ATP synthase subunit alpha

Overview
NameATP synthase subunit alpha
Smed IDSMED30005014
Length (bp)1790
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ATP synthase subunit alpha (SMED30005014) t-SNE clustered cells

Violin plots show distribution of expression levels for ATP synthase subunit alpha (SMED30005014) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ATP synthase subunit alpha (SMED30005014) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ATP synthase subunit alpha (SMED30005014) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005014

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30005014h1SMcG0021989 dd_Smed_v4_731_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30005014h1SMcG0021989 dd_Smed_v4_731_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30005014h1SMcG0021989 dd_Smed_v4_731_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005014h1SMcG0021989 dd_Smed_v4_731_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30005014h1SMcG0021989 dd_Smed_v4_731_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30005014h1SMcG0021989 dd_Smed_v4_731_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005014h1SMcG0021989 dd_Smed_v4_731_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30005014h1SMcG0021989 dd_Smed_v4_731_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005014h1SMcG0021989 Contig48848uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005014h1SMcG0021989 Contig48848newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 2 cellSMED30005014h1SMcG0021989 dd_Smed_v6_731_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx progenitor cellSMED30005014h1SMcG0021989 dd_Smed_v6_731_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ATP synthase subunit alpha vs. Ensembl Human
Match: ATP5F1A (ATP synthase F1 subunit alpha [Source:HGNC Symbol;Acc:HGNC:823])

HSP 1 Score: 899.427 bits (2323), Expect = 0.000e+0
Identity = 436/520 (83.85%), Postives = 478/520 (91.92%), Query Frame = 3
Query:  132 ARQIHVSSSL--NAEIPEVTSILESAIMGQSSQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFEQDYLKYFLANHQDLLKNIREAGVISEETDTKMKQIVTDFIKDFE 1685
            AR  H S++        E++SILE  I+G  + V+LEETGRVLSIGDGIARV+GL+N+QAEEMVEFSSGLKGM+LNLE DNVGVVVFGNDKLIKEGD+VKRTGAIVDVP+G+ELLGRVVDALGN IDGKGP+    R RVGLKAPGIIPR SV+EPMQTG+KAVDSLVPIGRGQRELIIGDRQTGKT+IAIDTIINQKRFNDG+DEKKKLYCIYVAIGQKRSTVAQLVKRL++ADAMKYTIVVSATASDAAPLQYL+PYSGC+MGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKM+D +GGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQT+AMKQVAG MKLELAQYREVAAFAQFGSDLDA+TQQLL+RGVRLTELLKQGQY PMAIE+Q+ VIYAGVRGYLDK++PSKITKFE  +L + ++ HQ LL  IR  G ISE++D K+K+IVT+F+  FE
Sbjct:   33 ARNFHASNTHLQKTGTAEMSSILEERILGADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKTRRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVVSQHQALLGTIRADGKISEQSDAKLKEIVTNFLAGFE 552          
BLAST of ATP synthase subunit alpha vs. Ensembl Human
Match: ATP5F1A (ATP synthase F1 subunit alpha [Source:HGNC Symbol;Acc:HGNC:823])

HSP 1 Score: 899.427 bits (2323), Expect = 0.000e+0
Identity = 436/520 (83.85%), Postives = 478/520 (91.92%), Query Frame = 3
Query:  132 ARQIHVSSSL--NAEIPEVTSILESAIMGQSSQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFEQDYLKYFLANHQDLLKNIREAGVISEETDTKMKQIVTDFIKDFE 1685
            AR  H S++        E++SILE  I+G  + V+LEETGRVLSIGDGIARV+GL+N+QAEEMVEFSSGLKGM+LNLE DNVGVVVFGNDKLIKEGD+VKRTGAIVDVP+G+ELLGRVVDALGN IDGKGP+    R RVGLKAPGIIPR SV+EPMQTG+KAVDSLVPIGRGQRELIIGDRQTGKT+IAIDTIINQKRFNDG+DEKKKLYCIYVAIGQKRSTVAQLVKRL++ADAMKYTIVVSATASDAAPLQYL+PYSGC+MGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKM+D +GGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQT+AMKQVAG MKLELAQYREVAAFAQFGSDLDA+TQQLL+RGVRLTELLKQGQY PMAIE+Q+ VIYAGVRGYLDK++PSKITKFE  +L + ++ HQ LL  IR  G ISE++D K+K+IVT+F+  FE
Sbjct:   33 ARNFHASNTHLQKTGTAEMSSILEERILGADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKTRRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVVSQHQALLGTIRADGKISEQSDAKLKEIVTNFLAGFE 552          
BLAST of ATP synthase subunit alpha vs. Ensembl Human
Match: ATP5F1A (ATP synthase F1 subunit alpha [Source:HGNC Symbol;Acc:HGNC:823])

HSP 1 Score: 892.108 bits (2304), Expect = 0.000e+0
Identity = 431/502 (85.86%), Postives = 471/502 (93.82%), Query Frame = 3
Query:  180 VTSILESAIMGQSSQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFEQDYLKYFLANHQDLLKNIREAGVISEETDTKMKQIVTDFIKDFE 1685
            ++SILE  I+G  + V+LEETGRVLSIGDGIARV+GL+N+QAEEMVEFSSGLKGM+LNLE DNVGVVVFGNDKLIKEGD+VKRTGAIVDVP+G+ELLGRVVDALGN IDGKGP+    R RVGLKAPGIIPR SV+EPMQTG+KAVDSLVPIGRGQRELIIGDRQTGKT+IAIDTIINQKRFNDG+DEKKKLYCIYVAIGQKRSTVAQLVKRL++ADAMKYTIVVSATASDAAPLQYL+PYSGC+MGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKM+D +GGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQT+AMKQVAG MKLELAQYREVAAFAQFGSDLDA+TQQLL+RGVRLTELLKQGQY PMAIE+Q+ VIYAGVRGYLDK++PSKITKFE  +L + ++ HQ LL  IR  G ISE++D K+K+IVT+F+  FE
Sbjct:    1 MSSILEERILGADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKTRRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVVSQHQALLGTIRADGKISEQSDAKLKEIVTNFLAGFE 502          
BLAST of ATP synthase subunit alpha vs. Ensembl Human
Match: ATP5F1A (ATP synthase F1 subunit alpha [Source:HGNC Symbol;Acc:HGNC:823])

HSP 1 Score: 849.351 bits (2193), Expect = 0.000e+0
Identity = 418/520 (80.38%), Postives = 458/520 (88.08%), Query Frame = 3
Query:  132 ARQIHVSSSL--NAEIPEVTSILESAIMGQSSQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFEQDYLKYFLANHQDLLKNIREAGVISEETDTKMKQIVTDFIKDFE 1685
            AR  H S++        E++SILE  I+G  + V+LEETGRVLSIGDGIARV+GL+N+QAEEMVEFSSGLKGM+LNLE DNVGVVVFGNDKLIKEGD+VKRTGAIVD PIG +                       R RVGLKAPGIIPR SV+EPMQTG+KAVDSLVPIGRGQRELIIGDRQTGKT+IAIDTIINQKRFNDG+DEKKKLYCIYVAIGQKRSTVAQLVKRL++ADAMKYTIVVSATASDAAPLQYL+PYSGC+MGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKM+D +GGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQT+AMKQVAG MKLELAQYREVAAFAQFGSDLDA+TQQLL+RGVRLTELLKQGQY PMAIE+Q+ VIYAGVRGYLDK++PSKITKFE  +L + ++ HQ LL  IR  G ISE++D K+K+IVT+F+  FE
Sbjct:   33 ARNFHASNTHLQKTGTAEMSSILEERILGADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDGPIGSKT----------------------RRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVVSQHQALLGTIRADGKISEQSDAKLKEIVTNFLAGFE 530          
BLAST of ATP synthase subunit alpha vs. Ensembl Human
Match: ATP5F1A (ATP synthase F1 subunit alpha [Source:HGNC Symbol;Acc:HGNC:823])

HSP 1 Score: 362.073 bits (928), Expect = 1.143e-122
Identity = 177/207 (85.51%), Postives = 194/207 (93.72%), Query Frame = 3
Query:  180 VTSILESAIMGQSSQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVA 800
            ++SILE  I+G  + V+LEETGRVLSIGDGIARV+GL+N+QAEEMVEFSSGLKGM+LNLE DNVGVVVFGNDKLIKEGD+VKRTGAIVDVP+G+ELLGRVVDALGN IDGKGP+    R RVGLKAPGIIPR SV+EPMQTG+KAVDSLVPIGRGQRELIIGDRQTGKT+IAIDTIINQKRFNDG+DEKKKLYCIYVAIGQKRSTVA
Sbjct:    1 MSSILEERILGADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKTRRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKKKLYCIYVAIGQKRSTVA 207          
BLAST of ATP synthase subunit alpha vs. Ensembl Celegans
Match: atp-1 (ATP synthase subunit alpha, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q9XXK1])

HSP 1 Score: 864.759 bits (2233), Expect = 0.000e+0
Identity = 417/503 (82.90%), Postives = 463/503 (92.05%), Query Frame = 3
Query:  177 EVTSILESAIMGQSSQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFEQDYLKYFLANHQDLLKNIREAGVISEETDTKMKQIVTDFIKDFE 1685
            EV+ ILE  I+G  + +NLEETG+VLSIGDGIARVYGLKNIQAEEMVEF SG+KGMA+NL+ DNVGVVVFGNDK+I+EGD+VKRTGAIVDVP+GD LLGRVVDALGNPIDGKGP+    R+RV +KAPGIIPR SV+EPM TGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFND  D+KKKL+CIYVA+GQKRSTVAQ+VKRL++A AM YTIVVSATASDAAPLQ+L+PYSGCAMGE+FRDNGKHALII+DDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKM++  GGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKG+RPAINVGLSVSRVGSAAQTKAMKQVAG MKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPM IE+Q+ VIYAGV+GYLDK+DPS ITKFE+++L +  ++ Q LLK IRE G IS +TD ++K +V +F+  F+
Sbjct:   35 EVSKILEERILGTETGINLEETGKVLSIGDGIARVYGLKNIQAEEMVEFDSGIKGMAMNLDVDNVGVVVFGNDKVIREGDIVKRTGAIVDVPVGDGLLGRVVDALGNPIDGKGPIANARRSRVEVKAPGIIPRLSVREPMVTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDAGDDKKKLFCIYVAVGQKRSTVAQIVKRLTDAGAMDYTIVVSATASDAAPLQFLAPYSGCAMGEHFRDNGKHALIIFDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNNSLGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGVRPAINVGLSVSRVGSAAQTKAMKQVAGSMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMGIEEQVGVIYAGVKGYLDKVDPSAITKFEKEFLAHLRSSQQALLKTIREEGQISPQTDAQLKDVVVNFLATFK 537          
BLAST of ATP synthase subunit alpha vs. Ensembl Celegans
Match: atp-1 (ATP synthase subunit alpha, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q9XXK1])

HSP 1 Score: 864.759 bits (2233), Expect = 0.000e+0
Identity = 417/503 (82.90%), Postives = 463/503 (92.05%), Query Frame = 3
Query:  177 EVTSILESAIMGQSSQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFEQDYLKYFLANHQDLLKNIREAGVISEETDTKMKQIVTDFIKDFE 1685
            EV+ ILE  I+G  + +NLEETG+VLSIGDGIARVYGLKNIQAEEMVEF SG+KGMA+NL+ DNVGVVVFGNDK+I+EGD+VKRTGAIVDVP+GD LLGRVVDALGNPIDGKGP+    R+RV +KAPGIIPR SV+EPM TGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFND  D+KKKL+CIYVA+GQKRSTVAQ+VKRL++A AM YTIVVSATASDAAPLQ+L+PYSGCAMGE+FRDNGKHALII+DDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKM++  GGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKG+RPAINVGLSVSRVGSAAQTKAMKQVAG MKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPM IE+Q+ VIYAGV+GYLDK+DPS ITKFE+++L +  ++ Q LLK IRE G IS +TD ++K +V +F+  F+
Sbjct:   35 EVSKILEERILGTETGINLEETGKVLSIGDGIARVYGLKNIQAEEMVEFDSGIKGMAMNLDVDNVGVVVFGNDKVIREGDIVKRTGAIVDVPVGDGLLGRVVDALGNPIDGKGPIANARRSRVEVKAPGIIPRLSVREPMVTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDAGDDKKKLFCIYVAVGQKRSTVAQIVKRLTDAGAMDYTIVVSATASDAAPLQFLAPYSGCAMGEHFRDNGKHALIIFDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNNSLGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGVRPAINVGLSVSRVGSAAQTKAMKQVAGSMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMGIEEQVGVIYAGVKGYLDKVDPSAITKFEKEFLAHLRSSQQALLKTIREEGQISPQTDAQLKDVVVNFLATFK 537          
BLAST of ATP synthase subunit alpha vs. Ensembl Celegans
Match: atp-1 (ATP synthase subunit alpha, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q9XXK1])

HSP 1 Score: 864.759 bits (2233), Expect = 0.000e+0
Identity = 417/503 (82.90%), Postives = 463/503 (92.05%), Query Frame = 3
Query:  177 EVTSILESAIMGQSSQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFEQDYLKYFLANHQDLLKNIREAGVISEETDTKMKQIVTDFIKDFE 1685
            EV+ ILE  I+G  + +NLEETG+VLSIGDGIARVYGLKNIQAEEMVEF SG+KGMA+NL+ DNVGVVVFGNDK+I+EGD+VKRTGAIVDVP+GD LLGRVVDALGNPIDGKGP+    R+RV +KAPGIIPR SV+EPM TGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFND  D+KKKL+CIYVA+GQKRSTVAQ+VKRL++A AM YTIVVSATASDAAPLQ+L+PYSGCAMGE+FRDNGKHALII+DDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKM++  GGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKG+RPAINVGLSVSRVGSAAQTKAMKQVAG MKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPM IE+Q+ VIYAGV+GYLDK+DPS ITKFE+++L +  ++ Q LLK IRE G IS +TD ++K +V +F+  F+
Sbjct:   35 EVSKILEERILGTETGINLEETGKVLSIGDGIARVYGLKNIQAEEMVEFDSGIKGMAMNLDVDNVGVVVFGNDKVIREGDIVKRTGAIVDVPVGDGLLGRVVDALGNPIDGKGPIANARRSRVEVKAPGIIPRLSVREPMVTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDAGDDKKKLFCIYVAVGQKRSTVAQIVKRLTDAGAMDYTIVVSATASDAAPLQFLAPYSGCAMGEHFRDNGKHALIIFDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNNSLGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGVRPAINVGLSVSRVGSAAQTKAMKQVAGSMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMGIEEQVGVIYAGVKGYLDKVDPSAITKFEKEFLAHLRSSQQALLKTIREEGQISPQTDAQLKDVVVNFLATFK 537          
BLAST of ATP synthase subunit alpha vs. Ensembl Celegans
Match: atp-1 (ATP synthase subunit alpha, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q9XXK1])

HSP 1 Score: 864.759 bits (2233), Expect = 0.000e+0
Identity = 417/503 (82.90%), Postives = 463/503 (92.05%), Query Frame = 3
Query:  177 EVTSILESAIMGQSSQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFEQDYLKYFLANHQDLLKNIREAGVISEETDTKMKQIVTDFIKDFE 1685
            EV+ ILE  I+G  + +NLEETG+VLSIGDGIARVYGLKNIQAEEMVEF SG+KGMA+NL+ DNVGVVVFGNDK+I+EGD+VKRTGAIVDVP+GD LLGRVVDALGNPIDGKGP+    R+RV +KAPGIIPR SV+EPM TGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFND  D+KKKL+CIYVA+GQKRSTVAQ+VKRL++A AM YTIVVSATASDAAPLQ+L+PYSGCAMGE+FRDNGKHALII+DDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKM++  GGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKG+RPAINVGLSVSRVGSAAQTKAMKQVAG MKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPM IE+Q+ VIYAGV+GYLDK+DPS ITKFE+++L +  ++ Q LLK IRE G IS +TD ++K +V +F+  F+
Sbjct:   35 EVSKILEERILGTETGINLEETGKVLSIGDGIARVYGLKNIQAEEMVEFDSGIKGMAMNLDVDNVGVVVFGNDKVIREGDIVKRTGAIVDVPVGDGLLGRVVDALGNPIDGKGPIANARRSRVEVKAPGIIPRLSVREPMVTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDAGDDKKKLFCIYVAVGQKRSTVAQIVKRLTDAGAMDYTIVVSATASDAAPLQFLAPYSGCAMGEHFRDNGKHALIIFDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNNSLGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGVRPAINVGLSVSRVGSAAQTKAMKQVAGSMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMGIEEQVGVIYAGVKGYLDKVDPSAITKFEKEFLAHLRSSQQALLKTIREEGQISPQTDAQLKDVVVNFLATFK 537          
BLAST of ATP synthase subunit alpha vs. Ensembl Celegans
Match: atp-1 (ATP synthase subunit alpha, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q9XXK1])

