Roc domain-containing protein

Overview
NameRoc domain-containing protein
Smed IDSMED30005007
Length (bp)8614
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Roc domain-containing protein (SMED30005007) t-SNE clustered cells

Violin plots show distribution of expression levels for Roc domain-containing protein (SMED30005007) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Roc domain-containing protein (SMED30005007) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Roc domain-containing protein (SMED30005007) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005007

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30005007SMESG000073246.1 dd_Smed_v4_11669_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30005007SMESG000073246.1 dd_Smed_v4_11669_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30005007SMESG000073246.1 dd_Smed_v4_29498_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005007SMESG000073246.1 dd_Smed_v4_11669_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30005007SMESG000073246.1 dd_Smed_v4_11669_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Roc domain-containing protein vs. Ensembl Human
Match: LRRK2 (leucine rich repeat kinase 2 [Source:HGNC Symbol;Acc:HGNC:18618])

HSP 1 Score: 119.013 bits (297), Expect = 1.192e-25
Identity = 130/511 (25.44%), Postives = 229/511 (44.81%), Query Frame = 3
Query: 4698 LVIQHQSIRYVPDSIQQLENLEILDLSYNPLLEXXXXXXXXXXXXXXXXXXHC------PSISVPPPEIIARGTSLSYLKYLLAKTVVCNRTKLMFVGLGEAGKTSLLHALRSDENSAKEIIEQQEKQVTDGIDITKWTVICHNE---EIQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIEHGD-LDFWLSSISCHSKYAPVFVVGTRCD-----QVQADMSCFSS--LKKR-YSQIEDFILVDSLSGT-GIKDLKQKLIHVTLNLP-----YMHQAIPSTILDLENQFTSIRSQKNY-ITYQEFQNIAISQGIFEKDVK-------SVIQILHDFGSIQYFDTEILK--NYVVINPQWIVDIMANVVSVVNQ---KIKNGIFYHENMKDVWDKFESKLFNWM---LNLTEEFDLTFPHPTMEPKANIVPCLLSEEEPEIEWPKF-SEQTLCKFYHINYKFEFLPAGLFNRIQVRLFDFT------------EAKKLWKYGMYF 6071
            L + H  ++ +P  I  LENL  LD+SYN  L     ++  +  I  L L           I     +II       +L+  L K V  NR KLM VG   +GKT+LL  L   + S     +   +  T GID+  W +   ++   ++  + WDFAG++ +Y+TH  F++++A+Y+ V+ + +G    D +  WL +I   +  +PV +VGT  D     Q +A MS  +   L KR +  I D+  V++   +  +  L++ +I+ +LN        + Q IP   ++LE    S R  KN  I +       + Q + E  ++         +  L++ G + +F    L+  +   + P+W+  IMA +++V  +   K   GI    +++    K      N+M     L E+F +  P   +  +  +VP  LS+  P IE P   + + + + Y + Y     P G ++R+  RL + +              +  W+ G+Y 
Sbjct: 1250 LHLSHNKLKEIPPEIGCLENLTSLDVSYNLELRSFPNEMGKLSKIWDLPLDELHLNFDFKHIGCKAKDII------RFLQQRLKKAVPYNRMKLMIVGNTGSGKTTLLQQLMKTKKS-----DLGMQSATVGIDVKDWPIQIRDKRKRDLVLNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARASSSPVILVGTHLDVSDEKQRKACMSKITKELLNKRGFPAIRDYHFVNATEESDALAKLRKTIINESLNFKIRDQLVVGQLIPDCYVELEKIILSER--KNVPIEFPVIDRKRLLQLVRENQLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKIMAQILTVKVEGCPKHPKGIISRRDVEKFLSKKRKFPKNYMSQYFKLLEKFQIALP---IGEEYLLVPSSLSDHRPVIELPHCENSEIIIRLYEMPY----FPMGFWSRLINRLLEISPYMLSGRERALRPNRMYWRQGIYL 1740          
BLAST of Roc domain-containing protein vs. Ensembl Human
Match: LRRK1 (leucine rich repeat kinase 1 [Source:HGNC Symbol;Acc:HGNC:18608])

HSP 1 Score: 99.3673 bits (246), Expect = 1.089e-19
Identity = 102/443 (23.02%), Postives = 184/443 (41.53%), Query Frame = 3
Query: 4860 SISVPPPEIIARGTS--LSYLKYLLAKTVVCNRTKLMFVGLGEAGKTSLLHALRSDENSAKEIIEQQEKQVTDGIDITKWTV------ICHNEEIQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIEH-GDLDFWLSSISCHSKYAPVFVVGTRCDQVQADMS--------------CFSSLKKRYSQIEDFIL-----VDSLSGTGIKDLKQKLIHVTLNLP----------YMHQAIPSTILDL------ENQFTSIRSQKNYITYQEFQNIAISQGIFE----KDVKSVIQILHDFGSIQYF--DTEILKNYVVINPQWIVDIMANVVSVVNQK--IKNGIFYHENMKD--VWDKFESKLFNWMLNLTEEFDLTFPHPTMEPKANIVPCLLSEEEPEIEWPKFSEQTLCKFYHINYKFEFLPAGLFNRIQVRLF 6026
            +IS  P EI   G    LSYL+  L K   C   K++ VG    GK++LL  L++    A +++  +       I  TKW +          E ++++ WD  G       +Q F ++KA+Y+VVW++  G E   +L FWL +I   +  A V VVGT  D ++A                 C S    R +   D        +   S  G + L+Q + HVT ++              + IP + L L      E Q  S      Y+T ++ + +       +    +D++S I  L + G++ +F   +  L+N   ++P W+ + +  + ++   +   KNG+   E+++   V   F  +          +F++  P   +   + ++P LL   +P ++       T      + +K  F+P G + R   R+ 
Sbjct:  606 TISNVPAEIQKEGPKAMLSYLRAQLRKAEKCKLMKMIIVGPPRQGKSTLLEILQT--GRAPQVVHGEAT-----IRTTKWELQRPAGSRAKVESVEFNVWDIGGPASMATVNQCFFTDKALYVVVWNLALGEEAVANLQFWLLNIEAKAPNAVVLVVGTHLDLIEAKFRVERIATLRAYVLALCRSPSGSRATGFPDITFKHLHEISCKSLEGQEGLRQLIFHVTCSMKDVGSTIGCQRLAGRLIPRSYLSLQEAVLAEQQRRSRDDDVQYLTDRQLEQLVEQTPDNDIKDYEDLQSAISFLIETGTLLHFPDTSHGLRNLYFLDPIWLSECLQRIFNIKGSRSVAKNGVIRAEDLRMLLVGTGFTQQTEEQYFQFLAKFEIALP---VANDSYLLPHLLP-SKPGLDTHGMRHPTANTIQRV-FKMSFVPVGFWQRFIARML 1036          
BLAST of Roc domain-containing protein vs. Ensembl Human
Match: MFHAS1 (malignant fibrous histiocytoma amplified sequence 1 [Source:HGNC Symbol;Acc:HGNC:16982])

HSP 1 Score: 89.7373 bits (221), Expect = 7.194e-17
Identity = 137/625 (21.92%), Postives = 232/625 (37.12%), Query Frame = 3
Query: 4116 QLKCLPRTIYSLKGLQRLIINQVKINTLP-DIYEFPNLKYLQIEKCPIKTYNDSNECXXXXXXXXXXXXXQTISNFICXXXXXXXXXXXXHGIESLPDEFGRLENMKELKLIGSPLYYELLKNDFIIKSDNLEFEYPEIGFYKVKENDKNPISFLPVADI---------FINVPRIGSGYSEPV----DVNSHGGFPMAILQLKKLITLVIQHQSIRYVPDSIQQLENLEILDLSYNPLLEXXXXXXXXXXXXXXXXXXHCPSISVPPPEIIARGTS--LSYLKYLL-AKTVVCNRTKLMFVGLGEAGKTSLLHALRSDENSAKEIIEQQEK-------QVTDGIDITKWTVICHNEEIQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQ-GIEH--GDLDFWLSSISCHSKYAPVFVVGTRCD--------------------QVQADMSCFSSLKKRYSQ--IEDFILVDSLS-----GTGIKDLKQKLIHVT--LN------------------------------------LPYMHQAIPSTILDLEN-QFTSIRSQKNYITYQEFQNIAISQGIFEKDVKSVIQILHDFGSIQYF-DTEILKNYVVINPQWIVDIM 5708
            QL   PR +  L  L+ L ++  ++  LP DI     LK L +    + T                      +    C   +L  + L  +G+++LP +F  L+ +K L L                 S NL  E+P               + LP+A +           +VP + SG    +    D N     P +I++L  L  LV+Q   I  +PD   QL  + +  +  NPL++                         PP E+  +G     +Y K L  ++  V  R KL+ +G   AGKT L H L  +          +EK        V+ GI++T WT    +  +++  +D AG + Y     FFLS  A+Y++V ++      H    +  +L  +     +A V +VGT  D                    Q + D    S L K   +    DF L  +       G   K+L+++  H    LN                                     P +H+ +P +   LE   F   ++Q+ ++++ +   + +  G+ E  ++S +  LH+ G + YF D+  LK +V  N   ++DI+
Sbjct:  192 QLTAFPRQLLQLVALEELDVSSNRLRGLPEDISALRALKILWLSGAELGT----------------------LPAGFCELASLESLMLDNNGLQALPAQFSCLQRLKMLNL-----------------SSNLFEEFPA--------------ALLPLAGLEELYLSRNQLTSVPSLISGLGRLLTLWLDNNRIRYLPDSIVELTGLEELVLQGNQIAVLPDHFGQLSRVGLWKIKDNPLIQ-------------------------PPYEVCMKGIPYIAAYQKELAHSQPAVQPRLKLLLMGHKAAGKTLLRHCLTEERVEGCPGGGDKEKCYPPSPPPVSKGIEVTSWTADA-SRGLRFIVYDLAGDESYEVIQPFFLSPGALYVLVVNLATYEPRHFPTTVGSFLHRVGARVPHAVVCIVGTHADLCGERELEEKCLDIHRQIALQEKHDAEGLSRLAKVVDEALARDFELRSASPHAAYYGVSDKNLRRRKAHFQYLLNHRLQILSPVLPVSCRDPRHLRRLRDKLLSVAEHREIFPNLHRVLPRSWQVLEELHFQPPQAQRLWLSWWDSARLGLQAGLTEDRLQSALSYLHESGKLLYFEDSPALKEHVFHNLTRLIDIL 737          
BLAST of Roc domain-containing protein vs. Ensembl Human
Match: MFHAS1 (malignant fibrous histiocytoma amplified sequence 1 [Source:HGNC Symbol;Acc:HGNC:16982])

HSP 1 Score: 89.7373 bits (221), Expect = 7.194e-17
Identity = 137/625 (21.92%), Postives = 232/625 (37.12%), Query Frame = 3
Query: 4116 QLKCLPRTIYSLKGLQRLIINQVKINTLP-DIYEFPNLKYLQIEKCPIKTYNDSNECXXXXXXXXXXXXXQTISNFICXXXXXXXXXXXXHGIESLPDEFGRLENMKELKLIGSPLYYELLKNDFIIKSDNLEFEYPEIGFYKVKENDKNPISFLPVADI---------FINVPRIGSGYSEPV----DVNSHGGFPMAILQLKKLITLVIQHQSIRYVPDSIQQLENLEILDLSYNPLLEXXXXXXXXXXXXXXXXXXHCPSISVPPPEIIARGTS--LSYLKYLL-AKTVVCNRTKLMFVGLGEAGKTSLLHALRSDENSAKEIIEQQEK-------QVTDGIDITKWTVICHNEEIQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQ-GIEH--GDLDFWLSSISCHSKYAPVFVVGTRCD--------------------QVQADMSCFSSLKKRYSQ--IEDFILVDSLS-----GTGIKDLKQKLIHVT--LN------------------------------------LPYMHQAIPSTILDLEN-QFTSIRSQKNYITYQEFQNIAISQGIFEKDVKSVIQILHDFGSIQYF-DTEILKNYVVINPQWIVDIM 5708
            QL   PR +  L  L+ L ++  ++  LP DI     LK L +    + T                      +    C   +L  + L  +G+++LP +F  L+ +K L L                 S NL  E+P               + LP+A +           +VP + SG    +    D N     P +I++L  L  LV+Q   I  +PD   QL  + +  +  NPL++                         PP E+  +G     +Y K L  ++  V  R KL+ +G   AGKT L H L  +          +EK        V+ GI++T WT    +  +++  +D AG + Y     FFLS  A+Y++V ++      H    +  +L  +     +A V +VGT  D                    Q + D    S L K   +    DF L  +       G   K+L+++  H    LN                                     P +H+ +P +   LE   F   ++Q+ ++++ +   + +  G+ E  ++S +  LH+ G + YF D+  LK +V  N   ++DI+
Sbjct:  192 QLTAFPRQLLQLVALEELDVSSNRLRGLPEDISALRALKILWLSGAELGT----------------------LPAGFCELASLESLMLDNNGLQALPAQFSCLQRLKMLNL-----------------SSNLFEEFPA--------------ALLPLAGLEELYLSRNQLTSVPSLISGLGRLLTLWLDNNRIRYLPDSIVELTGLEELVLQGNQIAVLPDHFGQLSRVGLWKIKDNPLIQ-------------------------PPYEVCMKGIPYIAAYQKELAHSQPAVQPRLKLLLMGHKAAGKTLLRHCLTEERVEGCPGGGDKEKCYPPSPPPVSKGIEVTSWTADA-SRGLRFIVYDLAGDESYEVIQPFFLSPGALYVLVVNLATYEPRHFPTTVGSFLHRVGARVPHAVVCIVGTHADLCGERELEEKCLDIHRQIALQEKHDAEGLSRLAKVVDEALARDFELRSASPHAAYYGVSDKNLRRRKAHFQYLLNHRLQILSPVLPVSCRDPRHLRRLRDKLLSVAEHREIFPNLHRVLPRSWQVLEELHFQPPQAQRLWLSWWDSARLGLQAGLTEDRLQSALSYLHESGKLLYFEDSPALKEHVFHNLTRLIDIL 737          
BLAST of Roc domain-containing protein vs. Ensembl Human
Match: MFHAS1 (malignant fibrous histiocytoma amplified sequence 1 [Source:HGNC Symbol;Acc:HGNC:16982])

HSP 1 Score: 89.3521 bits (220), Expect = 9.921e-17
Identity = 137/625 (21.92%), Postives = 232/625 (37.12%), Query Frame = 3
Query: 4116 QLKCLPRTIYSLKGLQRLIINQVKINTLP-DIYEFPNLKYLQIEKCPIKTYNDSNECXXXXXXXXXXXXXQTISNFICXXXXXXXXXXXXHGIESLPDEFGRLENMKELKLIGSPLYYELLKNDFIIKSDNLEFEYPEIGFYKVKENDKNPISFLPVADI---------FINVPRIGSGYSEPV----DVNSHGGFPMAILQLKKLITLVIQHQSIRYVPDSIQQLENLEILDLSYNPLLEXXXXXXXXXXXXXXXXXXHCPSISVPPPEIIARGTS--LSYLKYLL-AKTVVCNRTKLMFVGLGEAGKTSLLHALRSDENSAKEIIEQQEK-------QVTDGIDITKWTVICHNEEIQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQ-GIEH--GDLDFWLSSISCHSKYAPVFVVGTRCD--------------------QVQADMSCFSSLKKRYSQ--IEDFILVDSLS-----GTGIKDLKQKLIHVT--LN------------------------------------LPYMHQAIPSTILDLEN-QFTSIRSQKNYITYQEFQNIAISQGIFEKDVKSVIQILHDFGSIQYF-DTEILKNYVVINPQWIVDIM 5708
            QL   PR +  L  L+ L ++  ++  LP DI     LK L +    + T                      +    C   +L  + L  +G+++LP +F  L+ +K L L                 S NL  E+P               + LP+A +           +VP + SG    +    D N     P +I++L  L  LV+Q   I  +PD   QL  + +  +  NPL++                         PP E+  +G     +Y K L  ++  V  R KL+ +G   AGKT L H L  +          +EK        V+ GI++T WT    +  +++  +D AG + Y     FFLS  A+Y++V ++      H    +  +L  +     +A V +VGT  D                    Q + D    S L K   +    DF L  +       G   K+L+++  H    LN                                     P +H+ +P +   LE   F   ++Q+ ++++ +   + +  G+ E  ++S +  LH+ G + YF D+  LK +V  N   ++DI+
Sbjct:  192 QLTAFPRQLLQLVALEELDVSSNRLRGLPEDISALRALKILWLSGAELGT----------------------LPAGFCELASLESLMLDNNGLQALPAQFSCLQRLKMLNL-----------------SSNLFEEFPA--------------ALLPLAGLEELYLSRNQLTSVPSLISGLGRLLTLWLDNNRIRYLPDSIVELTGLEELVLQGNQIAVLPDHFGQLSRVGLWKIKDNPLIQ-------------------------PPYEVCMKGIPYIAAYQKELAHSQPAVQPRLKLLLMGHKAAGKTLLRHCLTEERVEGCPGGGDKEKCYPPSPPPVSKGIEVTSWTADA-SRGLRFIVYDLAGDESYEVIQPFFLSPGALYVLVVNLATYEPRHFPTTVGSFLHRVGARVPHAVVCIVGTHADLCGERELEEKCLDIHRQIALQEKHDAEGLSRLAKVVDEALARDFELRSASPHAAYYGVSDKNLRRRKAHFQYLLNHRLQILSPVLPVSCRDPRHLRRLRDKLLSVAEHREIFPNLHRVLPRSWQVLEELHFQPPQAQRLWLSWWDSARLGLQAGLTEDRLQSALSYLHESGKLLYFEDSPALKEHVFHNLTRLIDIL 737          
BLAST of Roc domain-containing protein vs. Ensembl Celegans
Match: lrk-1 (Leucine-rich repeat serine/threonine-protein kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TZM3])

HSP 1 Score: 102.834 bits (255), Expect = 3.727e-21
Identity = 90/386 (23.32%), Postives = 171/386 (44.30%), Query Frame = 3
Query: 4905 LSYLKYLLAKTVVCNRTKLMFVGLGEAGKTSLLHALRSDENSAKEIIEQQE--KQVTDGIDITKWTVICHNEE-------IQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIEH-GDLDFWLSSISCHSKYAPVFVVGTRCDQVQADMSCFS---------SLKKRY----------SQIEDFILVDSLSGTGIKDLKQKLIHVTLNLPY-----MHQAIPSTILDLENQFTSI------RSQKNYITYQEFQNIAISQGI------FEKDVK--SVIQILHDFGSIQYFDTEILKNYVVINPQWIVDIMANVVSVVNQKIKNGIFYHENMKDVWDKFESK----LFNWMLNLTEEFDLTFPHPTMEPKANIVPCLLSEE 5906
            ++YLK +L ++   +  +LM +G    GK+ +  AL       KE +++++     T  I   +W       +       + +S  DF GQ  Y++THQ+FLS++++ +V+W +  G E    LD WL +I   +  + V +VGT  DQV ++ S F           ++ RY           +I D IL++S S   +K L   +      +       M Q IPS+ + L      +        Q   +T + ++     + I      F  D++  +    LHD G +  F+   L++ + ++P W+ + + +VV + +  +  G+   + +      F+S     L   +L+L  +F+L       +P+  ++P LL +E
Sbjct:  960 VAYLKTILEESKTYHHLRLMILGSDGVGKSVIWDAL------CKEAVQKRQPIHSETGVIRQAEWKFEAKRSKGDKNLGPVGFSVIDFGGQREYHSTHQYFLSKRSLNLVLWKITDGDEALAQLDTWLVNIHARAPNSTVILVGTNLDQVASNSSKFGPGYIDIMEQKVRTRYMVADADKSGLPRIVDVILINSTSRNDVKALLNTIYRTAWEVRMGKERAMEQQIPSSYIALMKVTKELGVEFRKEGQPAVMTVEAYRERVKKRMISKFGRPFRDDIEFYAACTFLHDCGELVRFEDATLRDLIFVDPLWLAEFLTSVVILRSPNLPAGLLSTDAINPHTRSFKSGALLMLKTQLLDLLHKFELAL---ATQPRQLLIPSLLPDE 1336          
BLAST of Roc domain-containing protein vs. Ensembl Fly
Match: Lrrk (gene:FBgn0038816 transcript:FBtr0334640)

