREY-LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLI--DHHCDIEARDKWDQR------PIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMK 865
            A + G + +     KRE  ++         +H A   GQT+IV++L+++  +I A  +    P++ A+Q  H + VK L+    + +   E    P+  A + GH  +V LL++     +++ K+    LH A +      A LL+  +H+ D+ ++   +Q       P+H A  Y    +  LL++    ++   +    P+H++        VKLL+D    I+ +      P+H A  +   + +++L++    I    + G SPL +A +
Sbjct:   50 ASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLES----DTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQ 320          

HSP 9 Score: 95.1301 bits (235), Expect = 3.635e-20
Identity = 69/300 (23.00%), Postives = 133/300 (44.33%), Query Frame = 2
Query:   29 IMSNSEHYQCFIRAIRGGSIKLFHRFFKREY-LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLI--DHHCNIESRDKWNR------RPIHLSC--SGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            ++  S+    F+RA R G+++      K    +   + N    +H A + G  ++V  L+    +I+   K     +H A+  G    V++LV    +INA+ +    P++ A +  H  IV  L+D+  +     + G+ PL  A + G  +   LL++     + + K     +H A   +      LL+  +H+ ++ S+   N+       P+H++         T+ L +    D  AR+     P+H+A        VK+L+D    I+   + G +PL  A ++G+E +I +L
Sbjct:    4 LLDKSDAATSFLRAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLES----DTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGI--TPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEML 297          

HSP 10 Score: 85.8853 bits (211), Expect = 2.622e-17
Identity = 46/192 (23.96%), Postives = 82/192 (42.71%), Query Frame = 2
Query:  140 NKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCD 715
            N   P+H A      ++  LL+D      +  K    P+H A++    +  K+L+ L  + N   +    P+H A + GH+ +V LL+  H  I    K G   +H A +  +   A++L  H  D+    K    P+H A  Y    +V  L+ +   + ++ +    P+H +     T  V  L+ H+  
Sbjct:  574 NGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEAS 765          
BLAST of SMED30005028 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003991.1 (pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1 gene:ENSPMAG00000003623.1 transcript:ENSPMAT00000003991.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 128.642 bits (322), Expect = 2.266e-30
Identity = 75/255 (29.41%), Postives = 130/255 (50.98%), Query Frame = 2
Query:  134 DLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGC-CTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            D N + P+H A      +  + +I         D+  +  +H+A+ NGH + V  LV+   +INA D+ DR  IH A   GH+ +V +L+ H  D+  +DK GY PLH A  +G+    KLL+D   DI+  + +    +H AC   +  +V  LID   N+   ++    P+H + +       ++LL+++  D+  +    + P+H+     R    + L+ +  +I+  D+ GN+PL IA + G+E LI+ L
Sbjct:  102 DKNWQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTALHVACYNGQDVVVNELIDCGANVNQANERGFTPLHFAAASTHGALCLELLVNNGADVNVQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCEDRDGNTPLHIAARYGHELLINTL 356          

HSP 2 Score: 119.398 bits (298), Expect = 1.658e-27
Identity = 72/251 (28.69%), Postives = 123/251 (49.00%), Query Frame = 2
Query:  143 KKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
             + P+  A   G  + V+ LI    ++ A+D   + P+H A+  G  + ++LLV     +N++D     P+HRAC       V  L+ H  D+ +RDK    PLH A      + A+ +I         D+  +  +H A     + +V  L+    NI + DK +RR IH +     TE VK+L+ H  D+  +D     P+H A ++ +   VK+L+D   DI++ + FGN+ L +A   G + +++ L
Sbjct:    6 SQAPLIQAIFNGDPDEVRSLIYKKEEVNAVDDEKRTPLHAAAYLGEAEIIELLVLSGARVNSKDNKWLTPLHRACASRSEAAVQTLLKHSADVNARDKNWQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTALHVACYNGQDVVVNEL 256          

HSP 3 Score: 104.76 bits (260), Expect = 4.475e-23
Identity = 70/258 (27.13%), Postives = 119/258 (46.12%), Query Frame = 2
Query:  110 KREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLID----HHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQ-RPIHCACEYERAGIVKLLIDHHCN--IESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDH-HCDIEECDQFGNSPLEIA 859
              E ++  D N++ P+  A   G T+   LL+     I A D      +H  +  GH++ V LL+    D++ R+   R P+H A   GH GI++ L+         I   D+ GY PLH+AC  G     +LL++   D+  + + +   P+HCA   +     ++LID      I   D   R P+H +      E ++LL+ H   +   D   + P+ +AC   +   V++LV+    D++  D   N+ L +A
Sbjct:  675 SNEAVDASDANEQTPVMLAVGNGHTDCASLLLSKGASINAKDNKGCTALHRGAATGHEECVDLLLQRSVDVSLRERRGRAPLHMAAACGHMGILSALVQAAMASGAPIPLTDRNGYTPLHWACYNGHDGCVELLLE--LDVFQKQEGNAFSPLHCAVLNDNESCAEMLIDTFGAKIINCPDAKGRMPLHAAAFTDHVECLQLLLSHNALVNVTDMAGKSPLMMACENGQATAVEVLVNSTKTDLKLQDANRNTALHLA 930          

HSP 4 Score: 99.7525 bits (247), Expect = 1.695e-21
Identity = 73/270 (27.04%), Postives = 118/270 (43.70%), Query Frame = 2
Query:  116 EYLEREDLNKKRPIHHACERGQTEIVKLLI---DYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLID----HHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNR-RPIHLSCSGCCTETVKLLIDHKCD--IEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
              L +E  +++  +H A   G  E ++LL+   D N  ++A D   Q P+  A  NGH     LL+S    INA+D      +HR    GH   V+LL+    D+  R++ G  PLH A   G       L+         I   D+    P+H AC     G V+LL++   ++  + + N   P+H +         ++LID      I   D   + P+H A      E +++L+ H+  +   D  G SPL +A + G    + +L
Sbjct:  641 SVLLKEGPDRRTALHSAATNGHVECLRLLVENADSNEAVDASDANEQTPVMLAVGNGHTDCASLLLSKGASINAKDNKGCTALHRGAATGHEECVDLLLQRSVDVSLRERRGRAPLHMAAACGHMGILSALVQAAMASGAPIPLTDRNGYTPLHWACYNGHDGCVELLLE--LDVFQKQEGNAFSPLHCAVLNDNESCAEMLIDTFGAKIINCPDAKGRMPLHAAAFTDHVECLQLLLSHNALVNVTDMAGKSPLMMACENGQATAVEVL 908          

HSP 5 Score: 87.4261 bits (215), Expect = 1.042e-17
Identity = 63/253 (24.90%), Postives = 114/253 (45.06%), Query Frame = 2
Query:  155 IHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDI--NARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQR-PIHCACEYERAGIVKLLI---DHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            +H  C   Q   ++ L+  + D    DK    P+HYA+  GH+  ++LL+        + +      P+H A  HGH G + +LI    D++ R+  GY PL  A   G  +  ++LI H   +  ++  D+R  +H A        ++LL+   D +  +++ D   + P+ L+     T+   LL+     I A+D      +H        E V +L+    D+   ++ G +PL +A   G+ G++  L
Sbjct:  520 VHSTCSEAQI-CLEHLLRKDADPGIQDKQGYTPVHYAAAYGHRVCLELLLEQPGAFQSDGKSGHPISPLHLAAYHGHHGALEVLIRSLVDLDVREGNGYTPLGLAALRGHTDCVRVLIQHGASVLLKEGPDRRTALHSAATNGHVECLRLLVENADSNEAVDASDANEQTPVMLAVGNGHTDCASLLLSKGASINAKDNKGCTALHRGAATGHEECVDLLLQRSVDVSLRERRGRAPLHMAAACGHMGILSAL 771          

HSP 6 Score: 72.0182 bits (175), Expect = 6.271e-13
Identity = 57/249 (22.89%), Postives = 103/249 (41.37%), Query Frame = 2
Query:  152 PIHHACERGQTEI-VKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHC-----NIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEG 880
            P+H A       + ++LL++   D+    K  + P+H  + +G     + L+    +I+  D     P+H A  +GH  ++N LI +  D   R   G  PLH A  +G ++  + L      + A  K+               IV    + H       I++ D++ R  +H + SG   E + LL+    D+  +D +++  +H A      + V  LV     + E D+   +PL  A     +G
Sbjct:  273 PLHFAAASTHGALCLELLVNNGADVNVQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCEDRDGNTPLHIAARYGHELLINTLITNGADTAKRGIHGMFPLHLAALSGFSDCCRKL------LSAGQKYS--------------IVSSFSNEHVLSAGFEIDTPDEFGRTCLHAAASGGNVECLNLLLSTGADMNKKDRFERTALHYAAANCNVQCVVTLVASGARLNEQDERRCTPLHYAAAADGDG 501          

HSP 7 Score: 71.633 bits (174), Expect = 7.370e-13
Identity = 68/315 (21.59%), Postives = 126/315 (40.00%), Query Frame = 2
Query:   56 CFIRAIRGGSIKLFHRFFKREY-LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHY-ASQNGHKKTVKL---------------------------LVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGY--RPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRR-PIHLSCSGCCTETVKLLI---DHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            C   A  GG+++  +        + ++D  ++  +H+A      + V  L+     +   D+    P+HY A+ +G   TV                             L+    D   +D+    P+H A  +GH   + LL++     +S  K G+   PLH A   G     ++LI    D++ R+     P+  A        V++LI H  ++  ++  +RR  +H + +    E ++LL+   D    ++A D  +Q P+ LA     T+   +L+     I   D  G + L     TG+E  + +L
Sbjct:  424 CLHAAASGGNVECLNLLLSTGADMNKKDRFERTALHYAAANCNVQCVVTLVASGARLNEQDERRCTPLHYAAAADGDGSTVSFSVYNTISVQSYIDVHSTCSEAQICLEHLLRKDADPGIQDKQGYTPVHYAAAYGHRVCLELLLEQPGAFQSDGKSGHPISPLHLAAYHGHHGALEVLIRSLVDLDVREGNGYTPLGLAALRGHTDCVRVLIQHGASVLLKEGPDRRTALHSAATNGHVECLRLLVENADSNEAVDASDANEQTPVMLAVGNGHTDCASLLLSKGASINAKDNKGCTALHRGAATGHEECVDLL 738          

HSP 8 Score: 59.3066 bits (142), Expect = 4.219e-9
Identity = 60/300 (20.00%), Postives = 114/300 (38.00%), Query Frame = 2
Query:  140 NKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHS-------------GIVNLLIDHHC-----DIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSG-------------------------CCTET---VKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGN--SPLEIAMKTGNEGLIHIL 895
            + K P+H     G+    + LI    +I+  D+    P+H A++ GH+  +  L++   D   R      P+H A   G S              IV+   + H      +I++ D+ G   LH A   G  E   LL+    D+  +D++++  +H A        V  L+     +  +D+    P+H + +                           C+E    ++ L+    D   +D     P+H A        +++L++     +   + G+  SPL +A   G+ G + +L
Sbjct:  303 DGKSPLHMTAVHGRFTRSQTLIQNGGEIDCEDRDGNTPLHIAARYGHELLINTLITNGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSAGQKYSIVSSFSNEHVLSAGFEIDTPDEFGRTCLHAAASGGNVECLNLLLSTGADMNKKDRFERTALHYAAANCNVQCVVTLVASGARLNEQDERRCTPLHYAAAADGDGSTVSFSVYNTISVQSYIDVHSTCSEAQICLEHLLRKDADPGIQDKQGYTPVHYAAAYGHRVCLELLLEQPGAFQSDGKSGHPISPLHLAAYHGHHGALEVL 602          

HSP 9 Score: 53.1434 bits (126), Expect = 3.275e-7
Identity = 41/170 (24.12%), Postives = 74/170 (43.53%), Query Frame = 2
Query:  107 FKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLV-SLHCDINARDEWDRVPIHRACEHGH---SGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRP-IHCACEYERAGIVKLLI 601
            F  + +   D   + P+H A      E ++LL+ +N  +   D   + P+  A +NG    V++LV S   D+  +D      +H AC   H   + ++   +D    I + +     PLH A ++G A   ++L++    I A D     P + CA     A  + L++
Sbjct:  844 FGAKIINCPDAKGRMPLHAAAFTDHVECLQLLLSHNALVNVTDMAGKSPLMMACENGQATAVEVLVNSTKTDLKLQDANRNTALHLACSRSHETCALLILDKLDDLNLINATNAALQTPLHLAARSGMATVVQVLLNKGASILAVDHNGYTPALSCAPNKSVAECLSLIL 1013          
BLAST of SMED30005028 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007954.1 (pep scaffold:Pmarinus_7.0:GL479092:583:36301:1 gene:ENSPMAG00000007165.1 transcript:ENSPMAT00000007954.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 124.405 bits (311), Expect = 3.359e-29
Identity = 78/287 (27.18%), Postives = 133/287 (46.34%), Query Frame = 2
Query:   74 RGGSIKLFHRFF------------KREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAET-AKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            R G   L H  F            K   +   D  ++R +H A   G TE+VK+L+    D+   DK    P+H A+ +GH   V+LL+SL  ++N  + +    +H AC +G   +V+ L+D   D   R++ G+  LH+A  +       +LL++HH D+ A+    + P+H    + R    + LI +   I+  DK    P+H++        +  LI +  D   R      P+HLA  +  ++  + L+    D++  D+FG + L  A   GN   I++L
Sbjct:   45 RAGRTALHHAAFNGNLEMVNLLISKGANVNAMDKRERRAVHWAGYMGHTEVVKMLLSNGADVNWKDKKGYTPLHAAAASGHVTVVRLLLSLKAEMNEFNGFGNTALHVACHNGQDAVVSELLDAGADAGHRNERGFTALHFAAASTHGAICLELLVNHHADVNAQSYDGKSPLHMTAIHGRFTRSQTLIQNGGEIDCGDKEGNTPLHIAARYGHELLINTLISNGADAARRGSHGMFPLHLAALSGFSDCCRKLLTPGFDVDAVDEFGRTCLHAAAAGGNAECINLL 331          

HSP 2 Score: 120.553 bits (301), Expect = 5.025e-28
Identity = 68/255 (26.67%), Postives = 130/255 (50.98%), Query Frame = 2
Query:  134 DLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTET-VKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            D N + P+H A      +    LI    ++   D+  +  +H+A+ NG+ + V LL+S   ++NA D+ +R  +H A   GH+ +V +L+ +  D+  +DK GY PLH A  +G     +LL+    ++   + +    +H AC   +  +V  L+D   +   R++     +H + +       ++LL++H  D+ A+ +  + P+H+     R    + L+ +  +I+  D+ GN+PL IA + G+E LI+ L
Sbjct:   11 DKNWQTPLHVASANRAIKCADALIPLLSNVNVSDRAGRTALHHAAFNGNLEMVNLLISKGANVNAMDKRERRAVHWAGYMGHTEVVKMLLSNGADVNWKDKKGYTPLHAAAASGHVTVVRLLLSLKAEMNEFNGFGNTALHVACHNGQDAVVSELLDAGADAGHRNERGFTALHFAAASTHGAICLELLVNHHADVNAQSYDGKSPLHMTAIHGRFTRSQTLIQNGGEIDCGDKEGNTPLHIAARYGHELLINTL 265          

HSP 3 Score: 78.5666 bits (192), Expect = 4.991e-15
Identity = 47/185 (25.41%), Postives = 87/185 (47.03%), Query Frame = 2
Query:  314 CDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKT 868
             D+NARD+  + P+H A  +      + LI    ++   D+ G   LH+A   G  E   LLI    ++ A DK ++R +H A       +VK+L+ +  ++  +DK    P+H + +      V+LL+  K ++   + +    +H+AC+  +   V  L+D   D    ++ G + L  A  +
Sbjct:    5 ADVNARDKNWQTPLHVASANRAIKCADALIPLLSNVNVSDRAGRTALHHAAFNGNLEMVNLLISKGANVNAMDKRERRAVHWAGYMGHTEVVKMLLSNGADVNWKDKKGYTPLHAAAASGHVTVVRLLLSLKAEMNEFNGFGNTALHVACHNGQDAVVSELLDAGADAGHRNERGFTALHFAAAS 189          

HSP 4 Score: 75.8702 bits (185), Expect = 3.400e-14
Identity = 44/162 (27.16%), Postives = 76/162 (46.91%), Query Frame = 2
Query:  401 IDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLI 886
            + H  D+ +RDK    PLH A      + A  LI    ++   D+  +  +H A       +V LLI    N+ + DK  RR +H +     TE VK+L+ +  D+  +D     P+H A  +     V++L+    ++ E + FGN+ L +A   G + ++
Sbjct:    1 LRHAADVNARDKNWQTPLHVASANRAIKCADALIPLLSNVNVSDRAGRTALHHAAFNGNLEMVNLLISKGANVNAMDKRERRAVHWAGYMGHTEVVKMLLSNGADVNWKDKKGYTPLHAAAASGHVTVVRLLLSLKAEMNEFNGFGNTALHVACHNGQDAVV 162          

HSP 5 Score: 64.6994 bits (156), Expect = 9.951e-11
Identity = 39/132 (29.55%), Postives = 62/132 (46.97%), Query Frame = 2
Query:  500 IDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            + H  D+ ARDK  Q P+H A           LI    N+   D+  R  +H +      E V LLI    ++ A D  ++R +H A     TE VK+L+ +  D+   D+ G +PL  A  +G+  ++ +L
Sbjct:    1 LRHAADVNARDKNWQTPLHVASANRAIKCADALIPLLSNVNVSDRAGRTALHHAAFNGNLEMVNLLISKGANVNAMDKRERRAVHWAGYMGHTEVVKMLLSNGADVNWKDKKGYTPLHAAAASGHVTVVRLL 132          