HSP 1 Score: 864.759 bits (2233), Expect = 0.000e+0
Identity = 417/503 (82.90%), Postives = 463/503 (92.05%), Query Frame = 3
Query:  177 EVTSILESAIMGQSSQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFEQDYLKYFLANHQDLLKNIREAGVISEETDTKMKQIVTDFIKDFE 1685
            EV+ ILE  I+G  + +NLEETG+VLSIGDGIARVYGLKNIQAEEMVEF SG+KGMA+NL+ DNVGVVVFGNDK+I+EGD+VKRTGAIVDVP+GD LLGRVVDALGNPIDGKGP+    R+RV +KAPGIIPR SV+EPM TGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFND  D+KKKL+CIYVA+GQKRSTVAQ+VKRL++A AM YTIVVSATASDAAPLQ+L+PYSGCAMGE+FRDNGKHALII+DDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKM++  GGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKG+RPAINVGLSVSRVGSAAQTKAMKQVAG MKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPM IE+Q+ VIYAGV+GYLDK+DPS ITKFE+++L +  ++ Q LLK IRE G IS +TD ++K +V +F+  F+
Sbjct:   35 EVSKILEERILGTETGINLEETGKVLSIGDGIARVYGLKNIQAEEMVEFDSGIKGMAMNLDVDNVGVVVFGNDKVIREGDIVKRTGAIVDVPVGDGLLGRVVDALGNPIDGKGPIANARRSRVEVKAPGIIPRLSVREPMVTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDAGDDKKKLFCIYVAVGQKRSTVAQIVKRLTDAGAMDYTIVVSATASDAAPLQFLAPYSGCAMGEHFRDNGKHALIIFDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNNSLGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGVRPAINVGLSVSRVGSAAQTKAMKQVAGSMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMGIEEQVGVIYAGVKGYLDKVDPSAITKFEKEFLAHLRSSQQALLKTIREEGQISPQTDAQLKDVVVNFLATFK 537          
BLAST of ATP synthase subunit alpha vs. Ensembl Fly
Match: blw (gene:FBgn0011211 transcript:FBtr0071883)

HSP 1 Score: 872.848 bits (2254), Expect = 0.000e+0
Identity = 424/518 (81.85%), Postives = 469/518 (90.54%), Query Frame = 3
Query:  135 RQIHVSSSLNAEIPEVTSILESAIMGQSSQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFEQDYLKYFLANHQDLLKNIREAGVISEETDTKMKQIVTDFIKDFEG 1688
            R++HV+S+  +   E+++ILE  I+G + + +LEETGRVLSIGDGIARVYGL NIQA+EMVEFSSGLKGMALNLE DNVGVVVFGNDKLIK+GD+VKRTGAIVDVP+GDELLGRVVDALGN IDGKG +    R RVG+KAPGIIPR SV+EPMQTG+KAVDSLVPIGRGQRELIIGDRQTGKTA+AIDTIINQKRFN+  DE KKLYCIYVAIGQKRSTVAQ+VKRL+++ AM Y+++VSATASDAAPLQYL+PYSGCAMGEYFRD GKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMS   GGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAG MKLELAQYREVAAFAQFGSDLDA+TQQLLNRGVRLTELLKQGQYVPMAIEDQ+ VIY GVRG+LDKMDP+KITKFE+++L++   + Q LL  I + G ISE +D K+K IV  F+  F+G
Sbjct:   37 RKLHVASTQRS--AEISNILEERILGVAPKADLEETGRVLSIGDGIARVYGLNNIQADEMVEFSSGLKGMALNLEPDNVGVVVFGNDKLIKQGDIVKRTGAIVDVPVGDELLGRVVDALGNAIDGKGAINTKDRFRVGIKAPGIIPRVSVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTALAIDTIINQKRFNEAQDESKKLYCIYVAIGQKRSTVAQIVKRLTDSGAMGYSVIVSATASDAAPLQYLAPYSGCAMGEYFRDKGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSPAMGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGSMKLELAQYREVAAFAQFGSDLDAATQQLLNRGVRLTELLKQGQYVPMAIEDQVAVIYCGVRGHLDKMDPAKITKFEKEFLQHIKTSEQALLDTIAKDGAISEASDAKLKDIVAKFMSTFQG 552          
BLAST of ATP synthase subunit alpha vs. Ensembl Fly
Match: Vha55 (gene:FBgn0005671 transcript:FBtr0301661)

HSP 1 Score: 103.219 bits (256), Expect = 5.681e-23
Identity = 87/344 (25.29%), Postives = 157/344 (45.64%), Query Frame = 3
Query:  339 GMALNLERDNVGVVVF-GNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGP--LTQNLRARVGLKAPGIIPRTSV--KEPMQTGVKAVDSLVPIGRGQRELIIGD-------------RQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYF-RDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQ 1313
            G  L +      V VF G   +  +  + + TG I+  P+ +++LGRV +  G PID KGP  L ++    + ++   I P + +  +E +QTG+ A+D +  I RGQ+  I                RQ G   +   ++++        D       ++ A+G    T     +      +M+   +    A+D    + ++P       E+      KH L+I  D+S  A A R++S      PGR  +PG ++   + + ERA ++      GS+T +P++     D++  IP     IT+GQI+++ +L  + I P +NV  S+SR+  +A  + M +
Sbjct:   63 GQVLEVSGSKAVVQVFEGTSGIDAKNTLCEFTGDILRTPVSEDMLGRVFNGSGKPID-KGPPILAEDF---LDIQGQPINPWSRIYPEEMIQTGISAIDVMNSIARGQKIPIFSAAGLPHNEIAAQICRQAGLVKLPGKSVLD--------DHTDNFAIVFAAMGVNMETARFFKQDFEENGSMENVCLFLNLANDPTIERIITPRLALTAAEFLAYQCEKHVLVILTDMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEG--RNGSITQIPILTMPNDDITHPIPDLTGYITEGQIYVDRQLHNRQIYPPVNVLPSLSRLMKSAIGEGMTR 392          
BLAST of ATP synthase subunit alpha vs. Ensembl Fly
Match: Vha55 (gene:FBgn0005671 transcript:FBtr0082670)

HSP 1 Score: 103.219 bits (256), Expect = 5.681e-23
Identity = 87/344 (25.29%), Postives = 157/344 (45.64%), Query Frame = 3
Query:  339 GMALNLERDNVGVVVF-GNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGP--LTQNLRARVGLKAPGIIPRTSV--KEPMQTGVKAVDSLVPIGRGQRELIIGD-------------RQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYF-RDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQ 1313
            G  L +      V VF G   +  +  + + TG I+  P+ +++LGRV +  G PID KGP  L ++    + ++   I P + +  +E +QTG+ A+D +  I RGQ+  I                RQ G   +   ++++        D       ++ A+G    T     +      +M+   +    A+D    + ++P       E+      KH L+I  D+S  A A R++S      PGR  +PG ++   + + ERA ++      GS+T +P++     D++  IP     IT+GQI+++ +L  + I P +NV  S+SR+  +A  + M +
Sbjct:   63 GQVLEVSGSKAVVQVFEGTSGIDAKNTLCEFTGDILRTPVSEDMLGRVFNGSGKPID-KGPPILAEDF---LDIQGQPINPWSRIYPEEMIQTGISAIDVMNSIARGQKIPIFSAAGLPHNEIAAQICRQAGLVKLPGKSVLD--------DHTDNFAIVFAAMGVNMETARFFKQDFEENGSMENVCLFLNLANDPTIERIITPRLALTAAEFLAYQCEKHVLVILTDMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEG--RNGSITQIPILTMPNDDITHPIPDLTGYITEGQIYVDRQLHNRQIYPPVNVLPSLSRLMKSAIGEGMTR 392          
BLAST of ATP synthase subunit alpha vs. Ensembl Fly
Match: Vha55 (gene:FBgn0005671 transcript:FBtr0082671)

HSP 1 Score: 103.219 bits (256), Expect = 5.681e-23
Identity = 87/344 (25.29%), Postives = 157/344 (45.64%), Query Frame = 3
Query:  339 GMALNLERDNVGVVVF-GNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGP--LTQNLRARVGLKAPGIIPRTSV--KEPMQTGVKAVDSLVPIGRGQRELIIGD-------------RQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYF-RDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQ 1313
            G  L +      V VF G   +  +  + + TG I+  P+ +++LGRV +  G PID KGP  L ++    + ++   I P + +  +E +QTG+ A+D +  I RGQ+  I                RQ G   +   ++++        D       ++ A+G    T     +      +M+   +    A+D    + ++P       E+      KH L+I  D+S  A A R++S      PGR  +PG ++   + + ERA ++      GS+T +P++     D++  IP     IT+GQI+++ +L  + I P +NV  S+SR+  +A  + M +
Sbjct:   63 GQVLEVSGSKAVVQVFEGTSGIDAKNTLCEFTGDILRTPVSEDMLGRVFNGSGKPID-KGPPILAEDF---LDIQGQPINPWSRIYPEEMIQTGISAIDVMNSIARGQKIPIFSAAGLPHNEIAAQICRQAGLVKLPGKSVLD--------DHTDNFAIVFAAMGVNMETARFFKQDFEENGSMENVCLFLNLANDPTIERIITPRLALTAAEFLAYQCEKHVLVILTDMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEG--RNGSITQIPILTMPNDDITHPIPDLTGYITEGQIYVDRQLHNRQIYPPVNVLPSLSRLMKSAIGEGMTR 392          
BLAST of ATP synthase subunit alpha vs. Ensembl Fly
Match: ATPsynbeta (gene:FBgn0010217 transcript:FBtr0089186)

HSP 1 Score: 94.3597 bits (233), Expect = 4.121e-20
Identity = 77/305 (25.25%), Postives = 136/305 (44.59%), Query Frame = 3
Query:  387 GNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRL------SNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRD-NGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRV 1280
            G + L++ G  V  TG  + +P+G E LGR+++ +G PID +GP+  +  A +  +AP  +  +  +E + TG+K VD L P  +G +  + G    GKT + ++ I N  + + G       Y ++  +G++      L   +      S  D      +V    ++    +     +G  + EYFRD  G+  L+  D++ +   A  ++S LL R P    Y   +      + ER          GS+T++  I   A D++   P    +  D    L   +   GI PA++   S SR+
Sbjct:   92 GTEGLVR-GQKVLDTGYPIRIPVGAETLGRIINVIGEPIDERGPIDTDKTAAIHAEAPEFVQMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGG-------YSVFAGVGERTREGNDLYNEMIEGGVISLKDKTSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGSMQERITTTKK----GSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRI 384          
BLAST of ATP synthase subunit alpha vs. Ensembl Zebrafish
Match: atp5fa1 (ATP synthase F1 subunit alpha [Source:ZFIN;Acc:ZDB-GENE-060201-1])

HSP 1 Score: 899.427 bits (2323), Expect = 0.000e+0
Identity = 435/503 (86.48%), Postives = 471/503 (93.64%), Query Frame = 3
Query:  177 EVTSILESAIMGQSSQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFEQDYLKYFLANHQDLLKNIREAGVISEETDTKMKQIVTDFIKDFE 1685
            EV+SILE  I+G  +   LEETGRVLSIGDGIARVYGL+N+QAEEMVEFSSGLKGM+LNLE DNVGVVVFGNDKLIKEGD+VKRTGAIVDVP+G+ELLGRVVDALGNPIDGKGPL    R RVGLKAPGIIPR SV+EPMQTG+KAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFN+G +EKKKLYCIYVAIGQKRSTVAQLVKRL++ADAMKYTIVVSATASDAAPLQYL+PYSGC+MGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKM+D +GGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQT+AMKQVAG MKLELAQYREVAAFAQFGSDLDA+TQQLLNRGVRLTELLKQGQY PMAIE+Q+ VIYAGVRG+LDKM+PSKITKFE+ +L++ ++ HQDLL  IR  G ISE +D K+K+IV +F+  FE
Sbjct:   49 EVSSILEEKILGADTGAELEETGRVLSIGDGIARVYGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNPIDGKGPLGSKERRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNEGTEEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDNFGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLNRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGHLDKMEPSKITKFEKAFLQHVISQHQDLLAAIRSDGKISEASDAKLKEIVLNFLSSFE 551          
BLAST of ATP synthase subunit alpha vs. Ensembl Zebrafish
Match: atp6v1ba (ATPase, H+ transporting, lysosomal, V1 subunit B, member a [Source:ZFIN;Acc:ZDB-GENE-030711-3])

HSP 1 Score: 100.908 bits (250), Expect = 4.730e-22
Identity = 84/303 (27.72%), Postives = 142/303 (46.86%), Query Frame = 3
Query:  429 TGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSV--KEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQ----KRFNDGADEKKKLYCI-YVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYF-RDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQ 1313
            TG I+  P+ +++LGRV +  G PID +GP T      + +    I P+  +  +E +QTG+ A+D +  I RGQ+  I          IA   I  Q    ++  D  D   + + I + A+G    T            +M    +    A+D    + ++P       EY      KH L+I  D+S  A A R++S      PGR  +PG ++   + + ERA ++      GS+T +P++     D++  IP     IT+GQ++++ +L  + I P INV  S+SR+  +A  + M +
Sbjct:  106 TGDILRTPVSEDMLGRVFNGSGKPID-RGP-TVLAEDYLDIMGQPINPQCRIYPEEMIQTGISAIDGMNSIARGQKIPIFSAAGLPHNEIAAQ-ICRQAGLVQKSKDVTDYSSENFAIVFAAMGVNMETARFFKSDFEENGSMDNVCLFLNLANDPTIERIITPRLALTTAEYLAYQCEKHVLVILTDMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEG--RNGSITQIPILTMPNDDITHPIPDLTGYITEGQVYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTR 403          
BLAST of ATP synthase subunit alpha vs. Ensembl Zebrafish
Match: atp6v1ba (ATPase, H+ transporting, lysosomal, V1 subunit B, member a [Source:ZFIN;Acc:ZDB-GENE-030711-3])

HSP 1 Score: 100.908 bits (250), Expect = 4.730e-22
Identity = 84/303 (27.72%), Postives = 142/303 (46.86%), Query Frame = 3
Query:  429 TGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSV--KEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQ----KRFNDGADEKKKLYCI-YVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYF-RDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQ 1313
            TG I+  P+ +++LGRV +  G PID +GP T      + +    I P+  +  +E +QTG+ A+D +  I RGQ+  I          IA   I  Q    ++  D  D   + + I + A+G    T            +M    +    A+D    + ++P       EY      KH L+I  D+S  A A R++S      PGR  +PG ++   + + ERA ++      GS+T +P++     D++  IP     IT+GQ++++ +L  + I P INV  S+SR+  +A  + M +
Sbjct:  106 TGDILRTPVSEDMLGRVFNGSGKPID-RGP-TVLAEDYLDIMGQPINPQCRIYPEEMIQTGISAIDGMNSIARGQKIPIFSAAGLPHNEIAAQ-ICRQAGLVQKSKDVTDYSSENFAIVFAAMGVNMETARFFKSDFEENGSMDNVCLFLNLANDPTIERIITPRLALTTAEYLAYQCEKHVLVILTDMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEG--RNGSITQIPILTMPNDDITHPIPDLTGYITEGQVYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTR 403          
BLAST of ATP synthase subunit alpha vs. Ensembl Zebrafish
Match: atp6v1b2 (ATPase H+ transporting V1 subunit B2 [Source:ZFIN;Acc:ZDB-GENE-030711-4])