HSP 1 Score: 100.523 bits (249), Expect = 2.790e-20
Identity = 93/424 (21.93%), Postives = 177/424 (41.75%), Query Frame = 3
Query: 4905 LSYLKYLLAKTVVCNRTKLMFVGLGEAGKTSLLHALRS----------------DENSAKEIIEQQEKQV-------------TDGIDITKWTVICHNEE--------IQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIEH-GDLDFWLSSISCHSKYAPVFVVGTRCDQVQADMSCFSSLKKRYSQIEDFILVDSLSGTGIKDLKQKL---------IHVTLNL---------------PYMHQAIPST----------------------ILDLENQFTSIRSQKNYITYQEFQNIAISQGIFEKDVKSVIQILHDFGSIQYFDTEILKNYVVINPQWIVDIMANVVSV--VNQKIKNGIFYHENMKDVWDKFESKL---FNWMLNLTEEFDLTFPHPTMEPKANIVPCLLSEEE 5909
            + YLK +        R KLM VG+   GK++LL  LR                 + + AK +   +                 T G+DI  W  IC   +        + +  WDF GQ  YY THQ+FLS++++Y+V+W +  G +   +L  WL +I   +  +PV +VGT  D V   +S   + + +    E FI +      G+  +   +         IH+  N+               P + Q IP++                      +LD E     +  Q     Y+ F++ A        +++      H+ G + ++D   L++Y  ++PQW+ D++A+VV+V  +N     G+   ++++ ++   + +     +++++L  +F++     T + +  ++P LL  +E
Sbjct:  887 VGYLKSIYEDAQPYARMKLMVVGVAGIGKSTLLDLLRQGAGSGSSSSSHRSRASENHWAKRMGHARSTSRSHRHSSASSANISTVGVDIGTW--ICEKRKRAPGSHGPVVFRTWDFGGQKEYYATHQYFLSKRSLYLVLWRISDGHKGLAELLQWLGNIQARAPNSPVIIVGTHFDAVGESISPQKAEQLQQLIREKFIAIPDAEKIGLPRVIDSIEISCRTLHNIHLLANIIYDTAMQLRSPGSKEPMLLQKIPASYIALEDIVNVIACNLRAAGRDPVLDGEQYKRLVTEQMRLHNYKSFRDAA--------ELQQATTWCHENGVLLHYDDATLRDYYFLDPQWLCDMLAHVVTVREINPFAPTGVMKLDDLQMLFRSVQVQGNGNRSYIVSLLNKFEVAL---TWDSRTLLIPSLLPSQE 1297          
BLAST of Roc domain-containing protein vs. Ensembl Fly
Match: Lrrk (gene:FBgn0038816 transcript:FBtr0112788)

HSP 1 Score: 100.138 bits (248), Expect = 2.819e-20
Identity = 93/424 (21.93%), Postives = 177/424 (41.75%), Query Frame = 3
Query: 4905 LSYLKYLLAKTVVCNRTKLMFVGLGEAGKTSLLHALRS----------------DENSAKEIIEQQEKQV-------------TDGIDITKWTVICHNEE--------IQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIEH-GDLDFWLSSISCHSKYAPVFVVGTRCDQVQADMSCFSSLKKRYSQIEDFILVDSLSGTGIKDLKQKL---------IHVTLNL---------------PYMHQAIPST----------------------ILDLENQFTSIRSQKNYITYQEFQNIAISQGIFEKDVKSVIQILHDFGSIQYFDTEILKNYVVINPQWIVDIMANVVSV--VNQKIKNGIFYHENMKDVWDKFESKL---FNWMLNLTEEFDLTFPHPTMEPKANIVPCLLSEEE 5909
            + YLK +        R KLM VG+   GK++LL  LR                 + + AK +   +                 T G+DI  W  IC   +        + +  WDF GQ  YY THQ+FLS++++Y+V+W +  G +   +L  WL +I   +  +PV +VGT  D V   +S   + + +    E FI +      G+  +   +         IH+  N+               P + Q IP++                      +LD E     +  Q     Y+ F++ A        +++      H+ G + ++D   L++Y  ++PQW+ D++A+VV+V  +N     G+   ++++ ++   + +     +++++L  +F++     T + +  ++P LL  +E
Sbjct:  910 VGYLKSIYEDAQPYARMKLMVVGVAGIGKSTLLDLLRQGAGSGSSSSSHRSRASENHWAKRMGHARSTSRSHRHSSASSANISTVGVDIGTW--ICEKRKRAPGSHGPVVFRTWDFGGQKEYYATHQYFLSKRSLYLVLWRISDGHKGLAELLQWLGNIQARAPNSPVIIVGTHFDAVGESISPQKAEQLQQLIREKFIAIPDAEKIGLPRVIDSIEISCRTLHNIHLLANIIYDTAMQLRSPGSKEPMLLQKIPASYIALEDIVNVIACNLRAAGRDPVLDGEQYKRLVTEQMRLHNYKSFRDAA--------ELQQATTWCHENGVLLHYDDATLRDYYFLDPQWLCDMLAHVVTVREINPFAPTGVMKLDDLQMLFRSVQVQGNGNRSYIVSLLNKFEVAL---TWDSRTLLIPSLLPSQE 1320          
BLAST of Roc domain-containing protein vs. Ensembl Fly
Match: Lrrk (gene:FBgn0038816 transcript:FBtr0334641)

HSP 1 Score: 100.138 bits (248), Expect = 2.836e-20
Identity = 93/424 (21.93%), Postives = 177/424 (41.75%), Query Frame = 3
Query: 4905 LSYLKYLLAKTVVCNRTKLMFVGLGEAGKTSLLHALRS----------------DENSAKEIIEQQEKQV-------------TDGIDITKWTVICHNEE--------IQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIEH-GDLDFWLSSISCHSKYAPVFVVGTRCDQVQADMSCFSSLKKRYSQIEDFILVDSLSGTGIKDLKQKL---------IHVTLNL---------------PYMHQAIPST----------------------ILDLENQFTSIRSQKNYITYQEFQNIAISQGIFEKDVKSVIQILHDFGSIQYFDTEILKNYVVINPQWIVDIMANVVSV--VNQKIKNGIFYHENMKDVWDKFESKL---FNWMLNLTEEFDLTFPHPTMEPKANIVPCLLSEEE 5909
            + YLK +        R KLM VG+   GK++LL  LR                 + + AK +   +                 T G+DI  W  IC   +        + +  WDF GQ  YY THQ+FLS++++Y+V+W +  G +   +L  WL +I   +  +PV +VGT  D V   +S   + + +    E FI +      G+  +   +         IH+  N+               P + Q IP++                      +LD E     +  Q     Y+ F++ A        +++      H+ G + ++D   L++Y  ++PQW+ D++A+VV+V  +N     G+   ++++ ++   + +     +++++L  +F++     T + +  ++P LL  +E
Sbjct:  978 VGYLKSIYEDAQPYARMKLMVVGVAGIGKSTLLDLLRQGAGSGSSSSSHRSRASENHWAKRMGHARSTSRSHRHSSASSANISTVGVDIGTW--ICEKRKRAPGSHGPVVFRTWDFGGQKEYYATHQYFLSKRSLYLVLWRISDGHKGLAELLQWLGNIQARAPNSPVIIVGTHFDAVGESISPQKAEQLQQLIREKFIAIPDAEKIGLPRVIDSIEISCRTLHNIHLLANIIYDTAMQLRSPGSKEPMLLQKIPASYIALEDIVNVIACNLRAAGRDPVLDGEQYKRLVTEQMRLHNYKSFRDAA--------ELQQATTWCHENGVLLHYDDATLRDYYFLDPQWLCDMLAHVVTVREINPFAPTGVMKLDDLQMLFRSVQVQGNGNRSYIVSLLNKFEVAL---TWDSRTLLIPSLLPSQE 1388          
BLAST of Roc domain-containing protein vs. Ensembl Zebrafish
Match: mfhas1 (malignant fibrous histiocytoma amplified sequence 1 [Source:ZFIN;Acc:ZDB-GENE-080917-20])

HSP 1 Score: 90.8929 bits (224), Expect = 1.909e-17
Identity = 121/548 (22.08%), Postives = 224/548 (40.88%), Query Frame = 3
Query: 4389 IESLPDEFGRLENMKELKLIGSPLYYELLKNDF---IIKSDNLEFEYPEIGFYKVKENDKNPISFLPVADIFINVPRIGSGYSEPVDVNSHGGFPMAILQLKKLITLVIQHQSIRYVPDSIQQLENLEILDLSYNPLLEXXXXXXXXXXXXXXXXXXHCPSISVPPPEIIARGTS--LSYLKYLL-AKTVVCNRTKLMFVGLGEAGKTSLLHALRSDENSAKEIIEQQEKQVTDGIDITKWTVICHNEEIQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIE---HGDLDFWLSSISCHSKYAPVFVVGTRCD--------------------QVQADMSCF-------------------------------SSLKKRYSQIEDFILVDSL-------------SGTGIKDLKQKLIHVTLN---LPYMHQAIPSTILDLENQFTSIRSQKNYITYQEFQNIAISQGIFEKDVKSVIQILHDFGSIQYF-DTEILKNYVVINPQWIVDIMANVVSVVNQKIKNGIFYHENMKDVWDKFESK 5801
            +  LP  FG+L+ +K L L  +         DF   IIK   LE  Y            +N ++FLP       V ++ +  +  +D NS    P +I++L KL  LV+Q   I  +PD+  +L  + I  +  NPL++                         PP E+  +G     +Y K L  ++  +  R KL+ +G G AGKT+L   + S ++  K  I         GID+T W V      + +  +D +G+  Y     FFLS  A+Y++V +++       +  +  +L  +S    +A V +VGT  D                    Q + D+ C                                 +L+++ SQ++ ++L + L             +   I+ LK+KL+ V  +    P +H+ +P +   LE      + Q  ++++ +   + +  G+ E  ++S +  LH+ G + YF D+  LK YV  N       +   ++++N      +F+  ++  + +K +++
Sbjct:  244 LTRLPQSFGKLQKLKMLNLSSNSF------EDFPQVIIKLTRLEELY----------LSRNKLTFLPE-----EVGQLCNLANLWLDNNSITFLPDSIVELGKLEELVLQGNQIAILPDNFGKLAKVNIWKVKDNPLIQ-------------------------PPYEVCMKGIPYIAAYQKELAHSQPAIKPRLKLVLMGQGNAGKTTLRQCIVSKQSDTKMAIG------CRGIDVTNW-VADAKRSLTFIVYDLSGKQNYDLIKPFFLSPGALYVLVVNLKLYTSKSFYSHVGSFLHLLSAKVPHAVVCIVGTHSDLCEEVEVEEKCLDIHRQISFQEKMDIDCLHVLALQVDEALEQGYDVRTSTPHVLFYGVTDKNLRRKKSQLQ-YMLNNRLQILSPVICVSCVAAQRNIQHLKEKLMSVADHREIFPNLHRVLPKSWQMLEE--LHFKPQDLWLSWWDSARLGLQAGLTEDRLQSALSYLHESGKLLYFEDSTTLKEYVFHN-------LPRFIAILN------VFFQRDLPAMLEKLQAE 722          
BLAST of Roc domain-containing protein vs. Ensembl Zebrafish
Match: mfhas1 (malignant fibrous histiocytoma amplified sequence 1 [Source:ZFIN;Acc:ZDB-GENE-080917-20])

HSP 1 Score: 90.8929 bits (224), Expect = 1.909e-17
Identity = 121/548 (22.08%), Postives = 224/548 (40.88%), Query Frame = 3
Query: 4389 IESLPDEFGRLENMKELKLIGSPLYYELLKNDF---IIKSDNLEFEYPEIGFYKVKENDKNPISFLPVADIFINVPRIGSGYSEPVDVNSHGGFPMAILQLKKLITLVIQHQSIRYVPDSIQQLENLEILDLSYNPLLEXXXXXXXXXXXXXXXXXXHCPSISVPPPEIIARGTS--LSYLKYLL-AKTVVCNRTKLMFVGLGEAGKTSLLHALRSDENSAKEIIEQQEKQVTDGIDITKWTVICHNEEIQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIE---HGDLDFWLSSISCHSKYAPVFVVGTRCD--------------------QVQADMSCF-------------------------------SSLKKRYSQIEDFILVDSL-------------SGTGIKDLKQKLIHVTLN---LPYMHQAIPSTILDLENQFTSIRSQKNYITYQEFQNIAISQGIFEKDVKSVIQILHDFGSIQYF-DTEILKNYVVINPQWIVDIMANVVSVVNQKIKNGIFYHENMKDVWDKFESK 5801
            +  LP  FG+L+ +K L L  +         DF   IIK   LE  Y            +N ++FLP       V ++ +  +  +D NS    P +I++L KL  LV+Q   I  +PD+  +L  + I  +  NPL++                         PP E+  +G     +Y K L  ++  +  R KL+ +G G AGKT+L   + S ++  K  I         GID+T W V      + +  +D +G+  Y     FFLS  A+Y++V +++       +  +  +L  +S    +A V +VGT  D                    Q + D+ C                                 +L+++ SQ++ ++L + L             +   I+ LK+KL+ V  +    P +H+ +P +   LE      + Q  ++++ +   + +  G+ E  ++S +  LH+ G + YF D+  LK YV  N       +   ++++N      +F+  ++  + +K +++
Sbjct:  244 LTRLPQSFGKLQKLKMLNLSSNSF------EDFPQVIIKLTRLEELY----------LSRNKLTFLPE-----EVGQLCNLANLWLDNNSITFLPDSIVELGKLEELVLQGNQIAILPDNFGKLAKVNIWKVKDNPLIQ-------------------------PPYEVCMKGIPYIAAYQKELAHSQPAIKPRLKLVLMGQGNAGKTTLRQCIVSKQSDTKMAIG------CRGIDVTNW-VADAKRSLTFIVYDLSGKQNYDLIKPFFLSPGALYVLVVNLKLYTSKSFYSHVGSFLHLLSAKVPHAVVCIVGTHSDLCEEVEVEEKCLDIHRQISFQEKMDIDCLHVLALQVDEALEQGYDVRTSTPHVLFYGVTDKNLRRKKSQLQ-YMLNNRLQILSPVICVSCVAAQRNIQHLKEKLMSVADHREIFPNLHRVLPKSWQMLEE--LHFKPQDLWLSWWDSARLGLQAGLTEDRLQSALSYLHESGKLLYFEDSTTLKEYVFHN-------LPRFIAILN------VFFQRDLPAMLEKLQAE 722          
BLAST of Roc domain-containing protein vs. Ensembl Zebrafish
Match: mfhas1 (malignant fibrous histiocytoma amplified sequence 1 [Source:ZFIN;Acc:ZDB-GENE-080917-20])

HSP 1 Score: 90.5077 bits (223), Expect = 2.334e-17
Identity = 121/548 (22.08%), Postives = 224/548 (40.88%), Query Frame = 3
Query: 4389 IESLPDEFGRLENMKELKLIGSPLYYELLKNDF---IIKSDNLEFEYPEIGFYKVKENDKNPISFLPVADIFINVPRIGSGYSEPVDVNSHGGFPMAILQLKKLITLVIQHQSIRYVPDSIQQLENLEILDLSYNPLLEXXXXXXXXXXXXXXXXXXHCPSISVPPPEIIARGTS--LSYLKYLL-AKTVVCNRTKLMFVGLGEAGKTSLLHALRSDENSAKEIIEQQEKQVTDGIDITKWTVICHNEEIQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIE---HGDLDFWLSSISCHSKYAPVFVVGTRCD--------------------QVQADMSCF-------------------------------SSLKKRYSQIEDFILVDSL-------------SGTGIKDLKQKLIHVTLN---LPYMHQAIPSTILDLENQFTSIRSQKNYITYQEFQNIAISQGIFEKDVKSVIQILHDFGSIQYF-DTEILKNYVVINPQWIVDIMANVVSVVNQKIKNGIFYHENMKDVWDKFESK 5801
            +  LP  FG+L+ +K L L  +         DF   IIK   LE  Y            +N ++FLP       V ++ +  +  +D NS    P +I++L KL  LV+Q   I  +PD+  +L  + I  +  NPL++                         PP E+  +G     +Y K L  ++  +  R KL+ +G G AGKT+L   + S ++  K  I         GID+T W V      + +  +D +G+  Y     FFLS  A+Y++V +++       +  +  +L  +S    +A V +VGT  D                    Q + D+ C                                 +L+++ SQ++ ++L + L             +   I+ LK+KL+ V  +    P +H+ +P +   LE      + Q  ++++ +   + +  G+ E  ++S +  LH+ G + YF D+  LK YV  N       +   ++++N      +F+  ++  + +K +++
Sbjct:  244 LTRLPQSFGKLQKLKMLNLSSNSF------EDFPQVIIKLTRLEELYL----------SRNKLTFLPE-----EVGQLCNLANLWLDNNSITFLPDSIVELGKLEELVLQGNQIAILPDNFGKLAKVNIWKVKDNPLIQ-------------------------PPYEVCMKGIPYIAAYQKELAHSQPAIKPRLKLVLMGQGNAGKTTLRQCIVSKQSDTKMAIG------CRGIDVTNW-VADAKRSLTFIVYDLSGKQNYDLIKPFFLSPGALYVLVVNLKLYTSKSFYSHVGSFLHLLSAKVPHAVVCIVGTHSDLCEEVEVEEKCLDIHRQISFQEKMDIDCLHVLALQVDEALEQGYDVRTSTPHVLFYGVTDKNLRRKKSQLQ-YMLNNRLQILSPVICVSCVAAQRNIQHLKEKLMSVADHREIFPNLHRVLPKSWQMLEE--LHFKPQDLWLSWWDSARLGLQAGLTEDRLQSALSYLHESGKLLYFEDSTTLKEYVFHN-------LPRFIAILN------VFFQRDLPAMLEKLQAE 722          
BLAST of Roc domain-containing protein vs. Ensembl Zebrafish
Match: BX511222.1 (malignant fibrous histiocytoma amplified sequence 1 [Source:NCBI gene;Acc:797005])

HSP 1 Score: 88.1965 bits (217), Expect = 1.219e-16
Identity = 119/548 (21.72%), Postives = 224/548 (40.88%), Query Frame = 3
Query: 4389 IESLPDEFGRLENMKELKLIGSPLYYELLKNDF---IIKSDNLEFEYPEIGFYKVKENDKNPISFLPVADIFINVPRIGSGYSEPVDVNSHGGFPMAILQLKKLITLVIQHQSIRYVPDSIQQLENLEILDLSYNPLLEXXXXXXXXXXXXXXXXXXHCPSISVPPPEIIARGTS--LSYLKYLL-AKTVVCNRTKLMFVGLGEAGKTSLLHALRSDENSAKEIIEQQEKQVTDGIDITKWTVICHNEEIQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIE---HGDLDFWLSSISCHSKYAPVFVVGTRCD--------------------QVQADMSCF-------------------------------SSLKKRYSQIEDFILVDSL-------------SGTGIKDLKQKLIHVTLN---LPYMHQAIPSTILDLENQFTSIRSQKNYITYQEFQNIAISQGIFEKDVKSVIQILHDFGSIQYF-DTEILKNYVVINPQWIVDIMANVVSVVNQKIKNGIFYHENMKDVWDKFESK 5801
            +  LP  FG+++ +K L L  +         DF   IIK   LE  Y            +N ++FLP       V ++ +  +  +D NS    P +I++L KL  LV+Q   I  +PD+  +L  + I  +  NPL++                         PP E+  +G     +Y K L  ++  +  R KL+ +G G AGKT+L   + S ++  K  I         GID+T W V      + +  +D +G+  Y     FFLS  A+Y++V +++       +  +  +L  +S    +A V +VGT  D                    Q + D+ C                                 +L+++ SQ++ ++L + L             +   I+ LK+KL+ V  +    P +H+ +P +   LE      + +  ++++ +   + +  G+ E  ++S +  LH+ G + YF D+  LK YV  N       +   ++++N      +F+  ++  + +K +++
Sbjct:  244 LTRLPQSFGKMQKLKMLNLSSNSF------EDFPQVIIKLTKLEELY----------LSRNKLTFLPE-----EVGQLCNLANLWLDNNSITFLPDSIVELGKLEELVLQGNQIAILPDNFGKLAKVNIWKVKDNPLIQ-------------------------PPYEVCMKGIPYIAAYQKELAHSQPAIKPRLKLVLMGQGNAGKTTLRQCIVSKQSDTKMAIG------CRGIDVTNW-VADAERSLTFIVYDLSGKQNYDLIKPFFLSPGALYVLVVNLKLYTSKSFYSHVGSFLHLLSAKVPHAVVCIVGTHSDLCEEVEVEEKCLDIHRQISFQEKMDIDCLHVLALQVDEALEQGYDVRTSTPHVLFYGVTDKNLRRKKSQLQ-YMLNNRLQILSPVICVSCVAAQRNIQHLKEKLMSVADHREIFPNLHRVLPKSWQMLEE--LHFKPKDLWLSWWDSARLGLQAGLTEDRLQSALSYLHESGKLLYFEDSTTLKEYVFHN-------LPRFIAILN------VFFQRDLPAMLEKLQAE 722          
BLAST of Roc domain-containing protein vs. Ensembl Zebrafish
Match: spryd3 (SPRY domain containing 3 [Source:ZFIN;Acc:ZDB-GENE-070928-22])