HSP 6 Score: 63.5438 bits (153), Expect = 2.331e-10
Identity = 71/307 (23.13%), Postives = 123/307 (40.07%), Query Frame = 2
Query:   83 SIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVK-LLIDYNCDIEALDKWNQR-PIHYASQNG-------HKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLID---------HH------CDIEARDKWDQRPIHCACEYERA----------GIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCD--IEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            ++++  RF     L   D + + P+  A  RG TE V+ LL +  C   +     +R P+H A  +         K  +K+L S    IN     DR P+  A  +GH+  V LL+D   + ++ D   +  LH   + G  +    L+          HH      C + +R    Q P +     +RA            V+LL++  C     + +   P+H +         ++LID      +  +D   + P+H A  A   E  ++L+ H   ++  D+ G +PL      G  G++  L
Sbjct:  474 ALEVLLRFVGEADLR--DGHGRAPLELAAARGHTECVETLLANGACAGASSGTAAKRCPLHSAGGSAVAELLTIGKSRIKILGS----INLFVRTDRTPLMLAVTNGHTDCVLLLMDKGANPDAVDLQKHTALHRGVRLGPQDPVMNLVQISVVRRLRPHHPSGGGGCLLFSRPVLPQAPTNLYLHSQRALCKIYYNSHEACVELLLEQLCQKFEGNPFT--PLHCAVMNDNESCAEMLIDAMGAKIVMCQDGKGRTPLHAAAFADNVECAQLLLSHGARVDATDRRGRTPLMTGALQGQSGIVEYL 772          

HSP 7 Score: 63.1586 bits (152), Expect = 2.908e-10
Identity = 37/141 (26.24%), Postives = 62/141 (43.97%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQ 544
            +  +  + K P+H     G+    + LI    +I+  DK    P+H A++ GH+  +  L+S   D   R      P+H A   G S     L+    D+++ D+ G   LH A   G AE   LL+    D+  +D++  
Sbjct:  206 VNAQSYDGKSPLHMTAIHGRFTRSQTLIQNGGEIDCGDKEGNTPLHIAARYGHELLINTLISNGADAARRGSHGMFPLHLAALSGFSDCCRKLLTPGFDVDAVDEFGRTCLHAAAAGGNAECINLLLSSGADLGKKDRYGS 346          

HSP 8 Score: 50.447 bits (119), Expect = 2.492e-6
Identity = 45/183 (24.59%), Postives = 79/183 (43.17%), Query Frame = 2
Query:  140 NKKRPIHHACERGQTEIVKLLIDYNCD--IEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDH-HCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEA----RDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCS 667
            N   P+H A         ++LID      +   D   + P+H A+   + +  +LL+S    ++A D   R P+      G SGIV  L+++   D+   D      LH AC  G  ET  LL+    ++ A     ++    P+H A     + +V+ L+    ++ + D+    P  L+C+
Sbjct:  684 NPFTPLHCAVMNDNESCAEMLIDAMGAKIVMCQDGKGRTPLHAAAFADNVECAQLLLSHGARVDATDRRGRTPLMTGALQGQSGIVEYLVNNTKGDLSLTDDKKNTALHLACGKGH-ETCALLLLEKVEVVALIDCPNRNQHTPLHLAARNGLSTVVQDLLSKGASVLALDENGHTPA-LACA 864          
BLAST of SMED30005028 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 119.013 bits (297), Expect = 1.656e-27
Identity = 70/252 (27.78%), Postives = 121/252 (48.02%), Query Frame = 2
Query:  140 NKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            N   P+H A +RG   +VKLL+D    I+   +    P+H A+++GH+K +++L+     I A+ +    P+H A +  H   V LL+     ++        PLH A   G    AKLL+D   +  AR      P+H AC+  R  +++LL+ H  +I +  +    PIH++        V+LL+ +     A +   + P+H+A  A + E VK L+     +    +   +PL IA + G   ++ +L
Sbjct:  237 NGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLL 488          

HSP 2 Score: 112.464 bits (280), Expect = 1.491e-25
Identity = 64/252 (25.40%), Postives = 117/252 (46.43%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESR--DKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHILNG 901
            PIH A   G   +V+LL+       A +   + P+H AS+ G  + VK L+     +  +   D+ P+H A   G + IV LL+    D  +    G  PL++A + G  + A LL+++  DI    K    P+H A +Y R  +  LL++ + + + +   +    P+H++      +   LL+D      +       P+H+A    + E  K+L++   +     Q G +PL +A + G+  ++ +L G
Sbjct:  406 PIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLG 657          

HSP 3 Score: 105.916 bits (263), Expect = 1.553e-23
Identity = 67/271 (24.72%), Postives = 126/271 (46.49%), Query Frame = 2
Query:  122 LEREDLNKKR--PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL--NGVIYVSCN 922
            LE +   K R   +H A  +  T    LL+ +  + +   K    P+H A+  G+     LL++L   ++        P+H A + G++ +V LL+D    I+++ + G  PLH A ++G  +  ++L++    I A+ K    P+H A + E    V+LL+     ++        P+H++         KLL+D   +  AR      P+H+AC   R + +++L+ H   I    + G +P+ +A   G+  ++ +L  NG    + N
Sbjct:  163 LESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATN 433          

HSP 4 Score: 103.219 bits (256), Expect = 1.140e-22
Identity = 65/269 (24.16%), Postives = 118/269 (43.87%), Query Frame = 2
Query:   68 AIRGGSIKLFHRFFKREY-LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTG 871
            A R G  K+     +R+  +  +  N   P+H A +      V+LL+     ++ +      P+H A+  GH +  KLL+    + NAR      P+H AC+     ++ LL+ H   I +  + G  P+H A   G     +LL+ +     A +   + P+H A    +  +VK L+     +  + + ++ P+H++      E V+LL+    D  A       P++ A      +   +L+++  DI    + G +PL IA K G
Sbjct:  278 AARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYG 546          

HSP 5 Score: 100.908 bits (250), Expect = 6.571e-22
Identity = 63/267 (23.60%), Postives = 121/267 (45.32%), Query Frame = 2
Query:   68 AIRGGSIKLFHRFFKREY-LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMK 865
            A + G + +     KRE  ++         +H A   GQT+IV++L+++  +I A  +    P++ A+Q  H + VK L+    + +   E    P+  A + GH  +V LL++     +++ K+    LH A +      A LL+ H  + +   K    P+H A  Y    +  LL++    ++   +    P+H++        VKLL+D    I+ +      P+H A  +   + +++L++    I    + G SPL +A +
Sbjct:   51 ASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLES----DTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQ 313          

HSP 6 Score: 100.138 bits (248), Expect = 1.009e-21
Identity = 71/295 (24.07%), Postives = 129/295 (43.73%), Query Frame = 2
Query:   23 IFIMS-NSEHYQCFIRAIRGGSIKLFHRFFKREY-LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSC--SGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
             F +S  S+    F+RA R G+++      K    +   + N    +H A + G  ++V  L+    +I+   K     +H A+  G    V++LV    +INA+ +    P++ A +  H  IV  L+D+  +     + G+ PL  A + G  +   LL++     + + K     +H A   +      LL+ H  N +   K    P+H++         T+ L +    D  AR+     P+H+A        VK+L+D    I+   + G +PL  A ++G+E +I +L
Sbjct:    2 FFALSFQSDAATSFLRAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLES----DTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGIT--PLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEML 290          

HSP 7 Score: 93.5893 bits (231), Expect = 1.282e-19
Identity = 55/242 (22.73%), Postives = 105/242 (43.39%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLID--YNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTG 871
            P+H A + G+ E+  LL++   + D +   +    P+H A+   H+K   LL+      ++  +    P+H A +     +  +L++   +     + G  PLH A + G A+   LL+  H  I    K     +H A + ++  + ++L  H  ++ +  K    P+H++      + V  L+ ++  + A+      P+H A     T  V  L+ H     E    GN+ L IA + G
Sbjct:  538 PLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLG 779          

HSP 8 Score: 85.8853 bits (211), Expect = 2.542e-17
Identity = 46/192 (23.96%), Postives = 82/192 (42.71%), Query Frame = 2
Query:  140 NKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCD 715
            N   P+H A      ++  LL+D      +  K    P+H A++    +  K+L+ L  + N   +    P+H A + GH+ +V LL+  H  I    K G   +H A +  +   A++L  H  D+    K    P+H A  Y    +V  L+ +   + ++ +    P+H +     T  V  L+ H+  
Sbjct:  569 NGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEAS 760          
BLAST of SMED30005028 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007449.1 (pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 118.242 bits (295), Expect = 3.254e-27
Identity = 64/247 (25.91%), Postives = 111/247 (44.94%), Query Frame = 2
Query:  155 IHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            +H A   GQTE+V+ L+     ++A  +  Q P+H A++ G  + V+LL+      +A       P+H A   GH  +  +L++H   +    K G+ PLH A K G+ E A LL+      +A  K    P+H A  Y+   +  LL+D   +  +  K    P+H++      E    L+++  +  A       P+HL       +   +L+  + D+    + G SPL +A +     +  IL
Sbjct:   85 LHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEIL 331          

HSP 2 Score: 107.071 bits (266), Expect = 8.507e-24
Identity = 58/252 (23.02%), Postives = 111/252 (44.05%), Query Frame = 2
Query:  140 NKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            N   P+H A   G  ++  +L+++   +    K    P+H AS+ G  +   LL+      +A  +    P+H A  + +  +  LL+D      +  K GY PLH A K  + E A  L+++  +  A  +    P+H   +   A +  LL+  + ++    K    P+HL+         ++L+ H   + A       P+ +AC+    + V  L+ H  D+    + G +PL  A + G+  ++++L
Sbjct:  146 NGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLL 397          

HSP 3 Score: 105.916 bits (263), Expect = 2.177e-23
Identity = 60/251 (23.90%), Postives = 109/251 (43.43%), Query Frame = 2
Query:  143 KKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            ++ P+H A   G+ EIV+LL+ +    +A       P+H A++ GH+    +L+     +    +    P+H A ++G   + +LL+      ++  K G  PLH A      + A LL+D      A  K    P+H A + ++  I   L+++     +  +    P+HL       +   LL+    D+         P+HLA    +    +ILV H   +    + G +PL +A   GN  +++ L
Sbjct:  114 EQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFL 364          

HSP 4 Score: 103.219 bits (256), Expect = 1.401e-22
Identity = 57/243 (23.46%), Postives = 109/243 (44.86%), Query Frame = 2
Query:  137 LNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMK 865
            LN   P+H AC++ +  +++LL+ Y   IEA+ +    P+H ++  G+   V +L+      NA +      +H A   G + +V  L+ +   ++++ +    PLH A + G+ E  +LL+ H    +A       P+H A       +  +L++H  ++    K    P+H++      E   LL+      +A       P+H+A +    +   +L+D         + G +PL IA K
Sbjct:   13 LNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAK 255          

HSP 5 Score: 102.064 bits (253), Expect = 3.772e-22
Identity = 59/251 (23.51%), Postives = 111/251 (44.22%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHILNGV 904
            P+H A + G+ E+  LL+      +A  K    P+H AS   ++K   LL+      +A  +    P+H A +     I   L+++  +  +  + G  PLH   + G A+ A LL+  + D+    K    P+H A + ++  + ++L+ H  ++ +  K    P+ ++C     + V  L+ H  D+ ++      P+H A     T  V +L+       +    GN+ L IA + G   ++  L  V
Sbjct:  183 PLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTLKVV 433          

HSP 6 Score: 93.9745 bits (232), Expect = 9.018e-20
Identity = 44/154 (28.57%), Postives = 74/154 (48.05%), Query Frame = 2
Query:  140 NKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLI 601
            N   P+H A ++ Q EI   L++Y  +  A+ +    P+H  +Q GH     LL++ + D+N   +    P+H A +     +  +L+ H   + +  KLGY PL  AC  G  +    L+ H  D+ ++ K    P+H A +     IV LL+
Sbjct:  245 NGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLL 398          

HSP 7 Score: 92.8189 bits (229), Expect = 2.618e-19
Identity = 54/213 (25.35%), Postives = 89/213 (41.78%), Query Frame = 2
Query:   92 LFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARD 730
            L  RF   +   +  L    P+H A      ++  LL+D      A  K    P+H A++    +    L+    + NA       P+H   + GH+ + +LL+  + D+    K G  PLH A +  +   A++L+ H   + A  K    P+  AC Y    +V  L+ H  ++ S+ K    P+H +     T  V LL+  KC     D
Sbjct:  199 LLQRFASPDAAGKNGLT---PLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLL--KCGARPND 406          

HSP 8 Score: 88.9669 bits (219), Expect = 3.521e-18
Identity = 50/228 (21.93%), Postives = 104/228 (45.61%), Query Frame = 2
Query:  212 NCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            N ++ AL+ +   P+H A +    + ++LL+     I A  E    P+H +   G+  IV +L+       + +  G   LH A +AG+ E  + L+ +   ++A+ + +Q P+H A    +  IV+LL+ H  + ++       P+H++      +   +L++H   +         P+H+A    + E   +L+      +   + G +PL +A    N+ +  +L
Sbjct:    7 NPNVRALNGFT--PLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLL 232          

HSP 9 Score: 82.0333 bits (201), Expect = 5.491e-16
Identity = 43/166 (25.90%), Postives = 79/166 (47.59%), Query Frame = 2
Query:  398 LIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            L+D   +   R   G+ PLH ACK  R    +LL+ +   IEA  +    P+H +       IV +L+    +  + +      +H++     TE V+ L+ +   ++A+   +Q P+H+A    + E V++L+ H    +     G +PL +A + G+E +  IL
Sbjct:    1 LLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAIL 166          
BLAST of SMED30005028 vs. Ensembl Yeast
Match: PHO81 (Cyclin-dependent kinase (CDK) inhibitor; regulates Pho80p-Pho85p and Pcl7p-Pho85p cyclin-CDK complexes in response to phosphate levels; inhibitory activity for Pho80p-Pho85p requires myo-D-inositol heptakisphosphate (IP7) generated by Vip1p; relative distribution to the nucleus increases upon DNA replication stress [Source:SGD;Acc:S000003465])

HSP 1 Score: 59.3066 bits (142), Expect = 2.690e-9
Identity = 60/257 (23.35%), Postives = 115/257 (44.75%), Query Frame = 2
Query:  113 REYLEREDLNKKRPIHHACERGQTEIVKLLIDYNC--DIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLID----HHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQ-RPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAM 862
            ++ L  +D++ + P+H+A E G+ E V  L+  N   D++ +D  ++ P+  A  N H   V+ L+++    NA       PI +            ++D+  ++ S  K+ + PL+ ACK    + AKLL++     + D  A++K  Q       +    G+  L I                  ++  G   + ++LLI +  D    D +++  PI  A  +  +E +  L+ H+  ++  D  G+SPL  A+
Sbjct:  414 QKLLNAQDIHSRVPLHYAAELGKLEFVHSLLITNLLEDVDPIDSDSKTPLVLAITNNHIDVVRDLLTI-GGANAS------PIEKP-----------ILDYSKNVISSTKVQFDPLNVACKFNNHDAAKLLLEIRSKQNAD-NAKNKSSQHLCQPLFKKNSTGLCTLHI------------------VAKIGGDPQLIQLLIRYGADPNEIDGFNKWTPIFYAVRSGHSEVITELLKHNARLDIEDDNGHSPLFYAL 633          
BLAST of SMED30005028 vs. Ensembl Yeast
Match: GDE1 (Glycerophosphocholine (GroPCho) phosphodiesterase; hydrolyzes GroPCho to choline and glycerolphosphate, for use as a phosphate source and as a precursor for phosphocholine synthesis; may interact with ribosomes [Source:SGD;Acc:S000006031])

HSP 1 Score: 58.9214 bits (141), Expect = 3.501e-9
Identity = 51/185 (27.57%), Postives = 91/185 (49.19%), Query Frame = 2
Query:  143 KKRPIHHACERGQTEIVKLLI----DYNC-------DIEAL-DKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDH-HCDIESRD-KLGYRPLHYACKAGRAETAKLLIDHHCDIEARDK-WDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPI 652
            K+ P+H++C+ G +E+ KL+I    ++N        D+ A  D  +  P+H      H KT ++L+    D N + +   + +H A E  +  ++++L+     DI  +D +L   PL+ AC+    E A  L+ +  D+E R+K +    I  A       IVKLLI ++ N +  D+    P+
Sbjct:  428 KRTPLHYSCQYGLSEVTKLIIKLMKEWNIWNEIPIDDVSAFGDAESLTPLHLCVLGAHPKTTEVLLQ-SLDPNVKLKSSSL-LHLATEWNNYPLLHVLLSSKRFDINYQDNELHETPLYLACRLNFFEAAVCLLYNGADLEIREKLFGWTAIFVAAAEGFTDIVKLLIANNANFDIEDEGGWTPM 610          
BLAST of SMED30005028 vs. Ensembl Yeast
Match: AKR1 (Palmitoyl transferase involved in protein palmitoylation; acts as a negative regulator of pheromone response pathway; required for endocytosis of pheromone receptors; involved in cell shape control; contains ankyrin repeats; AKR1 has a paralog, AKR2, that arose from the whole genome duplication; any of several human homologs encoding DHHC-type zinc fingers (ZDHHC) can complement temperature sensitivity of yeast akr1 null mutant [Source:SGD;Acc:S000002672])

HSP 1 Score: 57.3806 bits (137), Expect = 1.041e-8
Identity = 50/198 (25.25%), Postives = 80/198 (40.40%), Query Frame = 2
Query:  158 HHACERGQTEIVKLLI-----DYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINAR-DEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHC-----DIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDI 718
            H AC+RG    VK +I     + N D ++ +  +   +H+AS N     V  LVS   D+NAR       P+H A  +G+  IV+ L+ H  D    D  G+  LH +  +        ++ +       DI+ RD   +  +  A     +  V  L+    +I+  D     P+H          +K LI    D 
Sbjct:   78 HTACQRGDLATVKEMIHGKLLEVNNDGDSTE--HITGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADF 273          
BLAST of SMED30005028 vs. Ensembl Yeast
Match: AVO2 (Component of a complex containing the Tor2p kinase and other proteins; complex may have a role in regulation of cell growth [Source:SGD;Acc:S000004672])