HSP 1 Score: 100.523 bits (249), Expect = 5.762e-22
Identity = 86/305 (28.20%), Postives = 144/305 (47.21%), Query Frame = 3
Query:  429 TGAIVDVPIGDELLGRVVDALGNPIDGKGP--LTQNLRARVGLKAPGIIPRTSV--KEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQ----KRFNDGADEKKKLYCI-YVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYF-RDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQ 1313
            TG I+  P+ +++LGRV +  G PID +GP  L ++    +G     I P+  +  +E +QTG+ A+D +  I RGQ+  I          IA   I  Q    K+  D  D  +  + I + A+G    T            +M    +    A+D    + ++P       E+      KH L+I  D+S  A A R++S      PGR  +PG ++   + + ERA ++      GS+T +P++     D++  IP     IT+GQI+++ +L  + I P INV  S+SR+  +A  + M +
Sbjct:  114 TGDILRTPVSEDMLGRVFNGSGKPID-RGPAVLAEDYLDIMGQP---INPQCRIYPEEMIQTGISAIDGMNSIARGQKIPIFSAAGLPHNEIAAQ-ICRQAGLVKKSKDVMDYSEDNFAIVFAAMGVNMETARFFKSDFEENGSMDNVCLFLNLANDPTIERIITPRLALTSAEFLAYQCEKHVLVILTDMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEG--RNGSITQIPILTMPNDDITHPIPDLTGYITEGQIYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTR 411          
BLAST of ATP synthase subunit alpha vs. Ensembl Zebrafish
Match: atp6v1b2 (ATPase H+ transporting V1 subunit B2 [Source:ZFIN;Acc:ZDB-GENE-030711-4])

HSP 1 Score: 100.523 bits (249), Expect = 5.762e-22
Identity = 86/305 (28.20%), Postives = 144/305 (47.21%), Query Frame = 3
Query:  429 TGAIVDVPIGDELLGRVVDALGNPIDGKGP--LTQNLRARVGLKAPGIIPRTSV--KEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQ----KRFNDGADEKKKLYCI-YVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYF-RDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQ 1313
            TG I+  P+ +++LGRV +  G PID +GP  L ++    +G     I P+  +  +E +QTG+ A+D +  I RGQ+  I          IA   I  Q    K+  D  D  +  + I + A+G    T            +M    +    A+D    + ++P       E+      KH L+I  D+S  A A R++S      PGR  +PG ++   + + ERA ++      GS+T +P++     D++  IP     IT+GQI+++ +L  + I P INV  S+SR+  +A  + M +
Sbjct:  114 TGDILRTPVSEDMLGRVFNGSGKPID-RGPAVLAEDYLDIMGQP---INPQCRIYPEEMIQTGISAIDGMNSIARGQKIPIFSAAGLPHNEIAAQ-ICRQAGLVKKSKDVMDYSEDNFAIVFAAMGVNMETARFFKSDFEENGSMDNVCLFLNLANDPTIERIITPRLALTSAEFLAYQCEKHVLVILTDMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEG--RNGSITQIPILTMPNDDITHPIPDLTGYITEGQIYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTR 411          
BLAST of ATP synthase subunit alpha vs. Ensembl Xenopus
Match: gh2 (growth hormone 2 [Source:Xenbase;Acc:XB-GENE-5872064])

HSP 1 Score: 908.286 bits (2346), Expect = 0.000e+0
Identity = 445/552 (80.62%), Postives = 490/552 (88.77%), Query Frame = 3
Query:   54 MALMKVALTALKRVPQSSFKINQISLA------RQIHVSSSL--NAEIPEVTSILESAIMGQSSQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFEQDYLKYFLANHQDLLKNIREAGVISEETDTKMKQIVTDFIKDFE 1685
            M  ++VA    + +P+ +  +++ +L       R IH S +    +   EV+SILE  I+G  +  +LEETGRVLSIGDGIARVYGL+N+QAEEMVEFSSGLKGM+LNLE DNVGVVVFGNDKLIKEGD+VKRTGAIVDVP+GDELLGRVVDALGN IDGKGPL   +R RVGLKAPGIIPR SV+EPMQTG+KAVDSLVPIGRGQRELIIGDRQTGKT+IAIDTIINQKRFNDG DEKKKLYCIYVAIGQKRSTVAQLVKRL++ADAMKYTIVVSATASDAAPLQYL+PYSGC+MGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKM+D +GGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQT+AMKQVAG MKLELAQYREVAAFAQFGSDLDA+TQQLLNRGVRLTELLKQGQYVPMAIE+Q+ VIYAGVRG+LDKM+PSKITKFE  +L +  + HQ+LL  IR  G ISE+ D K+K+IV  F+  FE
Sbjct:    1 MLSVRVATALARTLPRQAGLVSKKALGAAFVATRNIHASGAWLQKSGTAEVSSILEERILGADTSADLEETGRVLSIGDGIARVYGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGDELLGRVVDALGNAIDGKGPLASKIRRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDHFGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLNRGVRLTELLKQGQYVPMAIEEQVTVIYAGVRGHLDKMEPSKITKFENAFLAHVKSQHQELLATIRADGKISEQADAKLKEIVLSFLSTFE 552          
BLAST of ATP synthase subunit alpha vs. Ensembl Xenopus
Match: gh2 (growth hormone 2 [Source:Xenbase;Acc:XB-GENE-5872064])

HSP 1 Score: 905.205 bits (2338), Expect = 0.000e+0
Identity = 440/519 (84.78%), Postives = 475/519 (91.52%), Query Frame = 3
Query:  135 RQIHVSSSL--NAEIPEVTSILESAIMGQSSQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFEQDYLKYFLANHQDLLKNIREAGVISEETDTKMKQIVTDFIKDFE 1685
            R IH S +    +   EV+SILE  I+G  +  +LEETGRVLSIGDGIARVYGL+N+QAEEMVEFSSGLKGM+LNLE DNVGVVVFGNDKLIKEGD+VKRTGAIVDVP+GDELLGRVVDALGN IDGKGPL   +R RVGLKAPGIIPR SV+EPMQTG+KAVDSLVPIGRGQRELIIGDRQTGKT+IAIDTIINQKRFNDG DEKKKLYCIYVAIGQKRSTVAQLVKRL++ADAMKYTIVVSATASDAAPLQYL+PYSGC+MGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKM+D +GGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQT+AMKQVAG MKLELAQYREVAAFAQFGSDLDA+TQQLLNRGVRLTELLKQGQYVPMAIE+Q+ VIYAGVRG+LDKM+PSKITKFE  +L +  + HQ+LL  IR  G ISE+ D K+K+IV  F+  FE
Sbjct:   24 RNIHASGAWLQKSGTAEVSSILEERILGADTSADLEETGRVLSIGDGIARVYGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGDELLGRVVDALGNAIDGKGPLASKIRRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDHFGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLNRGVRLTELLKQGQYVPMAIEEQVTVIYAGVRGHLDKMEPSKITKFENAFLAHVKSQHQELLATIRADGKISEQADAKLKEIVLSFLSTFE 542          
BLAST of ATP synthase subunit alpha vs. Ensembl Xenopus
Match: gh2 (growth hormone 2 [Source:Xenbase;Acc:XB-GENE-5872064])

HSP 1 Score: 902.508 bits (2331), Expect = 0.000e+0
Identity = 442/544 (81.25%), Postives = 485/544 (89.15%), Query Frame = 3
Query:   54 MALMKVALTALKRVPQSSFKINQISLARQIHVSSSLNAEIPEVTSILESAIMGQSSQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFEQDYLKYFLANHQDLLKNIREAGVISEETDTKMKQIVTDFIKDFE 1685
            M  ++VA    + +P+ +  ++       I+  +   A   EV+SILE  I+G  +  +LEETGRVLSIGDGIARVYGL+N+QAEEMVEFSSGLKGM+LNLE DNVGVVVFGNDKLIKEGD+VKRTGAIVDVP+GDELLGRVVDALGN IDGKGPL   +R RVGLKAPGIIPR SV+EPMQTG+KAVDSLVPIGRGQRELIIGDRQTGKT+IAIDTIINQKRFNDG DEKKKLYCIYVAIGQKRSTVAQLVKRL++ADAMKYTIVVSATASDAAPLQYL+PYSGC+MGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKM+D +GGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQT+AMKQVAG MKLELAQYREVAAFAQFGSDLDA+TQQLLNRGVRLTELLKQGQYVPMAIE+Q+ VIYAGVRG+LDKM+PSKITKFE  +L +  + HQ+LL  IR  G ISE+ D K+K+IV  F+  FE
Sbjct:    1 MLSVRVATALARTLPRQAGLVSTKPPFAVINFITLFPAGTAEVSSILEERILGADTSADLEETGRVLSIGDGIARVYGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGDELLGRVVDALGNAIDGKGPLASKIRRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDHFGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLNRGVRLTELLKQGQYVPMAIEEQVTVIYAGVRGHLDKMEPSKITKFENAFLAHVKSQHQELLATIRADGKISEQADAKLKEIVLSFLSTFE 544          
BLAST of ATP synthase subunit alpha vs. Ensembl Xenopus
Match: gh2 (growth hormone 2 [Source:Xenbase;Acc:XB-GENE-5872064])

HSP 1 Score: 902.123 bits (2330), Expect = 0.000e+0
Identity = 436/503 (86.68%), Postives = 469/503 (93.24%), Query Frame = 3
Query:  177 EVTSILESAIMGQSSQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFEQDYLKYFLANHQDLLKNIREAGVISEETDTKMKQIVTDFIKDFE 1685
            EV+SILE  I+G  +  +LEETGRVLSIGDGIARVYGL+N+QAEEMVEFSSGLKGM+LNLE DNVGVVVFGNDKLIKEGD+VKRTGAIVDVP+GDELLGRVVDALGN IDGKGPL   +R RVGLKAPGIIPR SV+EPMQTG+KAVDSLVPIGRGQRELIIGDRQTGKT+IAIDTIINQKRFNDG DEKKKLYCIYVAIGQKRSTVAQLVKRL++ADAMKYTIVVSATASDAAPLQYL+PYSGC+MGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKM+D +GGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQT+AMKQVAG MKLELAQYREVAAFAQFGSDLDA+TQQLLNRGVRLTELLKQGQYVPMAIE+Q+ VIYAGVRG+LDKM+PSKITKFE  +L +  + HQ+LL  IR  G ISE+ D K+K+IV  F+  FE
Sbjct:   19 EVSSILEERILGADTSADLEETGRVLSIGDGIARVYGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGDELLGRVVDALGNAIDGKGPLASKIRRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDHFGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLNRGVRLTELLKQGQYVPMAIEEQVTVIYAGVRGHLDKMEPSKITKFENAFLAHVKSQHQELLATIRADGKISEQADAKLKEIVLSFLSTFE 521          
BLAST of ATP synthase subunit alpha vs. Ensembl Xenopus
Match: gh2 (growth hormone 2 [Source:Xenbase;Acc:XB-GENE-5872064])

HSP 1 Score: 900.197 bits (2325), Expect = 0.000e+0
Identity = 438/515 (85.05%), Postives = 473/515 (91.84%), Query Frame = 3
Query:  141 IHVSSSLNAEIPEVTSILESAIMGQSSQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFEQDYLKYFLANHQDLLKNIREAGVISEETDTKMKQIVTDFIKDFE 1685
            I+  +   A   EV+SILE  I+G  +  +LEETGRVLSIGDGIARVYGL+N+QAEEMVEFSSGLKGM+LNLE DNVGVVVFGNDKLIKEGD+VKRTGAIVDVP+GDELLGRVVDALGN IDGKGPL   +R RVGLKAPGIIPR SV+EPMQTG+KAVDSLVPIGRGQRELIIGDRQTGKT+IAIDTIINQKRFNDG DEKKKLYCIYVAIGQKRSTVAQLVKRL++ADAMKYTIVVSATASDAAPLQYL+PYSGC+MGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKM+D +GGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQT+AMKQVAG MKLELAQYREVAAFAQFGSDLDA+TQQLLNRGVRLTELLKQGQYVPMAIE+Q+ VIYAGVRG+LDKM+PSKITKFE  +L +  + HQ+LL  IR  G ISE+ D K+K+IV  F+  FE
Sbjct:   31 INFITLFPAGTAEVSSILEERILGADTSADLEETGRVLSIGDGIARVYGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGDELLGRVVDALGNAIDGKGPLASKIRRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDHFGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLNRGVRLTELLKQGQYVPMAIEEQVTVIYAGVRGHLDKMEPSKITKFENAFLAHVKSQHQELLATIRADGKISEQADAKLKEIVLSFLSTFE 545          
BLAST of ATP synthase subunit alpha vs. Ensembl Mouse
Match: Atp5a1 (ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit 1 [Source:MGI Symbol;Acc:MGI:88115])

HSP 1 Score: 902.894 bits (2332), Expect = 0.000e+0
Identity = 438/520 (84.23%), Postives = 479/520 (92.12%), Query Frame = 3
Query:  132 ARQIHVSSSL--NAEIPEVTSILESAIMGQSSQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFEQDYLKYFLANHQDLLKNIREAGVISEETDTKMKQIVTDFIKDFE 1685
            AR +H S++        E++SILE  I+G  + V+LEETGRVLSIGDGIARV+GL+N+QAEEMVEFSSGLKGM+LNLE DNVGVVVFGNDKLIKEGDVVKRTGAIVDVP+G+ELLGRVVDALGN IDGKGP+    R RVGLKAPGIIPR SV+EPMQTG+KAVDSLVPIGRGQRELIIGDRQTGKT+IAIDTIINQKRFNDG DEKKKLYCIYVAIGQKRSTVAQLVKRL++ADAMKYTIVVSATASDAAPLQYL+PYSGC+MGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKM+D +GGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQT+AMKQVAG MKLELAQYREVAAFAQFGSDLDA+TQQLL+RGVRLTELLKQGQY PMAIE+Q+ VIYAGVRGYLDK++PSKITKFE  +L + ++ HQ LL NIR  G ISE++D K+K+IVT+F+  FE
Sbjct:   33 ARNLHASNTRLQKTGTAEMSSILEERILGADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKTRRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDSFGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVISQHQSLLGNIRSDGKISEQSDAKLKEIVTNFLAGFE 552          
BLAST of ATP synthase subunit alpha vs. Ensembl Mouse
Match: Atp5a1 (ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit 1 [Source:MGI Symbol;Acc:MGI:88115])

HSP 1 Score: 902.894 bits (2332), Expect = 0.000e+0
Identity = 438/520 (84.23%), Postives = 479/520 (92.12%), Query Frame = 3
Query:  132 ARQIHVSSSL--NAEIPEVTSILESAIMGQSSQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFEQDYLKYFLANHQDLLKNIREAGVISEETDTKMKQIVTDFIKDFE 1685
            AR +H S++        E++SILE  I+G  + V+LEETGRVLSIGDGIARV+GL+N+QAEEMVEFSSGLKGM+LNLE DNVGVVVFGNDKLIKEGDVVKRTGAIVDVP+G+ELLGRVVDALGN IDGKGP+    R RVGLKAPGIIPR SV+EPMQTG+KAVDSLVPIGRGQRELIIGDRQTGKT+IAIDTIINQKRFNDG DEKKKLYCIYVAIGQKRSTVAQLVKRL++ADAMKYTIVVSATASDAAPLQYL+PYSGC+MGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKM+D +GGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQT+AMKQVAG MKLELAQYREVAAFAQFGSDLDA+TQQLL+RGVRLTELLKQGQY PMAIE+Q+ VIYAGVRGYLDK++PSKITKFE  +L + ++ HQ LL NIR  G ISE++D K+K+IVT+F+  FE
Sbjct:   33 ARNLHASNTRLQKTGTAEMSSILEERILGADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKTRRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDSFGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVISQHQSLLGNIRSDGKISEQSDAKLKEIVTNFLAGFE 552          
BLAST of ATP synthase subunit alpha vs. Ensembl Mouse
Match: Atp5a1 (ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit 1 [Source:MGI Symbol;Acc:MGI:88115])