HSP 1 Score: 77.411 bits (189), Expect = 9.122e-14
Identity = 58/167 (34.73%), Postives = 81/167 (48.50%), Query Frame = 3
Query: 1830 NVLQELGILTY-NNETEVSLVVGKFPVSPDRRRFSMEILNPGASGRITIGLVPANYSV-IQPGWRENSLAYHGDDGGIFLGESVPQIIRETFSEVNNCIEVIIEYESSLDSPELVRHITWRKNGKFVEKILIQHDKE-LYPAIGMHSINEQVRLLDFEVWADTECSS 2321
             +L+    L+Y  N  EV   V   P+S     F + I++ G  G I +GLVP  Y +  QPGW   S+AYH DDG ++ G  V Q      +  +     I  Y  S D+  +    T  KNGK V  +++    + L+PAIGMHS+ E+VRL     W   E  S
Sbjct:   34 RMLKNGDTLSYQGNSDEVGCYVAPRPLSKGNCYFEVTIMDTGVRGTIAVGLVPQYYKLDYQPGWLPQSIAYHADDGKLYNGNPVGQQFGPKCNRGDRIGCGI--YADSFDAGLVTVFFT--KNGKEVGSVVVPVAPDGLFPAIGMHSLGEEVRLDLQAEWGSEEEDS 196          
BLAST of Roc domain-containing protein vs. Ensembl Xenopus
Match: hes2 (hes family bHLH transcription factor 2 [Source:Xenbase;Acc:XB-GENE-486138])

HSP 1 Score: 134.806 bits (338), Expect = 1.757e-30
Identity = 124/508 (24.41%), Postives = 237/508 (46.65%), Query Frame = 3
Query: 4686 KLITLVIQHQSIRYVPDSIQQLENLEILDLSYNPLLEXXXXXXXXXXXXXXXXXXH-CPSISVPPPEIIARGTSLSYLKYLLAKTVVCNRTKLMFVGLGEAGKTSLLHALRSDENSAKEIIEQQEKQVTDGIDITKWTVICHNE---EIQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIEHGD-LDFWLSSISCHSKYAPVFVVGTRCD--QVQADMSCFSSLKKRYS------QIEDFILVDSLSGTG-IKDLKQKLIHVTLNL-----PYMHQAIPSTILDLE----NQFTSIRSQKNYITYQEFQNIAISQGIF--EKDVKSVIQILHDFGSIQYFDTEI--LKNYVVINPQWIVDIMANVVSVVN---QKIKNGIFYHENMKDVWDKFESKLFNWM---LNLTEEFDLTFPHPTMEPKANIVPCLLSEEEPEIEWPKF-SEQTLCKFYHINYKFEFLPAGLFNRIQVRLFDFTE------------AKKLWKYGMYF 6071
            +L  L + +  I+ +P  I  LEN+   D+SYNP L     ++  +  I  L L   C  I +      A+   + +L+  L K V  NR K++ VG   +GKT+L+  L          +E   ++ T GID+  W ++   +   EI  + WDFAGQ+ +Y +H  F++ +A+Y+VV+ + +G+   D +  WL +I   +  +PV +VGT  D    +   +C S +K+          I ++  V++   +  +  L++ +I   LN      P + Q IP + L+LE    N+  ++  +   I+++    I     +   E ++   +  L++ G + +F+     L++   ++PQW+  I+A +++V     QK   GI +  +++   +K +    N+M     L E+F +  P   +     ++P  LS+  P IE P   + + + + Y ++Y     P G ++R+  RL + +              +  W+ G+Y 
Sbjct:  889 RLEKLHLSYNKIKEIPPEIGFLENITSFDISYNPDLRTFPDEMGKLTKIWDLPLDGLCLDIDLKHIGCKAKDL-IRFLQQRLKKAVPYNRMKVLIVGNTGSGKTTLVQQLMKCRR-----LEHGAEKATVGIDVKDWPILIRGKIKKEITLNVWDFAGQEEFYCSHPHFMTPQALYLVVYDLSKGVSEVDAIKPWLFNIKARASSSPVILVGTHLDVSDEKCQKACISKIKQELCNQHGLPSIREYHFVNASEESDLLAKLRKTIIRECLNFKIREQPVLGQLIPDSYLELEKKILNERKNVPLEFPVISHERMLEIVEESQLHLDENELTHAVHFLNESGVLLHFEDPALQLRDLYFVDPQWLCKIIAQILTVRADGCQKYPKGIIHCNDVERFLEKKKKFPKNYMSQYFKLLEKFQIALP---LGEDQLLIPSSLSDHRPVIELPHCENSEVIIRLYEMSY----FPMGFWSRLINRLLEVSTYMLSGRERAQRPNRMYWRQGIYL 1383          
BLAST of Roc domain-containing protein vs. Ensembl Xenopus
Match: hes2 (hes family bHLH transcription factor 2 [Source:Xenbase;Acc:XB-GENE-486138])

HSP 1 Score: 134.806 bits (338), Expect = 2.054e-30
Identity = 124/508 (24.41%), Postives = 237/508 (46.65%), Query Frame = 3
Query: 4686 KLITLVIQHQSIRYVPDSIQQLENLEILDLSYNPLLEXXXXXXXXXXXXXXXXXXH-CPSISVPPPEIIARGTSLSYLKYLLAKTVVCNRTKLMFVGLGEAGKTSLLHALRSDENSAKEIIEQQEKQVTDGIDITKWTVICHNE---EIQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIEHGD-LDFWLSSISCHSKYAPVFVVGTRCD--QVQADMSCFSSLKKRYS------QIEDFILVDSLSGTG-IKDLKQKLIHVTLNL-----PYMHQAIPSTILDLE----NQFTSIRSQKNYITYQEFQNIAISQGIF--EKDVKSVIQILHDFGSIQYFDTEI--LKNYVVINPQWIVDIMANVVSVVN---QKIKNGIFYHENMKDVWDKFESKLFNWM---LNLTEEFDLTFPHPTMEPKANIVPCLLSEEEPEIEWPKF-SEQTLCKFYHINYKFEFLPAGLFNRIQVRLFDFTE------------AKKLWKYGMYF 6071
            +L  L + +  I+ +P  I  LEN+   D+SYNP L     ++  +  I  L L   C  I +      A+   + +L+  L K V  NR K++ VG   +GKT+L+  L          +E   ++ T GID+  W ++   +   EI  + WDFAGQ+ +Y +H  F++ +A+Y+VV+ + +G+   D +  WL +I   +  +PV +VGT  D    +   +C S +K+          I ++  V++   +  +  L++ +I   LN      P + Q IP + L+LE    N+  ++  +   I+++    I     +   E ++   +  L++ G + +F+     L++   ++PQW+  I+A +++V     QK   GI +  +++   +K +    N+M     L E+F +  P   +     ++P  LS+  P IE P   + + + + Y ++Y     P G ++R+  RL + +              +  W+ G+Y 
Sbjct: 1238 RLEKLHLSYNKIKEIPPEIGFLENITSFDISYNPDLRTFPDEMGKLTKIWDLPLDGLCLDIDLKHIGCKAKDL-IRFLQQRLKKAVPYNRMKVLIVGNTGSGKTTLVQQLMKCRR-----LEHGAEKATVGIDVKDWPILIRGKIKKEITLNVWDFAGQEEFYCSHPHFMTPQALYLVVYDLSKGVSEVDAIKPWLFNIKARASSSPVILVGTHLDVSDEKCQKACISKIKQELCNQHGLPSIREYHFVNASEESDLLAKLRKTIIRECLNFKIREQPVLGQLIPDSYLELEKKILNERKNVPLEFPVISHERMLEIVEESQLHLDENELTHAVHFLNESGVLLHFEDPALQLRDLYFVDPQWLCKIIAQILTVRADGCQKYPKGIIHCNDVERFLEKKKKFPKNYMSQYFKLLEKFQIALP---LGEDQLLIPSSLSDHRPVIELPHCENSEVIIRLYEMSY----FPMGFWSRLINRLLEVSTYMLSGRERAQRPNRMYWRQGIYL 1732          
BLAST of Roc domain-containing protein vs. Ensembl Xenopus
Match: hes2 (hes family bHLH transcription factor 2 [Source:Xenbase;Acc:XB-GENE-486138])

HSP 1 Score: 134.806 bits (338), Expect = 2.079e-30
Identity = 124/508 (24.41%), Postives = 237/508 (46.65%), Query Frame = 3
Query: 4686 KLITLVIQHQSIRYVPDSIQQLENLEILDLSYNPLLEXXXXXXXXXXXXXXXXXXH-CPSISVPPPEIIARGTSLSYLKYLLAKTVVCNRTKLMFVGLGEAGKTSLLHALRSDENSAKEIIEQQEKQVTDGIDITKWTVICHNE---EIQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIEHGD-LDFWLSSISCHSKYAPVFVVGTRCD--QVQADMSCFSSLKKRYS------QIEDFILVDSLSGTG-IKDLKQKLIHVTLNL-----PYMHQAIPSTILDLE----NQFTSIRSQKNYITYQEFQNIAISQGIF--EKDVKSVIQILHDFGSIQYFDTEI--LKNYVVINPQWIVDIMANVVSVVN---QKIKNGIFYHENMKDVWDKFESKLFNWM---LNLTEEFDLTFPHPTMEPKANIVPCLLSEEEPEIEWPKF-SEQTLCKFYHINYKFEFLPAGLFNRIQVRLFDFTE------------AKKLWKYGMYF 6071
            +L  L + +  I+ +P  I  LEN+   D+SYNP L     ++  +  I  L L   C  I +      A+   + +L+  L K V  NR K++ VG   +GKT+L+  L          +E   ++ T GID+  W ++   +   EI  + WDFAGQ+ +Y +H  F++ +A+Y+VV+ + +G+   D +  WL +I   +  +PV +VGT  D    +   +C S +K+          I ++  V++   +  +  L++ +I   LN      P + Q IP + L+LE    N+  ++  +   I+++    I     +   E ++   +  L++ G + +F+     L++   ++PQW+  I+A +++V     QK   GI +  +++   +K +    N+M     L E+F +  P   +     ++P  LS+  P IE P   + + + + Y ++Y     P G ++R+  RL + +              +  W+ G+Y 
Sbjct: 1238 RLEKLHLSYNKIKEIPPEIGFLENITSFDISYNPDLRTFPDEMGKLTKIWDLPLDGLCLDIDLKHIGCKAKDL-IRFLQQRLKKAVPYNRMKVLIVGNTGSGKTTLVQQLMKCRR-----LEHGAEKATVGIDVKDWPILIRGKIKKEITLNVWDFAGQEEFYCSHPHFMTPQALYLVVYDLSKGVSEVDAIKPWLFNIKARASSSPVILVGTHLDVSDEKCQKACISKIKQELCNQHGLPSIREYHFVNASEESDLLAKLRKTIIRECLNFKIREQPVLGQLIPDSYLELEKKILNERKNVPLEFPVISHERMLEIVEESQLHLDENELTHAVHFLNESGVLLHFEDPALQLRDLYFVDPQWLCKIIAQILTVRADGCQKYPKGIIHCNDVERFLEKKKKFPKNYMSQYFKLLEKFQIALP---LGEDQLLIPSSLSDHRPVIELPHCENSEVIIRLYEMSY----FPMGFWSRLINRLLEVSTYMLSGRERAQRPNRMYWRQGIYL 1732          
BLAST of Roc domain-containing protein vs. Ensembl Xenopus
Match: hes2 (hes family bHLH transcription factor 2 [Source:Xenbase;Acc:XB-GENE-486138])

HSP 1 Score: 134.42 bits (337), Expect = 2.217e-30
Identity = 124/508 (24.41%), Postives = 237/508 (46.65%), Query Frame = 3
Query: 4686 KLITLVIQHQSIRYVPDSIQQLENLEILDLSYNPLLEXXXXXXXXXXXXXXXXXXH-CPSISVPPPEIIARGTSLSYLKYLLAKTVVCNRTKLMFVGLGEAGKTSLLHALRSDENSAKEIIEQQEKQVTDGIDITKWTVICHNE---EIQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIEHGD-LDFWLSSISCHSKYAPVFVVGTRCD--QVQADMSCFSSLKKRYS------QIEDFILVDSLSGTG-IKDLKQKLIHVTLNL-----PYMHQAIPSTILDLE----NQFTSIRSQKNYITYQEFQNIAISQGIF--EKDVKSVIQILHDFGSIQYFDTEI--LKNYVVINPQWIVDIMANVVSVVN---QKIKNGIFYHENMKDVWDKFESKLFNWM---LNLTEEFDLTFPHPTMEPKANIVPCLLSEEEPEIEWPKF-SEQTLCKFYHINYKFEFLPAGLFNRIQVRLFDFTE------------AKKLWKYGMYF 6071
            +L  L + +  I+ +P  I  LEN+   D+SYNP L     ++  +  I  L L   C  I +      A+   + +L+  L K V  NR K++ VG   +GKT+L+  L          +E   ++ T GID+  W ++   +   EI  + WDFAGQ+ +Y +H  F++ +A+Y+VV+ + +G+   D +  WL +I   +  +PV +VGT  D    +   +C S +K+          I ++  V++   +  +  L++ +I   LN      P + Q IP + L+LE    N+  ++  +   I+++    I     +   E ++   +  L++ G + +F+     L++   ++PQW+  I+A +++V     QK   GI +  +++   +K +    N+M     L E+F +  P   +     ++P  LS+  P IE P   + + + + Y ++Y     P G ++R+  RL + +              +  W+ G+Y 
Sbjct: 1198 RLEKLHLSYNKIKEIPPEIGFLENITSFDISYNPDLRTFPDEMGKLTKIWDLPLDGLCLDIDLKHIGCKAKDL-IRFLQQRLKKAVPYNRMKVLIVGNTGSGKTTLVQQLMKCRR-----LEHGAEKATVGIDVKDWPILIRGKIKKEITLNVWDFAGQEEFYCSHPHFMTPQALYLVVYDLSKGVSEVDAIKPWLFNIKARASSSPVILVGTHLDVSDEKCQKACISKIKQELCNQHGLPSIREYHFVNASEESDLLAKLRKTIIRECLNFKIREQPVLGQLIPDSYLELEKKILNERKNVPLEFPVISHERMLEIVEESQLHLDENELTHAVHFLNESGVLLHFEDPALQLRDLYFVDPQWLCKIIAQILTVRADGCQKYPKGIIHCNDVERFLEKKKKFPKNYMSQYFKLLEKFQIALP---LGEDQLLIPSSLSDHRPVIELPHCENSEVIIRLYEMSY----FPMGFWSRLINRLLEVSTYMLSGRERAQRPNRMYWRQGIYL 1692          
BLAST of Roc domain-containing protein vs. Ensembl Xenopus
Match: hes2 (hes family bHLH transcription factor 2 [Source:Xenbase;Acc:XB-GENE-486138])

HSP 1 Score: 134.42 bits (337), Expect = 2.352e-30
Identity = 124/508 (24.41%), Postives = 237/508 (46.65%), Query Frame = 3
Query: 4686 KLITLVIQHQSIRYVPDSIQQLENLEILDLSYNPLLEXXXXXXXXXXXXXXXXXXH-CPSISVPPPEIIARGTSLSYLKYLLAKTVVCNRTKLMFVGLGEAGKTSLLHALRSDENSAKEIIEQQEKQVTDGIDITKWTVICHNE---EIQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIEHGD-LDFWLSSISCHSKYAPVFVVGTRCD--QVQADMSCFSSLKKRYS------QIEDFILVDSLSGTG-IKDLKQKLIHVTLNL-----PYMHQAIPSTILDLE----NQFTSIRSQKNYITYQEFQNIAISQGIF--EKDVKSVIQILHDFGSIQYFDTEI--LKNYVVINPQWIVDIMANVVSVVN---QKIKNGIFYHENMKDVWDKFESKLFNWM---LNLTEEFDLTFPHPTMEPKANIVPCLLSEEEPEIEWPKF-SEQTLCKFYHINYKFEFLPAGLFNRIQVRLFDFTE------------AKKLWKYGMYF 6071
            +L  L + +  I+ +P  I  LEN+   D+SYNP L     ++  +  I  L L   C  I +      A+   + +L+  L K V  NR K++ VG   +GKT+L+  L          +E   ++ T GID+  W ++   +   EI  + WDFAGQ+ +Y +H  F++ +A+Y+VV+ + +G+   D +  WL +I   +  +PV +VGT  D    +   +C S +K+          I ++  V++   +  +  L++ +I   LN      P + Q IP + L+LE    N+  ++  +   I+++    I     +   E ++   +  L++ G + +F+     L++   ++PQW+  I+A +++V     QK   GI +  +++   +K +    N+M     L E+F +  P   +     ++P  LS+  P IE P   + + + + Y ++Y     P G ++R+  RL + +              +  W+ G+Y 
Sbjct: 1201 RLEKLHLSYNKIKEIPPEIGFLENITSFDISYNPDLRTFPDEMGKLTKIWDLPLDGLCLDIDLKHIGCKAKDL-IRFLQQRLKKAVPYNRMKVLIVGNTGSGKTTLVQQLMKCRR-----LEHGAEKATVGIDVKDWPILIRGKIKKEITLNVWDFAGQEEFYCSHPHFMTPQALYLVVYDLSKGVSEVDAIKPWLFNIKARASSSPVILVGTHLDVSDEKCQKACISKIKQELCNQHGLPSIREYHFVNASEESDLLAKLRKTIIRECLNFKIREQPVLGQLIPDSYLELEKKILNERKNVPLEFPVISHERMLEIVEESQLHLDENELTHAVHFLNESGVLLHFEDPALQLRDLYFVDPQWLCKIIAQILTVRADGCQKYPKGIIHCNDVERFLEKKKKFPKNYMSQYFKLLEKFQIALP---LGEDQLLIPSSLSDHRPVIELPHCENSEVIIRLYEMSY----FPMGFWSRLINRLLEVSTYMLSGRERAQRPNRMYWRQGIYL 1695          
BLAST of Roc domain-containing protein vs. Ensembl Mouse
Match: Lrrk2 (leucine-rich repeat kinase 2 [Source:MGI Symbol;Acc:MGI:1913975])