HSP 1 Score: 53.5286 bits (127), Expect = 9.547e-8
Identity = 55/182 (30.22%), Postives = 81/182 (44.51%), Query Frame = 2
Query:   68 AIRGGSIKLFHRFFKR--EYLEREDL-NKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRP--IHYASQNGHKKTVKLLVSLHCD-INARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDH---HCDIEARDKWDQRPIHCACEYERAGI 586
            AI  G++ +  R  +R  + L   D  N    +H+A   G+  I   LI    D   L K  +    +H A   GH++T+ LL+      IN R E  R PIH AC + +   ++LLI    D+   D  G  PLH   + G     K+L++      D   RDK + +PI  A  +E   I
Sbjct:   12 AIIEGNLLIVKRLLRRNPDLLTNIDSENGWSSLHYASYHGRYLICVYLIQLGHDKHELIKTFKGNTCVHLALMKGHEQTLHLLLQQFPRFINHRGENGRAPIHIACMNDYYQCLSLLIGVGADLWVMDTNGDTPLHVCLEYGSISCMKMLLNEGEVSLDDNVRDKGNWKPIDVAQTFEVGNI 193          
BLAST of SMED30005028 vs. Ensembl Yeast
Match: NAS6 (Evolutionarily conserved 19S regulatory particle assembly-chaperone; proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP); ortholog of human oncoprotein gankyrin, also known as p28, which interacts with the Rb tumor suppressor and CDK4/6 [Source:SGD;Acc:S000003464])

HSP 1 Score: 49.6766 bits (117), Expect = 5.876e-7
Identity = 41/164 (25.00%), Postives = 67/164 (40.85%), Query Frame = 2
Query:  449 PLHYACKAGRAETAKLLIDHHCDIEARDKWDQR-PIHCACEYERAGIVKLLIDHHCNI---ESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRP--IHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHILNGVIYVSCN 922
            PLH AC        + L+     +  +   D R P+H +  ++   I   L+    N+   +  D     P H++CS    E VK L D     +     +Q    +HLA   K  E  + L+++   +   D+F   PL  A   G+  LI +L G+   + N
Sbjct:    5 PLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVN 168          

HSP 2 Score: 47.7506 bits (112), Expect = 2.578e-6
Identity = 39/155 (25.16%), Postives = 68/155 (43.87%), Query Frame = 2
Query:  152 PIHHAC-ERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDR---VPIHRACEHGHSGIVNLLIDHHC--DIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLL 598
            P+H AC E    ++ +LL      +   D+  + P+H++      +    L+S   ++N  D  D     P H AC  G+  +V  L D     D+      G   LH A      E ++ LI++   +  +DK++Q P+H A       +++LL
Sbjct:    5 PLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELL 159          
BLAST of SMED30005028 vs. Ensembl Nematostella
Match: EDO49485 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG84])

HSP 1 Score: 87.8113 bits (216), Expect = 2.004e-19
Identity = 66/228 (28.95%), Postives = 108/228 (47.37%), Query Frame = 2
Query:  149 RPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGR-AETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRR-------PIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHH 808
            +P+H AC  G TE  K L+ Y  D+ A D  ++ P+H A+ +G+   ++LL+S   D N  D+  R P+H A  H +   V  L+    ++   D     PLHYA  +   A+  + L+ +  +   RDK     +H    Y  A   KL I+   ++ + D  NR        P+HL+        +++LI    D+E RD   + P+ LA      E V+ L++H+
Sbjct:    2 QPLHLACLGGFTECCKKLLFYGVDVNAKDNNDRTPLHCAACSGNVNCLELLMSQAGDFNCIDKLGRNPLHYAAGHTNFRCVMSLVTAGSNVNKPDTKACTPLHYAAASDLDAKCVEHLLRNRGNASKRDKQGYSAVH----YASANGHKLAIEMLLDVSANDLLNRSSGSPCVTPLHLAAFHGHKPALEVLIKSFNDLEVRDDRGRTPLDLASFQGHVECVECLLNHN 225          

HSP 2 Score: 80.4925 bits (197), Expect = 6.626e-17
Identity = 60/217 (27.65%), Postives = 94/217 (43.32%), Query Frame = 2
Query:  245 QRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYER-AGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQR-------PIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTG 871
             +P+H A   G  +  K L+    D+NA+D  DR P+H A   G+   + LL+    D    DKLG  PLHYA           L+    ++   D     P+H A   +  A  V+ L+ +  N   RDK     +H + +       KL I+   D+ A D  ++        P+HLA        +++L+    D+E  D  G +PL++A   G
Sbjct:    1 MQPLHLACLGGFTECCKKLLFYGVDVNAKDNNDRTPLHCAACSGNVNCLELLMSQAGDFNCIDKLGRNPLHYAAGHTNFRCVMSLVTAGSNVNKPDTKACTPLHYAAASDLDAKCVEHLLRNRGNASKRDKQGYSAVHYASA----NGHKLAIEMLLDVSANDLLNRSSGSPCVTPLHLAAFHGHKPALEVLIKSFNDLEVRDDRGRTPLDLASFQG 213          

HSP 3 Score: 74.3294 bits (181), Expect = 8.558e-15
Identity = 56/210 (26.67%), Postives = 95/210 (45.24%), Query Frame = 2
Query:  104 FFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHG-HSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQR-------PIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHK 709
             F    +  +D N + P+H A   G    ++LL+    D   +DK  + P+HYA+ + + + V  LV+   ++N  D     P+H A      +  V  L+ +  +   RDK GY  +HYA   G     KL I+   D+ A D  ++        P+H A  +     +++LI    ++E RD   R P+ L+      E V+ L++H 
Sbjct:   20 LFYGVDVNAKDNNDRTPLHCAACSGNVNCLELLMSQAGDFNCIDKLGRNPLHYAAGHTNFRCVMSLVTAGSNVNKPDTKACTPLHYAAASDLDAKCVEHLLRNRGNASKRDKQGYSAVHYASANGH----KLAIEMLLDVSANDLLNRSSGSPCVTPLHLAAFHGHKPALEVLIKSFNDLEVRDDRGRTPLDLASFQGHVECVECLLNHN 225          
BLAST of SMED30005028 vs. Ensembl Nematostella
Match: EDO42780 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0Q6])

HSP 1 Score: 77.7962 bits (190), Expect = 3.491e-16
Identity = 52/176 (29.55%), Postives = 76/176 (43.18%), Query Frame = 2
Query:   71 IRGGSIKLFHRFFKREYLEREDLNKK--RPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCD--IESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGI 586
            +  G I      F+R+    E LN +   P+  A   G  E V+ L      +   D   + P+  A+  G    V  L+++  D    D   R+P+H A  +     V LL+ H     I  +D  G   LH+A   GRAE  KLLIDH  +I ARD   +  +H A +    G+
Sbjct:   22 VHAGDITALKEEFQRDKGLIEALNSEGMTPLFVAVSTGNLECVQFLATSGASLNTRDNLGRTPLALAAYQGWNDGVYYLLAVGADSTIVDNCGRLPLHAATYYSSGRTVGLLLQHLPSDHINKQDGEGMTALHWAAYHGRAEHVKLLIDHDAEIVARDTEGKTALHWAAQVSHDGL 197          

HSP 2 Score: 68.1662 bits (165), Expect = 6.500e-13
Identity = 46/147 (31.29%), Postives = 63/147 (42.86%), Query Frame = 2
Query:  221 IEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCD--IEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIH 655
            IEAL+     P+  A   G+ + V+ L +    +N RD   R P+  A   G +  V  L+    D    D  G  PLH A       T  LL+ H     I  +D      +H A  + RA  VKLLIDH   I +RD   +  +H
Sbjct:   41 IEALNSEGMTPLFVAVSTGNLECVQFLATSGASLNTRDNLGRTPLALAAYQGWNDGVYYLLAVGADSTIVDNCGRLPLHAATYYSSGRTVGLLLQHLPSDHINKQDGEGMTALHWAAYHGRAEHVKLLIDHDAEIVARDTEGKTALH 187          

HSP 3 Score: 56.6102 bits (135), Expect = 5.182e-9
Identity = 42/157 (26.75%), Postives = 62/157 (39.49%), Query Frame = 2
Query:  419 IESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCD--IEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGL 883
            IE+ +  G  PL  A   G  E  + L      +  RD   + P+  A        V  L+    +    D   R P+H +       TV LL+ H     I  +D      +H A    R E VK+L+DH  +I   D  G + L  A +  ++GL
Sbjct:   41 IEALNSEGMTPLFVAVSTGNLECVQFLATSGASLNTRDNLGRTPLALAAYQGWNDGVYYLLAVGADSTIVDNCGRLPLHAATYYSSGRTVGLLLQHLPSDHINKQDGEGMTALHWAAYHGRAEHVKLLIDHDAEIVARDTEGKTALHWAAQVSHDGL 197          
BLAST of SMED30005028 vs. Ensembl Nematostella
Match: EDO38702 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC57])

HSP 1 Score: 80.8777 bits (198), Expect = 9.889e-16
Identity = 52/172 (30.23%), Postives = 80/172 (46.51%), Query Frame = 2
Query:  194 KLLIDYNCDIEALDKWNQRPIHYASQNGHKKTV-KLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDH 706
            +LL+D    I++ +  +  PIHYA++ G  +TV  LL      IN  D     P+H A  HGH+ +V  L+     I++R+   + PL  A   G  E A +L+D    ++  DK    P+H A       +VKLL+    NI   D   R  + ++      E    +IDH
Sbjct:  267 QLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESSHKEVAVAIIDH 438          

HSP 2 Score: 80.4925 bits (197), Expect = 1.024e-15
Identity = 77/311 (24.76%), Postives = 125/311 (40.19%), Query Frame = 2
Query:   53 QCFIRAIRGGSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHG-----------------------HSGIVN--------------LLIDHHCDIESRDKLGYRPLHYACKAGRAETA-KLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTG 871
            +C    I+   +K +  F K E ++RE L     +          I+  +I +   IE  DK    P+  A++  H  TV+ L+    DI A+D  DR  + RA   G                        +G+V               LL+D+   I+S++     P+HYA K GR  T   LL      I   D     P+H A  +  A +VK L+     I++R+     P+  + +    E   +L+D    ++  D     P+HLA      E VK+L+    +I   D  G + L+IA+++ 
Sbjct:  126 ECIFVMIKVSKLK-YLSFCKSEKIKREILLYFFDV--------VIIICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPVWTICDDVCLNGLVGGSNKLILVLRISSQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESS 427          

HSP 3 Score: 70.8626 bits (172), Expect = 1.114e-12
Identity = 66/269 (24.54%), Postives = 106/269 (39.41%), Query Frame = 2
Query:  113 REYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNG----------HKKTV-----------------KLLVSLHCD----------INARDEWDRVPIHRACEHGHSGIV-NLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDH 805
            R  +E  D +K  P+  A E+   + V+ L+ +  DI A D  ++  +  A+  G          H+K V                 KL++ L             I+++++ D  PIH A + G    V  LL      I   D     PLH A   G A   K L+     I+AR+     P+ CA       +  +L+D    ++  DK    P+HL+      E VKLL+  K +I   D   +  + +A  +   E    ++DH
Sbjct:  170 RACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPVWTICDDVCLNGLVGGSNKLILVLRISSQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESSHKEVAVAIIDH 438          

HSP 4 Score: 64.3142 bits (155), Expect = 1.346e-10
Identity = 55/239 (23.01%), Postives = 105/239 (43.93%), Query Frame = 2
Query:  140 NKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLV----------SLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDI----ESRDKLGYRPLHYA--CKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHH 808
             +  P+H AC  G   + K L++   D+ +LD+    P+H+A   G+    KLL           ++   +  +D  ++  +H A E GH  +  L ++   ++    ES++K  ++ +  A  C     + +KL     C    + +  +R I     ++   I+  +I     IE RDK    P+ ++      +TV+ L+ H  DI A+D  D+  +  A      ET++  ++H 
Sbjct:    3 TQMTPLHVACSHGCIPVAKCLVEAGADLRSLDEEQMTPLHFACMEGNLGVAKLLFVAAELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFHKTIVVARECIFVMIKVSKLKYLSFC----KSEKIKREILLYF-FDVVIIICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQ 236          

HSP 5 Score: 54.6842 bits (130), Expect = 1.394e-7
Identity = 38/149 (25.50%), Postives = 63/149 (42.28%), Query Frame = 2
Query:   68 AIRGGSIKLFHRFFKRE--YLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDH 508
            A + G ++      KR+   +  ED     P+H A   G   +VK L+     I+A +     P+  A+  G  +   +L+     ++  D+    P+H A   GH  +V LL+    +I   D  G   L  A ++   E A  +IDH
Sbjct:  290 AAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESSHKEVAVAIIDH 438          

HSP 6 Score: 54.299 bits (129), Expect = 1.821e-7
Identity = 52/207 (25.12%), Postives = 79/207 (38.16%), Query Frame = 2
Query:  350 PIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKW-------------DQRPIHCACEYERAGIVKLLIDHHCNI----ESRDKWNRRPIHLS---------------CSGCCTETVK---------------LLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECD 829
            P+H AC HG   +   L++   D+ S D+    PLH+AC  G    AKLL       E R  W             +Q  +H A E     + KL ++   N+    ES++K   + I ++                S C +E +K                +I  +  IE RD     P+ +A      +TV+ L+ H  DI   D
Sbjct:    7 PLHVACSHGCIPVAKCLVEAGADLRSLDEEQMTPLHFACMEGNLGVAKLLF---VAAELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFHKTIVVARECIFVMIKVSKLKYLSFCKSEKIKREILLYFFDVVIIICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKD 210          

HSP 7 Score: 51.2174 bits (121), Expect = 1.902e-6
Identity = 68/315 (21.59%), Postives = 110/315 (34.92%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVKLLI----------DYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLL------------IDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETV-------------------------------------KLLIDHKCDIEARDWWDQRPIHLACNAKRTETV-KILVDHHCDIEECDQFGNSPLEIAMKTGNEGLI 886
            L   D  +  P+H AC  G   + KLL             +  +   D+  Q  +H A + GH    KL +    ++NA  E      H+        I  ++           KL Y      CK+ + +   LL            I     IE RDK    P+  A E      V+ L+ H  +I ++D  +R  +  + +  C ET+                                     +LL+D+   I++++  D  PIH A    R  TV  +L      I + D   N+PL +A   G+  ++
Sbjct:   30 LRSLDEEQMTPLHFACMEGNLGVAKLLFVAAELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFHKTIVVARECIFVMI--------KVSKLKYLSF---CKSEKIKREILLYFFDVVIIICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPVWTICDDVCLNGLVGGSNKLILVLRISSQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVV 333          
BLAST of SMED30005028 vs. Ensembl Nematostella
Match: EDO39112 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB40])

HSP 1 Score: 80.1073 bits (196), Expect = 2.253e-15
Identity = 51/196 (26.02%), Postives = 98/196 (50.00%), Query Frame = 2
Query:   83 SIKLFHRFFKREYLEREDLNKKRPIHHACERGQT-EIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCD-INARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNI--ESRDKWNRRPIHL 658
            ++++  R   +  +  +D   K P+H+A  R Q  +I++LLI+   ++ A+D   + P+H+A++ G    + +L+  + + IN  D      +H A     +    LL++   +++ RD     PL Y    G   T K+L+++  D+EARDK  + P+  A  + R  + + L+D   +I  E+   WN   + L
Sbjct:   18 TVEIILRNGGKSIINSKDSYGKTPLHYAVIRCQGGKIIQLLIESGANVLAVDFDERLPLHHAAEQGMLDNISILLQANPETINEVDNRSLTALHIAAAAARTEACRLLLEKGAEVDYRDDERLTPLFYVASVGCPLTVKVLLEYDADLEARDKNRKTPLISAAYFGRLEVFRTLLDSGADIAAETSSGWNALDVAL 213          

HSP 2 Score: 77.411 bits (189), Expect = 1.853e-14
Identity = 58/222 (26.13%), Postives = 104/222 (46.85%), Query Frame = 2
Query:  254 IHYASQNGHKKTVKLLV--SLHCDINARDEWDRVPIHRACEHGHSG-IVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCD-IEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHILNGVI 907
            +H A+     +TV++++       IN++D + + P+H A      G I+ LLI+   ++ + D     PLH+A + G  +   +L+  + + I   D      +H A    R    +LL++    ++ RD     P+    S  C  TVK+L+++  D+EARD   + P+  A    R E  + L+D   DI      G + L++A+   N   + I N +I
Sbjct:    7 LHVAAACSDFRTVEIILRNGGKSIINSKDSYGKTPLHYAVIRCQGGKIIQLLIESGANVLAVDFDERLPLHHAAEQGMLDNISILLQANPETINEVDNRSLTALHIAAAAARTEACRLLLEKGAEVDYRDDERLTPLFYVASVGCPLTVKVLLEYDADLEARDKNRKTPLISAAYFGRLEVFRTLLDSGADIAAETSSGWNALDVALDNNN---LDITNEII 225          

HSP 3 Score: 63.929 bits (154), Expect = 2.365e-10
Identity = 41/161 (25.47%), Postives = 74/161 (45.96%), Query Frame = 2
Query:  134 DLNKKRPIHHACERGQTEIVKLLIDYNCD-IEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHC 613
            D +++ P+HHA E+G  + + +L+  N + I  +D  +   +H A+     +  +LL+    +++ RD+    P+      G    V +L+++  D+E+RDK    PL  A   GR E  + L+D   DI A        +  A +     I   +I H  
Sbjct:   69 DFDERLPLHHAAEQGMLDNISILLQANPETINEVDNRSLTALHIAAAAARTEACRLLLEKGAEVDYRDDERLTPLFYVASVGCPLTVKVLLEYDADLEARDKNRKTPLISAAYFGRLEVFRTLLDSGADIAAETSSGWNALDVALDNNNLDITNEIIRHES 229          
BLAST of SMED30005028 vs. Ensembl Nematostella
Match: EDO38725 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC11])