HSP 1 Score: 895.19 bits (2312), Expect = 0.000e+0
Identity = 433/502 (86.25%), Postives = 471/502 (93.82%), Query Frame = 3
Query:  180 VTSILESAIMGQSSQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFEQDYLKYFLANHQDLLKNIREAGVISEETDTKMKQIVTDFIKDFE 1685
            ++SILE  I+G  + V+LEETGRVLSIGDGIARV+GL+N+QAEEMVEFSSGLKGM+LNLE DNVGVVVFGNDKLIKEGDVVKRTGAIVDVP+G+ELLGRVVDALGN IDGKGP+    R RVGLKAPGIIPR SV+EPMQTG+KAVDSLVPIGRGQRELIIGDRQTGKT+IAIDTIINQKRFNDG DEKKKLYCIYVAIGQKRSTVAQLVKRL++ADAMKYTIVVSATASDAAPLQYL+PYSGC+MGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKM+D +GGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQT+AMKQVAG MKLELAQYREVAAFAQFGSDLDA+TQQLL+RGVRLTELLKQGQY PMAIE+Q+ VIYAGVRGYLDK++PSKITKFE  +L + ++ HQ LL NIR  G ISE++D K+K+IVT+F+  FE
Sbjct:    1 MSSILEERILGADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKTRRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDSFGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVISQHQSLLGNIRSDGKISEQSDAKLKEIVTNFLAGFE 502          
BLAST of ATP synthase subunit alpha vs. Ensembl Mouse
Match: Atp5a1 (ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit 1 [Source:MGI Symbol;Acc:MGI:88115])

HSP 1 Score: 895.19 bits (2312), Expect = 0.000e+0
Identity = 433/502 (86.25%), Postives = 471/502 (93.82%), Query Frame = 3
Query:  180 VTSILESAIMGQSSQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFEQDYLKYFLANHQDLLKNIREAGVISEETDTKMKQIVTDFIKDFE 1685
            ++SILE  I+G  + V+LEETGRVLSIGDGIARV+GL+N+QAEEMVEFSSGLKGM+LNLE DNVGVVVFGNDKLIKEGDVVKRTGAIVDVP+G+ELLGRVVDALGN IDGKGP+    R RVGLKAPGIIPR SV+EPMQTG+KAVDSLVPIGRGQRELIIGDRQTGKT+IAIDTIINQKRFNDG DEKKKLYCIYVAIGQKRSTVAQLVKRL++ADAMKYTIVVSATASDAAPLQYL+PYSGC+MGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKM+D +GGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQT+AMKQVAG MKLELAQYREVAAFAQFGSDLDA+TQQLL+RGVRLTELLKQGQY PMAIE+Q+ VIYAGVRGYLDK++PSKITKFE  +L + ++ HQ LL NIR  G ISE++D K+K+IVT+F+  FE
Sbjct:    1 MSSILEERILGADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKTRRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDSFGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVISQHQSLLGNIRSDGKISEQSDAKLKEIVTNFLAGFE 502          
BLAST of ATP synthase subunit alpha vs. Ensembl Mouse
Match: Atp6v1b2 (ATPase, H+ transporting, lysosomal V1 subunit B2 [Source:MGI Symbol;Acc:MGI:109618])

HSP 1 Score: 102.064 bits (253), Expect = 2.400e-22
Identity = 86/305 (28.20%), Postives = 145/305 (47.54%), Query Frame = 3
Query:  429 TGAIVDVPIGDELLGRVVDALGNPIDGKGP--LTQNLRARVGLKAPGIIPRTSV--KEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQ----KRFNDGADEKKKLYCI-YVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYF-RDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQ 1313
            TG I+  P+ +++LGRV +  G PID +GP  L ++    +G     I P+  +  +E +QTG+ A+D +  I RGQ+  I          IA   I  Q    K+  D  D  ++ + I + A+G    T            +M    +    A+D    + ++P       E+      KH L+I  D+S  A A R++S      PGR  +PG ++   + + ERA ++      GS+T +P++     D++  IP     IT+GQI+++ +L  + I P INV  S+SR+  +A  + M +
Sbjct:  115 TGDILRTPVSEDMLGRVFNGSGKPID-RGPVVLAEDFLDIMGQP---INPQCRIYPEEMIQTGISAIDGMNSIARGQKIPIFSAAGLPHNEIAAQ-ICRQAGLVKKSKDVVDYSEENFAIVFAAMGVNMETARFFKSDFEENGSMDNVCLFLNLANDPTIERIITPRLALTTAEFLAYQCEKHVLVILTDMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEG--RNGSITQIPILTMPNDDITHPIPDLTGYITEGQIYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTR 412          
BLAST of ATP synthase subunit alpha vs. UniProt/SwissProt
Match: sp|P19483|ATPA_BOVIN (ATP synthase subunit alpha, mitochondrial OS=Bos taurus OX=9913 GN=ATP5F1A PE=1 SV=1)

HSP 1 Score: 905.205 bits (2338), Expect = 0.000e+0
Identity = 439/520 (84.42%), Postives = 478/520 (91.92%), Query Frame = 3
Query:  132 ARQIHVSSSL--NAEIPEVTSILESAIMGQSSQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFEQDYLKYFLANHQDLLKNIREAGVISEETDTKMKQIVTDFIKDFE 1685
            AR +H S+S        EV+SILE  I+G  + V+LEETGRVLSIGDGIARV+GL+N+QAEEMVEFSSGLKGM+LNLE DNVGVVVFGNDKLIKEGD+VKRTGAIVDVP+G+ELLGRVVDALGN IDGKGP+    R RVGLKAPGIIPR SV+EPMQTG+KAVDSLVPIGRGQRELIIGDRQTGKT+IAIDTIINQKRFNDG DEKKKLYCIYVAIGQKRSTVAQLVKRL++ADAMKYTIVVSATASDAAPLQYL+PYSGC+MGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKM+D +GGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQT+AMKQVAG MKLELAQYREVAAFAQFGSDLDA+TQQLL+RGVRLTELLKQGQY PMAIE+Q+ VIYAGVRGYLDK++PSKITKFE  +L + ++ HQ LL  IR  G ISEE+D K+K+IVT+F+  FE
Sbjct:   33 ARNLHASNSRLQKTGTAEVSSILEERILGADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKARRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVISQHQALLSKIRTDGKISEESDAKLKEIVTNFLAGFE 552          
BLAST of ATP synthase subunit alpha vs. UniProt/SwissProt
Match: sp|P80021|ATPA_PIG (ATP synthase subunit alpha, mitochondrial OS=Sus scrofa OX=9823 GN=ATP5F1A PE=1 SV=2)

HSP 1 Score: 904.82 bits (2337), Expect = 0.000e+0
Identity = 439/520 (84.42%), Postives = 478/520 (91.92%), Query Frame = 3
Query:  132 ARQIHVSSSL--NAEIPEVTSILESAIMGQSSQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFEQDYLKYFLANHQDLLKNIREAGVISEETDTKMKQIVTDFIKDFE 1685
            AR +H S++        EV+SILE  I+G  + V+LEETGRVLSIGDGIARV+GL+N+QAEEMVEFSSGLKGM+LNLE DNVGVVVFGNDKLIKEGD+VKRTGAIVDVP+G+ELLGRVVDALGN IDGKGP+    R RVGLKAPGIIPR SV+EPMQTG+KAVDSLVPIGRGQRELIIGDRQTGKT+IAIDTIINQKRFNDG DEKKKLYCIYVAIGQKRSTVAQLVKRL++ADAMKYTIVVSATASDAAPLQYL+PYSGC+MGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKM+D +GGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQT+AMKQVAG MKLELAQYREVAAFAQFGSDLDA+TQQLL+RGVRLTELLKQGQY PMAIE+Q+ VIYAGVRGYLDK++PSKITKFE  +L + ++ HQ LL  IR  G ISEETD K+K+IVT+F+  FE
Sbjct:   33 ARNLHASNTRLQKTGTAEVSSILEERILGADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKTRRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYAPMAIEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVISQHQALLGKIRADGKISEETDAKLKEIVTNFLAGFE 552          
BLAST of ATP synthase subunit alpha vs. UniProt/SwissProt
Match: sp|Q03265|ATPA_MOUSE (ATP synthase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1a PE=1 SV=1)

HSP 1 Score: 902.894 bits (2332), Expect = 0.000e+0
Identity = 438/520 (84.23%), Postives = 479/520 (92.12%), Query Frame = 3
Query:  132 ARQIHVSSSL--NAEIPEVTSILESAIMGQSSQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFEQDYLKYFLANHQDLLKNIREAGVISEETDTKMKQIVTDFIKDFE 1685
            AR +H S++        E++SILE  I+G  + V+LEETGRVLSIGDGIARV+GL+N+QAEEMVEFSSGLKGM+LNLE DNVGVVVFGNDKLIKEGDVVKRTGAIVDVP+G+ELLGRVVDALGN IDGKGP+    R RVGLKAPGIIPR SV+EPMQTG+KAVDSLVPIGRGQRELIIGDRQTGKT+IAIDTIINQKRFNDG DEKKKLYCIYVAIGQKRSTVAQLVKRL++ADAMKYTIVVSATASDAAPLQYL+PYSGC+MGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKM+D +GGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQT+AMKQVAG MKLELAQYREVAAFAQFGSDLDA+TQQLL+RGVRLTELLKQGQY PMAIE+Q+ VIYAGVRGYLDK++PSKITKFE  +L + ++ HQ LL NIR  G ISE++D K+K+IVT+F+  FE
Sbjct:   33 ARNLHASNTRLQKTGTAEMSSILEERILGADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKTRRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDSFGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVISQHQSLLGNIRSDGKISEQSDAKLKEIVTNFLAGFE 552          
BLAST of ATP synthase subunit alpha vs. UniProt/SwissProt
Match: sp|P15999|ATPA_RAT (ATP synthase subunit alpha, mitochondrial OS=Rattus norvegicus OX=10116 GN=Atp5f1a PE=1 SV=2)

HSP 1 Score: 902.123 bits (2330), Expect = 0.000e+0
Identity = 437/519 (84.20%), Postives = 479/519 (92.29%), Query Frame = 3
Query:  135 RQIHVSSSL--NAEIPEVTSILESAIMGQSSQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFEQDYLKYFLANHQDLLKNIREAGVISEETDTKMKQIVTDFIKDFE 1685
            R +H S++        E++SILE  I+G  + V+LEETGRVLSIGDGIARV+GL+N+QAEEMVEFSSGLKGM+LNLE DNVGVVVFGNDKLIKEGD+VKRTGAIVDVP+GDELLGRVVDALGN IDGKGP+   +R RVGLKAPGIIPR SV+EPMQTG+KAVDSLVPIGRGQRELIIGDRQTGKT+IAIDTIINQKRFNDG DEKKKLYCIYVAIGQKRSTVAQLVKRL++ADAMKYTIVVSATASDAAPLQYL+PYSGC+MGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKM+D +GGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQT+AMKQVAG MKLELAQYREVAAFAQFGSDLDA+TQQLL+RGVRLTELLKQGQY PMAIE+Q+ VIYAGVRGYLDK++PSKITKFE  +L + ++ HQ LL NIR  G ISE++D K+K+IVT+F+  FE
Sbjct:   34 RNLHASNTRLQKTGTAEMSSILEERILGADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGDELLGRVVDALGNAIDGKGPVGSKIRRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDSFGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKITKFESAFLSHVVSQHQSLLGNIRSDGKISEQSDAKLKEIVTNFLAGFE 552          
BLAST of ATP synthase subunit alpha vs. UniProt/SwissProt
Match: sp|Q5R546|ATPA_PONAB (ATP synthase subunit alpha, mitochondrial OS=Pongo abelii OX=9601 GN=ATP5F1A PE=2 SV=1)

HSP 1 Score: 901.353 bits (2328), Expect = 0.000e+0
Identity = 436/520 (83.85%), Postives = 479/520 (92.12%), Query Frame = 3
Query:  132 ARQIHVSSSL--NAEIPEVTSILESAIMGQSSQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFEQDYLKYFLANHQDLLKNIREAGVISEETDTKMKQIVTDFIKDFE 1685
            AR  H S++        E++SILE  I+G  + V+LEETGRVLSIGDGIARV+GL+N+QAEEMVEFSSGLKGM+LNLE DNVGVVVFGNDKLIKEGD+VKRTGAIVDVP+G+ELLGRVVDALGN IDGKGP++   R RVGLKAPGIIPR SV+EPMQTG+KAVDSLVPIGRGQRELIIGDRQTGKT+IAIDTIINQKRFNDG+DEKKKLYCIYVAIGQKRSTVAQLVKRL++ADAMKYTIVVSATASDAAPLQYL+PYSGC+MGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKM+D +GGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQT+AMKQVAG MKLELAQYREVAAFAQFGSDLDA+TQQLL+RGVRLTELLKQGQY PMAIE+Q+ VIYAGVRGYLDK++PSKITKFE  +L + ++ HQ LL  IR  G ISE++D K+K+IVT+F+  FE
Sbjct:   33 ARNFHASNTHLQKTGTAEMSSILEERILGADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPISSKTRRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVVSQHQALLGTIRADGKISEQSDAKLKEIVTNFLAGFE 552          
BLAST of ATP synthase subunit alpha vs. TrEMBL
Match: A0A0R3T1Y6 (ATP synthase subunit alpha OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS919 PE=3 SV=1)

HSP 1 Score: 934.865 bits (2415), Expect = 0.000e+0
Identity = 457/518 (88.22%), Postives = 483/518 (93.24%), Query Frame = 3
Query:  132 ARQIHVSSSLNAEIPEVTSILESAIMGQSSQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFEQDYLKYFLANHQDLLKNIREAGVISEETDTKMKQIVTDFIKDFE 1685
            AR I  ++   A+ PE +SILE  I+GQS QVNLEETGRVLSIGDGIARVYGL NIQAEEMVEFSSGLKGMALNLE DNVGVVVFGNDKLIKEGD+VKR GAIVDVP+G+ELLGRVVDALGNPIDG G +    R RVG+KAPGIIPRTSVKEPMQTG+KAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFN+GADEKKKLYCIYVAIGQKRSTVAQLV+RL+ ADAMKYTIVVSATASDAAPLQYL+PYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSD YGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLE ELF+KGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDA+TQ LLNRGVRLTELLKQGQYVPMAIE+Q+VVIYAGVRG+LDKMDPSKITKFEQD+LKYF ANHQD+LK IRE G IS E D K+K IVTDF+  ++
Sbjct:   27 ARHISTTNKYYAQSPEFSSILEERILGQSQQVNLEETGRVLSIGDGIARVYGLNNIQAEEMVEFSSGLKGMALNLEPDNVGVVVFGNDKLIKEGDIVKRAGAIVDVPVGEELLGRVVDALGNPIDGLGAIGAKKRQRVGIKAPGIIPRTSVKEPMQTGMKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNEGADEKKKLYCIYVAIGQKRSTVAQLVRRLTVADAMKYTIVVSATASDAAPLQYLAPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDQYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLENELFFKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDATTQALLNRGVRLTELLKQGQYVPMAIEEQVVVIYAGVRGHLDKMDPSKITKFEQDFLKYFQANHQDILKTIREVGEISPELDEKLKTIVTDFLASYQ 544          
BLAST of ATP synthase subunit alpha vs. TrEMBL
Match: A0A5K3F4K1 (ATP synthase subunit alpha OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 933.71 bits (2412), Expect = 0.000e+0
Identity = 461/546 (84.43%), Postives = 496/546 (90.84%), Query Frame = 3
Query:   54 MALMKVALTALKRVPQSSFKINQI--SLARQIHVSSSLNAEIPEVTSILESAIMGQSSQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFEQDYLKYFLANHQDLLKNIREAGVISEETDTKMKQIVTDFIKDFE 1685
            M+ ++  +  + + P S FK   +  +  R +  S+ L A+ PE +SILE  I+G S QVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLE DNVGVVVFGNDKLIKEGD+VKR GAIVDVP+G+ELLGRVVDALGNPIDG G ++   R RVG+KAPGIIPRTSVKEPMQTG+KAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLV+RL+ A AMKYTIVVSATASDAAPLQYL+PYSGCAMGEYFRD+GKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSD YGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLE ELF+KGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDA+TQ LLNRGVRLTELLKQGQYVPMAIE+Q+VVIYAGVRG+LDKMDPSKITKFEQD+LKYF ANHQD+LK IRE G IS E D K+K IVTDF+  ++
Sbjct:    1 MSFLRSVVPLVIKTPGSIFKAAPLVTNAVRHVSTSNRLFAQSPEFSSILEERILGLSQQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLEPDNVGVVVFGNDKLIKEGDIVKRAGAIVDVPVGEELLGRVVDALGNPIDGLGAISAKKRQRVGVKAPGIIPRTSVKEPMQTGMKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVRRLTIAGAMKYTIVVSATASDAAPLQYLAPYSGCAMGEYFRDSGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDQYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLENELFFKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDATTQALLNRGVRLTELLKQGQYVPMAIEEQVVVIYAGVRGHLDKMDPSKITKFEQDFLKYFQANHQDILKTIREVGEISPELDEKLKTIVTDFLAGYQ 546          
BLAST of ATP synthase subunit alpha vs. TrEMBL
Match: A0A3P6HMQ3 (ATP synthase subunit alpha OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS1156 PE=3 SV=1)