HSP 1 Score: 121.324 bits (303), Expect = 1.805e-26
Identity = 123/513 (23.98%), Postives = 233/513 (45.42%), Query Frame = 3
Query: 4698 LVIQHQSIRYVPDSIQQLENLEILDLSYNPLLEXXXXXXXXXXXX--XXXXXXHC----PSISVPPPEIIARGTSLSYLKYLLAKTVVCNRTKLMFVGLGEAGKTSLLHALRSDENSAKEIIEQQEKQVTDGIDITKWTVICHNE---EIQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIEHGD-LDFWLSSISCHSKYAPVFVVGTRCD--QVQADMSCFSSL------KKRYSQIEDFILVDSLSGT-GIKDLKQKLIHVTLNL-----PYMHQAIPSTILDLENQFTSIR----------SQKNYITYQEFQNIAISQGIFEKDVKSVIQILHDFGSIQYFDTEILK--NYVVINPQWIVDIMANVVSV-VNQKIKN--GIFYHENMKDVWDKFESKLFNWMLN---LTEEFDLTFPHPTMEPKANIVPCLLSEEEPEIEWPKF-SEQTLCKFYHINYKFEFLPAGLFNRIQVRLFDFT------------EAKKLWKYGMYF 6071
            L + H  ++ +P  I  LENL  LD+SYN  L     ++  +  I    L  +H       +     +II       +L+  L K V  NR KLM VG   +GKT+LL  L   +       E   +  T GID+  W++    +   ++  + WDFAG++ +Y+TH  F++++A+Y+ V+ + +G    D +  WL +I   +  +PV +VGT  D    +   +C S +      K+ +  I D+  V++   +  +  L++ +I+ +LN      P + Q IP   ++LE    S R          ++K+ +       + +     E ++   +  L++ G + +F    L+  +   + P+W+  +MA +++V V+  +K+  GI    +++    K +    N+M+    L E+F +  P   +  +  +VP  LS+  P IE P   + + + + Y + Y     P G ++R+  RL + +              +  W+ G+Y 
Sbjct: 1250 LHLSHNKLKEIPPEIGCLENLTSLDVSYNLELRSFPNEMGKLSKIWDLPLDGLHLNFDFKHVGCKAKDII------RFLQQRLKKAVPYNRMKLMIVGNTGSGKTTLLQQLMKMKKP-----ELGMQGATVGIDVRDWSIQIRGKRRKDLVLNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARASSSPVILVGTHLDVSDEKQRKACISKITKELLNKRGFPTIRDYHFVNATEESDALAKLRKTIINESLNFKIRDQPVVGQLIPDCYVELEKIILSERKAVPTEFPVINRKHLLQLVNEHQLQLD----ENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKVMAQILTVKVDGCLKHPKGIISRRDVEKFLSKKKRFPKNYMMQYFKLLEKFQIALP---IGEEYLLVPSSLSDHRPVIELPHCENSEIIIRLYEMPY----FPMGFWSRLINRLLEISPFMLSGRERALRPNRMYWRQGIYL 1740          
BLAST of Roc domain-containing protein vs. Ensembl Mouse
Match: Lrrk1 (leucine-rich repeat kinase 1 [Source:MGI Symbol;Acc:MGI:2142227])

HSP 1 Score: 99.7525 bits (247), Expect = 5.910e-20
Identity = 117/502 (23.31%), Postives = 215/502 (42.83%), Query Frame = 3
Query: 4683 KKLITLVIQHQSIRYVPDSIQQLENLEILDLSYNPLLEXXXXXXXXXXXXXXXXXXHCPSISVPPPEIIARG--TSLSYLKYLLAKTVVCNRTKLMFVGLGEAGKTSLLHALRSDENSAKEIIEQQEKQVTDGIDITKWTV------ICHNEEIQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIEH-GDLDFWLSSISCHSKYAPVFVVGTRCDQVQADMS--------------CFSSLKKRYSQIEDFIL-----VDSLSGTGIKDLKQKLIHVTLNL----------PYMHQAIPSTILDL------ENQFTSIRSQKNYITYQEF-QNIAISQGIFEK---DVKSVIQILHDFGSIQYF--DTEILKNYVVINPQWIVDIMANVVSVVNQK--IKNGIFYHENMKD--VWDKFESKLFNWMLNLTEEFDLTFPHPTMEPKANIVPCLLSEEEPEIEWPKFSEQTLCKFYHINYKFEFLPAGLFNRIQVRLF 6026
            + L  L +    +  VP S+  L+NL  L L  NP L ++  ++  + ++ QL +    +IS  P E+   G   +LS+L+  L K   C   K++ VG    GK++LL  L++ +  A ++   +       I  TKW +          E ++++ WD  G       +Q F ++KA+Y+VVW++  G E   +L FWL +I   +  A V VVGT  D ++A                 C S    R +   D        +   +  G + L+Q + HVT N+              + IP + + L      E Q  S+  Q  Y+T ++  Q +  + G   K   D++S I  L + G++ +F   +  L+N   ++P W+ + +  + ++   +   KNG+   E+++   V   F  +          +F++  P   +   + ++P LL   +P ++              + +K  F+P G + R   R+ 
Sbjct:  548 ESLEVLCLNDNHLDAVPPSVCLLKNLSELYLGNNPGLRELPPELGQLGNLWQLDIEDL-NISNVPAEVRKEGPKATLSFLRAQLRKAEKCKLMKMILVGPPRQGKSTLLEILQTGK--APQLAHSEAT-----IRTTKWELQRPAGSKAKVESVEFNVWDIGGPASMATVNQCFFTDKALYVVVWNLALGEEAVANLQFWLLNIEAKAPNAVVLVVGTHLDLIEAKFRVERIATLRAYVLALCRSPSGSRATGFPDITFKHLHEISCKNLEGQEGLRQLIFHVTCNMKDVGSTIGCQKLAGRLIPRSYISLQEAVLAEQQRRSLGDQVQYLTDRQLDQLVEQTPGNDIKDYEDLQSAISFLIETGTLLHFPDTSHGLRNLYFLDPIWLSECLQRIFNIKGSRSVAKNGVIQAEDLRMLLVGTGFTQQTEEQYFQFLAKFEIALP---VANDSYLLPHLLP-SKPGLDTHSMRHPMANTIQRV-FKMSFVPVGFWQRFIARML 1036          
BLAST of Roc domain-containing protein vs. Ensembl Mouse
Match: Mfhas1 (malignant fibrous histiocytoma amplified sequence 1 [Source:MGI Symbol;Acc:MGI:1098644])

HSP 1 Score: 93.5893 bits (231), Expect = 2.873e-18
Identity = 124/554 (22.38%), Postives = 213/554 (38.45%), Query Frame = 3
Query: 4326 TISNFICXXXXXXXXXXXXHGIESLPDEFGRLENMKELKLIGSPLYYELLKNDFIIKSDNLEFEYPEIGFYKVKENDKNPISFLPVADI---------FINVPRIGSGYSEP----VDVNSHGGFPMAILQLKKLITLVIQHQSIRYVPDSIQQLENLEILDLSYNPLLEXXXXXXXXXXXXXXXXXXHCPSISVPPPEIIARGTS--LSYLKYLL-AKTVVCNRTKLMFVGLGEAGKTSLLHALRSDENSAKEIIEQQEKQV-------TDGIDITKWTVICHNEEIQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIEH---GDLDFWLSSISCHSKYAPVFVVGTRCD--------------------QVQADMSCFSSLKKRYSQ--IEDFILVDSLS-----GTGIKDLKQKLIHVT--LN------------------------------------LPYMHQAIPSTILDLEN-QFTSIRSQKNYITYQEFQNIAISQGIFEKDVKSVIQILHDFGSIQYF-DTEILKNYVVINPQWIVDIM 5708
            T+    C   +L  + L  +G+++LPDEF RL+ +K L L                 S NL  E+P               + LP+A +           +VP + +G        +D N     P +I++L  L  LV+Q   I  +PD+  QL  + +  +  NPL++                         PP E+  +G     +Y K L  ++  V  R KL+ +G   AGKT L H L  D+    +    +EK         + GI++T WT    +  +++  +D AG + Y     FFLS  A+Y++V ++           +  +L  +     +A V +VGT  D                    Q + D    S L K   +    DF L  +       G   K+L+++  H    LN                                     P +H+ +P +   LE   F   ++Q+ ++++ +   + +  G+ E  ++S +  LH+ G + YF D+  LK +V  N   ++DI+
Sbjct:  237 TLPRGFCELASLESLMLDNNGLQALPDEFSRLQRLKMLNL-----------------SSNLFEEFPA--------------ALLPLAGLEELYLSRNQLTSVPSLIAGLGRLLTLWLDNNRIRYLPDSIVELTGLEELVLQGNQIAVLPDNFGQLSRVGLWKIKDNPLIQ-------------------------PPYEVCMKGIPYIAAYQKELAHSQPAVQPRLKLLLMGHKAAGKTLLRHCLTEDKVEGGQGGGDKEKSYLPFPPLGSKGIEVTSWTADA-SRGLRFIVYDLAGDESYEVIQPFFLSPGALYVLVVNLATYEPRCFPTTVGSFLHRVGARVPHAVVCIVGTHADLCGERELEEKCLDIHRQIALQEKNDAEGLSHLAKVVDEALARDFELRSASPHAAYYGVSDKNLRRRKAHFQYLLNHRLQILSPVLPVSCRDPLQLQRLRDKLLSVAEHREIFPNLHRVLPRSWQVLEELHFQPPQAQRLWLSWWDSARLGLQAGLTEDRLQSALSYLHESGKLLYFEDSPALKEHVFHNLTRLIDIL 733          
BLAST of Roc domain-containing protein vs. Ensembl Mouse
Match: Mfhas1 (malignant fibrous histiocytoma amplified sequence 1 [Source:MGI Symbol;Acc:MGI:1098644])

HSP 1 Score: 92.8189 bits (229), Expect = 3.707e-18
Identity = 123/554 (22.20%), Postives = 212/554 (38.27%), Query Frame = 3
Query: 4326 TISNFICXXXXXXXXXXXXHGIESLPDEFGRLENMKELKLIGSPLYYELLKNDFIIKSDNLEFEYPEIGFYKVKENDKNPISFLPVADI---------FINVPRIGSGYSEP----VDVNSHGGFPMAILQLKKLITLVIQHQSIRYVPDSIQQLENLEILDLSYNPLLEXXXXXXXXXXXXXXXXXXHCPSISVPPPEIIARGTS--LSYLKYLL-AKTVVCNRTKLMFVGLGEAGKTSLLHALRSDENSAKEIIEQQEKQV-------TDGIDITKWTVICHNEEIQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIEH---GDLDFWLSSISCHSKYAPVFVVGTRCD--------------------QVQADMSCFSSLKKRYSQ--IEDFILVDSLS-----GTGIKDLKQKLIHVTLNL--------------------------------------PYMHQAIPSTILDLEN-QFTSIRSQKNYITYQEFQNIAISQGIFEKDVKSVIQILHDFGSIQYF-DTEILKNYVVINPQWIVDIM 5708
            T+    C   +L  + L  +G+++LPDEF RL+ +K L L                 S NL  E+              P + LP+A +           +VP + +G        +D N     P +I++L  L  LV+Q   I  +PD+  QL  + +  +  NPL++                         PP E+  +G     +Y K L  ++  V  R KL+ +G   AGKT L H L  D+    +    +EK         + GI++T WT    +  +++  +D AG + Y     FFLS  A+Y++V ++           +  +L  +     +A V +VGT  D                    Q + D    S L K   +    DF L  +       G   K+L+++  H    L                                      P +H+ +P +   LE   F   ++Q+ ++++ +   + +  G+ E  ++S +  LH+ G + YF D+  LK +V  N   ++DI+
Sbjct:   43 TLPRGFCELASLESLMLDNNGLQALPDEFSRLQRLKMLNL-----------------SSNLFEEF--------------PAALLPLAGLEELYLSRNQLTSVPSLIAGLGRLLTLWLDNNRIRYLPDSIVELTGLEELVLQGNQIAVLPDNFGQLSRVGLWKIKDNPLIQ-------------------------PPYEVCMKGIPYIAAYQKELAHSQPAVQPRLKLLLMGHKAAGKTLLRHCLTEDKVEGGQGGGDKEKSYLPFPPLGSKGIEVTSWTADA-SRGLRFIVYDLAGDESYEVIQPFFLSPGALYVLVVNLATYEPRCFPTTVGSFLHRVGARVPHAVVCIVGTHADLCGERELEEKCLDIHRQIALQEKNDAEGLSHLAKVVDEALARDFELRSASPHAAYYGVSDKNLRRRKAHFQYLLNHRLQILSPVLPVSCRDPLQLQRLRDKLLSVAEHREIFPNLHRVLPRSWQVLEELHFQPPQAQRLWLSWWDSARLGLQAGLTEDRLQSALSYLHESGKLLYFEDSPALKEHVFHNLTRLIDIL 539          
BLAST of Roc domain-containing protein vs. Ensembl Mouse
Match: Spryd3 (SPRY domain containing 3 [Source:MGI Symbol;Acc:MGI:2446175])

HSP 1 Score: 79.337 bits (194), Expect = 2.334e-14
Identity = 55/155 (35.48%), Postives = 84/155 (54.19%), Query Frame = 3
Query: 1830 NVLQELGILTYN-NETEVSLVVGKFPVSPDRRRFSMEILNPGASGRITIGLVPANYSV-IQPGWRENSLAYHGDDGGIFLGESVPQIIRETFSEVNNCIEVIIEYES-SLDSPELVRHITWRKNGKFVEKILIQHDKE-LYPAIGMHSINEQVRL 2282
            ++L +   L+Y+ N  EV   V   P++ D   F + I++ G  G I +GLVP  YS+  QPGW  +S+AYH DDG ++ G +     R+  S+ N+   +    E  S D       I + KNGK V   ++    + L+PA+GMHS+ E+VRL
Sbjct:   48 HILVDGDTLSYHGNSGEVGCYVASRPLTKDSNYFEVSIVDSGVRGTIAVGLVPQYYSLDHQPGWLPDSVAYHADDGKLYNGRAKG---RQFGSKCNSGDRIGCGIEPVSFDVQ--TAQIFFTKNGKRVGSTIMPMSPDGLFPAVGMHSLGEEVRL 197          