HSP 1 Score: 74.7146 bits (182), Expect = 5.327e-15
Identity = 63/223 (28.25%), Postives = 97/223 (43.50%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVK 790
            L + D      +HHA    + E +  LI  N  IE L      P+H A + G  +  +LLV     ++ +++    P+H A   G    +  L+     I+ RD     P   A  AGR E A LL++       +D+  + P+H AC   RA  V+ L     +   RD+  +  +H++      + V  L+ +  DI ARD     P  L C AK T +VK
Sbjct:    1 LNKMDDTGFSALHHATRYNRVEAMAELI-RNGSIEDLST----PLHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPFLSAVAAGRTENAMLLLE-------KDENQKSPLHLACAAGRALHVEALTRAGLSTNERDEEGQSALHMAALSGFRKVVTQLLRYGADINARDSNRWTP--LMCAAK-TGSVK 208          

HSP 2 Score: 67.0106 bits (162), Expect = 2.565e-12
Identity = 46/176 (26.14%), Postives = 76/176 (43.18%), Query Frame = 2
Query:  347 VPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGN 874
             P+H AC+ G   +  LL++    ++ ++  G  PLH A   G  +  K L+     I+ RD   + P   A    R     LL++       +D+  + P+HL+C+      V+ L         RD   Q  +H+A  +   + V  L+ +  DI   D    +PL  A KTG+
Sbjct:   38 TPLHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPFLSAVAAGRTENAMLLLE-------KDENQKSPLHLACAAGRALHVEALTRAGLSTNERDEEGQSALHMAALSGFRKVVTQLLRYGADINARDSNRWTPLMCAAKTGS 206          

HSP 3 Score: 53.9138 bits (128), Expect = 7.190e-8
Identity = 36/133 (27.07%), Postives = 56/133 (42.11%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDI 520
            ++  D + + P   A   G+TE   LL++        D+  + P+H A   G    V+ L       N RDE  +  +H A   G   +V  L+ +  DI +RD   + PL  A K G  +T   L+     I
Sbjct:   95 IDERDFSHRTPFLSAVAAGRTENAMLLLEK-------DENQKSPLHLACAAGRALHVEALTRAGLSTNERDEEGQSALHMAALSGFRKVVTQLLRYGADINARDSNRWTPLMCAAKTGSVKTCMELLQSGASI 220          
BLAST of SMED30005028 vs. Ensembl Medaka
Match: ankrd52a (serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C [Source:NCBI gene;Acc:101155432])

HSP 1 Score: 136.732 bits (343), Expect = 3.615e-32
Identity = 75/251 (29.88%), Postives = 134/251 (53.39%), Query Frame = 2
Query:  146 KRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSC-SGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            + P+H A     T   + L+ +  ++   D+  +  +H+A+Q+G ++ VKLL++   +++A D+ +R PIH A   GH  +V LL+    D   +DKLGY PLH A  +G  E  K L+    +I+  + +    +H AC   +  +   L++H  N+   +K    P+HL+  S      ++LL+++  D+  +    + P+H+A    R    +IL+ +  DI+  D++GN+PL +A K G+E LI  L
Sbjct:  108 QTPLHVASANRATRCAEALLSHLSNLNIADRTGRTALHHAAQSGFQEMVKLLLNKGANLSAIDKKERQPIHCAAYLGHLEVVKLLLSRSNDKSCKDKLGYTPLHAAAASGHIEIVKYLLRMGAEIDEPNTFGNTALHMACYMGQEAVATELVNHGANVNQPNKCGYTPLHLAAVSTNGALCLELLVNNGADVNQQSKEGKSPLHMAAIHGRFTRSQILIQNGGDIDCVDKYGNTPLHVAAKYGHELLISTL 358          

HSP 2 Score: 124.405 bits (311), Expect = 2.337e-28
Identity = 70/258 (27.13%), Postives = 130/258 (50.39%), Query Frame = 2
Query:  110 KREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGL 883
            K E +   D  ++ P+H A   G   I+ LLI+    +   D+    P+H A+ + +++ V LL+    + NARD++ + P+H A  +  +     L+ H  ++   D+ G   LH+A ++G  E  KLL++   ++ A DK +++PIHCA       +VKLL+    +   +DK    P+H + +    E VK L+    +I+  + +    +H+AC   +      LV+H  ++ + ++ G +PL +A  + N  L
Sbjct:   30 KTEDVNALDQERRTPLHAAACVGDVHIIDLLIESGASVNVKDQVWLTPLHRAAASRNERAVSLLLRRGAEANARDKFWQTPLHVASANRATRCAEALLSHLSNLNIADRTGRTALHHAAQSGFQEMVKLLLNKGANLSAIDKKERQPIHCAAYLGHLEVVKLLLSRSNDKSCKDKLGYTPLHAAAASGHIEIVKYLLRMGAEIDEPNTFGNTALHMACYMGQEAVATELVNHGANVNQPNKCGYTPLHLAAVSTNGAL 287          

HSP 3 Score: 121.324 bits (303), Expect = 1.872e-27
Identity = 69/251 (27.49%), Postives = 123/251 (49.00%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGI-VKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTG 871
            L   D   +  +HHA + G  E+VKLL++   ++ A+DK  ++PIH A+  GH + VKLL+S   D + +D+    P+H A   GH  IV  L+    +I+  +  G   LH AC  G+   A  L++H  ++   +K    P+H A       + ++LL+++  ++  + K  + P+H++         ++LI +  DI+  D +   P+H+A        +  L+ +  D       G  PL +A+  G
Sbjct:  133 LNIADRTGRTALHHAAQSGFQEMVKLLLNKGANLSAIDKKERQPIHCAAYLGHLEVVKLLLSRSNDKSCKDKLGYTPLHAAAASGHIEIVKYLLRMGAEIDEPNTFGNTALHMACYMGQEAVATELVNHGANVNQPNKCGYTPLHLAAVSTNGALCLELLVNNGADVNQQSKEGKSPLHMAAIHGRFTRSQILIQNGGDIDCVDKYGNTPLHVAAKYGHELLISTLMTNGADTARRGIHGMFPLHLAVLYG 383          

HSP 4 Score: 114.775 bits (286), Expect = 2.252e-25
Identity = 72/250 (28.80%), Postives = 120/250 (48.00%), Query Frame = 2
Query:  134 DLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGL 883
            ++  + P+  A      E V+LL+    D+ ALD+  + P+H A+  G    + LL+     +N +D+    P+HRA    +   V+LL+    +  +RDK    PLH A        A+ L+ H  ++   D+  +  +H A +     +VKLL++   N+ + DK  R+PIH +      E VKLL+    D   +D     P+H A  +   E VK L+    +I+E + FGN+ L +A   G E +
Sbjct:    5 NIADQPPLVQAIFSRNAEEVQLLLHKTEDVNALDQERRTPLHAAACVGDVHIIDLLIESGASVNVKDQVWLTPLHRAAASRNERAVSLLLRRGAEANARDKFWQTPLHVASANRATRCAEALLSHLSNLNIADRTGRTALHHAAQSGFQEMVKLLLNKGANLSAIDKKERQPIHCAAYLGHLEVVKLLLSRSNDKSCKDKLGYTPLHAAAASGHIEIVKYLLRMGAEIDEPNTFGNTALHMACYMGQEAV 254          

HSP 5 Score: 103.99 bits (258), Expect = 4.391e-22
Identity = 75/332 (22.59%), Postives = 125/332 (37.65%), Query Frame = 2
Query:  110 KREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKA----------------------------------GRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCN---------------------------------------------------IESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPL 850
            K   L   D  +++PIH A   G  E+VKLL+  + D    DK    P+H A+ +GH + VK L+ +  +I+  + +    +H AC  G   +   L++H  ++   +K GY PLH A  +                                  GR   +++LI +  DI+  DK+   P+H A +Y    ++  L+ +  +                                                   I + D + R  +H + SG   E + LL+    D+  RD   + P+H A    R +    LV    ++ E DQ G +PL
Sbjct:  162 KGANLSAIDKKERQPIHCAAYLGHLEVVKLLLSRSNDKSCKDKLGYTPLHAAAASGHIEIVKYLLRMGAEIDEPNTFGNTALHMACYMGQEAVATELVNHGANVNQPNKCGYTPLHLAAVSTNGALCLELLVNNGADVNQQSKEGKSPLHMAAIHGRFTRSQILIQNGGDIDCVDKYGNTPLHVAAKYGHELLISTLMTNGADTARRGIHGMFPLHLAVLYGFSDCCRKLLSSGQLYSIVSSMSKEHVLSAGFEINTPDNFGRTCLHAAASGGNVECLNLLLSSGADLNKRDIMGRTPLHYAAANGRYQCTVTLVSAGAEVNESDQTGCTPL 493          

HSP 6 Score: 99.7525 bits (247), Expect = 8.328e-21
Identity = 63/217 (29.03%), Postives = 105/217 (48.39%), Query Frame = 2
Query:  221 IEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTG 871
            +  L+  +Q P+  A  + + + V+LL+    D+NA D+  R P+H A   G   I++LLI+    +  +D++   PLH A  +       LL+    +  ARDK+ Q P+H A         + L+ H  N+   D+  R  +H +      E VKLL++   ++ A D  +++PIH A      E VK+L+    D    D+ G +PL  A  +G
Sbjct:    1 MGVLNIADQPPLVQAIFSRNAEEVQLLLHKTEDVNALDQERRTPLHAAACVGDVHIIDLLIESGASVNVKDQVWLTPLHRAAASRNERAVSLLLRRGAEANARDKFWQTPLHVASANRATRCAEALLSHLSNLNIADRTGRTALHHAAQSGFQEMVKLLLNKGANLSAIDKKERQPIHCAAYLGHLEVVKLLLSRSNDKSCKDKLGYTPLHAAAASG 217          

HSP 7 Score: 91.6633 bits (226), Expect = 3.005e-18
Identity = 69/258 (26.74%), Postives = 116/258 (44.96%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCD---IEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKW----DQRPIHCACEYERAGIVKLLIDHHCNI-ESRDKWNRRPIHLS-CSGCCTETVKLLIDHKCD-IEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            PIH A   G ++ ++++IDY  +       DK+ Q P+  A   GH   V+ L+      +A+D+     +HRA   GH   V  L+ H      RD  G  PLHYA   G+ E    L+      + +D+        P+H A        +++L++    I E  + +   P+H +  +G C+   +LL   +   I  RD   + P+H A  A+    +++++ H  +I   D  G S L +A   G+ G + IL
Sbjct:  649 PIHVAAANGHSDCLRMMIDYGEEGDLTNVADKFGQTPLMLAVLGGHTDCVRFLLERASSPDAQDKRGSTALHRAAVLGHDDCVTALLKHKASPLCRDIQGRTPLHYAASRGQTEILSSLMQAAVAADPQDQLLDNKQYTPLHWAAYKGHEDCLEVLLELKTFIHEEGNPFT--PLHCALMNGHCSAAERLLESARVHVINCRDAKGRSPLHAAAFAEDVAGLQLVLRHGAEINAVDNSGRSALMVAADKGHSGTVAIL 904          

HSP 8 Score: 80.8777 bits (198), Expect = 5.066e-15
Identity = 65/249 (26.10%), Postives = 110/249 (44.18%), Query Frame = 2
Query:  134 DLNKKRPIHHACERGQTEIVKLLIDYNCDI----EALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDH---HCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDH-HCNIESRDKWNRRPIHLSCSGC---CTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSP 847
            D+  + P+H+A  RGQTEI+  L+          + LD     P+H+A+  GH+  +++L+ L   I+  +     P+H A  +GH      L++    H  I  RD  G  PLH A  A      +L++ H  +I A D   +  +  A +   +G V +L+     ++   D+     +HL+CS     C   +   I     I A +   Q P+HLA        V+ L+     +   D+ G++P
Sbjct:  745 DIQGRTPLHYAASRGQTEILSSLMQAAVAADPQDQLLDNKQYTPLHWAAYKGHEDCLEVLLELKTFIH-EEGNPFTPLHCALMNGHCSAAERLLESARVHV-INCRDAKGRSPLHAAAFAEDVAGLQLVLRHGAEINAVDNSGRSALMVAADKGHSGTVAILLHRAKADLTLLDENKNTALHLACSKAHEMCALLILGEIHSPTLINATNSALQMPLHLAARNGLATVVQALLSRGATVLAVDEEGHTP 991          

HSP 9 Score: 75.8702 bits (185), Expect = 1.928e-13
Identity = 61/259 (23.55%), Postives = 120/259 (46.33%), Query Frame = 2
Query:  155 IHHACERGQTEIVKLLID--YNC--DIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCD-IESRDKLGYRPLHYACKAGRAETAKLLIDHHCD---IEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGN----SPLEIAMKTGNEGLIHIL 895
            +H+A   G  + ++LL++  +N   DIE+       P+H A+ NGH + ++LL      ++ +D   R  ++ A + GH   V +L+        + ++L + P+H A   G ++  +++ID+  +       DK+ Q P+  A        V+ L++   + +++DK     +H +      + V  L+ HK     RD   + P+H A +  +TE +  L+      +  DQ  +    +PL  A   G+E  + +L
Sbjct:  548 VHYAAYHGNKQNLELLLEMSFNALGDIES--SIPVSPLHLAADNGHWQALRLLTETAAYVDMQDAAGRSVLYLAAQKGHVRCVEVLLAQGASCFLNDNRLMWTPIHVAAANGHSDCLRMMIDYGEEGDLTNVADKFGQTPLMLAVLGGHTDCVRFLLERASSPDAQDKRGSTALHRAAVLGHDDCVTALLKHKASPLCRDIQGRTPLHYAASRGQTEILSSLMQAAVAADPQDQLLDNKQYTPLHWAAYKGHEDCLEVL 804          

HSP 10 Score: 73.1738 bits (178), Expect = 1.305e-12
Identity = 49/192 (25.52%), Postives = 78/192 (40.62%), Query Frame = 2
Query:  146 KRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHS-------------GIVNLLIDHHC-----DIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCS 667
            K P+H A   G+    ++LI    DI+ +DK+   P+H A++ GH+  +  L++   D   R      P+H A  +G S              IV+ +   H      +I + D  G   LH A   G  E   LL+    D+  RD   + P+H A    R      L+     +   D+    P+H S +
Sbjct:  307 KSPLHMAAIHGRFTRSQILIQNGGDIDCVDKYGNTPLHVAAKYGHELLISTLMTNGADTARRGIHGMFPLHLAVLYGFSDCCRKLLSSGQLYSIVSSMSKEHVLSAGFEINTPDNFGRTCLHAAASGGNVECLNLLLSSGADLNKRDIMGRTPLHYAAANGRYQCTVTLVSAGAEVNESDQTGCTPLHYSAA 498          

HSP 11 Score: 65.0846 bits (157), Expect = 3.735e-10
Identity = 60/283 (21.20%), Postives = 119/283 (42.05%), Query Frame = 2
Query:   56 CFIRAIRGGSIKLFHRFFKREY-LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHC----DIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARD---WWDQRPIHLACNAKRTETVKILVDH--HCDIEE-CDQFGNSPLEIAMKTG 871
            C   A  GG+++  +        L + D+  + P+H+A   G+ +    L+    ++   D+    P+HY++ +     V+     H   N + E +        E G    +  L+D   D    +  GY  +HYA   G  +  +LL++       DIE+       P+H A +      ++LL +    ++ +D   R  ++L+        V++L+         D    W   PIH+A     ++ +++++D+    D+    D+FG +PL +A+  G
Sbjct:  426 CLHAAASGGNVECLNLLLSSGADLNKRDIMGRTPLHYAAANGRYQCTVTLVSAGAEVNESDQTGCTPLHYSAASQAFGRVE----RHFSGNHQKEEEE-------EKGSYFCLEHLLDSGADPSMVNSKGYSAVHYAAYHGNKQNLELLLEMSFNALGDIES--SIPVSPLHLAADNGHWQALRLLTETAAYVDMQDAAGRSVLYLAAQKGHVRCVEVLLAQGASCFLNDNRLMW--TPIHVAAANGHSDCLRMMIDYGEEGDLTNVADKFGQTPLMLAVLGG 693          

HSP 12 Score: 61.2326 bits (147), Expect = 5.795e-9
Identity = 65/291 (22.34%), Postives = 115/291 (39.52%), Query Frame = 2
Query:   59 FIRAIRGGSIKLFHRFFKR-EYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEW----DRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDH---HCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDH-KCDIEARDWWDQRPIHLACN-AKRTETVKILVDHHCD--IEECDQFGNSPLEIAMKTGNEGLIHIL 895
             + A+ GG         +R    + +D      +H A   G  + V  L+ +       D   + P+HYA+  G  + +  L+      + +D+        P+H A   GH   + +L++    I       + PLH A   G    A+ L++    H  I  RD   + P+H A   E    ++L++ H   I + D   R  + ++     + TV +L+   K D+   D      +HLAC+ A     + IL + H    I   +     PL +A + G   ++  L
Sbjct:  686 LMLAVLGGHTDCVRFLLERASSPDAQDKRGSTALHRAAVLGHDDCVTALLKHKASPLCRDIQGRTPLHYAASRGQTEILSSLMQAAVAADPQDQLLDNKQYTPLHWAAYKGHEDCLEVLLELKTFIHEEGN-PFTPLHCALMNGHCSAAERLLESARVHV-INCRDAKGRSPLHAAAFAEDVAGLQLVLRHGAEINAVDNSGRSALMVAADKGHSGTVAILLHRAKADLTLLDENKNTALHLACSKAHEMCALLILGEIHSPTLINATNSALQMPLHLAARNGLATVVQAL 974          
BLAST of SMED30005028 vs. Ensembl Medaka
Match: ENSORLT00000018386.2 (serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C [Source:NCBI gene;Acc:101169196])