HSP 1 Score: 930.243 bits (2403), Expect = 0.000e+0
Identity = 456/517 (88.20%), Postives = 483/517 (93.42%), Query Frame = 3
Query:  135 RQIHVSSSLNAEIPEVTSILESAIMGQSSQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFEQDYLKYFLANHQDLLKNIREAGVISEETDTKMKQIVTDFIKDFE 1685
            R +  S+ L A+ PE +SILE  I+G S QVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLE DNVGVVVFGNDKLIKEGD+VKR GAIVDVP+G+ELLGRVVDALGNPIDG G ++   R RVG+KAPGIIPRTSVKEPMQTG+KAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLV+RL+ A AMKYTIVVSATASDAAPLQYL+PYSGCAMGEYFRD+GKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSD YGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLE ELF+KGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDA+TQ LLNRGVRLTELLKQGQYVPMAIE+Q+VVIYAGVRG+LDKMDPSKITKFEQD+LKYF ANHQD+LK IRE G IS E D K+K IVTDF+  ++
Sbjct:    7 RHVSTSNRLFAQSPEFSSILEERILGLSQQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLEPDNVGVVVFGNDKLIKEGDIVKRAGAIVDVPVGEELLGRVVDALGNPIDGLGAISAKKRQRVGVKAPGIIPRTSVKEPMQTGMKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVRRLTIAGAMKYTIVVSATASDAAPLQYLAPYSGCAMGEYFRDSGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDQYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLENELFFKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDATTQALLNRGVRLTELLKQGQYVPMAIEEQVVVIYAGVRGHLDKMDPSKITKFEQDFLKYFQANHQDILKTIREVGEISPELDEKLKTIVTDFLAGYQ 523          
BLAST of ATP synthase subunit alpha vs. TrEMBL
Match: A0A504X5S3 (ATP synthase subunit alpha OS=Fasciola gigantica OX=46835 GN=FGIG_02476 PE=3 SV=1)

HSP 1 Score: 929.858 bits (2402), Expect = 0.000e+0
Identity = 454/541 (83.92%), Postives = 497/541 (91.87%), Query Frame = 3
Query:   66 KVALTALKRVPQSSFKINQIS-LARQIHVSSSLNAEIPEVTSILESAIMGQSSQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFEQDYLKYFLANHQDLLKNIREAGVISEETDTKMKQIVTDFIKDFE 1685
            + ++ AL+++P+    +  ++  A ++  SSSLNA +PE +SILE  I+ Q+ Q NLEETGRVLSIGDGIARVYGLKNIQA+EMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKR GAIVDVP+G+ELLGRVVDALGNPIDGKG L    R RVGLKAPGIIPR SV+EPMQTG+KAVDSLVPIGRGQRELIIGDRQTGKTAIA+DTIINQKRFND A+EKKKLYCIYVAIGQKRSTVAQLVKRL++ D+MKYTIVVSATASDAAPLQYL+PYSGCAMGE+FRD+G+HALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKM+D YGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELF+KGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQ LLNRGVRLTELLKQGQYVPMAIE Q+VVIYAGVRGYLDK+DPSKIT+FEQD++K+ LANHQDLLK IRE G +   TD K+KQIV DF+  ++
Sbjct:    5 RTSVVALRQLPKLQKLVAPVACWAPKLSTSSSLNAGVPEFSSILEERILSQTVQTNLEETGRVLSIGDGIARVYGLKNIQADEMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKRAGAIVDVPVGEELLGRVVDALGNPIDGKGALNTKSRQRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTAIAVDTIINQKRFNDSAEEKKKLYCIYVAIGQKRSTVAQLVKRLNDTDSMKYTIVVSATASDAAPLQYLAPYSGCAMGEFFRDSGRHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFHKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQLLLNRGVRLTELLKQGQYVPMAIELQVVVIYAGVRGYLDKLDPSKITQFEQDFVKFVLANHQDLLKTIREDGELKPATDEKLKQIVIDFLAGYQ 545          
BLAST of ATP synthase subunit alpha vs. TrEMBL
Match: A0A0X3PFQ3 (ATP synthase subunit alpha OS=Schistocephalus solidus OX=70667 GN=ATPA PE=3 SV=1)

HSP 1 Score: 929.472 bits (2401), Expect = 0.000e+0
Identity = 456/546 (83.52%), Postives = 496/546 (90.84%), Query Frame = 3
Query:   54 MALMKVALTALKRVPQSSFKINQISLARQIHVSSS--LNAEIPEVTSILESAIMGQSSQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFEQDYLKYFLANHQDLLKNIREAGVISEETDTKMKQIVTDFIKDFE 1685
            M+L++   +   R P S  ++  ++     H+S+S  L A+ PE +SILE  I+G S ++NLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLE DNVGVVVFGNDKLIKEGD+VKR GAIVDVP+G+ELLGRVVDALGNPIDG G +    R RVG KAPGIIPRTSVKEPMQTG+KAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFN+GADEKKKLYCIYVAIGQKRSTVAQLVKRL+ A AMKYTIVVSATASDAAPLQYL+PYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKM+D YGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLE+ELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQ LLNRGVRLTELLKQ QYVPM+IE+Q+VVIY+GVRG+LDKMDP+KITKFE D+LKYFLANHQD+LK +RE G IS E D K+K+IVT+F+  ++
Sbjct:    1 MSLLRKLFSVTARAPSSLSRVAPVTPNGVKHLSTSQKLLAQSPEFSSILEERILGLSQKINLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLEADNVGVVVFGNDKLIKEGDIVKRAGAIVDVPVGEELLGRVVDALGNPIDGLGAVATKARRRVGTKAPGIIPRTSVKEPMQTGMKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNEGADEKKKLYCIYVAIGQKRSTVAQLVKRLTVAGAMKYTIVVSATASDAAPLQYLAPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDSYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLESELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQALLNRGVRLTELLKQNQYVPMSIEEQVVVIYSGVRGHLDKMDPAKITKFESDFLKYFLANHQDILKTLREVGEISPELDAKLKKIVTEFLGGYQ 546          
BLAST of ATP synthase subunit alpha vs. Ensembl Cavefish
Match: atp5fa1 (ATP synthase F1 subunit alpha [Source:NCBI gene;Acc:103036804])

HSP 1 Score: 901.353 bits (2328), Expect = 0.000e+0
Identity = 436/503 (86.68%), Postives = 470/503 (93.44%), Query Frame = 3
Query:  177 EVTSILESAIMGQSSQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFEQDYLKYFLANHQDLLKNIREAGVISEETDTKMKQIVTDFIKDFE 1685
            EV+SILE  I+G  +  +LEETGRVLSIGDGIARVYGL+N+QAEEMVEFSSGLKGM+LNLE DNVGVVVFGNDKLIKEGD+VKRTGAIVDVP+G+ELLGRVVDALGN IDGKGPL    R RVGLKAPGIIPR SV+EPMQTG+KAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDG DEKKKLYCIYVAIGQKRSTVAQLVKRL++ADAMKYTIVVSATASDAAPLQYL+PYSGC+MGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKM+D +GGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQT+AMKQVAG MKLELAQYREVAAFAQFGSDLDA+TQQLLNRGVRLTELLKQGQY PMAIE+Q+ VIYAGVRG+LDKM+PSKITKFE+ +L++ L+ HQDLL  IR  G ISE  D K+K++V +F+  FE
Sbjct:   50 EVSSILEEKILGADTGADLEETGRVLSIGDGIARVYGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPLGSKQRRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGTDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDNFGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLNRGVRLTELLKQGQYAPMAIEEQVTVIYAGVRGHLDKMEPSKITKFERAFLQHILSQHQDLLATIRADGKISEAADAKLKEVVLNFLSSFE 552          
BLAST of ATP synthase subunit alpha vs. Ensembl Cavefish
Match: atp6v1b2 (V-type proton ATPase subunit B, brain isoform [Source:NCBI gene;Acc:103034689])

HSP 1 Score: 101.293 bits (251), Expect = 2.695e-22
Identity = 85/303 (28.05%), Postives = 143/303 (47.19%), Query Frame = 3
Query:  429 TGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSV--KEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQ----KRFNDGADEKKKLYCI-YVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYF-RDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQ 1313
            TG I+  P+ +++LGRV +  G PID +GP T      + +    I P+  +  +E +QTG+ A+D +  I RGQ+  I          IA   I  Q    K+  D  D  ++ + I + A+G    T            +M    +    A+D    + ++P       E+      KH L+I  D+S  A A R++S      PGR  +PG ++   + + ERA ++      GS+T +P++     D++  IP     IT+GQI+++ +L  + I P INV  S+SR+  +A  + M +
Sbjct:  114 TGDILRTPVSEDMLGRVFNGSGKPID-RGP-TVLAEDYLDIMGQPINPQCRIYPEEMIQTGISAIDGMNSIARGQKIPIFSAAGLPHNEIAAQ-ICRQAGLVKKSKDVMDYSEENFAIVFAAMGVNMETARFFKSDFEENGSMDNVCLFLNLANDPTIERIITPRLALTAAEFLAYQCEKHVLVILTDMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEG--RNGSITQIPILTMPNDDITHPIPDLTGYITEGQIYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTR 411          
BLAST of ATP synthase subunit alpha vs. Ensembl Cavefish
Match: atp5f1b (ATP synthase F1 subunit beta [Source:NCBI gene;Acc:103028518])

HSP 1 Score: 96.6709 bits (239), Expect = 9.791e-21
Identity = 78/305 (25.57%), Postives = 136/305 (44.59%), Query Frame = 3
Query:  387 GNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNA------DAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRD-NGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRV 1280
            G + L++ G  V  TGA + +P+G E LGR+++ +G PID +GP+T    A +  +AP     +  +E + TG+K VD L P  +G +  + G    GKT + ++ I N  + + G       Y ++  +G++      L   +  +      D      +V    ++    +     +G  + EYFRD  G+  L+  D++ +   A  ++S LL R P    Y   +      + ER          GS+T++  I   A D++   P    +  D    L   +   GI PA++   S SR+
Sbjct:  105 GTEGLVR-GQKVLDTGAPIRIPVGPETLGRIMNVIGEPIDERGPITTKTTAPIHAEAPEFTDMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGG-------YSVFAGVGERTREGNDLYHEMIESGVINLKDTTSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKK----GSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRI 397          
BLAST of ATP synthase subunit alpha vs. Ensembl Cavefish
Match: atp6v1ba (ATPase, H+ transporting, lysosomal, V1 subunit B, member a [Source:ZFIN;Acc:ZDB-GENE-030711-3])

HSP 1 Score: 86.6557 bits (213), Expect = 8.637e-18
Identity = 79/288 (27.43%), Postives = 130/288 (45.14%), Query Frame = 3
Query:  474 RVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSV--KEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQ----KRFNDGADEKKKLYCI-YVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYF-RDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQ 1313
            RV +  G PID +GP    + A   L    I P+  +  +E +QTG+ A+D +  I RGQ+  I          IA   I  Q    ++  D  D     + I + A+G    T            +M    +    A+D    + ++P       EY      KH L+I  D+S  A A R++S      PGR  +PG ++   + + ERA ++      GS+T +P++     D++  IP     IT+GQ++++ +L  + I P INV  S+SR+  +A  + M +
Sbjct:   28 RVFNGSGKPID-RGP---TVLAEDYLDIMAINPQCRIYPEEMIQTGISAIDGMNSIARGQKIPIFSAAGLPHNEIAAQ-ICRQAGLVQKSKDVMDYSSDNFAIVFAAMGVNMETARFFKSDFEENGSMDNVCLFLNLANDPTIERIITPRLALTSAEYLAYQCEKHVLVILTDMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEG--RNGSITQIPILTMPNDDITHPIPDLTGYITEGQVYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTR 308          
BLAST of ATP synthase subunit alpha vs. Ensembl Cavefish
Match: ENSAMXT00000015199.2 (V-type proton ATPase catalytic subunit A-like [Source:NCBI gene;Acc:103045016])