HSP 2 Score: 53.1434 bits (126), Expect = 4.151e-6
Identity = 27/69 (39.13%), Postives = 36/69 (52.17%), Query Frame = 3
Query: 1872 TEVSLVVGKFPVSPDRRRFSMEILNPGASGRITIGLVPANYSV-IQPGWRENSLAYHGDDGGIFLGESV 2075
             +V L   + P+S     F +EI++PG    I +GL   +Y     PGW   S+AYH DDG IF G  V
Sbjct:  243 VDVGLAQARHPLSTRSHYFEVEIVDPGEKCYIALGLARKDYPKNRHPGWSRGSVAYHADDGKIFHGSGV 311          
BLAST of Roc domain-containing protein vs. UniProt/SwissProt
Match: sp|Q55E58|PATS1_DICDI (Probable serine/threonine-protein kinase pats1 OS=Dictyostelium discoideum OX=44689 GN=pats1 PE=3 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 4.846e-58
Identity = 209/708 (29.52%), Postives = 334/708 (47.18%), Query Frame = 3
Query: 4389 IESLPDEFGRLENMKEL-----KLIGSPLYYELLKNDFIIKSDNLEFEYPEIGFYKVKENDKNPISFLPVADIF-INVPRIGSGYSEPVDVNSHGGFPMAILQLKKLITLVIQHQSIRYVPDSIQQLENLEILDLSYNPLLEXXXXXXXXXXXXXXXXXXHCPSISVPPPEIIARG--TSLSYLKYLLAKTVVCNRTKLMFVGLGEAGKTSLLHALRSDENSAKEIIEQQEKQVTDGIDITKWTVICHNEE----------------IQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIEHGDLDFWLSSISCHSKYAPVFVVGTRCDQVQADMSCFSSLKK------RYSQIEDFILVDSLSGTGIKDLKQKLIHVTLNLPYMHQAIPSTILDLENQFTSIRSQK--NYITYQEF-QNIAISQGIFEKDVKSVIQILHDFGSIQYFDTEI-LKNYVVINPQWIVDIMANVVSVVNQKIKNGIFYHENMKDVWD--KFESKLFNWMLNLTEEFDLTF---PHPT-MEPKANIVPCLLSEEEPEI---EWPKFSEQTLCKFYHINYKFEFLPAGLFNRIQVRLFDFT--EAKKLWKYGMYFEKNGHHVLFMRENKS----SLIVRAIGVRPVNVLAMVDDVIKGLVKASFHGVRYNLEISCPDCIEYGNNISNDATKYWSNISMIPSKLIKKALIKKVEYLQC 6365
            I  LP EFG L+++++L      L+  P  +  L N   ++  +L F               N ++ LP    F IN+ ++       ++ N     P  I QL KL+ L +    +  +P SI QL  L  L+L+ N  L         ++S    + +    +  PPPEI++ G  + L YLK L+     C + KLM VG    GKT+LL  L+  +  A           TDGI I +W   C  EE                I  S WDFAGQ++YY THQFFLSE+++YIV W+     E   ++FWL SI+  +K AP+ +VGT  D V    +     +       RY  I+   LV   SG GI  L++KL  +  +   M +++P + + LEN       ++    I + EF Q   I     E ++      LH  GS+ YF  E  LK +V+++PQWI  +++++++  +   K+GI  H+++K +W   ++ + L   +++L E+F++++   P  T  E   +++P LL  + P I    W  F+ Q + +F  I Y+FEF+P G F+R+ VR+ +F   EAK  WK GM  + +    +F+  N +    S  VR  G     +   V + I+ L+  SF    Y + + C  CI     +S     Y+      P  + + A +K   YL+C
Sbjct: 1552 IVELPKEFGDLKSLEKLYLDFNSLVTLPHSFRQLTN---LEELSLSF---------------NSMTELPREVCFLINLKKLM------IEGNQIQFLPNEISQLSKLMILNVCKNKLDSLPASIGQLSQLVSLNLNNNSQL-VSLRPTMGLLSNLVELKLDGTRLKTPPPEIVSLGLKSILLYLKDLIKGQEQCYKMKLMIVGQENVGKTTLLKTLKEKKKKATP---SGPNISTDGIAIDQWVFSCLFEELDETSQNGRLIKKKQDITLSIWDFAGQEIYYTTHQFFLSERSVYIVAWNCALAEEESRVEFWLQSITTRAKDAPIIIVGTHLDDVNRTTAKMQKKRMKEKYLIRYQNIKAIKLVSCTSGKGITSLREKLEALVQSQSNMGESLPRSYMLLENLVKEETKKRIIPTIPWTEFIQMGTICTITDEAELLRATMFLHQLGSLVYFPKEPGLKQFVILDPQWITTMLSSIITTKHSYAKDGILNHKSLKQIWRPPQYPTHLHPHLISLLEKFEISYNLSPDSTSFETGTSLIPSLLLNDRPAIFPSLWGSFN-QLVRQFGRI-YQFEFVPNGFFSRLMVRILNFARVEAKCYWKNGMILQHD-EETIFLEMNNAKKSLSFTVRG-GANSTTLSRDVIETIQSLLDDSFQLPTY-VFVPCFHCIF----LSLPQCYYF------PLDVCENAAVKGTGYLKC 2216          
BLAST of Roc domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6XHB2|ROCO4_DICDI (Probable serine/threonine-protein kinase roco4 OS=Dictyostelium discoideum OX=44689 GN=roco4 PE=1 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 1.120e-47
Identity = 160/527 (30.36%), Postives = 268/527 (50.85%), Query Frame = 3
Query: 4659 FPMAILQL-KKLITLVIQHQSIRYVPDSIQQLENLEILDLSYNPLLEXXXXXXXXXXXXXXXXXXHCPSISVPPPEIIARGTS--LSYLKYLL--AKTVVCNRTKLMFVGLGEAGKTSLLHALRSDENSAKEIIEQQEKQVTDGIDITKWTVICHNEEIQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIEHGDLDFWLSSISCHSKYA--PVFVVGTRCD-----QVQADMSCFSSLKKRYSQIEDFIL--VDSLSGTGIKDLKQKLIHVTLNLPYMHQAIPSTILDLENQFT---------------------------SIRSQK-NYITYQEFQNIAISQGIFEKDVKSVIQILHDFGSIQYFDTEILKNYVVINPQWIVDIMANVVSVVNQKIKNGIFYHENMKDVW-DKFESKLFNWMLNLTEEFDLTFPHPTMEPKANIVPCLLSEE-EPEI------EW---PKFSEQTLCKFYHINYKFEFLPAGLFNRIQVRLFDFT--EAKKLWKYGMYFE 6074
            FPM+I Q+   L+ L +    I  +P  IQ L++L IL L  N LLE +  +I  +  +K L L   P ++  P  ++  GT   L + K +L   K+   N+ KLMFVG    GKTSL  AL+  +    E+    +   T+G+ I        N+++++ AWDF GQ V+Y THQFFL+  A+Y+VV+ +        +++W+  +  +S  A   +F+VGT  D     Q+Q   S   +   +YS++++  +  V   +G GIK+LK++LIH       + + IP   + LE + T                           +I SQK  YI Y ++ N      +  +++K     LH+ G I +FDT  LKN VV++PQW+ D+M+++++  +  IK GI  H  +  VW  K++  L+  +L L E+F++++  P +    +++P LL E+ E EI      EW   P+  E   C+ +  +Y F+F+P G F R+ +R+   +  E +  W+ G+  +
Sbjct:  270 FPMSITQMCTHLVELDLSDNKITELPKDIQLLKSLRILILRGN-LLEDIPLEICYLGDLKILELQENP-LNNFPLSVVQSGTKNLLLFCKNILERKKSETWNKVKLMFVGQEGVGKTSLCQALKGSKKKKAELQVTGDTVSTEGVKIQN----IKNKKVEFHAWDFGGQQVFYPTHQFFLTTHALYLVVFKLTDPNFAERVNYWVRQVKSNSSGAVPAIFLVGTHSDVCTPEQLQEAESILKANFVKYSRVKENTINFVCCATGKGIKELKKRLIHEAEKSHLIKKDIPGNYMVLEARLTNRGANPGRMAVSGSPIGGGSSAQLSSNAINSQKERYIDYDDYMNECKLSHLQPEEIKGATDFLHNLGIILHFDTPTLKNLVVLDPQWLADVMSSLITFSHNWIKRGILNHSELVAVWGGKYDQSLWPLLLKLLEKFEVSYELPNI--AKSLIPSLLPEDAEGEISTIKDREWVTLPQAIESGRCQVFGCDYNFDFMPLGFFARLLLRILLISGVEVRTYWRNGVLLD 788          
BLAST of Roc domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8MVR1|GBPC_DICDI (Cyclic GMP-binding protein C OS=Dictyostelium discoideum OX=44689 GN=gbpC PE=1 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 3.719e-35
Identity = 139/580 (23.97%), Postives = 260/580 (44.83%), Query Frame = 3
Query: 4677 QLKKLITLVIQHQSIRYVPDSIQQLENLEILDLSYNPLLEXXXXXXXXXXXXXXXXXXHCPSISVPPPEIIARGTS--LSYLKYLLAKTVVCNRTKLMFVGLGEAGKTSLLHALRSDENSAKEIIEQQEKQVTD----GIDITKWTVIC-------HNEEIQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIEHGDLDFWLSSISCHSKYAPVFVVGTRCDQ------VQADM-SCFSSLKKRYSQIEDFILVDSLSGTGIKDLKQKLIHVTLNLPYMHQAIPSTILDLENQFTSIRSQK--NYITYQEFQNIA-ISQGIFEKDVKSVIQILHDFGSIQYF---DTEILKNYVVINPQWIVDIMANVVS---VVNQKIKNGIFYHENMKDVWDK--FESKLFNWMLNLTEEF---------DLTFPHPTMEPKA----NIVPCLLSEEEPEI-EWPKFSEQTLCKFYHINYKFEFLPAGLFNRIQVRLFDFTEAKKLWKYGMYFEKNGHHVLF-----MRENKSS-----LIVRAIG-VRPVNVLAMVDDVIKGLVKASFHGVRYNLEISCPDC 6248
            +L KL  L + +  +  +P SI  L +L+ L++  NP++                          PP  ++++G    +S+L+ L      C R+KL+ +G    GKTS++  ++  +              +     GI+I ++               I  S WD A QDVY+ + Q F SE+++YIVV+++    +   +++WL  I   S  +P+ +VGT  D       V A + S  S  +KR++ I+  I V   +G  +  L+Q +  +    PY+ + +PS+   LE     ++ ++    + +QE+ N+A I        ++   + LH+ GSI YF   ++  +   V+++ QWI++ M+++++   ++N    NGI    +++ VW    +   L   +L++ + F         DL  P    E +     N+VP LLS+    + +W  F +       +  Y   FLP   F ++ + L +FT+ +   K  +      +H        +++NK       L V   G V PV++L +V D I+ L  + ++ +     ISC +C
Sbjct:  261 RLSKLEVLSVNNNKLTLLPTSIASLSSLKTLNIKSNPII-------------------------TPPSTVVSKGLKDIVSFLRELETGARPCLRSKLVVLGDPGVGKTSVVQCMKGKKKKTNVTSSSINIGGSSGSEVGIEIDQYDFDVVFDEDDKKRRVITLSTWDIANQDVYFASSQLFDSERSVYIVVFNLNND-DFSAIEYWLHCIMSTSPNSPIVLVGTHIDAFENLNVVNAVLESVASRFQKRFTNIQAIISVSCTTGYDVDKLRQLIEDIIKTQPYLKEKVPSSFFTLEEALIEVKKKRIPPVMMWQEYINLANICNLKDSVQIQRATEFLHNIGSIVYFNDLNSSTVGKMVILDQQWIINCMSSLITSKLLINN--CNGIVRQSDLELVWKAPTYPEHLHPALLSIMQAFEICRSLSPSDLVRPEEVNEKEVMGDRNLVPNLLSDNTNIVAQWDDFIDPDTI-LLNRQYHLPFLPEKFFGKLIIHLMNFTKVESCQKRAVILRNQDNHEALIELKTIKDNKDGTFKKILTVDVRGLVSPVSLLRIVTDTIESLF-SQWYKLDIKRYISCYEC 810          
BLAST of Roc domain-containing protein vs. UniProt/SwissProt
Match: sp|Q1ZXD6|ROCO5_DICDI (Probable serine/threonine-protein kinase roco5 OS=Dictyostelium discoideum OX=44689 GN=roco5 PE=3 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 4.198e-34
Identity = 122/462 (26.41%), Postives = 202/462 (43.72%), Query Frame = 3
Query: 4659 FPMAILQLKKLITLVIQHQSIRYVPDSIQQLENLEILDLSYNPLLEXXXXXXXXXXXXXXXXXXHCPSISVPPPEIIARGTSLSYLKYL-LAKTV--VCNRTKLMFVGLGEAGKTSLLHALRS--------------------------------DENSAKEI--IEQQEKQVTDGIDITKWTVICHNEE--IQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVW--SVRQGIEHGDLDFWLSSISCHSKYAPVFVVGTRCDQV-------QADMSCFSSLKKRYSQIEDFILVDSLSGTGIKDLKQKLIHVTLNLPYMHQAIPSTILDLENQFTSIRSQKN--YITYQEFQNIAISQGIFEKDVKSVIQILHDFGSIQYFD--TEILKNYVVINPQWIVDIMANVVSVVNQKIKNGIFYHENMKDVWDK--FESKLFNWMLNLTEEFDLTFPHPTMEPKANI 5882
             P  I +L  L TL + + +I  +P  + QL  L++L+++ NP+                        IS+P  ++++    +  LKYL LA T    C R KLM VG    GKTS+   L+                                 D N+ + I  +       TDGI++  W     ++   + +S WDFAGQ+VYY+THQFF+S ++++IVV+  SV    E   + +WL  I      +PV +VGT  D +       Q      S    ++  ++ F+ V   SG  I  L+  ++ +      +      +   LEN   S R       IT  EF  +AIS GI +  + +    L + G I YFD     L  ++ I+P W+  +MA +++     +++G+    N+  +W    F   L + +L + ++F++   HP  +PKA I
Sbjct: 1167 LPPQIGKLSSLQTLNLSNNAIESLPWQLSQLTTLKVLNITGNPI---------------SFDGASNAKISIP--DVLSGDDLIGILKYLKLASTKEKPCMRMKLMLVGQENVGKTSIAKCLKKEIIPVGKKLRQTIGLGTKKSKTPTLTEANGSIDFNAPQSINPLNTSLNISTDGINMDDWRPPSEDQSPPVTFSIWDFAGQEVYYSTHQFFISSRSVFIVVFDMSVYNPDETSRVPYWLQCIEAFGGNSPVILVGTHLDDLPNGVDVNQITQDIHSKYFTKFPNVKFFLPVSCKSGKNINKLQNHIVKLGKAEKKLGDLFSRSYFQLENLILSEREMNTPPIITLSEFTEMAISCGIPQTSITAAADFLKELGVIVYFDDPKSGLDQFIFIDPPWLTRLMATIITSKPNFVQSGVLDQSNLHQIWKPPDFPQHLHHVLLAILQKFEIV--HPLPDPKATI 1609          

HSP 2 Score: 62.003 bits (149), Expect = 1.257e-7
Identity = 48/145 (33.10%), Postives = 73/145 (50.34%), Query Frame = 3
Query: 5859 TMEPKAN---IVPCLLSEEEP-EIEWPKFSEQTLCK------FYHINYKFEFLPAGLFNRIQVRLFDFTEAKKLWKYGMYFEKNGHHVLFMRENKSSLI-VRAIGVRPVNVLAMV----DDVIKGLVKASFHGVRYNLEISCPDC 6248
            T+ PK++   +VP LLSEE P  IE  K  +Q L K      F    Y+FEFLP G F+++ +R   FT  K+ WK G+  EK+    L     + + I  +A G  P ++L  +    + +I G  K  FH   + +  +C +C
Sbjct: 1713 TLVPKSSTKHLVPILLSEERPNSIE--KLYDQILLKSQQQQPFLERIYQFEFLPIGFFSKLMIRTMHFTTVKEFWKNGLLVEKDDSQCLIESIQQFNQINFKAWGKNPASLLRFIIETAEVLISGWYKLHFH---FLVPCNCINC 1852          
BLAST of Roc domain-containing protein vs. UniProt/SwissProt
Match: sp|Q54WS5|ROCO6_DICDI (Probable serine/threonine-protein kinase roco6 OS=Dictyostelium discoideum OX=44689 GN=roco6 PE=3 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 1.951e-28
Identity = 75/266 (28.20%), Postives = 137/266 (51.50%), Query Frame = 3
Query: 5109 NEEIQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIEHGDLDFWLSSISCHSKYAPVFVVGTRCDQVQADMS----------CFSSLKKRYSQIEDFILVDSLSGTGIKDLKQKLIHVTLNLPYMHQAIPSTILDLENQFTSIRSQ--KNYITYQEFQNIAISQGIF--EKDVKSVIQILHDFGSIQYFDTEILKNYVVINPQWIVDIMANVVSVVNQKIKNGIFYHENMKDVWDK----FESKLFNWMLNLTEEFDLTFP 5852
            N+ +  S WD AGQ++YY +HQ FL++ A+Y+VVW++ +   +  ++FWL SI   ++ AP+ ++GT  D   A  S           +S   +++ +++   ++   +G G  +    L    + LP + Q++P   L LE      RS      +T+Q F  + +S   F  E  VK   + L   GSI +FD   L  YV ++PQW+  + +++++  ++ IK+G+    ++  +W       +  L + ++NL E F+L FP
Sbjct:  625 NQRVTMSIWDCAGQELYYTSHQMFLTDSALYVVVWNLCKPEVNSRVEFWLHSIRSKAENAPILLIGTHLDDYLATHSESELDEILENIYSKYFRKF-RLKGISILSCSTGVGFDNFLDLLKKTVVELPSLKQSLPELYLKLEKLIIKKRSTLVPPVLTWQSFSQMVLSNLDFHDEIHVKVATKALVPLGSISFFDEPGLDQYVFLDPQWLTGVFSSIITTKHKFIKDGVLKKSDLYQIWKPPHFIEDEGLHSLLINLLERFELMFP 889          
BLAST of Roc domain-containing protein vs. TrEMBL
Match: K1QX07 (Putative serine/threonine-protein kinase pats1 OS=Crassostrea gigas OX=29159 GN=CGI_10012201 PE=4 SV=1)

HSP 1 Score: 651.358 bits (1679), Expect = 0.000e+0
Identity = 524/1651 (31.74%), Postives = 832/1651 (50.39%), Query Frame = 3
Query: 3432 LWEHSMLHLISWDKLLFYPFCPGKSTIYDSKPHLVNTEGIELFEVNSSPSEICKAVFFNPKLLLCHKLILNYKFLLPKYNRILR------KEITDFSQDEIEYLIFSILNKITSYMVLTNLFFDEKYAFTQSLKVNWNK-----YFENNN-------------NHSLVLESHGVSCK--LHSSLYDEQINLDDIIGAPETNQKDNEIIMENHSIFDYAKCSQSIILSGKTVKELPAELFVKFINL--CSLELRNMFQLKCLPRTIYSLKGLQRLIINQVKINTLP-DIYEFPNLKYLQIEKCPIKTYN-DSNECXXXXXXXXXXXXXQTISNFICXXXXXXXXXXXXHGIESLPDEFGRLENMKELKLIGSPLYYELLKNDFIIKSDNLEF--EYPEI-------GFYKV-KENDKNPISFLPVADI-------FINVPRIGSGYSEPVDVN-SHGGFPMAILQLKKLITLVIQHQSIRYVPDSIQQLENLEILDLSYNPLLEXXXXXXXXXXXXXXXXXXHCPSISVPPPEIIARG--TSLSYLKYLLAKTVVCNRTKLMFVGLGEAGKTSLLHALRSDENSAKEIIEQQEKQVTDGIDITKWTVICHNE-EIQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIEHGDLDFWLSSISCHSKYAPVFVVGTRCDQVQADMSCFSSLKKRYSQIEDFILVDSLSGTGIKDLKQKLIHVTLNLPYMHQAIPSTILDLENQFTSIRSQKNYITYQEFQNIAISQGIF-EKDVKSVIQILHDFGSIQYFDTEILKNYVVINPQWIVDIMANVVSVVNQKIKN--GIFYHENMKDVWDKFESKLFNWMLNLTEEFDLTFPHPTMEPKANIVPCLLSEEEP-EIEWPKFSEQTLCKFYHINYKFEFLPAGLFNRIQVRLFDFTEAKKLWKYGMYFEKNGHHVLFMRENKSSLIVRAIGVRPVNVLAMVDDVIKGLVKASFHGVRYNLEISCPDCIEYGNNISNDATKYWSNISMIPSKLIKKALIKKVEYLQCEE-LHLNSIKSIKENTPETASAEEFINDLISKVQTVKSLYASSDKLVTFLHSTKDLTDLSAMPMKEFD----------NLFSDCNIVCIKINETSEVKWKTSISNCQLCLICLSENFIQIPKMNEMLEYXXXXXXXXXXXXXSSDKEIRQ--KWEYYPYFMTV------FIKINATHPKASTEKILEIKKAIQDSIVSSTVNETAGETYDCFVSYCWANSQDAVNKGTKAIPGAIISPDADPRKLARYLIDNGIKCWIDDSHMDKTXXXXXXXXXXXXXXKMMLAFVSDEYDKSDNCKMELNFMVEELRRPVSYVLVGSNMEWRFNSEVGLIMQKRHRSEILDFTNNNNISESRLLEELKVRL--RNCPDIAYEKN-------------DQNKIQGHNTALMEQLELISRQILNQLISFIT----DNCPRLIVID----VDPDDGTDSQIDNDIIMDSTLQSSLRASVSGNK--------------LVLKVICEGETNWHIADEAYPL---SIEDKDEIIEKCAVYLYMIYQVFEYKNPGLRCLQPDNISNMEFITKITQIAGSSTMTFKESYSNMVKYYMKYDPKIANCSLERYRLPSGREFWMCKKHADQNPRCKL 8042
            L+E   +H + +   L   F P K        H ++  GI    ++S P ++     F   + L    ++  K LLP Y  +         E+ +  +  IE L+  +L   ++Y  L +++  +           +         +N++             NH L+ +    SCK  +H+ + +E + ++D+  + +  +  +E++    + F++   + + I         P++ F KF NL   SLE   + Q +  P     L  L+ + +  V I  LP DI++ P LK L +   P+++ + D     KL+ L +  L   ++   IC+ + L  + +  + I +LP+E  +L N+K L + G PL       + I K     +  ++P I       G  K+ +E D+N  S L + ++       F  VPR G      V  N   GG P  I QLK L  L + +Q I+ VP  I+ L NL +L L++  +L+ ++A +    ++K+L L+ CPS+  PP E++ RG  +  +YLK L      C RTKLMFVGLGEAGKTSLL AL S   S+K+    Q  Q+TDGIDI  WTV   +  +I +SAWDFAGQ VYYNTHQFF+S++A+Y+++W++R G EH  LDFWLSSI+CH+   P+ V+GT+ DQV         LK RY QI+ F  V SL+G+ I +L+++L+ VTL+  YM + IP   L+LE Q  + R++++ + Y   ++ A+  GIF +KDVK  I+ L D G++QYFD + L++ VVINPQWIV++MA VVSV    I+N  G F HE++KDVW  ++  L NW+L+LTEEFDLTFP P      NIVPCLL  E+P E++WP    +   +   + YKF +LPAGLFNR QVRLF+F++ K +WK G Y +KN H  L  +EN S L V   G RP N+L +V +V + L+  SFHGV Y+  + CPDC      IS + TK   +  +  ++LI++A   K  +LQC +  H  S+  +    PE   + +F   L   +  ++S+  +    V  L+ + D+   S   +  F           +++   ++   K++E +      ++ NC++ + C+S+ F Q  K  +M  YIK    K   + +     IR+  +W++    M +       I+     P+    KI ++K  ++D I    + ++  +  D F+SYCW NSQ+AVN GT A  GA+     DPRK+  +L   G+ CW+D   M K  GL  ++++ L+N K+++A VSDEY +SD C MEL F V  +  P+  V+VG+  +W+  SEV L+M++  +     +    N      L +  + +      +I  E+                 K      +  E+ ELI R+ +  +I+          PRL V D    V+   G + Q  +     +  +S L  + + NK                ++++CE E  WH+  +   L   ++E+    I + A +L   Y + +  +  LRCL   N    E         G ST  F ++Y+ + K    +   I N   E   LPSG+  W+C+KH+  N   KL
Sbjct: 1803 LFEDLAVHRLCFFVDLLLHFQPQKKVDLKIPIHFMDMPGI--VPISSIPLDLSFCCNFQGWVYLA---LIGQKLLLPAYTNLFSGKQLSSAEMGELDRKRIENLLSQLL---STYASLCSIYAAQHGGLPNQQNPAFGAEKVVILIKNDDIAPVAYSKQTMKENHKLIRQGRKRSCKAHIHAIVKNELLPIEDVGISYDLFEPYSELV----NAFEWDVPNLACI---------PSDFFTKFPNLQYFSLESGLLEQDRSCPSGASRLPALETVKLQNVNIKALPKDIFQIPELKTLDMTNLPLRSLDVDLPHSSKLKKLVIQGLQFTSVPKQICILKELEELYIDYNPIVTLPNEILQLTNLKILSVKGIPLITFEGNKESITKDQFFSWHEQHPMIINHISKEGVAKLFEEFDQNKNSALEIKELAQMNLKLFFTVPRFGI-----VGSNLKSGGIPPVIFQLKNLQELYLDNQGIQAVPADIENLSNLLVLSLTHCLMLQSIAAPLGLNPNLKKLNLLSCPSLRTPPLEVVGRGFESVKAYLKRLHGGFTECRRTKLMFVGLGEAGKTSLLQALMS---SSKKTAGTQNAQLTDGIDIKTWTVKSEDGLDITFSAWDFAGQTVYYNTHQFFMSKRAVYMLLWNMRMGFEHAGLDFWLSSIACHAPDTPILVIGTQSDQVPKQEIPEKDLKSRYPQIQSFHYVSSLTGSKIPELQKELLSVTLSQSYMGEKIPQVWLNLEKQILAERTKQSILDYSVIEDFAMEHGIFDDKDVKQAIKFLDDLGTVQYFDNDFLRDKVVINPQWIVNVMACVVSVKQSPIQNHDGRFLHEHIKDVWKSYDESLHNWLLSLTEEFDLTFPLPGK--PINIVPCLLPLEQPTELQWPAVDMEHGIRENKMLYKFAYLPAGLFNRAQVRLFNFSDGKIIWKNGSYLKKNKHLALIRQENDSELTVLVQGPRPENILLLVHEVFESLILESFHGVVYDYFVPCPDC------ISKEGTK---DPCLFKAELIRRAKDLKAPFLQCTKYFHTVSMGQLLAMMPEDKDS-DFDIHLQHSISALQSINNAMQYDVVVLYCSADIPSDSNPGIDPFKIREELKNWGFSVYMHDDLETAKLDELT-----LAVKNCKVVVCCVSDQFEQDEKCRDMFLYIKEQLFKKFAIAV-----IRESLQWKHSELGMKIGQPKMCMIRT----PQRFATKINDLKDIVEDHIAGLEMMKS--DHPDIFISYCWQNSQEAVNNGTVARHGALGY--GDPRKIKEFLEKKGLSCWLDIEQMGK-YGLYQEIAIGLQNCKVIVACVSDEYVESDACMMELRFAVCNMNLPLVVVVVGTGDKWK-RSEVSLLMRRSDKGANKVYMQKENPEGFEALHKFVIDVLPTYTDEILSEEKRKKDAKKKRKQDFSDKKATNEKHSYQEEYELIQRKFMRHVITMTQQLDLQLMPRLFVFDFVRSVNKPKGPEVQAPSVERPKTASKSILTRASNLNKDRVKDDDEEWQSEDFCVRLLCEHEEGWHLVPKPLSLFTNTVEEVISTITEAAPFLARFYAILKQSSVKLRCL---NGKMGESFMNFLDYEGKSTSNFLKAYTAVHKLVSSH---IDN---EECHLPSGKVAWLCEKHSKGNRITKL 3383          