HSP 1 Score: 135.576 bits (340), Expect = 7.553e-32
Identity = 73/249 (29.32%), Postives = 127/249 (51.00%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHL-SCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            P+H A     T     LI + C ++  DK  + P+HYA+ +GH++ V LLV    +++A+D+ +R PIH A   G+  +V LL+ H   +  +DK GY PLH A  +G+ +    L+    + +  + +    +H AC   +  +   L++   N+         P+H+ + S C     +LL+++  D+  ++   + P+H+A    R    +IL+ +  +I+  D  GN+PL IA K G E LI  L
Sbjct:  106 PLHVAAANWATSCAAALIPHVCSLDVTDKLGRTPLHYAAHSGHREMVNLLVCKGANVSAKDKKERQPIHWAAHLGYLEVVKLLVSHGASVTCKDKHGYTPLHVAAVSGQLDVVSYLLRLRVEPDEPNSFGNTALHMACYTGQDIVASELVNCGANLNQPSYHGNTPLHMAAASSCGVMCFELLVNNGADVSVQNKDGKTPLHIAAKYGRFTGSQILIQNGAEIDCGDTNGNTPLHIAAKYGQELLISTL 354          

HSP 2 Score: 122.479 bits (306), Expect = 7.540e-28
Identity = 73/244 (29.92%), Postives = 121/244 (49.59%), Query Frame = 2
Query:  146 KRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNE 877
            + P+  A      E V  L+++N ++ A D+    P+H AS  G    +++L+S   +I+A+D     P+HRA    +     LL+ H  ++ SRDK  + PLH A        A  LI H C ++  DK  + P+H A       +V LL+    N+ ++DK  R+PIH +      E VKLL+ H   +  +D     P+H+A  + + + V  L+    + +E + FGN+ L +A  TG +
Sbjct:    9 QSPLIQAIFSRNAEDVTSLLNHNENVNAQDQEQGTPLHAASYLGDVHVMEILISSGANISAKDTGMLTPLHRAAASRN----KLLLKHKSEVNSRDKFWHTPLHVAAANWATSCAAALIPHVCSLDVTDKLGRTPLHYAAHSGHREMVNLLVCKGANVSAKDKKERQPIHWAAHLGYLEVVKLLVSHGASVTCKDKHGYTPLHVAAVSGQLDVVSYLLRLRVEPDEPNSFGNTALHMACYTGQD 248          

HSP 3 Score: 120.553 bits (301), Expect = 3.047e-27
Identity = 68/252 (26.98%), Postives = 125/252 (49.60%), Query Frame = 2
Query:  113 REYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKT 868
             E +  +D  +  P+H A   G   ++++LI    +I A D     P+H A+ + +K    LL+    ++N+RD++   P+H A  +  +     LI H C ++  DKLG  PLHYA  +G  E   LL+    ++ A+DK +++PIH A       +VKLL+ H  ++  +DK    P+H++      + V  L+  + + +  + +    +H+AC   +      LV+   ++ +    GN+PL +A  +
Sbjct:   31 NENVNAQDQEQGTPLHAASYLGDVHVMEILISSGANISAKDTGMLTPLHRAAASRNK----LLLKHKSEVNSRDKFWHTPLHVAAANWATSCAAALIPHVCSLDVTDKLGRTPLHYAAHSGHREMVNLLVCKGANVSAKDKKERQPIHWAAHLGYLEVVKLLVSHGASVTCKDKHGYTPLHVAAVSGQLDVVSYLLRLRVEPDEPNSFGNTALHMACYTGQDIVASELVNCGANLNQPSYHGNTPLHMAAAS 278          

HSP 4 Score: 101.679 bits (252), Expect = 2.075e-21
Identity = 63/217 (29.03%), Postives = 108/217 (49.77%), Query Frame = 2
Query:  245 QRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            Q P+  A  + + + V  L++ + ++NA+D+    P+H A   G   ++ +LI    +I ++D     PLH A     A   KLL+ H  ++ +RDK+   P+H A           LI H C+++  DK  R P+H +      E V LL+    ++ A+D  +++PIH A +    E VK+LV H   +   D+ G +PL +A  +G   ++  L
Sbjct:    9 QSPLIQAIFSRNAEDVTSLLNHNENVNAQDQEQGTPLHAASYLGDVHVMEILISSGANISAKDTGMLTPLHRAA----ASRNKLLLKHKSEVNSRDKFWHTPLHVAAANWATSCAAALIPHVCSLDVTDKLGRTPLHYAAHSGHREMVNLLVCKGANVSAKDKKERQPIHWAAHLGYLEVVKLLVSHGASVTCKDKHGYTPLHVAAVSGQLDVVSYL 221          

HSP 5 Score: 94.3597 bits (233), Expect = 4.040e-19
Identity = 70/299 (23.41%), Postives = 125/299 (41.81%), Query Frame = 2
Query:  110 KREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGH----SGIVN------------------------------LLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSC----SGCCTETVKLLIDH-----KCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNE 877
            K   +  +D  +++PIH A   G  E+VKLL+ +   +   DK    P+H A+ +G    V  L+ L  + +  + +    +H AC  G     S +VN                              LL+++  D+  ++K G  PLH A K GR   +++LI +  +I+  D     P+H A +Y +  ++  L+ +  +   +      P+HL+       CC + +     H     + DI   D   +  +H A +    E + +L++   +++  D  G SPL  A   GN 
Sbjct:  158 KGANVSAKDKKERQPIHWAAHLGYLEVVKLLVSHGASVTCKDKHGYTPLHVAAVSGQLDVVSYLLRLRVEPDEPNSFGNTALHMACYTGQDIVASELVNCGANLNQPSYHGNTPLHMAAASSCGVMCFELLVNNGADVSVQNKDGKTPLHIAAKYGRFTGSQILIQNGAEIDCGDTNGNTPLHIAAKYGQELLISTLLTNGADKNRQGIHGMLPLHLAALCGFPDCCRKLLSSGESHPSSGEELDINMSDDHGRTALHAAASGGNVECLNLLLNCGAELDIKDILGRSPLHYAAANGNS 456          

HSP 6 Score: 73.1738 bits (178), Expect = 1.132e-12
Identity = 65/280 (23.21%), Postives = 122/280 (43.57%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIH-RACEHGHSG-------------IVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLL--IDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARD---WWDQRPIHLACNAKRTETVKILVD--HHCDIEEC-DQFGNSPLEIAMKTGNEGLIHIL 895
            +   D + +  +H A   G  E + LL++   +++  D   + P+HYA+ NG+ +    LV    ++N  D     P+H  A  H   G              ++ L+D+  D   ++  GY  +HYA   G  +  +LL  I  +C  EA       P+H A  Y     + LL +   +++ RD   +  +HL+     ++ V++L++H      R+    W    +H A    + + + +LV+   + D+ +  D  G + L +A    +   +HIL
Sbjct:  403 INMSDDHGRTALHAAASGGNVECLNLLLNCGAELDIKDILGRSPLHYAAANGNSQCTVSLVRAGAEVNDADLMGCSPLHYAAASHAFCGGFLQFLLVRFVFRCLDYLLDNGVDPTLKNCRGYSAVHYAAACGNKQHLELLLEISFNCLEEAESNIPVSPLHLAAYYGHCEALGLLCETLVSLDVRDIQGQTALHLAAQRGFSQCVEVLLEHGASYGLREHKRRWTA--LHAAAAEGQVDCLLLLVNCKQNVDVVDSQDTQGRTALMLAALGCHTDCVHIL 680          

HSP 7 Score: 67.781 bits (164), Expect = 5.646e-11
Identity = 62/279 (22.22%), Postives = 111/279 (39.78%), Query Frame = 2
Query:  134 DLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSL---------HCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYER--AGIVKL------------LIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLL--IDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            D N   P+H A + GQ  ++  L+    D          P+H A+  G     + L+S            DIN  D+  R  +H A   G+   +NLL++   +++ +D LG  PLHYA   G ++    L+    ++   D     P+H A        G ++             L+D+  +   ++      +H + +    + ++LL  I   C  EA       P+HLA      E + +L +    ++  D  G + L +A + G    + +L
Sbjct:  332 DTNGNTPLHIAAKYGQELLISTLLTNGADKNRQGIHGMLPLHLAALCGFPDCCRKLLSSGESHPSSGEELDINMSDDHGRTALHAAASGGNVECLNLLLNCGAELDIKDILGRSPLHYAAANGNSQCTVSLVRAGAEVNDADLMGCSPLHYAAASHAFCGGFLQFLLVRFVFRCLDYLLDNGVDPTLKNCRGYSAVHYAAACGNKQHLELLLEISFNCLEEAESNIPVSPLHLAAYYGHCEALGLLCETLVSLDVRDIQGQTALHLAAQRGFSQCVEVL 610          

HSP 8 Score: 53.9138 bits (128), Expect = 1.078e-6
Identity = 51/261 (19.54%), Postives = 110/261 (42.15%), Query Frame = 2
Query:  116 EYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKL----GYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCAC--EYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILV-DHHCDIEECDQFGNSPLEIAMKTGNE 877
            + ++ +D   +  +  A     T+ V +L++   + +A DK     +H  +  G ++    L+        RD   R P+H A   GH+ ++  L+      +  D +     Y P H+A   G      +L+++      ++     P+HCA    ++ A ++ +       +  +D   R P+H +        ++LL+    ++ A D + +  + +A +  +T  V+ L+   + D+   D   N+ L +A   G+E
Sbjct:  652 DVVDSQDTQGRTALMLAALGCHTDCVHILLEKKANPDAADKKGFTALHRVAMLGSEECESALLEHGASALCRDFQGRTPLHLAASCGHTKLLGALLKAARKADPLDSMLDFRSYTPTHWAAYHGHEGCLHVLLENRI-FSNQEGNPFTPLHCALVGGFDAAAVLLVKAAGPQIVNKKDAKGRSPLHAAAHSGSVAGLQLLLTCGAEVNAVDHFGRSALMVAADCGQTMAVEFLLHKANPDLSLVDANNNTALHLACNKGHE 911          

HSP 9 Score: 53.5286 bits (127), Expect = 1.378e-6
Identity = 60/302 (19.87%), Postives = 117/302 (38.74%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDI---EALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWD---RVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDH-------------------------------HCNIESRDKWNRR-----PIHLSCSGCCTETVKLLIDHKCD--IEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            L+  D+  +  +H A +RG ++ V++L+++       E   +W    +H A+  G    + LLV+   +++  D  D   R  +  A    H+  V++L++   + ++ DK G+  LH     G  E    L++H      RD   + P+H A       ++  L+                                 H  +E+R   N+      P+H +  G       LL+       +  +D   + P+H A ++     +++L+    ++   D FG S L +A   G    +  L
Sbjct:  584 LDVRDIQGQTALHLAAQRGFSQCVEVLLEHGASYGLREHKRRWTA--LHAAAAEGQVDCLLLLVNCKQNVDVVDSQDTQGRTALMLAALGCHTDCVHILLEKKANPDAADKKGFTALHRVAMLGSEECESALLEHGASALCRDFQGRTPLHLAASCGHTKLLGALLKAARKADPLDSMLDFRSYTPTHWAAYHGHEGCLHVLLENRIFSNQEGNPFTPLHCALVGGFDAAAVLLVKAAGPQIVNKKDAKGRSPLHAAAHSGSVAGLQLLLTCGAEVNAVDHFGRSALMVAADCGQTMAVEFL 883          
BLAST of SMED30005028 vs. Ensembl Medaka
Match: ENSORLT00000027359.1 (serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C [Source:NCBI gene;Acc:101169196])

HSP 1 Score: 135.191 bits (339), Expect = 7.728e-32
Identity = 73/249 (29.32%), Postives = 127/249 (51.00%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHL-SCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            P+H A     T     LI + C ++  DK  + P+HYA+ +GH++ V LLV    +++A+D+ +R PIH A   G+  +V LL+ H   +  +DK GY PLH A  +G+ +    L+    + +  + +    +H AC   +  +   L++   N+         P+H+ + S C     +LL+++  D+  ++   + P+H+A    R    +IL+ +  +I+  D  GN+PL IA K G E LI  L
Sbjct:   37 PLHVAAANWATSCAAALIPHVCSLDVTDKLGRTPLHYAAHSGHREMVNLLVCKGANVSAKDKKERQPIHWAAHLGYLEVVKLLVSHGASVTCKDKHGYTPLHVAAVSGQLDVVSYLLRLRVEPDEPNSFGNTALHMACYTGQDIVASELVNCGANLNQPSYHGNTPLHMAAASSCGVMCFELLVNNGADVSVQNKDGKTPLHIAAKYGRFTGSQILIQNGAEIDCGDTNGNTPLHIAAKYGQELLISTL 285          

HSP 2 Score: 109.383 bits (272), Expect = 8.960e-24
Identity = 58/206 (28.16%), Postives = 108/206 (52.43%), Query Frame = 2
Query:  251 PIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKT 868
            P+H A+ + +K+ V+LL+    ++N+RD++   P+H A  +  +     LI H C ++  DKLG  PLHYA  +G  E   LL+    ++ A+DK +++PIH A       +VKLL+ H  ++  +DK    P+H++      + V  L+  + + +  + +    +H+AC   +      LV+   ++ +    GN+PL +A  +
Sbjct:    4 PLHRAAASRNKRAVELLLKHKSEVNSRDKFWHTPLHVAAANWATSCAAALIPHVCSLDVTDKLGRTPLHYAAHSGHREMVNLLVCKGANVSAKDKKERQPIHWAAHLGYLEVVKLLVSHGASVTCKDKHGYTPLHVAAVSGQLDVVSYLLRLRVEPDEPNSFGNTALHMACYTGQDIVASELVNCGANLNQPSYHGNTPLHMAAAS 209          

HSP 3 Score: 99.7525 bits (247), Expect = 7.756e-21
Identity = 56/177 (31.64%), Postives = 88/177 (49.72%), Query Frame = 2
Query:  347 VPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNE 877
             P+HRA    +   V LL+ H  ++ SRDK  + PLH A        A  LI H C ++  DK  + P+H A       +V LL+    N+ ++DK  R+PIH +      E VKLL+ H   +  +D     P+H+A  + + + V  L+    + +E + FGN+ L +A  TG +
Sbjct:    3 TPLHRAAASRNKRAVELLLKHKSEVNSRDKFWHTPLHVAAANWATSCAAALIPHVCSLDVTDKLGRTPLHYAAHSGHREMVNLLVCKGANVSAKDKKERQPIHWAAHLGYLEVVKLLVSHGASVTCKDKHGYTPLHVAAVSGQLDVVSYLLRLRVEPDEPNSFGNTALHMACYTGQD 179          

HSP 4 Score: 80.8777 bits (198), Expect = 4.864e-15
Identity = 45/149 (30.20%), Postives = 74/149 (49.66%), Query Frame = 2
Query:  449 PLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            PLH A  +      +LL+ H  ++ +RDK+   P+H A           LI H C+++  DK  R P+H +      E V LL+    ++ A+D  +++PIH A +    E VK+LV H   +   D+ G +PL +A  +G   ++  L
Sbjct:    4 PLHRAAASRNKRAVELLLKHKSEVNSRDKFWHTPLHVAAANWATSCAAALIPHVCSLDVTDKLGRTPLHYAAHSGHREMVNLLVCKGANVSAKDKKERQPIHWAAHLGYLEVVKLLVSHGASVTCKDKHGYTPLHVAAVSGQLDVVSYL 152          

HSP 5 Score: 71.2478 bits (173), Expect = 4.225e-12
Identity = 65/286 (22.73%), Postives = 122/286 (42.66%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRAC--------------------EHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLL--IDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARD---WWDQRPIHLACNAKRTETVKILVD--HHCDIEEC-DQFGNSPLEIAMKTGNEGLIHIL 895
            +   D + +  +H A   G  E + LL++   +++  D   + P+HYA+ NG+ +    LV    ++N  D     P+H A                     EH     ++ L+D+  D   ++  GY  +HYA   G  +  +LL  I  +C  EA       P+H A  Y     + LL +   +++ RD   +  +HL+     ++ V++L++H      R+    W    +H A    + + + +LV+   + D+ +  D  G + L +A    +   +HIL
Sbjct:  343 INMSDDHGRTALHAAASGGNVECLNLLLNCGAELDIKDILGRSPLHYAAANGNSQCTVSLVRAGAEVNDADLMGCSPLHYAAASHAFCGGETVSGSSLSEEKEHEAYLCLDYLLDNGVDPTLKNCRGYSAVHYAAACGNKQHLELLLEISFNCLEEAESNIPVSPLHLAAYYGHCEALGLLCETLVSLDVRDIQGQTALHLAAQRGFSQCVEVLLEHGASYGLREHKRRWTA--LHAAAAEGQVDCLLLLVNCKQNVDVVDSQDTQGRTALMLAALGCHTDCVHIL 626          

HSP 6 Score: 68.5514 bits (166), Expect = 3.198e-11
Identity = 55/251 (21.91%), Postives = 103/251 (41.04%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERG-QTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETA-KLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKT 868
            L +   +   P+H A          +LL++   D+   +K  + P+H A++ G     ++L+    +I+  D     P+H A ++G   +++ L+ +  D   +   G  PLH A   G  +   KLL   H        ++  P   A     +G          +I   D   R  +H + SG   E + LL++   +++ +D   + P+H A     ++    LV    ++ + D  G SPL  A  +
Sbjct:  192 LNQPSYHGNTPLHMAAASSCGVMCFELLVNNGADVSVQNKDGKTPLHIAAKYGRFTGSQILIQNGAEIDCGDTNGNTPLHIAAKYGQELLISTLLTNGADKNRQGIHGMLPLHLAALCGFPDCCRKLLSSGHF-------YNSMP--SAVGSPSSG-------EELDINMSDDHGRTALHAAASGGNVECLNLLLNCGAELDIKDILGRSPLHYAAANGNSQCTVSLVRAGAEVNDADLMGCSPLHYAAAS 426          