HSP 1 Score: 63.929 bits (154), Expect = 3.144e-10
Identity = 64/251 (25.50%), Postives = 115/251 (45.82%), Query Frame = 3
Query:  588 EPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSN---------ADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRL---LERAAK---MSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIF--LETELFYKGIRPAINVGLSVSRVGSA 1289
             P+ TG + +D+L P  +G    I G    GKT I+    +++   +D          IYV  G++ + ++++++                MK T +V+ T++     +  S Y+G  + EYFRD G +  ++ D  S+ A A R++S  L   P    YP    YL +RL    ERA +   + +    GS++ +  +    GD S  + +  + I   Q+F  L+ +L  +   P++N  +S S+   A
Sbjct:  225 HPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQS--LSKYSNSD--------VIIYVGCGERGNEMSEVLRDFPELTMEVDGKVESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPADSGYPA---YLGARLASFYERAGRVKCLGNPEREGSVSIVGAVSPPGGDFSDPVTSATLGIV--QVFWGLDKKLAQRKHFPSVNWLISYSKYTRA 460          
BLAST of ATP synthase subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002562.1 (pep scaffold:Pmarinus_7.0:GL480249:15961:22717:1 gene:ENSPMAG00000002332.1 transcript:ENSPMAT00000002562.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 707.983 bits (1826), Expect = 0.000e+0
Identity = 348/372 (93.55%), Postives = 360/372 (96.77%), Query Frame = 3
Query:  342 MALNLERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQY 1457
            MALNLE DNVGVVVFGNDKLIKEGDVVKRTGAIVDVP+G++LLGRVVDALGN IDGKGPL   LR RVGLKAPGIIPR SV+EPMQTG+KAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDG DEKKKLYCIYVAIGQKRSTVAQLVKRL+NADAM+YTIVVSATASDAAPLQYL+PYSGC+MGE+FRDNG HALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKM+D + GGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAG MKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQY
Sbjct:    1 MALNLEPDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPVGEQLLGRVVDALGNAIDGKGPLGAKLRRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGNDEKKKLYCIYVAIGQKRSTVAQLVKRLTNADAMRYTIVVSATASDAAPLQYLAPYSGCSMGEFFRDNGMHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDNFKGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGSMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQY 372          
BLAST of ATP synthase subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006391.1 (pep scaffold:Pmarinus_7.0:GL477089:2:6303:1 gene:ENSPMAG00000005764.1 transcript:ENSPMAT00000006391.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 654.44 bits (1687), Expect = 0.000e+0
Identity = 315/365 (86.30%), Postives = 339/365 (92.88%), Query Frame = 3
Query:  594 MQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFEQDYLKYFLANHQDLLKNIREAGVISEETDTKMKQIVTDFIKDFEG 1688
            MQTG+KAVDSLVP  RGQRELIIGDRQT KTAIAIDTIINQKRFNDG DEKKKLYCIYVAIGQKRSTVAQLVKRL++ADAM+YTIVVSATASDAAPLQYL+PYSGC+MGE+FRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKM+D + GGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAG MKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIE+Q+ +IYAGVRGYLDK++PSKITKFE  +L +  +  +++L  IR  G IS+ TD K+KQIVT F+  F+ 
Sbjct:    1 MQTGIKAVDSLVPTFRGQRELIIGDRQTWKTAIAIDTIINQKRFNDGTDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMRYTIVVSATASDAAPLQYLAPYSGCSMGEFFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDNFKGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGSMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEEQVAIIYAGVRGYLDKLEPSKITKFESAFLLHIQSQQKEVLATIRTEGKISDATDVKLKQIVTSFLSTFDA 365          
BLAST of ATP synthase subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001377.1 (pep scaffold:Pmarinus_7.0:GL481380:275:12300:1 gene:ENSPMAG00000001232.1 transcript:ENSPMAT00000001377.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 101.679 bits (252), Expect = 2.963e-23
Identity = 88/306 (28.76%), Postives = 147/306 (48.04%), Query Frame = 3
Query:  429 TGAIVDVPIGDELLGRVVDALGNPIDGKGP--LTQNLRARVGLKAPGIIPRTSV--KEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQ----KRFNDGADEKKKLYCI-YVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQ-YLSPYSGCAMGEYF-RDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQ 1313
            TG I+  P+ +++LGRV +  G PID KGP  L ++    +G   P I P++ +  +E +QTG+ A+D++  I RGQ+  I          IA   I  Q    K+  D  D     + I + A+G    T            +M    +    A+D   ++  ++P       E+      KH L+I  D+S  A A R++S      PGR  +PG ++   + + ERA ++      GS+T +P++     D++  IP     IT+GQI+++ +L  + I P INV  S+SR+  +A  + M +
Sbjct:   37 TGDILRTPVSEDMLGRVFNGSGKPID-KGPPVLAEDYLDIMGPGQP-INPQSRIYPEEMIQTGISAIDTMNSIARGQKIPIFSAAGLPHNEIAAQ-ICRQGGLVKQGKDTMDYSDDNFAIVFAAMGVNMETARFFKSDFEENGSMDNVCLFLNLANDYTMIERIITPRLALTTAEFLAYQCEKHVLVILTDMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEG--RNGSITQIPILTMPNDDITHPIPDLTGYITEGQIYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTR 337          
BLAST of ATP synthase subunit alpha vs. Ensembl Yeast
Match: ATP1 (Alpha subunit of the F1 sector of mitochondrial F1F0 ATP synthase; which is a large, evolutionarily conserved enzyme complex required for ATP synthesis; F1 translationally regulates ATP6 and ATP8 expression to achieve a balanced output of ATP synthase genes encoded in nucleus and mitochondria; phosphorylated; N-terminally propionylated in vivo [Source:SGD;Acc:S000000195])

HSP 1 Score: 773.467 bits (1996), Expect = 0.000e+0
Identity = 370/510 (72.55%), Postives = 437/510 (85.69%), Query Frame = 3
Query:  153 SSLNAEIPEVTSILESAIMGQSSQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFEQDYLKYFLANHQDLLKNIREAGVISEETDTKMKQIVTDFIKDF 1682
            +S  A+  EV+SILE  I G S + NL ETGRVL++GDGIARV+GL NIQAEE+VEFSSG+KGMALNLE   VG+V+FG+D+L+KEG++VKRTG IVDVP+G  LLGRVVDALGNPIDGKGP+    R+R  +KAPGI+PR SV EP+QTG+KAVD+LVPIGRGQRELIIGDRQTGKTA+A+DTI+NQKR+N+G+DE KKLYC+YVA+GQKRSTVAQLV+ L   DAMKY+I+V+ATAS+AAPLQYL+P++  ++GE+FRDNGKHALI+YDDLSKQAVAYRQ+SLLLRRPPGREAYPGDVFYLHSRLLERAAK+S+  G GSLTALPVIETQ GDVSAYIPTNVISITDGQIFLE ELFYKGIRPAINVGLSVSRVGSAAQ KA+KQVAG +KL LAQYREVAAFAQFGSDLDAST+Q L RG RLT+LLKQ QY P+A E+Q+ +IYAGV G+LD ++ S+I +FE  +L Y  +NH +LL  IRE G +S+E    +K     F+  F
Sbjct:   36 ASTKAQPTEVSSILEERIKGVSDEANLNETGRVLAVGDGIARVFGLNNIQAEELVEFSSGVKGMALNLEPGQVGIVLFGSDRLVKEGELVKRTGNIVDVPVGPGLLGRVVDALGNPIDGKGPIDAAGRSRAQVKAPGILPRRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSEKEGSGSLTALPVIETQGGDVSAYIPTNVISITDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQFGSDLDASTKQTLVRGERLTQLLKQNQYSPLATEEQVPLIYAGVNGHLDGIELSRIGEFESSFLSYLKSNHNELLTEIREKGELSKELLASLKSATESFVATF 545          
BLAST of ATP synthase subunit alpha vs. Ensembl Yeast
Match: VMA2 (Subunit B of V1 peripheral membrane domain of vacuolar H+-ATPase; electrogenic proton pump found throughout the endomembrane system; contains nucleotide binding sites; also detected in the cytoplasm; protein abundance increases in response to DNA replication stress; human homolog ATP6V1B1, implicated in autosomal-recessive distal renal tubular acidosis (RTA) with sensorineural deafness, complements yeast null mutant [Source:SGD;Acc:S000000331])

HSP 1 Score: 112.079 bits (279), Expect = 1.228e-26
Identity = 97/337 (28.78%), Postives = 155/337 (45.99%), Query Frame = 3
Query:  336 KGMALNLERDNVGVVVF-GNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIP--RTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQ-------KRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYF-RDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQ 1313
            +G  L +  D   V VF G   +  +   V+ TG  + +P+ +++LGR+ D  G PID  GP        + +    I P  R   +E + TGV A+D++  I RGQ+  I          IA   I  Q       K  +DG +E      ++ A+G    T     +      +++ T +    A+D    + ++P       EY      +H L I  D+S  A A R++S      PGR  YPG ++   S + ERA ++      GS+T +P++     D++  IP     IT+GQIF++ +L  KGI P INV  S+SR+  +A  + M +
Sbjct:   64 QGQVLEIRGDRAIVQVFEGTSGIDVKKTTVEFTGESLRIPVSEDMLGRIFDGSGRPID-NGPKV-FAEDYLDINGSPINPYARIYPEEMISTGVSAIDTMNSIARGQKIPIFSASGLPHNEIAAQ-ICRQAGLVRPTKDVHDGHEEN--FSIVFAAMGVNLETARFFKQDFEENGSLERTSLFLNLANDPTIERIITPRLALTTAEYLAYQTERHVLTILTDMSSYADALREVSAAREEVPGRRGYPGYMYTDLSTIYERAGRVEG--RNGSITQIPILTMPNDDITHPIPDLTGYITEGQIFVDRQLHNKGIYPPINVLPSLSRLMKSAIGEGMTR 393          
BLAST of ATP synthase subunit alpha vs. Ensembl Yeast
Match: ATP2 (Beta subunit of the F1 sector of mitochondrial F1F0 ATP synthase; which is a large, evolutionarily conserved enzyme complex required for ATP synthesis; F1 translationally regulates ATP6 and ATP8 expression to achieve a balanced output of ATP synthase genes encoded in nucleus and mitochondria; phosphorylated [Source:SGD;Acc:S000003882])

HSP 1 Score: 100.523 bits (249), Expect = 6.686e-23
Identity = 95/389 (24.42%), Postives = 170/389 (43.70%), Query Frame = 3
Query:  387 GNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLS-----NADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRD-NGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQT-KAMKQVAGRMKLELAQYREVA-AFAQFGSD-LDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKM 1526
            G + L++ G+ V  TG  + VP+G E LGR+++ +G PID +GP+   LR  +    P    +++  E ++TG+K VD L P  RG +  + G    GKT    + I N  + + G       + ++  +G++      L + +      N +      +V    ++    +     +G  + EYFRD  G+  L+  D++ +   A  ++S LL R P    Y   +      L ER          GS+T++  +   A D++   P    +  D    L   +   GI PA++   S SR+  AA   +    VA +++  L  Y+ +    A  G D L    +  + R  ++   L Q    P A+ +    ++ G+ G L ++
Sbjct:   99 GTEGLVR-GEKVLDTGGPISVPVGRETLGRIINVIGEPIDERGPIKSKLRKPIHADPPSFAEQSTSAEILETGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGG-------FSVFTGVGERTREGNDLYREMKETGVINLEGESKVALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKK----GSVTSVQAVYVPADDLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDAAVVGQEHYDVASKVQETLQTYKSLQDIIAILGMDELSEQDKLTVERARKIQRFLSQ----PFAVAE----VFTGIPGKLVRL 467          
BLAST of ATP synthase subunit alpha vs. Ensembl Yeast
Match: VMA1 (Subunit A of the V1 peripheral membrane domain of V-ATPase; protein precursor undergoes self-catalyzed splicing to yield the extein Tfp1p and the intein Vde (PI-SceI), which is a site-specific endonuclease; the V1 peripheral membrane domain of the vacuolar H+-ATPase (V-ATPase) has eight subunits; involved in methionine restriction extension of chronological lifespan in an autophagy-dependent manner [Source:SGD;Acc:S000002344])

HSP 1 Score: 61.6178 bits (148), Expect = 2.692e-10
Identity = 49/156 (31.41%), Postives = 79/156 (50.64%), Query Frame = 3
Query:  834 MKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRL---LERAAK---MSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIF--LETELFYKGIRPAINVGLSVSR 1277
            MK T +V+ T++     +  S Y+G  + EYFRD GK+  +I D  S+ A A R++S  L   P  + +P    YL ++L    ERA K   +      GS++ +  +    GD S  + T  + IT  Q+F  L+ +L  +   P+IN  +S S+
Sbjct:  767 MKRTTLVANTSNMPVAAREASIYTGITLAEYFRDQGKNVSMIADSSSRWAEALREISGRLGEMPADQGFPA---YLGAKLASFYERAGKAVALGSPDRTGSVSIVAAVSPAGGDFSDPVTTATLGIT--QVFWGLDKKLAQRKHFPSINTSVSYSK 917          
BLAST of ATP synthase subunit alpha vs. Ensembl Nematostella
Match: EDO27071 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAA0])

HSP 1 Score: 320.087 bits (819), Expect = 6.583e-107
Identity = 151/208 (72.60%), Postives = 176/208 (84.62%), Query Frame = 3
Query:  933 DNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFEQ 1556
            D+G+H L++YDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAK+SD  G GSLTALP+IETQAGDVSAYIPTNVISITDGQIFL++ELFY GIRPAINVGLSVSRVGSAAQ   MK++AG +KLELAQYREV  F +FGSDLD +TQ LL+RG  LT  L+Q +Y P+++E Q++VIYA V GY + +      + E+
Sbjct:    1 DSGRHCLVVYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDALGAGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLDSELFYNGIRPAINVGLSVSRVGSAAQVAMMKKLAGTLKLELAQYREVLGFTKFGSDLDKATQMLLDRGSLLTTALRQNKYSPLSVEKQVLVIYATVNGYFENVTNDNFMEVEK 208          
BLAST of ATP synthase subunit alpha vs. Ensembl Nematostella
Match: EDO42756 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0L1])

HSP 1 Score: 105.531 bits (262), Expect = 3.931e-24
Identity = 84/305 (27.54%), Postives = 147/305 (48.20%), Query Frame = 3
Query:  429 TGAIVDVPIGDELLGRVVDALGNPIDGKGP--LTQNLRARVGLKAPGIIPRTSV--KEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQK---RFNDGA--DEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYF-RDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQ 1313
            TG I+  P+ +++LGRV +  G  ID +GP  L ++    + ++   I P + +  +E +QTG+ A+D++  I RGQ+  I          IA   I  Q    +FN G   D +     ++ A+G    T     +      +M+   +    A+D    + ++P       E+      KH L+I  D+S  A A R++S      PGR  +PG ++   + + ERA ++      GS+T +P++     D++  IP     IT+GQI+++ +L  + I P INV  S+SR+  +A  + M +
Sbjct:   96 TGDILRTPVSEDMLGRVFNGSGKAID-RGPPVLAEDF---LDIQGQPINPWSRIYPEEMIQTGISAIDTMNSIARGQKIPIFSAAGLPHNDIAAQ-ICRQAGLVKFNKGVMDDHEDNFAIVFAAMGVNMETARFFKQDFEENGSMENVCLFLNLANDPTIERIITPRLALTTAEFLAYQCEKHVLVILTDMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATVYERAGRVEG--RNGSITQIPILTMPNDDITHPIPDLTGYITEGQIYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTR 393          
BLAST of ATP synthase subunit alpha vs. Ensembl Nematostella
Match: EDO34337 (ATP synthase subunit beta [Source:UniProtKB/TrEMBL;Acc:A7SPP0])

HSP 1 Score: 98.5969 bits (244), Expect = 3.874e-22
Identity = 77/305 (25.25%), Postives = 138/305 (45.25%), Query Frame = 3
Query:  387 GNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNA------DAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRD-NGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRV 1280
            G + LI+ G     TG  + +P+G E LGR+++ +G PID +GP+  + RA +  +AP  +  ++ +E ++TG+K VD L P  +G +  + G    GKT + ++ I N  + + G       Y ++  +G++      L   +  +      D      +V    ++    +     +G  + EYFRD  G+  L+  D++ +   A  ++S LL R P    Y   +      + ER          GS+T++  I   A D++   P    +  D    L   +   GI PA++   S SR+
Sbjct:    3 GTEGLIR-GQKCVDTGGPITIPVGPETLGRIINVIGEPIDERGPVETDKRAAIHAEAPEFVEMSTEQEILETGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGG-------YSVFAGVGERTREGNDLYHEMIMSGVINLKDKSSKVALVYGQMNEPPGARARVALTGLTVAEYFRDKEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKK----GSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRGIAELGIYPAVDPLDSTSRI 295          
BLAST of ATP synthase subunit alpha vs. Ensembl Nematostella
Match: EDO33624 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRN1])

HSP 1 Score: 73.559 bits (179), Expect = 1.091e-13
Identity = 67/252 (26.59%), Postives = 118/252 (46.83%), Query Frame = 3
Query:  573 RTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSN---------ADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRL---LERAAKMSDVYGG---GSLTALPVIETQAGDVSAYIPTNVISITDGQIF--LETELFYKGIRPAINVGLSVSR 1277
            + +   P+ TG + +D+L P  +G    I G    GKT I+     +  +F++          IYV  G++ + ++++++                MK T +V+ T++     +  S Y+G  + EYFRD G H  ++ D  S+ A A R++S  L   P    YP    YL +RL    ERA ++S +      GS+T +  +    GD S  + +  ++I   Q+F  L+ +L  +   P+IN  +S S+
Sbjct:  218 KMAANHPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQ----SLSKFSNSD------VIIYVGCGERGNEMSEVLRDFPELTVEINGQVESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGHHVSMMADSTSRWAEALREISGRLAEMPADSGYPA---YLGARLASFYERAGRVSCLGNPQREGSVTIVGAVSPPGGDFSDPVTSATLNIV--QVFWGLDKKLAQRKHFPSINWLISYSK 454          
BLAST of ATP synthase subunit alpha vs. Ensembl Medaka
Match: atp5fa1 (ATP synthase subunit alpha, mitochondrial [Source:NCBI gene;Acc:101169376])