HSP 2 Score: 108.612 bits (270), Expect = 2.566e-19
Identity = 106/363 (29.20%), Postives = 160/363 (44.08%), Query Frame = 3
Query: 1302 HKWV---NDVEFNNICSLCGNCSSVDGIECPYNRIISQRKGVCLCLKQSRICGSCGICQSCAANHWKNHCESDPNRLII-CNANYVNVPTRPISQFMGSKFTVD------IYQENSNTFAGLLIN----------DTDIMVD-IFGITNSCKNGAAIFADNLN-NIPSPL-PISVLSFEISESYFYKSDLYQFSKCSGINVLQELGILTYNNETEVSLVVGKF----PVSPDRRRFSMEILNPGASGRITIGLVPANYSV-IQPGWRENSLAYHGDDGGIFLGESVPQIIRETFSEVNNCIEVIIEYESSLDSPELVRHITWRKNGK--FVEKILIQHDKELYPAIGMHSINEQVRLLDFEVW 2300
            H W    N  +  ++C+LC  C    G +C +N I+      C C  +   C  CGIC +CA   W    E  P  L+   + +   V   P++ F   + T+       I  +N  + + +L+           + D M + I  +    K    + AD +   I  PL  ++V   ++S+    K   Y   +   + V QE GIL YN+ +  S+ VG+F    P S   R FS +ILN G    ITIG+ P+ Y    QPGW   S AYH DDGGIFL     +  +E   + +     I+  E  +D+    R + + KNG   +   I +      YP IG+HS  E V+LL+   W
Sbjct: 1229 HNWSPFSNVQQVQSVCTLCNRCCE-KGDKCAWNGIMGNYFRECCCETKQTGCVDCGICVTCAKEMWNLQSELRPMPLVYNKDKDIPPVGLNPVT-FDEIEITIQNGLCPPICLKNDQSGSVILVAPGKPAALQGIEADKMKEKIEALIKETKTSIKV-ADKVKLRISDPLGAVNVHKGDMSQKSVQKFTYYTV-QSREVTVFQEAGILCYNSFSP-SMPVGQFIGPKPFSNVFRSFSFKILNEGKDKAITIGIAPSFYEANRQPGWNRYSFAYHADDGGIFLETGYSRFKKEVCGKGD-----IMGVEFDVDT----RIVKFFKNGTEVYSHTINVNPRDGYYPMIGLHSPGECVKLLEVLPW 1577          
BLAST of Roc domain-containing protein vs. TrEMBL
Match: A0A2R2MQS5 (uncharacterized protein LOC106160503 OS=Lingula unguis OX=7574 GN=LOC106160503 PE=4 SV=1)

HSP 1 Score: 643.654 bits (1659), Expect = 0.000e+0
Identity = 419/1275 (32.86%), Postives = 670/1275 (52.55%), Query Frame = 3
Query: 4587 DIFINVPRIGSGYSEPVDVNSHGGFPMAILQLKKLITLVIQHQSIRYVPDSIQQLENLEILDLSYNPLLEXXXXXXX----XXXXXXXXXXXHCPSISVPPPEIIARGTS--LSYLKYLLAKTVVCNRTKLMFVGLGEAGKTSLLHALRSDENSAKEIIEQQEKQVTDGIDITKWTVICHN-EEIQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIEHGDLDFWLSSISCHSKYAPVFVVGTRCDQVQADMSCFSSLKKRYSQIEDFILVDSLSGTGIKDLKQKLIHVTLNLPYMHQAIPSTILDLENQFTSIRSQK--NYITYQEFQNIAISQGIFEK-DVKSVIQILHDFGSIQYFDTEILKNYVVINPQWIVDIMANVVSVVNQKIKNGIFYHENMKDVWDKFESKLFNWMLNLTEEFDLTFPHPTMEPKANIVPCLLSEEEPEIEWPKFSEQTLCKFYHINYKFEFLPAGLFNRIQVRLFDFTEAKKLWKYGMYFEKNGHHVLFMRENKSSLIVRAIGVRPVNVLAMVDDVIKGLVKASFHGVRYNLEISCPDCIEYGNNISNDATKYWSNISMIPSKLIKKALIKKVEYLQCEE----LHLNSIKSIKENTPETASAEEF-INDLISKVQTVKSLYASSDKLVTFLHSTKDLTDLSAMPMKEFDNLFSDCNIVCI---KINETSEVKWKTSISNCQLCLICLSENFIQIPKMNEMLEYXXXXXXXXXXXXXSSDKEIRQKWEYYPYFMTVFIKINATHPKASTEKILEIK---KAIQDSIVSSTVNETAGETYDCFVSYCWANSQDAVNKGTKAIPGAIISPDADPRKLARYLIDNGIKCWIDDSHMDKTXXXXXXXXXXXXXXKMMLAFVSDEYDKSDNCKMELNFMVEELRRPVSYVLVGSNMEWRFNSEVGLIMQKRHRSEI---------LDFTNNNNISESRLLEELKVRLRNCPDIAYEKNDQNKIQGHNTA-----------------LMEQLELISRQIL-----NQLISFITDNCPRLIVIDVDPDDGTDSQIDNDII-MDSTLQSSLRASVSGNKLVLKVICEGETNWHIADEAYPLSIEDKDEIIEKCAVYLYMIYQVFEYKNPGLRCLQPDNISNMEFITKITQIAGSSTMTFKESYSNMVKYYMKYDPKIANCSLERYRLPSGREFWMCKKHADQNPRCKLIERDRAAIDTFAIPIDNYDTSLLGDIKSKISSDTLQHNDSFHSIVQRFKT--TDAASN-RTTKHDLILPK 8243
            ++F++VPR+G  +    D +S  G P+A+ +++ L  L + +Q I  VP +I +L+ L +L+LS NPLLE V+ +++         + L L  CPS+  PP +I+ RG    +S+LK +     VC RTKLMFVGLG AGKTSLL AL S     K +     K+VTDGIDI  WTV  ++  E+ +S WDFAGQ VYYNTHQFFLS +A+Y+++W+ R G EH  L+FWLSSI+ H+  APVFV+GTR D+V         L+K++ QI  F  + SL+G GI+ L+ +L+ VTL   YM + IP+  L LE    +++ +K  + + ++E   +A   GI+E+ D+K  IQ L   GS+QYFD E L+ YVVINPQWI D+MA VVS+    IK+G   H ++  +W  ++ +   W+L LT+EFDLTFP P  + K N+VPCLL  EEP+ +WP+    +  +   + Y+F +LP GLFNR QVRLF FT+ K +WK G + +KN H  L  +  ++ L V+  G  P NVL ++ +V +GL+  ++HGV Y   + CPDC+           +   +  + P+ LI++A      +LQC      + LN +++I    P++ S  +  + + I K++ ++    S+D LV++  +  +LT+ +A P+K   ++ ++    C     I   +   +   + + +L L  +S+ + +  K  E+ +Y     KK  +++      I + +++    + + I +       S E + + K      +         +   +  D F+SYCW+NS DAV KGT    GA+     DPR++  YL   G++CW+D     KT GL   +S  L+ +K+++A VSDEY  S NC MEL F +  LR+P+   +VG+  EW   SEV +++ +   S+           +F  N        L++++ R+    +   EK +  K Q    A                   E+ ELI R+++     +  I+      P+L V+D    +G    I   ++ +   +      +    KLV K++CE E  WH++     L ++D+++ I   A YL  +  V ++    L C+   +   +EF+  I ++ G+ T  F +++ +  +  MK D       L+R  LPSG+  W+C KHAD  PR  ++  D A      +P    D   +  IK+         +  +   VQ  +T   DAAS  + T  DL  P+
Sbjct:   29 ELFMSVPRLGQTFK---DADS-SGIPLAVFEMENLRELRLANQGINSVPQTIAKLKRLRVLELSNNPLLESVAGEVAFLPIRDNVSQGLKLDGCPSLKSPPNDIVGRGGGAVISFLKRVAGGFTVCRRTKLMFVGLGGAGKTSLLRALMSGNYKTKSL---GAKEVTDGIDIKAWTVKKNDGPEVTFSTWDFAGQKVYYNTHQFFLSSRAVYLLLWTTRSGYEHAGLEFWLSSIASHAPGAPVFVIGTRADEVDKPEIPMEKLQKKFPQIAGFHFISSLTGQGIRVLEDRLVDVTLAQKYMGEQIPTVWLKLETAILTMKEKKKVSIVKWEEIAAMANEVGIYEEDDLKEAIQFLTYLGSVQYFDNEFLRKYVVINPQWIADVMACVVSIKANAIKDGRLNHSDIGVIWKAYDKEYHEWLLMLTQEFDLTFPLP--DQKVNLVPCLLPGEEPKYDWPELEADSGIRETRMLYQFTYLPTGLFNRAQVRLFQFTDGKAIWKEGSFLKKNAHIALIKQTRENELSVKVQGPEPENVLLLIHEVFEGLIAEAYHGVTYTYLVQCPDCVN---------KQRTHDPFLFPNNLIRQASNHAGAFLQCHRFFHSISLNELEAIM--PPDSKSDLDMQLENSIRKLRDMRK-NNSTDILVSYCAA--NLTENAADPIKVVQDI-NNMGYTCWFDEDIGTKTLSDFIVPLKDSKLLLAMVSKEYAEDEKCKELFQYASQKLKKPYVIVT-----ITKSFDWTKSELGMNIGLQEIFVDLSKEDVYDTKLDELKEKLKSKLEEEEKKEQDAVDVFISYCWSNSHDAVKKGTAEKDGALGWEKGDPREIRSYLESQGVRCWLDIEQAGKT-GLFEDISEGLKKAKVVVACVSDEYANSPNCMMELRFAMLNLRKPLVACVVGTKSEWE-TSEVSILLMRGRASDTSKKNTLPPKFNFQQNLKEYPPMFLKKIQDRIAQVKE-EMEKKEAVKAQPAEAADHTPAAEKRQKQEKIVSFQEEFELIQRKLMRFIEVHHAINLDIMPYPKLCVLDYVDLEGHAEAIKKSMVNLQPPVSDPDDQTGQHRKLVCKILCEYEQGWHLSGPPILLKLKDQEKFIADSAAYLARMNAVLKHSGVNLTCMGGSD-EALEFVRDI-ELKGTDTSGFAKAFKHFREEVMKNDVHKVRGHLKRCLLPSGKIRWLCPKHAD-GPRITILNSDLATAKDAVLPYSKCDEETMQLIKA---------DSKYEQTVQARQTQGQDAASALKITAQDLQAPR 1259          
BLAST of Roc domain-containing protein vs. TrEMBL
Match: A0A2T7PMT6 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_06007 PE=4 SV=1)