HSP 7 Score: 64.6994 bits (156), Expect = 5.156e-10
Identity = 66/294 (22.45%), Postives = 113/294 (38.44%), Query Frame = 2
Query:  134 DLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTV-KLLVSLH-----------------CDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCAC--------------------EYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLL--IDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            D N   P+H A + GQ  ++  L+    D          P+H A+  G      KLL S H                  DIN  D+  R  +H A   G+   +NLL++   +++ +D LG  PLHYA   G ++    L+    ++   D     P+H A                     E+E    +  L+D+  +   ++      +H + +    + ++LL  I   C  EA       P+HLA      E + +L +    ++  D  G + L +A + G    + +L
Sbjct:  263 DTNGNTPLHIAAKYGQELLISTLLTNGADKNRQGIHGMLPLHLAALCGFPDCCRKLLSSGHFYNSMPSAVGSPSSGEELDINMSDDHGRTALHAAASGGNVECLNLLLNCGAELDIKDILGRSPLHYAAANGNSQCTVSLVRAGAEVNDADLMGCSPLHYAAASHAFCGGETVSGSSLSEEKEHEAYLCLDYLLDNGVDPTLKNCRGYSAVHYAAACGNKQHLELLLEISFNCLEEAESNIPVSPLHLAAYYGHCEALGLLCETLVSLDVRDIQGQTALHLAAQRGFSQCVEVL 556          

HSP 8 Score: 53.5286 bits (127), Expect = 1.224e-6
Identity = 51/261 (19.54%), Postives = 110/261 (42.15%), Query Frame = 2
Query:  116 EYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKL----GYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCAC--EYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILV-DHHCDIEECDQFGNSPLEIAMKTGNE 877
            + ++ +D   +  +  A     T+ V +L++   + +A DK     +H  +  G ++    L+        RD   R P+H A   GH+ ++  L+      +  D +     Y P H+A   G      +L+++      ++     P+HCA    ++ A ++ +       +  +D   R P+H +        ++LL+    ++ A D + +  + +A +  +T  V+ L+   + D+   D   N+ L +A   G+E
Sbjct:  598 DVVDSQDTQGRTALMLAALGCHTDCVHILLEKKANPDAADKKGFTALHRVAMLGSEECESALLEHGASALCRDFQGRTPLHLAASCGHTKLLGALLKAARKADPLDSMLDFRSYTPTHWAAYHGHEGCLHVLLENRI-FSNQEGNPFTPLHCALVGGFDAAAVLLVKAAGPQIVNKKDAKGRSPLHAAAHSGSVAGLQLLLTCGAEVNAVDHFGRSALMVAADCGQTMAVEFLLHKANPDLSLVDANNNTALHLACNKGHE 857          

HSP 9 Score: 53.5286 bits (127), Expect = 1.403e-6
Identity = 60/302 (19.87%), Postives = 117/302 (38.74%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDI---EALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWD---RVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDH-------------------------------HCNIESRDKWNRR-----PIHLSCSGCCTETVKLLIDHKCD--IEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            L+  D+  +  +H A +RG ++ V++L+++       E   +W    +H A+  G    + LLV+   +++  D  D   R  +  A    H+  V++L++   + ++ DK G+  LH     G  E    L++H      RD   + P+H A       ++  L+                                 H  +E+R   N+      P+H +  G       LL+       +  +D   + P+H A ++     +++L+    ++   D FG S L +A   G    +  L
Sbjct:  530 LDVRDIQGQTALHLAAQRGFSQCVEVLLEHGASYGLREHKRRWTA--LHAAAAEGQVDCLLLLVNCKQNVDVVDSQDTQGRTALMLAALGCHTDCVHILLEKKANPDAADKKGFTALHRVAMLGSEECESALLEHGASALCRDFQGRTPLHLAASCGHTKLLGALLKAARKADPLDSMLDFRSYTPTHWAAYHGHEGCLHVLLENRIFSNQEGNPFTPLHCALVGGFDAAAVLLVKAAGPQIVNKKDAKGRSPLHAAAHSGSVAGLQLLLTCGAEVNAVDHFGRSALMVAADCGQTMAVEFL 829          
BLAST of SMED30005028 vs. Ensembl Medaka
Match: ENSORLT00000036677.1 (serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C [Source:NCBI gene;Acc:101169196])

HSP 1 Score: 135.191 bits (339), Expect = 7.728e-32
Identity = 73/249 (29.32%), Postives = 127/249 (51.00%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHL-SCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            P+H A     T     LI + C ++  DK  + P+HYA+ +GH++ V LLV    +++A+D+ +R PIH A   G+  +V LL+ H   +  +DK GY PLH A  +G+ +    L+    + +  + +    +H AC   +  +   L++   N+         P+H+ + S C     +LL+++  D+  ++   + P+H+A    R    +IL+ +  +I+  D  GN+PL IA K G E LI  L
Sbjct:   37 PLHVAAANWATSCAAALIPHVCSLDVTDKLGRTPLHYAAHSGHREMVNLLVCKGANVSAKDKKERQPIHWAAHLGYLEVVKLLVSHGASVTCKDKHGYTPLHVAAVSGQLDVVSYLLRLRVEPDEPNSFGNTALHMACYTGQDIVASELVNCGANLNQPSYHGNTPLHMAAASSCGVMCFELLVNNGADVSVQNKDGKTPLHIAAKYGRFTGSQILIQNGAEIDCGDTNGNTPLHIAAKYGQELLISTL 285          

HSP 2 Score: 109.383 bits (272), Expect = 8.960e-24
Identity = 58/206 (28.16%), Postives = 108/206 (52.43%), Query Frame = 2
Query:  251 PIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKT 868
            P+H A+ + +K+ V+LL+    ++N+RD++   P+H A  +  +     LI H C ++  DKLG  PLHYA  +G  E   LL+    ++ A+DK +++PIH A       +VKLL+ H  ++  +DK    P+H++      + V  L+  + + +  + +    +H+AC   +      LV+   ++ +    GN+PL +A  +
Sbjct:    4 PLHRAAASRNKRAVELLLKHKSEVNSRDKFWHTPLHVAAANWATSCAAALIPHVCSLDVTDKLGRTPLHYAAHSGHREMVNLLVCKGANVSAKDKKERQPIHWAAHLGYLEVVKLLVSHGASVTCKDKHGYTPLHVAAVSGQLDVVSYLLRLRVEPDEPNSFGNTALHMACYTGQDIVASELVNCGANLNQPSYHGNTPLHMAAAS 209          

HSP 3 Score: 99.7525 bits (247), Expect = 7.756e-21
Identity = 56/177 (31.64%), Postives = 88/177 (49.72%), Query Frame = 2
Query:  347 VPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNE 877
             P+HRA    +   V LL+ H  ++ SRDK  + PLH A        A  LI H C ++  DK  + P+H A       +V LL+    N+ ++DK  R+PIH +      E VKLL+ H   +  +D     P+H+A  + + + V  L+    + +E + FGN+ L +A  TG +
Sbjct:    3 TPLHRAAASRNKRAVELLLKHKSEVNSRDKFWHTPLHVAAANWATSCAAALIPHVCSLDVTDKLGRTPLHYAAHSGHREMVNLLVCKGANVSAKDKKERQPIHWAAHLGYLEVVKLLVSHGASVTCKDKHGYTPLHVAAVSGQLDVVSYLLRLRVEPDEPNSFGNTALHMACYTGQD 179          

HSP 4 Score: 80.8777 bits (198), Expect = 4.864e-15
Identity = 45/149 (30.20%), Postives = 74/149 (49.66%), Query Frame = 2
Query:  449 PLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            PLH A  +      +LL+ H  ++ +RDK+   P+H A           LI H C+++  DK  R P+H +      E V LL+    ++ A+D  +++PIH A +    E VK+LV H   +   D+ G +PL +A  +G   ++  L
Sbjct:    4 PLHRAAASRNKRAVELLLKHKSEVNSRDKFWHTPLHVAAANWATSCAAALIPHVCSLDVTDKLGRTPLHYAAHSGHREMVNLLVCKGANVSAKDKKERQPIHWAAHLGYLEVVKLLVSHGASVTCKDKHGYTPLHVAAVSGQLDVVSYL 152          

HSP 5 Score: 71.2478 bits (173), Expect = 4.225e-12
Identity = 65/286 (22.73%), Postives = 122/286 (42.66%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRAC--------------------EHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLL--IDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARD---WWDQRPIHLACNAKRTETVKILVD--HHCDIEEC-DQFGNSPLEIAMKTGNEGLIHIL 895
            +   D + +  +H A   G  E + LL++   +++  D   + P+HYA+ NG+ +    LV    ++N  D     P+H A                     EH     ++ L+D+  D   ++  GY  +HYA   G  +  +LL  I  +C  EA       P+H A  Y     + LL +   +++ RD   +  +HL+     ++ V++L++H      R+    W    +H A    + + + +LV+   + D+ +  D  G + L +A    +   +HIL
Sbjct:  343 INMSDDHGRTALHAAASGGNVECLNLLLNCGAELDIKDILGRSPLHYAAANGNSQCTVSLVRAGAEVNDADLMGCSPLHYAAASHAFCGGETVSGSSLSEEKEHEAYLCLDYLLDNGVDPTLKNCRGYSAVHYAAACGNKQHLELLLEISFNCLEEAESNIPVSPLHLAAYYGHCEALGLLCETLVSLDVRDIQGQTALHLAAQRGFSQCVEVLLEHGASYGLREHKRRWTA--LHAAAAEGQVDCLLLLVNCKQNVDVVDSQDTQGRTALMLAALGCHTDCVHIL 626          

HSP 6 Score: 68.5514 bits (166), Expect = 3.198e-11
Identity = 55/251 (21.91%), Postives = 103/251 (41.04%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERG-QTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETA-KLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKT 868
            L +   +   P+H A          +LL++   D+   +K  + P+H A++ G     ++L+    +I+  D     P+H A ++G   +++ L+ +  D   +   G  PLH A   G  +   KLL   H        ++  P   A     +G          +I   D   R  +H + SG   E + LL++   +++ +D   + P+H A     ++    LV    ++ + D  G SPL  A  +
Sbjct:  192 LNQPSYHGNTPLHMAAASSCGVMCFELLVNNGADVSVQNKDGKTPLHIAAKYGRFTGSQILIQNGAEIDCGDTNGNTPLHIAAKYGQELLISTLLTNGADKNRQGIHGMLPLHLAALCGFPDCCRKLLSSGHF-------YNSMP--SAVGSPSSG-------EELDINMSDDHGRTALHAAASGGNVECLNLLLNCGAELDIKDILGRSPLHYAAANGNSQCTVSLVRAGAEVNDADLMGCSPLHYAAAS 426          

HSP 7 Score: 64.6994 bits (156), Expect = 5.156e-10
Identity = 66/294 (22.45%), Postives = 113/294 (38.44%), Query Frame = 2
Query:  134 DLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTV-KLLVSLH-----------------CDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCAC--------------------EYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLL--IDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            D N   P+H A + GQ  ++  L+    D          P+H A+  G      KLL S H                  DIN  D+  R  +H A   G+   +NLL++   +++ +D LG  PLHYA   G ++    L+    ++   D     P+H A                     E+E    +  L+D+  +   ++      +H + +    + ++LL  I   C  EA       P+HLA      E + +L +    ++  D  G + L +A + G    + +L
Sbjct:  263 DTNGNTPLHIAAKYGQELLISTLLTNGADKNRQGIHGMLPLHLAALCGFPDCCRKLLSSGHFYNSMPSAVGSPSSGEELDINMSDDHGRTALHAAASGGNVECLNLLLNCGAELDIKDILGRSPLHYAAANGNSQCTVSLVRAGAEVNDADLMGCSPLHYAAASHAFCGGETVSGSSLSEEKEHEAYLCLDYLLDNGVDPTLKNCRGYSAVHYAAACGNKQHLELLLEISFNCLEEAESNIPVSPLHLAAYYGHCEALGLLCETLVSLDVRDIQGQTALHLAAQRGFSQCVEVL 556          

HSP 8 Score: 53.5286 bits (127), Expect = 1.224e-6
Identity = 51/261 (19.54%), Postives = 110/261 (42.15%), Query Frame = 2
Query:  116 EYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKL----GYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCAC--EYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILV-DHHCDIEECDQFGNSPLEIAMKTGNE 877
            + ++ +D   +  +  A     T+ V +L++   + +A DK     +H  +  G ++    L+        RD   R P+H A   GH+ ++  L+      +  D +     Y P H+A   G      +L+++      ++     P+HCA    ++ A ++ +       +  +D   R P+H +        ++LL+    ++ A D + +  + +A +  +T  V+ L+   + D+   D   N+ L +A   G+E
Sbjct:  598 DVVDSQDTQGRTALMLAALGCHTDCVHILLEKKANPDAADKKGFTALHRVAMLGSEECESALLEHGASALCRDFQGRTPLHLAASCGHTKLLGALLKAARKADPLDSMLDFRSYTPTHWAAYHGHEGCLHVLLENRI-FSNQEGNPFTPLHCALVGGFDAAAVLLVKAAGPQIVNKKDAKGRSPLHAAAHSGSVAGLQLLLTCGAEVNAVDHFGRSALMVAADCGQTMAVEFLLHKANPDLSLVDANNNTALHLACNKGHE 857          

HSP 9 Score: 53.5286 bits (127), Expect = 1.403e-6
Identity = 60/302 (19.87%), Postives = 117/302 (38.74%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDI---EALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWD---RVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDH-------------------------------HCNIESRDKWNRR-----PIHLSCSGCCTETVKLLIDHKCD--IEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            L+  D+  +  +H A +RG ++ V++L+++       E   +W    +H A+  G    + LLV+   +++  D  D   R  +  A    H+  V++L++   + ++ DK G+  LH     G  E    L++H      RD   + P+H A       ++  L+                                 H  +E+R   N+      P+H +  G       LL+       +  +D   + P+H A ++     +++L+    ++   D FG S L +A   G    +  L
Sbjct:  530 LDVRDIQGQTALHLAAQRGFSQCVEVLLEHGASYGLREHKRRWTA--LHAAAAEGQVDCLLLLVNCKQNVDVVDSQDTQGRTALMLAALGCHTDCVHILLEKKANPDAADKKGFTALHRVAMLGSEECESALLEHGASALCRDFQGRTPLHLAASCGHTKLLGALLKAARKADPLDSMLDFRSYTPTHWAAYHGHEGCLHVLLENRIFSNQEGNPFTPLHCALVGGFDAAAVLLVKAAGPQIVNKKDAKGRSPLHAAAHSGSVAGLQLLLTCGAEVNAVDHFGRSALMVAADCGQTMAVEFL 829          
BLAST of SMED30005028 vs. Ensembl Medaka
Match: ENSORLT00000036692.1 (serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C [Source:NCBI gene;Acc:101169196])

HSP 1 Score: 135.191 bits (339), Expect = 8.466e-32
Identity = 73/249 (29.32%), Postives = 127/249 (51.00%), Query Frame = 2
Query:  152 PIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHL-SCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            P+H A     T     LI + C ++  DK  + P+HYA+ +GH++ V LLV    +++A+D+ +R PIH A   G+  +V LL+ H   +  +DK GY PLH A  +G+ +    L+    + +  + +    +H AC   +  +   L++   N+         P+H+ + S C     +LL+++  D+  ++   + P+H+A    R    +IL+ +  +I+  D  GN+PL IA K G E LI  L
Sbjct:  110 PLHVAAANWATSCAAALIPHVCSLDVTDKLGRTPLHYAAHSGHREMVNLLVCKGANVSAKDKKERQPIHWAAHLGYLEVVKLLVSHGASVTCKDKHGYTPLHVAAVSGQLDVVSYLLRLRVEPDEPNSFGNTALHMACYTGQDIVASELVNCGANLNQPSYHGNTPLHMAAASSCGVMCFELLVNNGADVSVQNKDGKTPLHIAAKYGRFTGSQILIQNGAEIDCGDTNGNTPLHIAAKYGQELLISTL 358          

HSP 2 Score: 129.028 bits (323), Expect = 7.748e-30
Identity = 69/252 (27.38%), Postives = 128/252 (50.79%), Query Frame = 2
Query:  113 REYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKT 868
             E +  +D  +  P+H A   G   ++++LI    +I A D     P+H A+ + +K+ V+LL+    ++N+RD++   P+H A  +  +     LI H C ++  DKLG  PLHYA  +G  E   LL+    ++ A+DK +++PIH A       +VKLL+ H  ++  +DK    P+H++      + V  L+  + + +  + +    +H+AC   +      LV+   ++ +    GN+PL +A  +
Sbjct:   31 NENVNAQDQEQGTPLHAASYLGDVHVMEILISSGANISAKDTGMLTPLHRAAASRNKRAVELLLKHKSEVNSRDKFWHTPLHVAAANWATSCAAALIPHVCSLDVTDKLGRTPLHYAAHSGHREMVNLLVCKGANVSAKDKKERQPIHWAAHLGYLEVVKLLVSHGASVTCKDKHGYTPLHVAAVSGQLDVVSYLLRLRVEPDEPNSFGNTALHMACYTGQDIVASELVNCGANLNQPSYHGNTPLHMAAAS 282          

HSP 3 Score: 128.642 bits (322), Expect = 1.073e-29
Identity = 74/252 (29.37%), Postives = 125/252 (49.60%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNE 877
            ++   +  + P+  A      E V  L+++N ++ A D+    P+H AS  G    +++L+S   +I+A+D     P+HRA    +   V LL+ H  ++ SRDK  + PLH A        A  LI H C ++  DK  + P+H A       +V LL+    N+ ++DK  R+PIH +      E VKLL+ H   +  +D     P+H+A  + + + V  L+    + +E + FGN+ L +A  TG +
Sbjct:    1 MDLRSITDQSPLIQAIFSRNAEDVTSLLNHNENVNAQDQEQGTPLHAASYLGDVHVMEILISSGANISAKDTGMLTPLHRAAASRNKRAVELLLKHKSEVNSRDKFWHTPLHVAAANWATSCAAALIPHVCSLDVTDKLGRTPLHYAAHSGHREMVNLLVCKGANVSAKDKKERQPIHWAAHLGYLEVVKLLVSHGASVTCKDKHGYTPLHVAAVSGQLDVVSYLLRLRVEPDEPNSFGNTALHMACYTGQD 252          