HSP 1 Score: 905.59 bits (2339), Expect = 0.000e+0
Identity = 444/551 (80.58%), Postives = 492/551 (89.29%), Query Frame = 3
Query:   54 MALMKVALTALKRVPQSS-FKINQISL----ARQIHVSSSL--NAEIPEVTSILESAIMGQSSQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFEQDYLKYFLANHQDLLKNIREAGVISEETDTKMKQIVTDFIKDFE 1685
            M  ++VA + ++ +PQ + F    I+     A+ +H S          EV+SILE  I+G ++  +LEETGRVLSIGDGIARVYGL+N+QAEEMVEFSSGLKGM+LNLE DNVGVVVFGNDKLIKEGD+VKRTGAIVDVP+G+ELLGRVVDALGN IDGKGPL   +R RVGLKAPGIIPR SV+EPMQTG+KAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFN+G DEKKKLYCIYVAIGQKRSTVAQLVKRL++ DAMKYTIVVSATASDAAPLQYL+PYSGC+MGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKM+D +GGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQT+AMKQVAG MKLELAQYREVAAFAQFGSDLDA+TQQLLNRGVRLTELLKQGQY PMAIE+Q+ VIYAGVRG+LDKM+PSKITKFE+ +L++ L+ HQDLL  I+  G ISE +D K+KQ+V +F+  FE
Sbjct:    1 MLSVRVAASIVRNLPQRARFASKNIAAVCVGAKTLHTSRPWLQKTGTAEVSSILEEKILGANTSADLEETGRVLSIGDGIARVYGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPLGSKVRRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNEGTDEKKKLYCIYVAIGQKRSTVAQLVKRLTDTDAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDNFGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLNRGVRLTELLKQGQYCPMAIEEQVAVIYAGVRGHLDKMEPSKITKFEKAFLQHILSQHQDLLAAIKADGKISEASDAKLKQVVLNFLSSFE 551          
BLAST of ATP synthase subunit alpha vs. Ensembl Medaka
Match: atp5fa1 (ATP synthase subunit alpha, mitochondrial [Source:NCBI gene;Acc:101160076])

HSP 1 Score: 905.205 bits (2338), Expect = 0.000e+0
Identity = 440/533 (82.55%), Postives = 480/533 (90.06%), Query Frame = 3
Query:   87 KRVPQSSFKINQISLARQIHVSSSLNAEIPEVTSILESAIMGQSSQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFEQDYLKYFLANHQDLLKNIREAGVISEETDTKMKQIVTDFIKDFE 1685
            K +P +   +N +      H          EV+SILE  I+G  +  +LEETGRVLSIGDGIARVYGL+N+QAEEMVEFSSGLKGM+LNLE DNVGVVVFGNDKLIKEGD+VKRTGAIVDVP+G+ELLGRVVDALGN IDGKGPL   +R RVGLKAPGIIPR SV+EPMQTG+KAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDG DEKKKLYCIYVAIGQKRSTVAQLVKRL++ DAMKYTIVVSATASDAAPLQYL+PYSGC+MGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKM+D +GGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQT+AMKQVAG MKLELAQYREVAAFAQFGSDLDA+TQQLLNRGVRLTELLKQGQY PMAIE+Q+ VIYAGVRG+LDKM+PSKITKFE+ +L++ L+ HQDLL  I+  G ISE++D K+KQIV +F+  FE
Sbjct:   23 KTIPAACVGVNHL----HTHRPWLQKTGTAEVSSILEEKILGADTSADLEETGRVLSIGDGIARVYGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPLGSKIRRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGTDEKKKLYCIYVAIGQKRSTVAQLVKRLTDTDAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDNFGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLNRGVRLTELLKQGQYCPMAIEEQVAVIYAGVRGHLDKMEPSKITKFEKAFLQHILSQHQDLLSAIKTDGKISEQSDAKLKQIVLNFLSSFE 551          
BLAST of ATP synthase subunit alpha vs. Ensembl Medaka
Match: atp5fa1 (ATP synthase subunit alpha, mitochondrial [Source:NCBI gene;Acc:101160076])

HSP 1 Score: 903.664 bits (2334), Expect = 0.000e+0
Identity = 441/520 (84.81%), Postives = 479/520 (92.12%), Query Frame = 3
Query:  126 SLARQIHVSSSLNAEIPEVTSILESAIMGQSSQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFEQDYLKYFLANHQDLLKNIREAGVISEETDTKMKQIVTDFIKDFE 1685
            SL R+    S L+    EV+SILE  I+G  +  +LEETGRVLSIGDGIARVYGL+N+QAEEMVEFSSGLKGM+LNLE DNVGVVVFGNDKLIKEGD+VKRTGAIVDVP+G+ELLGRVVDALGN IDGKGPL   +R RVGLKAPGIIPR SV+EPMQTG+KAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDG DEKKKLYCIYVAIGQKRSTVAQLVKRL++ DAMKYTIVVSATASDAAPLQYL+PYSGC+MGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKM+D +GGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQT+AMKQVAG MKLELAQYREVAAFAQFGSDLDA+TQQLLNRGVRLTELLKQGQY PMAIE+Q+ VIYAGVRG+LDKM+PSKITKFE+ +L++ L+ HQDLL  I+  G ISE++D K+KQIV +F+  FE
Sbjct:   13 SLPRRAGFVSILST--AEVSSILEEKILGADTSADLEETGRVLSIGDGIARVYGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPLGSKIRRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGTDEKKKLYCIYVAIGQKRSTVAQLVKRLTDTDAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDNFGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLNRGVRLTELLKQGQYCPMAIEEQVAVIYAGVRGHLDKMEPSKITKFEKAFLQHILSQHQDLLSAIKTDGKISEQSDAKLKQIVLNFLSSFE 530          
BLAST of ATP synthase subunit alpha vs. Ensembl Medaka
Match: atp5fa1 (ATP synthase subunit alpha, mitochondrial [Source:NCBI gene;Acc:101169376])

HSP 1 Score: 902.508 bits (2331), Expect = 0.000e+0
Identity = 443/545 (81.28%), Postives = 489/545 (89.72%), Query Frame = 3
Query:   51 IMALMKVALTALKRVPQSSFKINQISLARQIHVSSSLNAEIPEVTSILESAIMGQSSQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFEQDYLKYFLANHQDLLKNIREAGVISEETDTKMKQIVTDFIKDFE 1685
            IM  ++VA + ++ +PQ           R   VS++      EV+SILE  I+G ++  +LEETGRVLSIGDGIARVYGL+N+QAEEMVEFSSGLKGM+LNLE DNVGVVVFGNDKLIKEGD+VKRTGAIVDVP+G+ELLGRVVDALGN IDGKGPL   +R RVGLKAPGIIPR SV+EPMQTG+KAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFN+G DEKKKLYCIYVAIGQKRSTVAQLVKRL++ DAMKYTIVVSATASDAAPLQYL+PYSGC+MGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKM+D +GGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQT+AMKQVAG MKLELAQYREVAAFAQFGSDLDA+TQQLLNRGVRLTELLKQGQY PMAIE+Q+ VIYAGVRG+LDKM+PSKITKFE+ +L++ L+ HQDLL  I+  G ISE +D K+KQ+V +F+  FE
Sbjct:   65 IMLSVRVAASIVRNLPQ-----------RARFVSTA------EVSSILEEKILGANTSADLEETGRVLSIGDGIARVYGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPLGSKVRRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNEGTDEKKKLYCIYVAIGQKRSTVAQLVKRLTDTDAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDNFGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLNRGVRLTELLKQGQYCPMAIEEQVAVIYAGVRGHLDKMEPSKITKFEKAFLQHILSQHQDLLAAIKADGKISEASDAKLKQVVLNFLSSFE 592          
BLAST of ATP synthase subunit alpha vs. Ensembl Medaka
Match: atp6v1ba (V-type proton ATPase subunit B, brain isoform-like [Source:NCBI gene;Acc:101173571])

HSP 1 Score: 101.679 bits (252), Expect = 2.120e-22
Identity = 87/305 (28.52%), Postives = 144/305 (47.21%), Query Frame = 3
Query:  429 TGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPG--IIPRTSV--KEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQ----KRFNDGADEKKKLYCI-YVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYF-RDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQ 1313
            TG I+  P+ +++LGRV +  G PID +GP   N+ A   L   G  I P+  +  +E +QTG+ A+D +  I RGQ+  I          IA   I  Q    ++  D  D   + + I + A+G    T            +M    +    A+D    + ++P       EY      KH L+I  D+S  A A R++S      PGR  +PG ++   + + ERA ++      GS+T +P++     D++  IP     IT+GQ++++ +L  + I P INV  S+SR+  +A  + M +
Sbjct:  106 TGDILRTPVSEDMLGRVFNGSGKPID-RGP---NVLAEDYLDIMGQPINPQCRIYPEEMIQTGISAIDGMNSIARGQKIPIFSAAGLPHNEIAAQ-ICRQAGLVQKSKDVMDYSAENFAIVFAAMGVNMETARFFKSDFEENGSMDNVCLFLNLANDPTIERIITPRLALTTAEYLAYQCEKHVLVILTDMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEG--RNGSITQIPILTMPNDDITHPIPDLTGYITEGQVYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTR 403          
BLAST of ATP synthase subunit alpha vs. Planmine SMEST
Match: SMESG000004897.1 (SMESG000004897.1)

HSP 1 Score: 1107.43 bits (2863), Expect = 0.000e+0
Identity = 547/547 (100.00%), Postives = 547/547 (100.00%), Query Frame = 3
Query:   54 MALMKVALTALKRVPQSSFKINQISLARQIHVSSSLNAEIPEVTSILESAIMGQSSQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFEQDYLKYFLANHQDLLKNIREAGVISEETDTKMKQIVTDFIKDFEGAA 1694
            MALMKVALTALKRVPQSSFKINQISLARQIHVSSSLNAEIPEVTSILESAIMGQSSQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFEQDYLKYFLANHQDLLKNIREAGVISEETDTKMKQIVTDFIKDFEGAA
Sbjct:    1 MALMKVALTALKRVPQSSFKINQISLARQIHVSSSLNAEIPEVTSILESAIMGQSSQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFEQDYLKYFLANHQDLLKNIREAGVISEETDTKMKQIVTDFIKDFEGAA 547          
BLAST of ATP synthase subunit alpha vs. Planmine SMEST
Match: SMESG000004897.1 (SMESG000004897.1)

HSP 1 Score: 1101.66 bits (2848), Expect = 0.000e+0
Identity = 544/544 (100.00%), Postives = 544/544 (100.00%), Query Frame = 3
Query:   63 MKVALTALKRVPQSSFKINQISLARQIHVSSSLNAEIPEVTSILESAIMGQSSQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFEQDYLKYFLANHQDLLKNIREAGVISEETDTKMKQIVTDFIKDFEGAA 1694
            MKVALTALKRVPQSSFKINQISLARQIHVSSSLNAEIPEVTSILESAIMGQSSQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFEQDYLKYFLANHQDLLKNIREAGVISEETDTKMKQIVTDFIKDFEGAA
Sbjct:    1 MKVALTALKRVPQSSFKINQISLARQIHVSSSLNAEIPEVTSILESAIMGQSSQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALNLERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFEQDYLKYFLANHQDLLKNIREAGVISEETDTKMKQIVTDFIKDFEGAA 544          
BLAST of ATP synthase subunit alpha vs. Planmine SMEST
Match: SMESG000022877.1 (SMESG000022877.1)

HSP 1 Score: 102.449 bits (254), Expect = 7.533e-23
Identity = 85/344 (24.71%), Postives = 157/344 (45.64%), Query Frame = 3
Query:  339 GMALNLERDNVGVVVF-GNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGP--LTQNLRARVGLKAPGIIPRTSV--KEPMQTGVKAVDSLVPIGRGQRELIIGD-------------RQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYF-RDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTKAMKQ 1313
            G  L +      V VF G   +  +    + TG I+  P+ +++LGR+ +  G P DG GP  + ++    + ++   I P + +  KE +QTG+ ++D +  I RGQ+  I                RQ G   +   ++++        D +     ++ A+G    T    ++      +M+   +    A+D    + ++P       EY      KH L+I  D++  A A R++S      PGR  +PG ++   + + ERA ++      GS+T +P++     D++  IP     IT+GQI+++ +L  + I P INV  S+SR+  +A  + M +
Sbjct:   63 GQVLEISGSKAVVQVFEGTSGIDAKHTTCEFTGDILRTPVSEDMLGRIFNGSGKPKDG-GPEIMAEDF---LDIQGQAINPSSRIYPKEMIQTGISSIDVMNSIARGQKIPIFSASGLPHNEIAAQICRQAGLVRLPGKSVLD--------DHQDNFAIVFAAMGVNMETARFFMQDFKEHGSMENVCLFLNLANDPTIERIITPRIALTTAEYLAYQCEKHVLVILTDMTSYAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEG--RNGSITQIPILTMPNDDITHPIPDLTGYITEGQIYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEEMTR 392          
BLAST of ATP synthase subunit alpha vs. Planmine SMEST
Match: SMESG000036539.1 (SMESG000036539.1)