HSP 1 Score: 642.499 bits (1656), Expect = 0.000e+0
Identity = 487/1447 (33.66%), Postives = 734/1447 (50.73%), Query Frame = 3
Query: 4026 ILSGKTVKELPAELFVKFINLCSLELRNMFQLKCLPRTIYSLKGLQRLIINQVKINTLP-DIYEFPNLKYLQIEKCPIKTYND-SNECXXXXXXXXXXXXXQTISNFICXXXXXXXXXXXXHGIESLPDEFGRLENMKELKLIGSP-LYYELLKNDFIIKSDNLEFEY-PEI-GFYKVKENDKNPIS-FLPVADI------------------FINVPRIGSGYSEPVDVN--SHGGFPMAILQLKKLITLVIQHQSIRYVPDSIQQLENLEILDLSYNPLLEXXXXXXXXXXXXXXXXXXHCPSISVPPPEIIARG--TSLSYLKYLLAKTVVCNRTKLMFVGLGEAGKTSLLHALRSDENSAKEIIEQQEKQVTDGIDITKWTVICHNE-EIQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIEHGDLDFWLSSISCHSKYAPVFVVGTRCDQV-QADMSCFSSLKKRYSQIEDFILVDSLSGTGIKDLKQKLIHVTLNLPYMHQAIPSTILDLENQFTSIRSQKNYITYQEFQNIAISQGIF-EKDVKSVIQILHDFGSIQYFDTEILKNYVVINPQWIVDIMANVVSVVNQKIK--NGIFYHENMKDVWDKFESKLFNWMLNLTEEFDLTFPHPTMEPKANIVPCLLSEEEP-EIEWPKFSEQTLCKFYHINYKFEFLPAGLFNRIQVRLFDFTEAKKLWKYGMYFEKNGHHVLFMRENKSSLIVRAIGVRPVNVLAMVDDVIKGLVKASFHGVRYNLEISCPDCIEYGNNISNDATKYWSNISMIPSKLIKKALIKKVEYLQCEE-LHLNSIKSIKENTPETASAEEFINDLISKVQTVKSLYASSDKLVTFLHSTKDL---------------TDLSAMPMKEFDNLFSDCNIVCIKINETSEVKWKTSISNCQLCLICLSENFIQIPKMNEMLEYXXXXXXXXXXXXXSSDKEIR--QKWEYYPYFM-------TVFIKINATHPKASTEKILEIKKAIQDSIVSSTVNETAGETYDCFVSYCWANSQDAVNKGTKAIPGAIISPDADPRKLARYLIDNGIKCWIDDSHMDKTXXXXXXXXXXXXXXKMMLAFVSDEYDKSDNCKMELNFMVEELRRPVSYVLVGSNMEWRFNSEVGLIMQKRHRSEILDFTNNNNISESRLLEELKVRLRNCPDIAYEKN---DQNKIQGH-------------NTALMEQLELISRQILNQLISFI--TDNC--PRLIVIDVDPDDGTDSQIDNDIIMDSTLQSSLRASVSGNKLVLKVICEGETNWHIADEAYPLSIED-KDEIIEK-----------------CAVYLYMIYQVFEYKNPGLRCLQ-PDNISNMEFITKITQIAGSSTMTFKESYSNMVKYYMK-YDPKIANCSLERYRLPSGREFWMCKKHADQNPRCKLIERDRAAID 8069
            IL G  ++ LP E F  F +L    L N  +L  +P  I   K L+++ +    I TLP D++E P+L  L++   P+K   D + E   L  L L  L L  +   +     LV + L+ + +  LP EF +L+ ++ L L G P +  E  ++   +   N  F+  P + GF     NDK  IS F    DI                  F +VPRIGS      D+N    GG P  I  L  L  L + +Q+I  VP  + +L+NL +L L+YNPLLE +   +  + S+K + LV CPS+  PP E+++RG  +  +YLK L      C RTKLMFVGLG AGKTSLL AL S   S K     + + +TDGI I  WTV   N  E+ YS WDFAGQ +YYNTHQFFLS++A+Y+++WS RQG EH  LDFWLSS++ H+   P+FVVGT CDQV +AD+     LK RY QI  F  V S++G GI +L++ L+ VTL    M + +P   L LE +  + RS K+ + ++  +  ++  GI+ EKD+K  IQ LH+ G++QYFD + L+  +VINPQWIV++MA VVSV + +++   G F H+ +  +W  +  +L  W+L LTEEFDLTFP P  E   NIVPCLL +EEP ++ WP    +   K   + Y F +LP GLFNR QVRLF F++ +  WK G   +KN H  L  + +   L+V+  G RP N++ +V +VI+ L++ SF+GV Y+  + CPDC      ++ + T+     SM    L+K+A   +  +LQC +  H  S+  ++E  P   +A +F   L   +  ++   +   K V  L+S +D+                DL     K+  + +   N+  I + +         + NC+L +  +S+NF +  K N+ML Y     KK  ++++     IR    WE     M        V IK    +     + ++++K+ +    + S ++       +CF+SYCW+NS DA +KGT   PGA+     DPR++ ++L  +GI CWID        GL   ++  +R S+M++AFVSDEY KSDNC MEL F V  L  P+   +VG+  +W+  SEVG++M +   S++  F   N ++   LLE +K        I  E N   DQ  I                 T+  E+ EL  R+ +  +IS++  TD+   PRL+V+D +            ++  S  Q  L+  V    L L  + +     H     +     + +D I  K                 C+ YL  +Y V +  +  L C   P      E+I +      +    F E+YS +     K  + +     L R  LP+G+  W+C+KH +  PR   +  + A+ D
Sbjct: 2127 ILDG--LETLPGEFFETFPSLQVFRLENCNKLTEIPPNISLCKRLEKVQLKDSPITTLPEDLFEIPDLMVLELVNLPVKVLPDRTPETSWLTKLVLSGLQLTAVPPSVGNLTELVELNLENNLLTDLPMEFQKLQRLRILNLCGIPWITMEGTRSGLPLDKYNEWFDSKPYLRGFLG---NDK--ISKFFHDCDISRNLMLFEEELAALNVHLFWDVPRIGS-----TDINDTEFGGIPPVIFTLSSLEELYLDYQAITTVPVHLCRLQNLAVLSLAYNPLLESLPGSLGHLPSLKSIRLVSCPSLRTPPNEVVSRGFESIKAYLKRLAGGFTECRRTKLMFVGLGGAGKTSLLRALMS---SGKRTEGTKGEDITDGIIIQPWTVKTDNGVEVTYSTWDFAGQTLYYNTHQFFLSKRAVYLLLWSTRQGFEHAGLDFWLSSVASHAPKTPIFVVGTHCDQVPKADIP-MEELKARYPQIVGFHFVSSVAGMGIAELEKDLLRVTLEQKNMGEKVPQVWLSLEQKILAERSTKSILQWEIIKGFSMEVGIYDEKDIKEAIQFLHELGTVQYFDNDFLREIIVINPQWIVNVMACVVSVKDSQLQKDKGRFSHKYIAQIWKDYPPELHKWLLQLTEEFDLTFPLPKEE--VNIVPCLLPQEEPKKLIWPSIEGREGVKETKMLYDFAYLPTGLFNRAQVRLFQFSDGELTWKRGSLLKKNNHLALIKQISNCQLLVQVQGPRPENIIFLVHEVIESLIEESFYGVVYDFLLPCPDC------MTKEGTR---EPSMFKGSLVKRAKDHRAPFLQCRKFFHTVSMAQLQEVMP-ADTATDFDAHLQQSIMALQKFNSEMSKDVVILYSAQDIPAKNENDKIHPAWIHADLEKDGEKDGYSCWFPENVQNISVEDL-----MMQLKNCKLVVALVSDNFERDQKSNDMLMYTMDTLKKAYIIVV-----IRPDMAWENADLGMRIGRQEVMVMIKTKDRYKSKVEDLLVQVKEKLHG--IHSAIHHP-----ECFISYCWSNSHDAQSKGTFCPPGALGW--GDPREIKKWLASHGITCWIDTEQATNGQGLFKNITEGMRQSRMLVAFVSDEYVKSDNCMMELRFGVLTLNLPLVVCIVGTGRDWK-ESEVGILMHRSKASKVY-FQQENPLAHGTLLEYVK-------KILAENNSHRDQLLITKQKMEKKQEQKKTPDKTSFNEECELTQRRFMRHIISYVSATDSTPMPRLLVVDFERTACLCGSSSGSVVHLSIFQ-LLKVEVETQLLDLPHLVQ-----HCGQRLHQEHARNLRDGICAKHLLASRWMKTLNLSSDSCSAYLARLYAVLQQSSVQLNCFAGPSGKKYHEWIEE----GAAENPNFVEAYSTIRSDLRKNLEAESFLQQLCRCHLPTGKTQWLCEKHQN-GPRITKLSTESASRD 3506          
BLAST of Roc domain-containing protein vs. TrEMBL
Match: A0A1I8GAN0 (Roc domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 635.95 bits (1639), Expect = 0.000e+0
Identity = 469/1456 (32.21%), Postives = 723/1456 (49.66%), Query Frame = 3
Query: 3885 CKLHSSLYDEQINLDDIIGAPETNQKDNEIIMENHSIFDYAKCSQSIILSGKTVKELPAELFVKFINLCSLELRNMFQLKCLPRTIYSLKGLQRLIINQVKINTLPDIYEFPNLKYLQIEKCPIKTYNDSNECXXXXXXXXXXXXXQT-ISNFICXXXXXXXXXXXXHGIESLPDEFGRLENMKELKLIG---------------------SPLYYELLKNDFIIKSDNLEFEYPEIGFYKV---KENDKNPISFLPVADIFINVPRIGSGYSEPVDVNSHGGFPMAILQLKKLITLVIQHQSIRYVPDSIQQLENLEILDLSYNPLLEXXXXXXXXXXXXXXXXXXHCPSISVPPPEIIARGTS--LSYLKYLLAKTVVCNRTKLMFVGLGEAGKTSLLHALRSDENSAKEIIEQQEKQVTDGIDITKWTVICHNEE--IQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIEHGDLDFWLSSISCHSKYAPVFVVGTRCDQVQ-ADMSCFSSLKKRYSQIEDFILVDSLSGTGIKDLKQKLIHVTLNLPYMHQAIPSTILDLENQFTSIRSQKNY--ITYQEFQNIAISQGIFE-KDVKSVIQILHDFGSIQYFDTEILKNYVVINPQWIVDIMANVVSVVNQKIKNGIFYHENMKDVWDKFESKLFNWMLNLTEEFDLTFPHPTMEPKANIVPCLLSEEEPEIEWPKFSE---QTLCKFYHINYKFEFLPAGLFNRIQVRLFDFTEAKKLWKYGMYFEKNGHHVLFMRENKSSLIVRAIGVRPVNVLAMVDDVIKGLVKASFHGVRYNLEISCPDCIEYGNNISNDATKYWSNISMIPSKLIKKALIKKVEYLQCE-ELH-LNSIKSIKENTPETASAEEFINDLISKVQTVKSLYA--SSDKLVTFLHS--TKDLTDLSAMPMKEFDNLFSDCNIVCIKINETSEVKWKTSISNCQLCLICLSENFIQIPK-MNEMLEYXXXXXXXXXXXXXSSDKEIRQKWEYYPYFMTVFIKINATHPKAST--EKILEIKKAIQDSIVSSTVNETAGETY--DCFVSYCWANSQDAVNKGTKAIPGAIISPDADPRKLARYLIDNGIKCWIDDSHMDKTXXXXXXXXXXXXXXKMMLAFVSDEYDKSDNCKMELNFMVEELRRPVSYVLVGSNMEWRFNSEVGLI------MQKRHRSEILDFTNNNNISESRLLEELKVRLRNCPDIAYEKNDQNKIQGHNTALMEQLELISRQILNQLISFITDNCPRLIVIDV-DPDDGTDSQIDNDIIMDSTLQSSLRASVSGNKL----VLKVICEGETNWHIADEAYPLSIEDK---DEIIEKCAVYLYMIYQVFEYKNPGLRCLQPDNISNMEFITKITQIAGSSTMTFKESYSNMVKYYM-KYDPKIANCSLERYRLPSGREFWMCKKHADQ-NPRCKLIERDRAA 8063
            C+ H         +D+++G   +            ++  +  C +S ++S + +    A        L +L L  M +++ L ++ + ++ L+ L I Q  + ++      PNL+ L I     K     N C        L   L T +   I   + L ++ L    I +LP EF  L +++EL + G                     SPL    L+N  +  +  LE   PE  F+ +   +E  K       +  +  +VPR+G    E VD +  GG P  + +L  L  L + HQ+I  VPD I+ L+ L+ L L +NP L+ +S  +S +  +  + +  CPS+  PP E+  RG+S  LSYLK+L +  V C RTKLMFVGLG  GKTSLL ALRS   +   I     +++TDGIDI  W +   +    + +S WDFAGQ VYYNTHQFFL+ +A+Y+++++VR G EH  L+FWLSSI+ H+  AP+ VVGT  DQV+  D     + K RY QI  F ++ S SG GI DL+++L+ V L  PYM + +P   LD E++    R++ +   + +QE  ++A SQG++E K V+  +  L+D GS+QYFDT+ L++ VVINP+WIVD+MA VVSV N  I+NG     ++  +W KF+  L  W+L LTE FDLT+    M+   NIVPCLL E+ PE  +P+ ++    TL +F    Y+F++LPAGLFNR QVRLF+FT++  +WK G    K+ H  +   + +  LI    G RP NVL M++DV   L+K +FHGV Y   + CP+C+   N+ S D+ +     S+I   +I+KA  ++V +LQC  E H LN  + +    PE  S  EF + L   +  ++      S D  + FL     KD  D      +          + C       +   +  +S+C   L+ L+++F      +N +      L+KK + L + +DK  R   E   + +     I+ T  K S    ++ E+ K +  ++ +S    +  ++   D FVSYCWANS DAV KGT+   GA+   D+DPR+L   L   GI+CW+D      T  L   +S  L    ++LAFVSDEY +S NC ME  F  + LR+P+  V+VG    ++   E+G++         R     L+F       +S L +E + R  N P +  +      +        E+ EL  R+ L Q   F   + PRL+V D  D  D +D     D                G KL    +++V CE +  WH    A  L+   K   + ++   +VYL  I  + +     L CL+   I   EF+  +   A  S  +F ++Y  + + Y      +  +  L +  L SG+  W+C +H    N R  ++  D A+
Sbjct:  742 CRAHQLAAGSPTLIDELVG---SAAAGEGEAAVAATLATFGSCVRSALISSRLISS--ASCLTGLTGLETLHLHRMEKMQSLDKS-WPMQRLRSLTITQSDLLSID--CNAPNLQSLTISIA--KVSQLPNTCSTKLESLTLDRCLITALPASIGQLDRLTMLHLLQLPIRTLPKEFSNLRSLQELVIDGIAWPDRVADQMDEHDSGAGTASPLDATYLRNPGVTLA-GLEPVPPEQQFFSLLITEEQAKRIADCRGLHYMLTDVPRMGL---ESVDDDDTGGIPPCLFELTNLRELRLSHQAIHQVPDKIKSLKKLQRLVLDHNPRLKSLSPCLSELPQLSHVDVSRCPSLQTPPVEVAKRGSSAMLSYLKFLASDQVECKRTKLMFVGLGGVGKTSLLRALRSPTGTTSVI---GAEEITDGIDIGDWQIDIGDGSPPLHFSTWDFAGQRVYYNTHQFFLTHRAVYLLLYTVRTGYEHAGLNFWLSSIASHAPNAPILVVGTHADQVEKPDKIPMETFKSRYPQICGFHIISSHSGMGIGDLRKQLVQVALQQPYMSERLPRIFLDFEDRLIEKRTRDHVKILDWQEVADLAQSQGLYEDKHVRQAVSFLNDIGSVQYFDTDYLRHKVVINPKWIVDVMACVVSVKNSPIQNGQLKRSDIPAIWSKFDPALHEWLLKLTEAFDLTY---AMKEDCNIVPCLLPEDVPEYSFPQEADGEGNTLARFI---YQFDYLPAGLFNRAQVRLFEFTDSNTIWKRGSLLRKDAHIAVITMDERQRLIATVFGPRPENVLFMINDVFDSLIKETFHGVHYEEILPCPECL---NSSSGDSER-----SVIRVAMIRKASSRQVSFLQCPFEFHILNLSQLLASIRPE--SLTEFDHQLEQSLLRLRRARLEMSRDVCLLFLADDFPKDGKDRGPTCPEAVAKKLEAEGLSCYPPYPEQQEDKQLHMSDCSAVLVFLTKSFGSDKACLNSLFSAKNNLRKKLVYLSVGADKSWRDCTELA-FLVGTDKYIDLTEAKKSVYEGQLAEVIKDVSAAVETSNQKPSDDDSRDKDVFVSYCWANSHDAVAKGTRN--GALGCEDSDPRRLRERLEAEGIRCWLDVKDTG-TRSLFEDISSGLGRCPLVLAFVSDEYQRSANCMMEFRFAAKNLRKPIVTVVVGQTQAFK-TQELGMLSLGYEEFDFRKDVPALEFKRLVAGIKSLLAKEAEKRSANVPLMKRKTTVAMPLPSQPGLFREEAELAQRRFLKQ---FSHSDLPRLLVPDFSDVTDFSDESRSKD--------------SDGGKLEELVLIRVFCENQRGWHAHGPAVSLATTSKTGRENLLSAASVYLLRICSLLQASGIRLNCLE--GIQAEEFLQAVRVEAAVSPKSFIDAYRTVQQLYTDATKGEQRHSGLSKCALGSGKLLWLCLEHQRAGNGRVTVLPDDEAS 2140          
BLAST of Roc domain-containing protein vs. TrEMBL
Match: A0A267ECV5 (Roc domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig008399g1 PE=4 SV=1)

HSP 1 Score: 635.18 bits (1637), Expect = 0.000e+0
Identity = 469/1456 (32.21%), Postives = 723/1456 (49.66%), Query Frame = 3
Query: 3885 CKLHSSLYDEQINLDDIIGAPETNQKDNEIIMENHSIFDYAKCSQSIILSGKTVKELPAELFVKFINLCSLELRNMFQLKCLPRTIYSLKGLQRLIINQVKINTLPDIYEFPNLKYLQIEKCPIKTYNDSNECXXXXXXXXXXXXXQT-ISNFICXXXXXXXXXXXXHGIESLPDEFGRLENMKELKLIG---------------------SPLYYELLKNDFIIKSDNLEFEYPEIGFYKV---KENDKNPISFLPVADIFINVPRIGSGYSEPVDVNSHGGFPMAILQLKKLITLVIQHQSIRYVPDSIQQLENLEILDLSYNPLLEXXXXXXXXXXXXXXXXXXHCPSISVPPPEIIARGTS--LSYLKYLLAKTVVCNRTKLMFVGLGEAGKTSLLHALRSDENSAKEIIEQQEKQVTDGIDITKWTVICHNEE--IQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIEHGDLDFWLSSISCHSKYAPVFVVGTRCDQVQ-ADMSCFSSLKKRYSQIEDFILVDSLSGTGIKDLKQKLIHVTLNLPYMHQAIPSTILDLENQFTSIRSQKNY--ITYQEFQNIAISQGIFE-KDVKSVIQILHDFGSIQYFDTEILKNYVVINPQWIVDIMANVVSVVNQKIKNGIFYHENMKDVWDKFESKLFNWMLNLTEEFDLTFPHPTMEPKANIVPCLLSEEEPEIEWPKFSE---QTLCKFYHINYKFEFLPAGLFNRIQVRLFDFTEAKKLWKYGMYFEKNGHHVLFMRENKSSLIVRAIGVRPVNVLAMVDDVIKGLVKASFHGVRYNLEISCPDCIEYGNNISNDATKYWSNISMIPSKLIKKALIKKVEYLQCE-ELH-LNSIKSIKENTPETASAEEFINDLISKVQTVKSLYA--SSDKLVTFLHS--TKDLTDLSAMPMKEFDNLFSDCNIVCIKINETSEVKWKTSISNCQLCLICLSENFIQIPK-MNEMLEYXXXXXXXXXXXXXSSDKEIRQKWEYYPYFMTVFIKINATHPKAST--EKILEIKKAIQDSIVSSTVNETAGETY--DCFVSYCWANSQDAVNKGTKAIPGAIISPDADPRKLARYLIDNGIKCWIDDSHMDKTXXXXXXXXXXXXXXKMMLAFVSDEYDKSDNCKMELNFMVEELRRPVSYVLVGSNMEWRFNSEVGLI------MQKRHRSEILDFTNNNNISESRLLEELKVRLRNCPDIAYEKNDQNKIQGHNTALMEQLELISRQILNQLISFITDNCPRLIVIDV-DPDDGTDSQIDNDIIMDSTLQSSLRASVSGNKL----VLKVICEGETNWHIADEAYPLSIEDK---DEIIEKCAVYLYMIYQVFEYKNPGLRCLQPDNISNMEFITKITQIAGSSTMTFKESYSNMVKYYM-KYDPKIANCSLERYRLPSGREFWMCKKHADQ-NPRCKLIERDRAA 8063
            C+ H         +D+++G   +            ++  +  C +S ++S + +    A        L +L L  M +++ L ++ + ++ L+ L I Q  + ++      PNL+ L I     K     N C        L   L T +   I   + L ++ L    I +LP EF  L +++EL + G                     SPL    L+N  +  +  LE   PE  F+ +   +E  K       +  +  +VPR+G    E VD +  GG P  + +L  L  L + HQ+I  VPD I+ L+ L+ L L +NP L+ +S  +S +  +  + +  CPS+  PP E+  RG+S  LSYLK+L +  V C RTKLMFVGLG  GKTSLL ALRS   +   I     +++TDGIDI  W +   +    + +S WDFAGQ VYYNTHQFFL+ +A+Y+++++VR G EH  L+FWLSSI+ H+  AP+ VVGT  DQV+  D     + K RY QI  F ++ S SG GI DL+++L+ V L  PYM + +P   LD E++    R++ +   + +QE  ++A SQG++E K V+  +  L+D GS+QYFDT+ L++ VVINP+WIVD+MA VVSV N  I+NG     ++  +W KF+  L  W+L LTE FDLT+    M+   NIVPCLL E+ PE  +P+ ++    TL +F    Y+F++LPAGLFNR QVRLF+FT++  +WK G    K+ H  +   + +  LI    G RP NVL M++DV   L+K +FHGV Y   + CP+C+   N+ S D+ +     S+I   +I+KA  ++V +LQC  E H LN  + +    PE  S  EF + L   +  ++      S D  + FL     KD  D      +          + C       +   +  +S+C   L+ L+++F      +N +      L+KK + L + +DK  R   E   + +     I+ T  K S    ++ E+ K +  ++ +S    +  ++   D FVSYCWANS DAV KGT+   GA+   D+DPR+L   L   GI+CW+D      T  L   +S  L    ++LAFVSDEY +S NC ME  F  + LR+P+  V+VG    ++   E+G++         R     L+F       +S L +E + R  N P +  +      +        E+ EL  R+ L Q   F   + PRL+V D  D  D +D     D                G KL    +++V CE +  WH    A  L+   K   + ++   +VYL  I  + +     L CL+   I   EF+  +   A  S  +F ++Y  + + Y      +  +  L +  L SG+  W+C +H    N R  ++  D A+
Sbjct: 1373 CRAHQLAAGSPTLIDELVG---SAAAGEGEAAVAATLATFGSCVRSALISSRLISS--ASCLTGLTGLETLHLHRMEKMQSLDKS-WPMQRLRSLTITQSDLLSID--CNAPNLQSLTISIA--KVSQLPNTCSTKLESLTLDRCLITALPASIGQLDRLTMLHLLQLPIRTLPKEFSNLRSLQELVIDGIAWPDRVADQMDEHDSGAGTASPLDATYLRNPGVTLA-GLEPVPPEQQFFSLLITEEQAKRIADCRGLHYMLTDVPRMGL---ESVDDDDTGGIPPCLFELTNLRELRLSHQAIHQVPDKIKSLKKLQRLVLDHNPRLKSLSPCLSELPQLSHVDVSRCPSLQTPPVEVAKRGSSAMLSYLKFLASDQVECKRTKLMFVGLGGVGKTSLLRALRSPTGTTSVI---GAEEITDGIDIGDWQIDIGDGSPPLHFSTWDFAGQRVYYNTHQFFLTHRAVYLLLYTVRTGYEHAGLNFWLSSIASHAPNAPILVVGTHADQVEKPDKIPMETFKSRYPQICGFHIISSHSGMGIGDLRKQLVQVALQQPYMSERLPRIFLDFEDRLIEKRTRDHVKILDWQEVADLAQSQGLYEDKHVRQAVSFLNDIGSVQYFDTDYLRHKVVINPKWIVDVMACVVSVKNSPIQNGQLKRSDIPAIWSKFDPALHEWLLKLTEAFDLTY---AMKEDCNIVPCLLPEDVPEYSFPQEADGEGNTLARFI---YQFDYLPAGLFNRAQVRLFEFTDSNTIWKRGSLLRKDAHIAVITMDERQRLIATVFGPRPENVLFMINDVFDSLIKETFHGVHYEEILPCPECL---NSSSGDSER-----SVIRVAMIRKASSRQVSFLQCPFEFHILNLSQLLASIRPE--SLTEFDHQLEQSLLRLRRARLEMSRDVCLLFLADDFPKDGKDRGPTCPEAVAKKLEAEGLSCYPPYPEQQEDKQLHMSDCSAVLVFLTKSFGSDKACLNSLFSAKNNLRKKLVYLSVGADKSWRDCTELA-FLVGTDKYIDLTEAKKSVYEGQLAEVIKDVSAAVETSNQKPSDDDSRDKDVFVSYCWANSHDAVAKGTRN--GALGCEDSDPRRLRERLEAEGIRCWLDVKDTG-TRSLFEDISSGLGRCPLVLAFVSDEYQRSANCMMEFRFAAKNLRKPIVTVVVGQTQAFK-TQELGMLSLGYEEFDFRKDVPALEFKRLVAGIKSLLAKEAEKRSANVPLMKRKTTVAMPLPSQPGLFREEAELAQRRFLKQ---FSHSDLPRLLVPDFSDVTDFSDESRSKD--------------SDGGKLEELVLIRVFCENQRGWHAHGPAVSLATTSKTGRENLLSAASVYLLRICSLLQASGIRLNCLE--GIQAEEFLQAVRVEAAVSPKSFIDAYRTVQQLYTDATKGEQRHSGLSKCALGSGKLLWLCLEHQRAGNGRVTVLPDDEAS 2771          