HSP 4 Score: 103.99 bits (258), Expect = 4.305e-22
Identity = 61/218 (27.98%), Postives = 109/218 (50.00%), Query Frame = 2
Query:  242 NQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            +Q P+  A  + + + V  L++ + ++NA+D+    P+H A   G   ++ +LI    +I ++D     PLH A  +      +LL+ H  ++ +RDK+   P+H A           LI H C+++  DK  R P+H +      E V LL+    ++ A+D  +++PIH A +    E VK+LV H   +   D+ G +PL +A  +G   ++  L
Sbjct:    8 DQSPLIQAIFSRNAEDVTSLLNHNENVNAQDQEQGTPLHAASYLGDVHVMEILISSGANISAKDTGMLTPLHRAAASRNKRAVELLLKHKSEVNSRDKFWHTPLHVAAANWATSCAAALIPHVCSLDVTDKLGRTPLHYAAHSGHREMVNLLVCKGANVSAKDKKERQPIHWAAHLGYLEVVKLLVSHGASVTCKDKHGYTPLHVAAVSGQLDVVSYL 225          

HSP 5 Score: 88.9669 bits (219), Expect = 1.879e-17
Identity = 72/311 (23.15%), Postives = 125/311 (40.19%), Query Frame = 2
Query:  110 KREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGH----SGIVN------------------------------LLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSC----SGCCTETVKLLID-----------------HKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNE 877
            K   +  +D  +++PIH A   G  E+VKLL+ +   +   DK    P+H A+ +G    V  L+ L  + +  + +    +H AC  G     S +VN                              LL+++  D+  ++K G  PLH A K GR   +++LI +  +I+  D     P+H A +Y +  ++  L+ +  +   +      P+HL+       CC    KLL                    + DI   D   +  +H A +    E + +L++   +++  D  G SPL  A   GN 
Sbjct:  162 KGANVSAKDKKERQPIHWAAHLGYLEVVKLLVSHGASVTCKDKHGYTPLHVAAVSGQLDVVSYLLRLRVEPDEPNSFGNTALHMACYTGQDIVASELVNCGANLNQPSYHGNTPLHMAAASSCGVMCFELLVNNGADVSVQNKDGKTPLHIAAKYGRFTGSQILIQNGAEIDCGDTNGNTPLHIAAKYGQELLISTLLTNGADKNRQGIHGMLPLHLAALCGFPDCCR---KLLSSGHFYNSMPSAVGSPSSGEELDINMSDDHGRTALHAAASGGNVECLNLLLNCGAELDIKDILGRSPLHYAAANGNS 469          

HSP 6 Score: 71.2478 bits (173), Expect = 5.158e-12
Identity = 65/286 (22.73%), Postives = 122/286 (42.66%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRAC--------------------EHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLL--IDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARD---WWDQRPIHLACNAKRTETVKILVD--HHCDIEEC-DQFGNSPLEIAMKTGNEGLIHIL 895
            +   D + +  +H A   G  E + LL++   +++  D   + P+HYA+ NG+ +    LV    ++N  D     P+H A                     EH     ++ L+D+  D   ++  GY  +HYA   G  +  +LL  I  +C  EA       P+H A  Y     + LL +   +++ RD   +  +HL+     ++ V++L++H      R+    W    +H A    + + + +LV+   + D+ +  D  G + L +A    +   +HIL
Sbjct:  416 INMSDDHGRTALHAAASGGNVECLNLLLNCGAELDIKDILGRSPLHYAAANGNSQCTVSLVRAGAEVNDADLMGCSPLHYAAASHAFCGGETVSGSSLSEEKEHEAYLCLDYLLDNGVDPTLKNCRGYSAVHYAAACGNKQHLELLLEISFNCLEEAESNIPVSPLHLAAYYGHCEALGLLCETLVSLDVRDIQGQTALHLAAQRGFSQCVEVLLEHGASYGLREHKRRWTA--LHAAAAEGQVDCLLLLVNCKQNVDVVDSQDTQGRTALMLAALGCHTDCVHIL 699          

HSP 7 Score: 64.3142 bits (155), Expect = 6.267e-10
Identity = 66/294 (22.45%), Postives = 113/294 (38.44%), Query Frame = 2
Query:  134 DLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTV-KLLVSLH-----------------CDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCAC--------------------EYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLL--IDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            D N   P+H A + GQ  ++  L+    D          P+H A+  G      KLL S H                  DIN  D+  R  +H A   G+   +NLL++   +++ +D LG  PLHYA   G ++    L+    ++   D     P+H A                     E+E    +  L+D+  +   ++      +H + +    + ++LL  I   C  EA       P+HLA      E + +L +    ++  D  G + L +A + G    + +L
Sbjct:  336 DTNGNTPLHIAAKYGQELLISTLLTNGADKNRQGIHGMLPLHLAALCGFPDCCRKLLSSGHFYNSMPSAVGSPSSGEELDINMSDDHGRTALHAAASGGNVECLNLLLNCGAELDIKDILGRSPLHYAAANGNSQCTVSLVRAGAEVNDADLMGCSPLHYAAASHAFCGGETVSGSSLSEEKEHEAYLCLDYLLDNGVDPTLKNCRGYSAVHYAAACGNKQHLELLLEISFNCLEEAESNIPVSPLHLAAYYGHCEALGLLCETLVSLDVRDIQGQTALHLAAQRGFSQCVEVL 629          

HSP 8 Score: 53.5286 bits (127), Expect = 1.454e-6
Identity = 51/261 (19.54%), Postives = 110/261 (42.15%), Query Frame = 2
Query:  116 EYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKL----GYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCAC--EYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILV-DHHCDIEECDQFGNSPLEIAMKTGNE 877
            + ++ +D   +  +  A     T+ V +L++   + +A DK     +H  +  G ++    L+        RD   R P+H A   GH+ ++  L+      +  D +     Y P H+A   G      +L+++      ++     P+HCA    ++ A ++ +       +  +D   R P+H +        ++LL+    ++ A D + +  + +A +  +T  V+ L+   + D+   D   N+ L +A   G+E
Sbjct:  671 DVVDSQDTQGRTALMLAALGCHTDCVHILLEKKANPDAADKKGFTALHRVAMLGSEECESALLEHGASALCRDFQGRTPLHLAASCGHTKLLGALLKAARKADPLDSMLDFRSYTPTHWAAYHGHEGCLHVLLENRI-FSNQEGNPFTPLHCALVGGFDAAAVLLVKAAGPQIVNKKDAKGRSPLHAAAHSGSVAGLQLLLTCGAEVNAVDHFGRSALMVAADCGQTMAVEFLLHKANPDLSLVDANNNTALHLACNKGHE 930          

HSP 9 Score: 53.1434 bits (126), Expect = 1.623e-6
Identity = 60/302 (19.87%), Postives = 117/302 (38.74%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDI---EALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWD---RVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDH-------------------------------HCNIESRDKWNRR-----PIHLSCSGCCTETVKLLIDHKCD--IEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHIL 895
            L+  D+  +  +H A +RG ++ V++L+++       E   +W    +H A+  G    + LLV+   +++  D  D   R  +  A    H+  V++L++   + ++ DK G+  LH     G  E    L++H      RD   + P+H A       ++  L+                                 H  +E+R   N+      P+H +  G       LL+       +  +D   + P+H A ++     +++L+    ++   D FG S L +A   G    +  L
Sbjct:  603 LDVRDIQGQTALHLAAQRGFSQCVEVLLEHGASYGLREHKRRWTA--LHAAAAEGQVDCLLLLVNCKQNVDVVDSQDTQGRTALMLAALGCHTDCVHILLEKKANPDAADKKGFTALHRVAMLGSEECESALLEHGASALCRDFQGRTPLHLAASCGHTKLLGALLKAARKADPLDSMLDFRSYTPTHWAAYHGHEGCLHVLLENRIFSNQEGNPFTPLHCALVGGFDAAAVLLVKAAGPQIVNKKDAKGRSPLHAAAHSGSVAGLQLLLTCGAEVNAVDHFGRSALMVAADCGQTMAVEFL 902          
BLAST of SMED30005028 vs. Planmine SMEST
Match: SMESG000017098.1 (SMESG000017098.1)

HSP 1 Score: 555.829 bits (1431), Expect = 0.000e+0
Identity = 267/285 (93.68%), Postives = 274/285 (96.14%), Query Frame = 2
Query:   50 YQCFIRAIRGGSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHILNGV 904
            +Q F+  I+ GS +LF ++FK EYLERE  + KRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHILNG 
Sbjct:    5 FQLFMDTIKSGSAELFRKYFKEEYLEREVRDMKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHILNGT 289          

HSP 2 Score: 159.458 bits (402), Expect = 6.801e-42
Identity = 99/117 (84.62%), Postives = 101/117 (86.32%), Query Frame = 3
Query: 2313 TRLLRACKNGNLQKVSSLLNGTVIEYSDEDKRRPIHWACESGXXXXXXXXXXXXCDLTARDKSNISPLDIAIRKSNKKLVRILKAAAKEQKLV*VSDNL------HRLKLQLPASLP 2645
            TRLLRACKNGNLQKVSSLLNGTVIEYSDEDKRRPIHWACESGKTKIVKLLIKTKCDLTARDKSNISPLDIAIRKSNKKLVRILKAAAKEQKLV   D L      HR   ++P   P
Sbjct:  289 TRLLRACKNGNLQKVSSLLNGTVIEYSDEDKRRPIHWACESGKTKIVKLLIKTKCDLTARDKSNISPLDIAIRKSNKKLVRILKAAAKEQKLV---DRLLSLITTHRKMFRIPGISP 402          

HSP 3 Score: 66.6254 bits (161), Expect = 4.182e-11
Identity = 33/81 (40.74%), Postives = 49/81 (60.49%), Query Frame = 2
Query:   59 FIRAIRGGSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLL 301
             +RA + G+++          +E  D +K+RPIH ACE G+T+IVKLLI   CD+ A DK N  P+  A +  +KK V++L
Sbjct:  291 LLRACKNGNLQKVSSLLNGTVIEYSDEDKRRPIHWACESGKTKIVKLLIKTKCDLTARDKSNISPLDIAIRKSNKKLVRIL 371          
BLAST of SMED30005028 vs. Planmine SMEST
Match: SMESG000017098.1 (SMESG000017098.1)

HSP 1 Score: 549.666 bits (1415), Expect = 0.000e+0
Identity = 267/284 (94.01%), Postives = 274/284 (96.48%), Query Frame = 2
Query:   50 YQCFIRAIRGGSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHILNG 901
            +Q F+  I+ GS +LF ++FK EYLERE  + KRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHILNG
Sbjct:    5 FQLFMDTIKSGSAELFRKYFKEEYLEREVRDMKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHILNG 288          
BLAST of SMED30005028 vs. Planmine SMEST
Match: SMESG000017098.1 (SMESG000017098.1)

HSP 1 Score: 472.241 bits (1214), Expect = 8.025e-160
Identity = 236/284 (83.10%), Postives = 242/284 (85.21%), Query Frame = 2
Query:   50 YQCFIRAIRGGSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHILNG 901
            +Q F+  I+ GS +LF ++FK EYLERE                                   WNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHILNG
Sbjct:    5 FQLFMDTIKSGSAELFRKYFKEEYLERE-----------------------------------WNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHILNG 253          
BLAST of SMED30005028 vs. Planmine SMEST
Match: SMESG000017084.1 (SMESG000017084.1)

HSP 1 Score: 316.235 bits (809), Expect = 2.249e-94
Identity = 163/319 (51.10%), Postives = 207/319 (64.89%), Query Frame = 2
Query:   47 HYQCFIRAIRGGSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEI---------------------------------VKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHILNGV 904
             ++ F+ AI  GS +LF R+FK EYLERED    R IHHAC +G +E+                                 VKLLI++NCDIEALD W QRPIH+A   GH + VKLL+  +CDI A D W+  PIH AC HGHS  + LLI+H+CDIE+ +    RP+H AC  G +E  KLLI++ CDIEA D W+QRPIH AC +  +  +KLLI+H C+IE+ D   +RPIHL+C    +E VKLLIDHKCDIEA DW +QRPIHLAC+   +E VK+L+DH C+IE  D  G+SPL +A KTGN+G+I ILNG 
Sbjct:    4 QFELFMEAIISGSTELFGRYFKAEYLEREDTKGWRSIHHACYQGHSEVIKLLITHNCDIETHDEDDQRPIHLACYQRHSEAVKLLIEHNCDIEALDGWKQRPIHHACYQGHSEAVKLLIEHNCDIEALDGWNWRPIHIACYHGHSEAIKLLIEHNCDIEALNGWNRRPIHLACDQGHSEAVKLLIENKCDIEALDIWNQRPIHLACYHGNSEAIKLLIEHKCDIEALDWQKQRPIHLACYQGRSEAVKLLIDHKCDIEALDWLNQRPIHLACDQGYSEAVKLLIDHKCNIEALDGNGDSPLALAEKTGNKGIICILNGA 322          

HSP 2 Score: 249.21 bits (635), Expect = 3.066e-70
Identity = 142/314 (45.22%), Postives = 183/314 (58.28%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARD-------------------------------------------------WWDQ---RPIHLACNAKRTETVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHILNGVI 907
            +E  D  K+RPIHHAC +G +E VKLLI++NCDIEALD WN RPIH A  +GH + +KLL+  +CDI A + W+R PIH AC+ GHS  V LLI++ CDIE+ D    RP+H AC  G +E  KLLI+H CDIEA D   QRPIH AC   R+  VKLLIDH C+IE+ D  N+RPIHL+C    +E VKLLIDHKC+IEA D                                                 ++D+   RPIH AC +   E VK+L+  +CDI   D+  +SP +IA+K  N+ L+ I+   I
Sbjct:   95 IEALDGWKQRPIHHACYQGHSEAVKLLIEHNCDIEALDGWNWRPIHIACYHGHSEAIKLLIEHNCDIEALNGWNRRPIHLACDQGHSEAVKLLIENKCDIEALDIWNQRPIHLACYHGNSEAIKLLIEHKCDIEALDWQKQRPIHLACYQGRSEAVKLLIDHKCDIEALDWLNQRPIHLACDQGYSEAVKLLIDHKCNIEALDGNGDSPLALAEKTGNKGIICILNGARLLLACKDGNVEKVSSLLSDTTIEYYDKDKRRPIHWACESGNIEIVKLLIKTNCDITVRDKSNSSPFDIAVKNDNKELVEIVKCAI 408          

HSP 3 Score: 113.62 bits (283), Expect = 2.108e-25
Identity = 67/117 (57.26%), Postives = 83/117 (70.94%), Query Frame = 3
Query: 2313 TRLLRACKNGNLQKVSSLLNGTVIEYSDEDKRRPIHWACESGXXXXXXXXXXXXCDLTARDKSNISPLDIAIRKSNKKLVRILKAAAKEQKLV*VSDNLHRLKLQLPASLPTSENKC 2663
             RLL ACK+GN++KVSSLL+ T IEY D+DKRRPIHWACESG  +IVKLLIKT CD+T RDKSN SP DIA++  NK+LV I+K A  +Q+        H L+ Q+     T E+ C
Sbjct:  322 ARLLLACKDGNVEKVSSLLSDTTIEYYDKDKRRPIHWACESGNIEIVKLLIKTNCDITVRDKSNSSPFDIAVKNDNKELVEIVKCAILDQQ------QKHELEQQISTMRLTCESGC 432          

HSP 4 Score: 63.5438 bits (153), Expect = 6.542e-10
Identity = 37/108 (34.26%), Postives = 55/108 (50.93%), Query Frame = 2
Query:   59 FIRAIRGGSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDR--VPIHRACEHG 376
             + A + G+++          +E  D +K+RPIH ACE G  EIVKLLI  NCDI   DK N  P   A +N +K+ V+++     D   + E ++    +   CE G
Sbjct:  324 LLLACKDGNVEKVSSLLSDTTIEYYDKDKRRPIHWACESGNIEIVKLLIKTNCDITVRDKSNSSPFDIAVKNDNKELVEIVKCAILDQQQKHELEQQISTMRLTCESG 431          
BLAST of SMED30005028 vs. Planmine SMEST
Match: SMESG000017030.1 (SMESG000017030.1)

HSP 1 Score: 314.309 bits (804), Expect = 9.736e-94
Identity = 167/318 (52.52%), Postives = 208/318 (65.41%), Query Frame = 2
Query:   44 EHYQCFIRAIRGGSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRDKWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKILVD---------------------------------HHCDIEECDQFGNSPLEIAMKTGNEGLIHILN 898
            + ++ FI AIR GS +LF R+FK E+LERED N  RPIHHAC  G +E VKLLI++ CDIEALD    RPIH A  +GH + +KLL+   CDI A D W++ PIH AC HGHS  V LLI+H CDIE+ D+  +RP+HYAC  G +E  KLLI+H C+IEA DKW+QRPIH A     +  +KLLI+H CNIE+ D  N RPIHL+C+   +E VKLLI+HKCDIEA DWW+QRPIHLAC   R+E VK+L+D                                 H CDIE  D+ GNS +EIA K+GN+ +I ILN
Sbjct:    3 QEFELFIDAIRSGSAELFDRYFKAEFLEREDANGWRPIHHACYHGNSEAVKLLIEHKCDIEALD---IRPIHLACYHGHSEAIKLLIEHKCDIEALDWWNQRPIHLACNHGHSEAVKLLIEHKCDIEALDEDNWRPIHYACNHGHSEAIKLLIEHECNIEALDKWNQRPIHYAINKRHSEAIKLLIEHECNIEALDGANWRPIHLACNHGHSEAVKLLIEHKCDIEALDWWNQRPIHLACYQGRSEAVKLLIDHKCDIEALDWRNRRPIHLACYHGHSEAVKLLTEHKCDIEALDEDGNSAVEIAEKSGNKIIIRILN 317          