HSP 1 Score: 99.7525 bits (247), Expect = 6.424e-22
Identity = 76/306 (24.84%), Postives = 140/306 (45.75%), Query Frame = 3
Query:  387 GNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPIDGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLSN-------ADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDN-GKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDVYGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRV 1280
            G + L++ G      G+ + +P+G E LGR+++ +G PID +GP+   +++ +  +AP  +  ++ +E ++TG+K VD L P  RG +  + G    GKT + ++ I N  R + G       Y ++  +G++      L   +          D  K ++V             ++  +G  + EYFRD  G+  L+  D++ +   A  ++S LL R P    Y   +      + ER    +     GS+T++  I   A D++   P    +  D    L   +   GI PA++   S+SR+
Sbjct:  112 GTEGLVR-GQECHDVGSSIRIPVGPETLGRIMNVIGEPIDERGPINSKMQSSIHQEAPDFVDMSTEQEILETGIKVVDLLAPYARGGKIGLFGGAGVGKTVLIMELINNIARAHGG-------YSVFAGVGERTREGNDLYHEMITTGVIDLKGDKSKVSLVYGQMNEPPGARARVA-LTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTNK----GSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRGIAELGIYPAVDPLDSISRI 404          
BLAST of ATP synthase subunit alpha vs. Planmine SMEST
Match: SMESG000028157.1 (SMESG000028157.1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.909e-12
Identity = 69/251 (27.49%), Postives = 114/251 (45.42%), Query Frame = 3
Query:  591 PMQTGVKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQLVKRLS---------NADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRL---LERAAKMSDVYGG----GSLTALPVIETQAGDVSAYIPTNVISITDGQIF--LETELFYKGIRPAINVGLSVSRVGSA 1289
            P+ TG + +D+L P  +G    I G    GKT I+       K  N           IYV  G++ + ++++++            N   MK T +V+ T++     +  S Y+G  + EYFRD G +  ++ D  S+ A A R++S  L   P    YP    YL +RL    ERA ++  + G     GS+T +  +    GD S  + +  + I   Q+F  L+ +L  +   P+IN  +S S+   A
Sbjct:  221 PLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSL---SKYSNSDV-------IIYVGCGERGNEMSEVLQDFPELTIEVDGVNESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNVSMMADSTSRWAEALREISGRLAEMPAESGYPA---YLGARLASFYERAGRVQCIGGPEERQGSVTIVGAVSPPGGDFSDPVTSATLGIV--QVFWGLDKKLAQRKHFPSINWLISHSKYTRA 456          
The following BLAST results are available for this feature:
BLAST of ATP synthase subunit alpha vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP5F1A0.000e+083.85ATP synthase F1 subunit alpha [Source:HGNC Symbol;... [more]
ATP5F1A0.000e+083.85ATP synthase F1 subunit alpha [Source:HGNC Symbol;... [more]
ATP5F1A0.000e+085.86ATP synthase F1 subunit alpha [Source:HGNC Symbol;... [more]
ATP5F1A0.000e+080.38ATP synthase F1 subunit alpha [Source:HGNC Symbol;... [more]
ATP5F1A1.143e-12285.51ATP synthase F1 subunit alpha [Source:HGNC Symbol;... [more]
back to top
BLAST of ATP synthase subunit alpha vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp-10.000e+082.90ATP synthase subunit alpha, mitochondrial [Source... [more]
atp-10.000e+082.90ATP synthase subunit alpha, mitochondrial [Source... [more]
atp-10.000e+082.90ATP synthase subunit alpha, mitochondrial [Source... [more]
atp-10.000e+082.90ATP synthase subunit alpha, mitochondrial [Source... [more]
atp-10.000e+082.90ATP synthase subunit alpha, mitochondrial [Source... [more]
back to top
BLAST of ATP synthase subunit alpha vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
blw0.000e+081.85gene:FBgn0011211 transcript:FBtr0071883[more]
Vha555.681e-2325.29gene:FBgn0005671 transcript:FBtr0301661[more]
Vha555.681e-2325.29gene:FBgn0005671 transcript:FBtr0082670[more]
Vha555.681e-2325.29gene:FBgn0005671 transcript:FBtr0082671[more]
ATPsynbeta4.121e-2025.25gene:FBgn0010217 transcript:FBtr0089186[more]
back to top
BLAST of ATP synthase subunit alpha vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp5fa10.000e+086.48ATP synthase F1 subunit alpha [Source:ZFIN;Acc:ZDB... [more]
atp6v1ba4.730e-2227.72ATPase, H+ transporting, lysosomal, V1 subunit B, ... [more]
atp6v1ba4.730e-2227.72ATPase, H+ transporting, lysosomal, V1 subunit B, ... [more]
atp6v1b25.762e-2228.20ATPase H+ transporting V1 subunit B2 [Source:ZFIN;... [more]
atp6v1b25.762e-2228.20ATPase H+ transporting V1 subunit B2 [Source:ZFIN;... [more]
back to top
BLAST of ATP synthase subunit alpha vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gh20.000e+080.62growth hormone 2 [Source:Xenbase;Acc:XB-GENE-58720... [more]
gh20.000e+084.78growth hormone 2 [Source:Xenbase;Acc:XB-GENE-58720... [more]
gh20.000e+081.25growth hormone 2 [Source:Xenbase;Acc:XB-GENE-58720... [more]
gh20.000e+086.68growth hormone 2 [Source:Xenbase;Acc:XB-GENE-58720... [more]
gh20.000e+085.05growth hormone 2 [Source:Xenbase;Acc:XB-GENE-58720... [more]
back to top
BLAST of ATP synthase subunit alpha vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atp5a10.000e+084.23ATP synthase, H+ transporting, mitochondrial F1 co... [more]
Atp5a10.000e+084.23ATP synthase, H+ transporting, mitochondrial F1 co... [more]
Atp5a10.000e+086.25ATP synthase, H+ transporting, mitochondrial F1 co... [more]
Atp5a10.000e+086.25ATP synthase, H+ transporting, mitochondrial F1 co... [more]
Atp6v1b22.400e-2228.20ATPase, H+ transporting, lysosomal V1 subunit B2 [... [more]
back to top
BLAST of ATP synthase subunit alpha vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P19483|ATPA_BOVIN0.000e+084.42ATP synthase subunit alpha, mitochondrial OS=Bos t... [more]
sp|P80021|ATPA_PIG0.000e+084.42ATP synthase subunit alpha, mitochondrial OS=Sus s... [more]
sp|Q03265|ATPA_MOUSE0.000e+084.23ATP synthase subunit alpha, mitochondrial OS=Mus m... [more]
sp|P15999|ATPA_RAT0.000e+084.20ATP synthase subunit alpha, mitochondrial OS=Rattu... [more]
sp|Q5R546|ATPA_PONAB0.000e+083.85ATP synthase subunit alpha, mitochondrial OS=Pongo... [more]
back to top
BLAST of ATP synthase subunit alpha vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3T1Y60.000e+088.22ATP synthase subunit alpha OS=Rodentolepis nana OX... [more]
A0A5K3F4K10.000e+084.43ATP synthase subunit alpha OS=Mesocestoides corti ... [more]
A0A3P6HMQ30.000e+088.20ATP synthase subunit alpha OS=Mesocestoides corti ... [more]
A0A504X5S30.000e+083.92ATP synthase subunit alpha OS=Fasciola gigantica O... [more]
A0A0X3PFQ30.000e+083.52ATP synthase subunit alpha OS=Schistocephalus soli... [more]
back to top
BLAST of ATP synthase subunit alpha vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp5fa10.000e+086.68ATP synthase F1 subunit alpha [Source:NCBI gene;Ac... [more]
atp6v1b22.695e-2228.05V-type proton ATPase subunit B, brain isoform [Sou... [more]
atp5f1b9.791e-2125.57ATP synthase F1 subunit beta [Source:NCBI gene;Acc... [more]
atp6v1ba8.637e-1827.43ATPase, H+ transporting, lysosomal, V1 subunit B, ... [more]
ENSAMXT00000015199.23.144e-1025.50V-type proton ATPase catalytic subunit A-like [Sou... [more]
back to top
BLAST of ATP synthase subunit alpha vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000002562.10.000e+093.55pep scaffold:Pmarinus_7.0:GL480249:15961:22717:1 g... [more]
ENSPMAT00000006391.10.000e+086.30pep scaffold:Pmarinus_7.0:GL477089:2:6303:1 gene:E... [more]
ENSPMAT00000001377.12.963e-2328.76pep scaffold:Pmarinus_7.0:GL481380:275:12300:1 gen... [more]
back to top
BLAST of ATP synthase subunit alpha vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
ATP10.000e+072.55Alpha subunit of the F1 sector of mitochondrial F1... [more]
VMA21.228e-2628.78Subunit B of V1 peripheral membrane domain of vacu... [more]
ATP26.686e-2324.42Beta subunit of the F1 sector of mitochondrial F1F... [more]
VMA12.692e-1031.41Subunit A of the V1 peripheral membrane domain of ... [more]
back to top
BLAST of ATP synthase subunit alpha vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO270716.583e-10772.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO427563.931e-2427.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343373.874e-2225.25ATP synthase subunit beta [Source:UniProtKB/TrEMB... [more]
EDO336241.091e-1326.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ATP synthase subunit alpha vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp5fa10.000e+080.58ATP synthase subunit alpha, mitochondrial [Source:... [more]
atp5fa10.000e+082.55ATP synthase subunit alpha, mitochondrial [Source:... [more]
atp5fa10.000e+084.81ATP synthase subunit alpha, mitochondrial [Source:... [more]
atp5fa10.000e+081.28ATP synthase subunit alpha, mitochondrial [Source:... [more]
atp6v1ba2.120e-2228.52V-type proton ATPase subunit B, brain isoform-like... [more]
back to top
BLAST of ATP synthase subunit alpha vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000004897.10.000e+0100.00SMESG000004897.1[more]
SMESG000004897.10.000e+0100.00SMESG000004897.1[more]
SMESG000022877.17.533e-2324.71SMESG000022877.1[more]
SMESG000036539.16.424e-2224.84SMESG000036539.1[more]
SMESG000028157.11.909e-1227.49SMESG000028157.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005014 ID=SMED30005014|Name=ATP synthase subunit alpha|organism=Schmidtea mediterranea sexual|type=transcript|length=1790bp
AAATTATATACAACTTTCCATTGAGTATTTGTTTATTTTCCAATTAATAA
ATAATGGCCTTGATGAAAGTTGCTTTAACGGCTTTAAAGAGAGTTCCACA
GTCTTCTTTCAAGATTAATCAAATTTCATTGGCACGCCAAATTCATGTTT
CTAGTTCCCTTAATGCTGAAATACCTGAAGTTACTAGTATTTTAGAAAGT
GCAATTATGGGTCAATCTTCGCAAGTTAATCTTGAAGAAACTGGTAGGGT
TTTGAGTATTGGAGATGGAATAGCTAGAGTTTACGGATTGAAAAATATTC
AAGCAGAAGAAATGGTTGAATTTTCTTCAGGTCTTAAAGGAATGGCACTC
AATTTAGAAAGAGATAATGTTGGTGTTGTAGTTTTTGGAAATGATAAATT
GATTAAAGAAGGTGATGTTGTTAAAAGAACCGGGGCTATTGTTGACGTTC
CGATTGGAGACGAATTGCTTGGAAGAGTAGTTGATGCTTTAGGAAATCCT
ATAGATGGGAAAGGACCACTTACACAAAATCTTAGAGCTCGAGTTGGGTT
AAAAGCTCCCGGTATAATTCCTAGAACATCTGTTAAAGAACCAATGCAGA
CTGGTGTGAAAGCAGTCGACAGCTTAGTACCAATAGGTCGAGGACAGCGA
GAATTGATTATTGGTGACAGGCAAACTGGTAAAACAGCTATTGCTATAGA
TACTATAATTAATCAAAAGCGATTTAATGATGGTGCGGATGAAAAGAAAA
AACTTTACTGCATTTACGTTGCTATTGGACAAAAACGATCCACAGTTGCT
CAGCTTGTGAAACGTCTATCTAATGCTGATGCCATGAAATATACAATTGT
AGTTTCAGCAACAGCTTCGGATGCTGCTCCATTGCAGTATTTATCACCCT
ATTCAGGTTGTGCTATGGGTGAATATTTCCGTGATAATGGAAAACATGCT
CTAATTATATATGACGATTTATCGAAACAAGCTGTCGCCTATAGACAAAT
GTCTTTGCTTCTACGAAGACCTCCAGGCAGAGAAGCATATCCCGGAGATG
TATTTTATTTGCATTCAAGGTTACTTGAAAGAGCAGCTAAAATGAGTGAT
GTCTACGGGGGTGGATCGTTGACAGCCTTGCCAGTTATTGAAACTCAAGC
TGGAGATGTATCAGCTTATATTCCAACAAATGTTATATCTATTACTGATG
GCCAAATATTTCTTGAAACCGAATTATTTTACAAGGGTATTCGACCAGCT
ATTAATGTGGGTTTGTCTGTTAGTAGAGTTGGATCCGCAGCTCAAACAAA
AGCTATGAAACAGGTTGCTGGTAGAATGAAATTAGAATTGGCTCAGTATC
GTGAGGTAGCTGCTTTCGCTCAATTCGGATCTGATTTAGATGCATCAACC
CAACAACTTTTAAATCGTGGTGTAAGGTTAACTGAATTGTTGAAACAAGG
ACAATATGTACCTATGGCAATTGAAGATCAAATTGTGGTTATTTATGCTG
GGGTCAGAGGATATTTAGACAAAATGGATCCATCTAAAATCACCAAATTC
GAACAGGATTACTTAAAATACTTTTTAGCAAATCATCAAGATCTACTTAA
AAATATTAGGGAGGCTGGAGTTATTAGTGAAGAAACTGACACTAAAATGA
AGCAAATCGTTACAGATTTCATTAAAGATTTTGAAGGCGCTGCATAAACC
TTAGTTTATATTTTAATAGAATATATAAATTGGTCTAATTTGTTAATAAA
TTCTGCGTGTGTGCATTAAATTATGATATTTCAGTATAAT
back to top

protein sequence of SMED30005014-orf-1

>SMED30005014-orf-1 ID=SMED30005014-orf-1|Name=SMED30005014-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=548bp
MALMKVALTALKRVPQSSFKINQISLARQIHVSSSLNAEIPEVTSILESA
IMGQSSQVNLEETGRVLSIGDGIARVYGLKNIQAEEMVEFSSGLKGMALN
LERDNVGVVVFGNDKLIKEGDVVKRTGAIVDVPIGDELLGRVVDALGNPI
DGKGPLTQNLRARVGLKAPGIIPRTSVKEPMQTGVKAVDSLVPIGRGQRE
LIIGDRQTGKTAIAIDTIINQKRFNDGADEKKKLYCIYVAIGQKRSTVAQ
LVKRLSNADAMKYTIVVSATASDAAPLQYLSPYSGCAMGEYFRDNGKHAL
IIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSDV
YGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAI
NVGLSVSRVGSAAQTKAMKQVAGRMKLELAQYREVAAFAQFGSDLDASTQ
QLLNRGVRLTELLKQGQYVPMAIEDQIVVIYAGVRGYLDKMDPSKITKFE
QDYLKYFLANHQDLLKNIREAGVISEETDTKMKQIVTDFIKDFEGAA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:1902600hydrogen ion transmembrane transport
GO:0046034ATP metabolic process
GO:0015992proton transport
GO:0015986ATP synthesis coupled proton transport
GO:0015991ATP hydrolysis coupled proton transport
GO:0006754ATP biosynthetic process
GO:0006810transport
GO:0006811ion transport
GO:0099132ATP hydrolysis coupled cation transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000028Category 2 cell
PLANA:0000110pharynx progenitor cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR038376ATP_synth_asu_C_sf
IPR033732ATP_synth_F1_a
IPR036121ATPase_F1/V1/A1_a/bsu_N_sf
IPR004100ATPase_F1/V1/A1_a/bsu_N
IPR005294ATP_synth_F1_asu
IPR000194ATPase_F1/V1/A1_a/bsu_nucl-bd
IPR023366ATP_synth_asu-like_sf
IPR027417P-loop_NTPase
IPR000793ATP_synth_asu_C
IPR020003ATPase_a/bsu_AS
Vocabulary: cellular component
TermDefinition
GO:0045261proton-transporting ATP synthase complex, catalytic core F(1)
GO:0033178proton-transporting two-sector ATPase complex, catalytic domain
Vocabulary: molecular function
TermDefinition
GO:0046961proton-transporting ATPase activity, rotational mechanism
GO:0046933proton-transporting ATP synthase activity, rotational mechanism
GO:0005524ATP binding
GO:0016820hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances
GO:0000166nucleotide binding
GO:0032559adenyl ribonucleotide binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR023366ATP synthase subunit alpha, N-terminal domain-like superfamilyGENE3DG3DSA:2.40.30.20coord: 8..77
e-value: 6.7E-35
score: 120.5
IPR000793ATP synthase, alpha subunit, C-terminalPFAMPF00306ATP-synt_ab_Ccoord: 363..488
e-value: 6.7E-48
score: 162.2
IPR005294ATP synthase, F1 complex, alpha subunitTIGRFAMTIGR00962TIGR00962coord: 5..492
e-value: 2.5E-243
score: 806.2
IPR005294ATP synthase, F1 complex, alpha subunitPIRSFPIRSF039088F_ATPase_subunit_alphacoord: 1..495
e-value: 4.2E-280
score: 926.9
IPR004100ATPase, F1/V1/A1 complex, alpha/beta subunit, N-terminal domainPFAMPF02874ATP-synt_ab_Ncoord: 10..76
e-value: 9.5E-19
score: 67.7
IPR000194ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domainPFAMPF00006ATP-synt_abcoord: 133..356
e-value: 3.5E-74
score: 249.1
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 78..363
e-value: 2.8E-133
score: 445.3
NoneNo IPR availablePANTHERPTHR43089F1 ATP SYNTHASE SUBUNIT ALPHAcoord: 2..493
NoneNo IPR availablePANTHERPTHR43089:SF6ATP SYNTHASE SUBUNIT ALPHA, MITOCHONDRIALcoord: 2..493
NoneNo IPR availableCDDcd18116ATP-synt_F1_alpha_Ncoord: 11..77
e-value: 1.27974E-35
score: 124.873
NoneNo IPR availableCDDcd18113ATP-synt_F1_alpha_Ccoord: 367..492
e-value: 1.35368E-68
score: 213.382
NoneNo IPR availableSUPERFAMILYSSF47917C-terminal domain of alpha and beta subunits of F1 ATP synthasecoord: 364..492
IPR038376ATP synthase, alpha subunit, C-terminal domain superfamilyGENE3DG3DSA:1.20.150.20coord: 364..494
e-value: 4.3E-59
score: 200.1
IPR020003ATPase, alpha/beta subunit, nucleotide-binding domain, active sitePROSITEPS00152ATPASE_ALPHA_BETAcoord: 347..356
IPR033732ATP synthase, F1 complex, alpha subunit nucleotide-binding domainCDDcd01132F1_ATPase_alphacoord: 78..359
e-value: 0.0
score: 598.862
IPR036121ATPase, F1/V1/A1 complex, alpha/beta subunit, N-terminal domain superfamilySUPERFAMILYSSF50615N-terminal domain of alpha and beta subunits of F1 ATP synthasecoord: 5..78
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 80..362