HSP 2 Score: 199.519 bits (506), Expect = 2.731e-53
Identity = 117/277 (42.24%), Postives = 149/277 (53.79%), Query Frame = 2
Query:  122 LEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARDEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRD----------------------------------------------------KWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTETVKIL 796
            +E  D +  RPIH+AC  G +E +KLLI++ C+IEALDKWNQRPIHYA    H + +KLL+   C+I A D  +  PIH AC HGHS  V LLI+H CDIE+ D    RP+H AC  GR+E  KLLIDH CDIEA D  ++RPIH AC +  +  VKLL +H C+IE+ D                                                    K  RRPIH +C     E VKLLI+ KCD+ ARD  +  P+ +A   +  E V+IL
Sbjct:  125 IEALDEDNWRPIHYACNHGHSEAIKLLIEHECNIEALDKWNQRPIHYAINKRHSEAIKLLIEHECNIEALDGANWRPIHLACNHGHSEAVKLLIEHKCDIEALDWWNQRPIHLACYQGRSEAVKLLIDHKCDIEALDWRNRRPIHLACYHGHSEAVKLLTEHKCDIEALDEDGNSAVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDLTARDKCEMSPLDIAVKNENKELVEIL 401          

HSP 3 Score: 105.531 bits (262), Expect = 5.860e-23
Identity = 59/90 (65.56%), Postives = 72/90 (80.00%), Query Frame = 3
Query: 2310 QTRLLRACKNGNLQKVSSLLNGTVIEYSDEDKRRPIHWACESGXXXXXXXXXXXXCDLTARDKSNISPLDIAIRKSNKKLVRILKAAAKE 2579
            + RLL ACKNG+L+ VS L+NG+ IE  D++KRRPIHWACESG  +IVKLLI+ KCDLTARDK  +SPLDIA++  NK+LV ILKA   E
Sbjct:  318 EARLLLACKNGDLKNVSKLVNGSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDLTARDKCEMSPLDIAVKNENKELVEILKAEELE 407          

HSP 4 Score: 61.2326 bits (147), Expect = 3.506e-9
Identity = 33/81 (40.74%), Postives = 47/81 (58.02%), Query Frame = 2
Query:   59 FIRAIRGGSIKLFHRFFKREYLEREDLNKKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLL 301
             + A + G +K   +      +E  D NK+RPIH ACE G  EIVKLLI+  CD+ A DK    P+  A +N +K+ V++L
Sbjct:  321 LLLACKNGDLKNVSKLVNGSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDLTARDKCEMSPLDIAVKNENKELVEIL 401          
The following BLAST results are available for this feature:
BLAST of SMED30005028 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANKRD441.236e-3027.84ankyrin repeat domain 44 [Source:HGNC Symbol;Acc:H... [more]
ANKRD442.168e-2927.84ankyrin repeat domain 44 [Source:HGNC Symbol;Acc:H... [more]
ANKRD283.768e-2929.41ankyrin repeat domain 28 [Source:HGNC Symbol;Acc:H... [more]
ANKRD283.768e-2929.41ankyrin repeat domain 28 [Source:HGNC Symbol;Acc:H... [more]
ANKRD441.426e-2827.84ankyrin repeat domain 44 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of SMED30005028 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-448.631e-2427.02AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-448.631e-2427.02AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.148e-2327.02AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.148e-2327.02AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.543e-2327.02AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of SMED30005028 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank25.529e-2927.82gene:FBgn0261788 transcript:FBtr0334062[more]
Ank27.232e-2827.82gene:FBgn0261788 transcript:FBtr0303120[more]
Tnks3.521e-2525.94gene:FBgn0027508 transcript:FBtr0084890[more]
Ank21.713e-2426.32gene:FBgn0261788 transcript:FBtr0303119[more]
Ank22.475e-2426.32gene:FBgn0261788 transcript:FBtr0334061[more]
back to top
BLAST of SMED30005028 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ankrd52a2.882e-2927.44ankyrin repeat domain 52a [Source:NCBI gene;Acc:55... [more]
ankrd52a3.212e-2927.44ankyrin repeat domain 52a [Source:NCBI gene;Acc:55... [more]
ankrd28b1.400e-2828.92ankyrin repeat domain 28b [Source:ZFIN;Acc:ZDB-GEN... [more]
ankrd28b1.400e-2828.92ankyrin repeat domain 28b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1b2.532e-2725.40ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of SMED30005028 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rev13.847e-2928.46REV1, DNA directed polymerase [Source:Xenbase;Acc:... [more]
rev14.112e-2928.46REV1, DNA directed polymerase [Source:Xenbase;Acc:... [more]
rev14.130e-2928.46REV1, DNA directed polymerase [Source:Xenbase;Acc:... [more]
rev14.160e-2928.46REV1, DNA directed polymerase [Source:Xenbase;Acc:... [more]
rev14.268e-2928.46REV1, DNA directed polymerase [Source:Xenbase;Acc:... [more]
back to top
BLAST of SMED30005028 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ankrd289.288e-3029.41ankyrin repeat domain 28 [Source:MGI Symbol;Acc:MG... [more]
Ankrd289.400e-3029.41ankyrin repeat domain 28 [Source:MGI Symbol;Acc:MG... [more]
Ankrd447.155e-2927.84ankyrin repeat domain 44 [Source:MGI Symbol;Acc:MG... [more]
Ankrd447.829e-2927.84ankyrin repeat domain 44 [Source:MGI Symbol;Acc:MG... [more]
Tnks2.480e-2727.59tankyrase, TRF1-interacting ankyrin-related ADP-ri... [more]
back to top
BLAST of SMED30005028 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q505D1|ANR28_MOUSE6.576e-2929.41Serine/threonine-protein phosphatase 6 regulatory ... [more]
sp|Q5UPG5|YL093_MIMIV1.429e-2829.52Putative ankyrin repeat protein L93 OS=Acanthamoeb... [more]
sp|O15084|ANR28_HUMAN1.809e-2829.41Serine/threonine-protein phosphatase 6 regulatory ... [more]
sp|Q502K3|ANR52_DANRE2.225e-2827.44Serine/threonine-protein phosphatase 6 regulatory ... [more]
sp|B2RXR6|ANR44_MOUSE5.476e-2827.84Serine/threonine-protein phosphatase 6 regulatory ... [more]
back to top
BLAST of SMED30005028 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1X7T5X63.228e-4940.00Uncharacterized protein OS=Amphimedon queenslandic... [more]
A0A1Y1VDP13.147e-4835.27ANK_REP_REGION domain-containing protein OS=Piromy... [more]
A0A1V5PQL81.518e-4535.86Phosphocholine transferase AnkX OS=bacterium ADurb... [more]
A0A5A8DVR91.058e-4435.62ANK_REP_REGION domain-containing protein OS=Cafete... [more]
A0A5A8DXK53.966e-4437.69ANK_REP_REGION domain-containing protein OS=Cafete... [more]
back to top
BLAST of SMED30005028 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ankrd449.565e-2927.45ankyrin repeat domain 44 [Source:ZFIN;Acc:ZDB-GENE... [more]
ankrd441.416e-2827.45ankyrin repeat domain 44 [Source:ZFIN;Acc:ZDB-GENE... [more]
ank1a5.770e-2825.88ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GEN... [more]
ENSAMXT00000048191.11.405e-2725.68pep primary_assembly:Astyanax_mexicanus-2.0:15:310... [more]
tnksa2.367e-2726.96tankyrase, TRF1-interacting ankyrin-related ADP-ri... [more]
back to top
BLAST of SMED30005028 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000093.12.018e-3028.15pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
ENSPMAT00000003991.12.266e-3029.41pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1... [more]
ENSPMAT00000007954.13.359e-2927.18pep scaffold:Pmarinus_7.0:GL479092:583:36301:1 gen... [more]
ENSPMAT00000000095.11.656e-2727.78pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
ENSPMAT00000007449.13.254e-2725.91pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1... [more]
back to top
BLAST of SMED30005028 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PHO812.690e-923.35Cyclin-dependent kinase (CDK) inhibitor; regulates... [more]
GDE13.501e-927.57Glycerophosphocholine (GroPCho) phosphodiesterase;... [more]
AKR11.041e-825.25Palmitoyl transferase involved in protein palmitoy... [more]
AVO29.547e-830.22Component of a complex containing the Tor2p kinase... [more]
NAS65.876e-725.00Evolutionarily conserved 19S regulatory particle a... [more]
back to top
BLAST of SMED30005028 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO494852.004e-1928.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO427803.491e-1629.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387029.889e-1630.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391122.253e-1526.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387255.327e-1528.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30005028 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ankrd52a3.615e-3229.88serine/threonine-protein phosphatase 6 regulatory ... [more]
ENSORLT00000018386.27.553e-3229.32serine/threonine-protein phosphatase 6 regulatory ... [more]
ENSORLT00000027359.17.728e-3229.32serine/threonine-protein phosphatase 6 regulatory ... [more]
ENSORLT00000036677.17.728e-3229.32serine/threonine-protein phosphatase 6 regulatory ... [more]
ENSORLT00000036692.18.466e-3229.32serine/threonine-protein phosphatase 6 regulatory ... [more]
back to top
BLAST of SMED30005028 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017098.16.801e-4293.68SMESG000017098.1[more]
SMESG000017098.10.000e+094.01SMESG000017098.1[more]
SMESG000017098.18.025e-16083.10SMESG000017098.1[more]
SMESG000017084.12.249e-9451.10SMESG000017084.1[more]
SMESG000017030.19.736e-9452.52SMESG000017030.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005028 ID=SMED30005028|Name=SMED30005028|organism=Schmidtea mediterranea sexual|type=transcript|length=3153bp
GTAAATTGTTATTTTGATTAATATTTTTATCATGTCAAATAGCGAGCATT
ATCAATGCTTTATACGCGCAATCAGAGGGGGATCAATAAAATTATTCCAC
AGATTTTTCAAAAGAGAATATTTGGAACGAGAGGACTTGAATAAGAAGCG
GCCAATTCATCACGCATGTGAACGTGGGCAGACAGAAATTGTGAAATTAC
TTATTGATTACAATTGTGATATTGAGGCACTTGATAAGTGGAATCAGCGG
CCAATTCATTATGCGAGTCAAAATGGGCACAAAAAAACAGTCAAACTTCT
GGTTTCCCTTCATTGTGATATTAATGCACGCGATGAGTGGGATCGGGTGC
CAATTCATCGCGCATGTGAGCATGGGCATTCAGGAATTGTAAACTTACTT
ATTGATCACCATTGTGATATCGAGTCACGTGATAAGTTGGGTTATCGACC
CTTACATTATGCGTGTAAGGCAGGGCGCGCAGAAACTGCAAAACTGCTGA
TTGATCACCACTGTGATATTGAGGCACGTGATAAGTGGGATCAGCGGCCA
ATTCATTGTGCATGTGAGTATGAGCGTGCTGGAATCGTAAAATTACTTAT
TGATCACCATTGTAATATCGAGTCACGTGATAAGTGGAATCGGCGCCCAA
TTCATCTCTCATGTAGTGGATGTTGCACTGAAACAGTCAAACTTTTGATT
GATCACAAATGTGATATCGAAGCCCGAGATTGGTGGGATCAGCGGCCAAT
TCATCTCGCCTGCAATGCAAAACGCACAGAAACAGTCAAAATACTGGTTG
ATCATCATTGTGATATTGAGGAATGTGACCAATTTGGTAATTCACCGCTG
GAAATTGCTATGAAAACGGGCAATGAAGGACTTATTCATATTCTGAACGG
GGTAATTTATGTCAGCTGTAATTAGATTTGACTATCAGGAATGACTCAGG
AACAATGATTGAGATACGAATATAGAAGGAAGATGAGGATAGGTAACAAT
GAGATTGAATGTAACTGACGGTGGAATAACAATGATAAACCAAAATTGGG
CTTTGGGTTGAGCTATAAGATTGATGTTTTTGATGATGATGATCTGGAGC
TTTGATCGTCTTTGATTGGGTTTTAATGGCTCAAAAACAGAAACGTAGGT
AGATTCGAGTCCCTCGTGTTACCCTTAACGCACTGGTTAGCAACCAAGCT
TCCTTCCCTCTAGCGACACTCAAAACGGAGATTATTTATTTTTATTGATT
TAAAAGTGCAATTATTGATTTTTAAGTCGAATTTTTTTCGAAAACAATTC
AAGTATTGATTTAAATGTGCGATTATTGATTTTAAAAAAAGTACAAAAGT
GGAATTTTTTAAGTGAAAATTTACTTTTGTTTTATTGCGCTAAAGCGCTG
GGATTTGAAATTTTTCTGATAATCAGCTGTAATTGGGTCCCAATTGCTGG
TAACCTTGCAAATAAATAAAATACTATATCCATTTACCATATAATATTAC
AGATGAATAAAACCCGTTAAAGCATGAGAACTGTATGTGGAACTTGACAT
TTGTTTTTTTACTGATGTAGGCATAGGACATGATAAAACTGACATAAATA
TAGAAATTAAAGGTCAGACCATCACCACTGTGTTTAGCATAACGCACTCC
ATTTGTACACAAACATAAATGTTTTAAACTCTTGAAGCTCTAACCATTTT
ATTAGGTAGCAAAACTGTTAGTGTGCAAAATATTCAAATTTTCATATTGT
CCTTAAAATTTGAAACATTCTAATGTAATTGGTTATAAAACTTATAAAAC
ATATCATTAAGGTCTGATCCTCTACCCACTCAGGGTGATGGTATTCCCTT
AAACGGCTCTCGTGAAATGTGCCTGAAATATAAACTTTATTGTCTTTATC
ATCAAATATCCGAACCTCTTACTCTTAAGCTTTCTGAATCGATATCGCCA
TCTGTTACATACAATCTCATAGTTTCCTTCTTTATTTCTATCTCAATCTC
AAAGTCTCCATCATAGAAATAATTCTATCCAAGCAAACGAATCGTTTCCA
GTCAAGATCATCGCTATTTTCCTTTTACATGTTCTACCTTTCAATTTCCT
CAGCATTATTCATCTTTTATCCCTCTCCATTACTTTAGGTAAAGTAATAT
GATTTTTGAACCATTCTTATGACTCTCTGTATGACTTAACACAAACAGGG
TTATTACTTGGGATTCATTCAAATCCGAGGGCCCCTCACTAATAATATAT
TGCATTTTATTACTTTCTCTATCATTTCTATTTCCCTGTCGGTTTTATTT
ATTCGCATTCAGACTAGATTGCTACGGGCATGTAAAAATGGGAACTTGCA
GAAGGTTTCCTCGTTGCTAAACGGTACTGTCATTGAATACAGTGATGAGG
ACAAAAGGCGCCCAATTCATTGGGCGTGTGAGAGCGGCAAAACTAAAATT
GTCAAATTACTGATTAAAACAAAATGTGATCTTACTGCAAGAGATAAATC
TAATATTTCCCCCTTGGACATTGCTATAAGGAAAAGTAATAAAAAGCTTG
TGAGAATTCTGAAGGCAGCGGCAAAAGAACAGAAGCTGGTGTAAGTGTCA
GATAATCTGCACCGATTAAAACTTCAACTGCCTGCCTCTCTTCCAACATC
GGAAAATAAATGCCTTGAAAATGAGTCCATTTTGACTTTTCGTTCGCCAA
ATTTATTATTTTTATTTTTCCAGTGATATGTTTTACAGCGAGTGCGTTGA
AATCCTTTGACAATCTACCATTGTTACTAATTTAACTTCATGGTCACTAA
AGTAGCCATCATTTGTAACCATCATTGCCGTCTATAAATCCGATCAGTAT
TCTCTTTTCAACGACGTTTAAACCCAGTTAATTTAAAATTCTTAGATTGA
TGTAGGTTACGGAGCTGGCATCATCTAACAGAGCGCTCACTTTTATTTTC
TTGTTCCCATTTTCTAGATAGATTGGGATTGTCCTTAAACTGAGGTAAGA
TCTCGTATTCCTCTCTTTTATAACTTTCCGCGTCAACATTGTGTTGCTCC
CCTTTTCATGCTCCGCATTTCCTTGTTTGTCGTGTAACATCTCATTGTGG
TTTTTGTTAGATCCGTTTACCTTGCAGAAGGATCTTTTTGGACAATCGTT
AGC
back to top

protein sequence of SMED30005028-orf-1

>SMED30005028-orf-1 ID=SMED30005028-orf-1|Name=SMED30005028-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=298bp
MSNSEHYQCFIRAIRGGSIKLFHRFFKREYLEREDLNKKRPIHHACERGQ
TEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINAR
DEWDRVPIHRACEHGHSGIVNLLIDHHCDIESRDKLGYRPLHYACKAGRA
ETAKLLIDHHCDIEARDKWDQRPIHCACEYERAGIVKLLIDHHCNIESRD
KWNRRPIHLSCSGCCTETVKLLIDHKCDIEARDWWDQRPIHLACNAKRTE
TVKILVDHHCDIEECDQFGNSPLEIAMKTGNEGLIHILNGVIYVSCN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003824catalytic activity
Vocabulary: biological process
TermDefinition
GO:0009116nucleoside metabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 201..230
e-value: 4.8
score: 16.2
coord: 36..65
e-value: 0.16
score: 21.0
coord: 3..32
e-value: 0.0019
score: 27.5
coord: 135..164
e-value: 2.6
score: 17.0
coord: 69..98
e-value: 0.092
score: 21.9
coord: 234..263
e-value: 3300.0
score: 1.1
coord: 102..131
e-value: 0.0012
score: 28.1
coord: 168..197
e-value: 21.0
score: 14.0
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 36..68
score: 10.633
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 102..134
score: 11.861
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 3..35
score: 11.247
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 69..101
score: 9.938
NoneNo IPR availablePFAMPF13857Ank_5coord: 188..242
e-value: 2.5E-7
score: 30.8
NoneNo IPR availablePFAMPF13637Ank_4coord: 104..156
e-value: 8.6E-10
score: 39.0
NoneNo IPR availablePANTHERPTHR24188ANKYRIN REPEAT PROTEINcoord: 39..177
coord: 6..104
coord: 73..244
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 6..67
e-value: 7.4E-13
score: 48.9
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 3..254
score: 63.162
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 2..109
e-value: 5.6E-34
score: 119.3
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 110..257
e-value: 1.7E-42
score: 147.3
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 6..254