HSP 2 Score: 85.8853 bits (211), Expect = 1.806e-12
Identity = 83/332 (25.00%), Postives = 145/332 (43.67%), Query Frame = 3
Query: 1182 SVMHLGTDSFEAILSQQNILSNKISSIPKESLKNYSVCYNHKW----VNDVEFNNICSLCGNCSSVDGIECPYNRIISQRKGVCLC-LKQSRICGSCGICQSCAANHWKNHCESDPNRLIICNANYVN-------------VPTRPISQFMGSKFTVDIYQENSN--TFAGLLIND-TDIMVDIFGITNSCKNGAAIFADNLNNIPSPLPISV-LSF-----EISESYFYKSDLYQFSKCSGINVLQELGILTY--------------NNETEVSLVVGKFPVSPDRRRFSMEILNPGASGRITIGLVPANYSVI-QPGWRENSLAYHGDDG 2051
            S +HL TD  + ++ +  +++    S      +N SV   H W    ++     ++CSLCG+CS V G +C +NRI S   G CLC       C SCG+C  CAA  W    +  P+R++     Y++              P+ P+   +  + +  I    S     + LL    T   ++++   +  +   A+F+ +   +  P+ ++  LS      ++ +        + F+  S  +V QE G+  Y              N    V+ ++G+  ++     F + I N G  G I+IG+VPA++ V+ QPG    S+ Y G DG
Sbjct:  415 SALHLFTDCADCLMMRHGVIAETAPS--NGEPENCSVHSEHCWEPQQLDGEPQQSVCSLCGSCS-VGGSDCAFNRIDSGTPGRCLCGALGGASCDSCGVCGRCAARLWAVGSDVRPSRVL---PGYIDDGDIADSSRCVRLCPSAPLQSVLAPEVSFSISPSGSQQPQLSVLLWEKHTPRYLEVYPKLSESQTD-AVFSTSQVLLEEPITVTFRLSAVNPVDDVMDGALGVDRRFSFALRSFCSVWQETGVAFYWFNTLQESAGLAASNIFVPVATLIGERRLTRSSSSFEICIENKGVKGNISIGVVPADFPVMAQPGTLPGSVGYSGVDG 739          
BLAST of Roc domain-containing protein vs. Ensembl Cavefish
Match: lrrk2 (leucine-rich repeat kinase 2 [Source:ZFIN;Acc:ZDB-GENE-071218-6])

HSP 1 Score: 81.2629 bits (199), Expect = 2.090e-14
Identity = 91/415 (21.93%), Postives = 180/415 (43.37%), Query Frame = 3
Query: 4911 YLKYLLAKTVVCNRTKLMFVGLGEAGKTSLLHALRSDENSAKEIIEQQEKQVTDGIDITK-----WTVICHNEE-IQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIEHGD-LDFWLSSISCHSKYAPVFVVGTRCDQVQADM--SCFSSLKK------RYSQIEDF-ILVDSLSGTGIKDLKQKLIHVT-----LNLPYMHQAIPSTILDLEN-----------QFTSIRSQKNYITYQEFQNIAISQGIFEKDVKSVIQILHDFGSIQYFDTEI--LKNYVVINPQWIVDIMANVVSVVNQKI---KNGIFYHENMKDVWDK---FESKLFNWMLNLTEEFDLTFPHPTMEPKANIVPCLLSEEEPEIEWPKFSEQTLCKFYHINYKFEFLPAGLFNRIQVRLFDFT 6035
            Y +  L K V   R KL+ VG   +GKT+L+          +++++ +  Q   GI  TK     WTV   +++ +  + WD  G + Y  +H  F+S +A+Y+V++++ +G+   D +  WL +I   +  +PV +VGT  D  +  +   C   L++       +  I++  IL        I  L++ +            P M Q +P   ++LE            +F  +R Q+     QE Q + + +G    ++   I+ L + G + +FD     L++   I+PQW+ ++++  + + +  +     G+     +     +   F  +       L E+F +  P      +  ++P  L   +P I+ P  SE +  +     Y+  + P G ++R   RL + +
Sbjct: 1299 YFQQRLKKAVPYFRMKLIVVGTAGSGKTTLI----------QQLMKHKRSQWKSGIGGTKISVRDWTVRDRDKKNMILNVWDIPGGEEYSESHPHFMSSRAMYLVLYNLSKGVSELDTVKPWLFNIKALAPLSPVILVGTHVDMCEDHVLQECMQKLREDVLIQLGFPAIKECPILCACEESDSISKLRKSIASGASCFKIQGQPVMGQLVPDCYVELERRVLQERTRVPPEFPVLRHQRLLQLIQESQ-LQLEEG----ELPHAIRFLSETGVLLHFDDPALQLRDLYFIDPQWLCNVISQTLILSSSGLCENTTGVVLRSVLTLCLSESRCFPREHLMQYFKLLEKFQIALP---FGDEQLLIPSSLLHHKPVIKLP-HSENS--EMIMRIYEMPYFPMGYWSRQINRLLEVS 1692          
BLAST of Roc domain-containing protein vs. Ensembl Cavefish
Match: spryd3 (SPRY domain containing 3 [Source:NCBI gene;Acc:103022309])

HSP 1 Score: 76.2554 bits (186), Expect = 9.494e-14
Identity = 55/169 (32.54%), Postives = 84/169 (49.70%), Query Frame = 3
Query: 1830 NVLQELGILTY-NNETEVSLVVGKFPVSPDRRRFSMEILNPGASGRITIGLVPANYSV-IQPGWRENSLAYHGDDGGIFLGESVPQIIRETFSEVN--NCIEVIIEYESSLDSPELVRHITWRKNGKFVEKILIQHDKE-LYPAIGMHSINEQVRLLDFEVWADTECSS 2321
             +L++   L+Y  N  EV   V   P+S     F + I++ G  G I +GLVP  Y +  QPGW  +S+AYH DDG ++ G  V Q      +  +   C      +++ L +      + + KNGK V  +++    + L+PAIGMHS+ E+VRL     W   E  S
Sbjct:   34 RMLKDGDTLSYQGNSDEVGCYVASRPLSKGNCYFEVTIMDTGVRGTIAVGLVPQYYKLDHQPGWLPHSIAYHADDGKLYNGNPVGQQFGPKCNRGDRIGCGIYADTFDAGLTT------VFFTKNGKEVGSVVVPVAPDGLFPAIGMHSLGEEVRLDLQAEWGTEEEDS 196          
BLAST of Roc domain-containing protein vs. Ensembl Cavefish
Match: spryd3 (SPRY domain containing 3 [Source:NCBI gene;Acc:103022309])

HSP 1 Score: 76.6406 bits (187), Expect = 1.100e-13
Identity = 56/167 (33.53%), Postives = 84/167 (50.30%), Query Frame = 3
Query: 1830 NVLQELGILTY-NNETEVSLVVGKFPVSPDRRRFSMEILNPGASGRITIGLVPANYSVI-QPGWRENSLAYHGDDGGIFLGESVPQIIRETFSEVNNCIEVIIEYESSLDSPELVRHITWRKNGKFVEKILIQHDKE-LYPAIGMHSINEQVRLLDFEVWADTECSS 2321
             +L++   L+Y  N  EV   V   P+S     F + I++ G  G I +GLVP  Y +  QPGW  +S+AYH DDG ++ G  V Q      +  +     I  Y  + D+   +  + + KNGK V  +++    + L+PAIGMHS+ E+VRL     W   E  S
Sbjct:   34 RMLKDGDTLSYQGNSDEVGCYVASRPLSKGNCYFEVTIMDTGVRGTIAVGLVPQYYKLDHQPGWLPHSIAYHADDGKLYNGNPVGQQFGPKCNRGDRIGCGI--YADTFDAG--LTTVFFTKNGKEVGSVVVPVAPDGLFPAIGMHSLGEEVRLDLQAEWGTEEEDS 196          
BLAST of Roc domain-containing protein vs. Ensembl Cavefish
Match: spryd3 (SPRY domain containing 3 [Source:NCBI gene;Acc:103022309])

HSP 1 Score: 76.6406 bits (187), Expect = 1.225e-13
Identity = 56/167 (33.53%), Postives = 84/167 (50.30%), Query Frame = 3
Query: 1830 NVLQELGILTY-NNETEVSLVVGKFPVSPDRRRFSMEILNPGASGRITIGLVPANYSVI-QPGWRENSLAYHGDDGGIFLGESVPQIIRETFSEVNNCIEVIIEYESSLDSPELVRHITWRKNGKFVEKILIQHDKE-LYPAIGMHSINEQVRLLDFEVWADTECSS 2321
             +L++   L+Y  N  EV   V   P+S     F + I++ G  G I +GLVP  Y +  QPGW  +S+AYH DDG ++ G  V Q      +  +     I  Y  + D+   +  + + KNGK V  +++    + L+PAIGMHS+ E+VRL     W   E  S
Sbjct:   34 RMLKDGDTLSYQGNSDEVGCYVASRPLSKGNCYFEVTIMDTGVRGTIAVGLVPQYYKLDHQPGWLPHSIAYHADDGKLYNGNPVGQQFGPKCNRGDRIGCGI--YADTFDAG--LTTVFFTKNGKEVGSVVVPVAPDGLFPAIGMHSLGEEVRLDLQAEWGTEEEDS 196          
BLAST of Roc domain-containing protein vs. Ensembl Cavefish
Match: mfhas1 (malignant fibrous histiocytoma amplified sequence 1 [Source:ZFIN;Acc:ZDB-GENE-080917-20])

HSP 1 Score: 75.8702 bits (185), Expect = 5.804e-13
Identity = 117/523 (22.37%), Postives = 217/523 (41.49%), Query Frame = 3
Query: 4389 IESLPDEFGRLENMKELKLIGSPL------YYELLKNDFIIKSDNLEFEYPEIGFYKVKEND----KNPISFLPV-ADIFINVPRIGSGYSEPVDVNSHGGFPMAILQLKKLITLVIQHQSIRYVPDSIQQLENLEILDLSYNPLLEXXXXXXXXXXXXXXXXXXHCPSISVPPPEIIARGTS--LSYLKYLL-AKTVVCNRTKLMFVGLGEAGKTSLLHALRSDENSAKEIIEQQEKQVTDGIDITKWTVICHNEEIQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQ---GIEHGDLDFWLSSISCHSKYAPVFVVGTRCD--------------------QVQADMSCFSS-------------------------------LKKRYSQIEDFILVDSL-------------SGTGIKDLKQKLIHVTLN---LPYMHQAIPSTILDLENQFTSIRSQKNYITYQEFQNIAISQGIFEKDVKSVIQILHDFGSIQYFDTEI-LKNYVVIN-PQWIV 5699
            I SLP+ F  L+N++ L L  + L      + +L +   +  S N   ++P++     +  +    +N +SFLP    +  N+  +       +D N     P +I++L+KL  LV+Q   I  +PD+  +L  + I  +  NPL++                         PP E+  +G     +Y K L  ++  V  R KL+ +G   AGKT L   + S    AK I   +      GID+T W    H   + +  +D +G+  Y     FFLS  A+YI+V +++       +  + ++L  +S    +A V +VGT  D                    Q + D+ C  +                               L+++ +Q++ ++L + L             +   ++ LK+KL+ V  +    P +H+ +P +   LE      + +  ++++ +   + +  G+ E  ++S +  LH+ G + YF+  I LK YV  N P++I 
Sbjct:  223 IVSLPETFSDLQNLESLMLDNNLLTALPQSFGKLQRLKMLNLSSNSFEDFPQVVLKIARLEELYLSRNQLSFLPEEVGLLSNLANLW------LDNNRITFLPDSIVELEKLEELVLQGNQIAILPDNFGKLAKVNIWKVKDNPLIQ-------------------------PPYEVCMKGIPYIAAYQKELAHSQPAVKPRLKLVLMGQKNAGKTRLRQCIVSKALDAKTIPGDR------GIDVTNWVADLH-RSLTFIVYDLSGKQNYDLIKPFFLSPGALYILVVNLKAYTCRTFYSSVGYFLHLLSAKVPHAVVCIVGTHTDLCEEMELEEKCLDIHRQISLQEKRDIDCLHTLAVQVDQALEQGYDVRASSPHVLFYGVSDKNLRRKKAQLQ-YMLNNRLQILSPVFCVSCTEAQKNVQRLKEKLMSVADHRQIFPNLHRVLPKSWQMLEE--LHFKPKDLWLSWWDSARLGLQAGLTEDRLQSALSYLHESGKLLYFEDSITLKEYVFHNLPRFIA 704          
BLAST of Roc domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004441.1 (pep scaffold:Pmarinus_7.0:GL477554:92318:114375:1 gene:ENSPMAG00000004044.1 transcript:ENSPMAT00000004441.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.3958 bits (163), Expect = 5.983e-11
Identity = 45/149 (30.20%), Postives = 71/149 (47.65%), Query Frame = 3
Query: 4905 LSYLKYLLAKTVVCNRTKLMFVGLGEAGKTSLLHALRSDENSAKEIIEQQEKQVTDGIDITKWTVI-------CHNEEIQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIEHG--DLDFWLSSISCHSKYAPVFVVGTRCDQV 5324
            L+YL+    ++  C   KLM VG    GKTSLL +LR         +      V   I ++ W +           E+I++S WD  G       H+   +++A+Y++VW++  G E G   L  WL +I   + +A V VVGT  D++
Sbjct:  152 LAYLRAQQRRSQHCYSLKLMVVGPSHQGKTSLLSSLRHRRKPPPPPVSGGCPDVP--IVLSTWDLQRPLGLADLKVEKIRFSVWDVGGTASALPVHRCLCTDRALYLLVWNLALG-EEGVVSLHHWLLTIQARAPHAAVIVVGTHLDRL 297          
BLAST of Roc domain-containing protein vs. Ensembl Nematostella
Match: EDO31971 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWE1])

HSP 1 Score: 143.665 bits (361), Expect = 8.191e-35
Identity = 134/506 (26.48%), Postives = 241/506 (47.63%), Query Frame = 3
Query: 4659 FPMAILQLKKLITLVIQHQSIRYVPDSIQQLENLEILDLSYNPLLEXXXXXXXXXXXXXXXXXXHCPSISVPP---PEIIARGTSLSYLKYLLAKTVVCNRTKLMFVGLGEAGKTSLLHALR-----SDENSAKEIIEQQEKQVTDGIDITKWTVICHNEEIQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIEHG--DLDFWLSSISCHSKYAPVFVVGTRCDQVQADMSCFSSLK-------KRYS-----QIEDFILVDSLSGTGIKDLKQKLIHVTLNLPYMHQ-----AIPSTILDLEN----QFTSIRSQKNYITYQEFQNIAISQGIFEKDVKS------VIQILHDFGSIQYFDTEI--LKNYVVINPQWIVDIMANVVSVV--NQKIKNGIFYHENMKDVWD--KFESKLFNWMLNLTEEFDLTFPHPTMEPKANIVPCLLSEEEPEI---EWPKFSEQTLCKFYH----INYKFEFLPAGLFNRIQVRLF 6026
            FP+ +     L TL++    +  VP S+ +L NL  LDLS NP L  +  Q+ ++    QL L       +P    P ++++ T L++L+  L K+V   R KLM VG+   GKT+LL AL+     S+ ++   ++++   Q++  +             I  S WD AGQ VYY  HQ FL+   +Y+ VW+   G E G  +L  WL +I   + Y+ V ++GT  D++    S  S +K       KRY      +I  + +V +++G GI +LK+ +    +N     Q      +P + + L++    +    R  +      E + +A++ G  + D+          + LHD G + +++ ++  L     I+P W+ D++A++V+V   N  +++GI    N++ V    +F        L L E F++     T++    ++P +L  E P +   E  +  ++T     H     NY+  ++P+GL++R+  RL 
Sbjct:  146 FPVDLFA-PTLETLLLNDNGLLVVPPSVCRLTNLNELDLSNNPDLRTLPPQLGNLRDCWQLRLNKLTLTELPKHVRPGVLSKDT-LAFLRATLRKSVPYYRMKLMVVGIQGYGKTTLLAALKGQPLPSNLSTVGIVVDEWSVQISTSLLSRIGITSGIGPTITLSTWDLAGQSVYYAAHQMFLTPSTLYLAVWNATLG-EEGVENLRSWLLNIKARAPYSDVIIIGTHLDRI-PRASRESRVKELNHMIMKRYDTKGFPKIVGYTVVSAVTGEGITELKELIYKKAINSKEQGQLVIGKQVPLSYIQLQDAIRHEADRRREARKPPILLEEEMLALAAGNKDNDIHDHEELALATRFLHDNGVLLHYNDQLRGLNTLYFIDPAWVCDLIASIVTVREKNGYVRDGIMLTSNVRMVLRDPRFPPNFIPQYLQLMERFEIAL---TLDDFQILIPSMLPHEAPGMKMNELYRLFQRTSPDNSHDSIQRNYQMAYVPSGLWSRLITRLL 644          
BLAST of Roc domain-containing protein vs. Ensembl Nematostella
Match: EDO30091 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1T0])

HSP 1 Score: 85.1149 bits (209), Expect = 3.692e-16
Identity = 103/435 (23.68%), Postives = 177/435 (40.69%), Query Frame = 3
Query: 5046 EQQEKQVTDGIDITKWTVICHNEEIQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWS------------VRQGIEHGDLD------------FWLSSISCHSK--------------------------YAPVFVVGTRCDQ----------VQADMSCFSSLKKRYSQ--IEDFILVDSLSGT---GIKDLKQKLIHVTLNLPYMHQAIPSTILDLENQFT-SIRSQKNYITYQEFQNIAISQGIFEKDVK--SVIQILHDFGSIQYFDTEILKNYVVINPQWIVDIMANVVSVVN------QKIKN-------GIFYHENMKDVWDKF---ESKLFNWMLNLTEEFDLT--FPHPTMEPKAN---IVPCLLSEEEPEIE-WPKFSEQTLCKFYHINYKFEFLPAGLFNRIQVRL---FDFTEAKKLWKYGMYF 6071
            E+ EK++ D +     ++    +EI   AWDFAGQ +YY TH  F S +A+Y++  +            VRQG+    LD             WL ++ C                               PV +VGT  D+          + A+  C     KRY +  I  F  VD+   +   GI+DL+ K+  V  + PYM + +P+   + E      I     ++   E + IA  +     DV+  +++   HD   I           VV+  QW+V++   ++++         + K+       G+ +   + DV+ +F    S+    +L++ E + L   F  P    K +   +VP  L+   PE + +P   +   C    I++   F+P GLF +++ RL   F FT   +L++ G  F
Sbjct:  588 ERIEKKIIDLLRKGDNSLSEKRKEIVLDAWDFAGQHLYYATHPVFFSSRAVYVLTHNLSKDLRKKAEPCVRQGVVKKKLDNANNETNLENLISWLVTVHCVQNLEERDKDCKRFPEKTDTTLTSTIKHLRPPVLIVGTHADKPSIPVEQAHAILAEAIC----GKRYDEHVIRPFFAVDNSKSSDEKGIQDLRTKIESVLKSEPYMGETLPAKWFNFEKAIAQQIERNVYFLQLSEVRRIAQYECFIADDVEFNTMLNFFHDLRVIVKH-----AGTVVLQSQWLVNLFKKLITIRTFNEMDPSRAKHWKTLEETGVLHQSLIDDVFGEFVPGNSQTQQDLLSMMERYGLVARFNAPDENGKESLQFLVPAQLT-SSPEFKVFPNDCDP--CALL-IHFPDGFVPHGLFPQLESRLVKHFGFTSPSRLFRNGARF 1009          
BLAST of Roc domain-containing protein vs. Ensembl Nematostella
Match: EDO47069 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN40])

HSP 1 Score: 67.781 bits (164), Expect = 6.592e-11
Identity = 65/270 (24.07%), Postives = 110/270 (40.74%), Query Frame = 3
Query: 5109 NEEIQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSV------------RQGIEHGDLD------------FWLSSISC------------------------HSKY--APVFVVGTRCDQVQADMSCFSSL------KKRYSQ--IEDFILVDSLSGT---GIKDLKQKLIHVTLNLPYMHQAIPSTILDLENQFT-SIRSQKNYITYQEFQNIAISQG--IFEKDVKSVIQILHDFGSIQYFDTEILKNYVVINPQWIVDIMANVVSV 5726
             +E     WDFAGQ +YY TH  F S +A+Y++  ++            RQG+    LD             WL ++ C                         +KY   PV +VGT  DQ    +    +L       K Y +  I  F  VD+   +   GI+DLK K+ +V  + PYM + +P+   + E      I     ++   E + IA ++   I +++V +++   HD   I           VV+  QW++++   +++V
Sbjct:  708 RKETVLDVWDFAGQHLYYATHPVFFSSRAVYVLTHNLSKNLNERAEPCMRQGVADIKLDNANNETNLENLISWLVTVHCIQSLEERDKEAELLSDKTGTTRATKTKYLRPPVLIVGTHADQPCVPVKQAHALLAEAICGKTYDEHVIRPFFSVDNTKSSDDQGIQDLKTKIANVLESEPYMGETLPAKWFNFEKAIAEQIERNVYFLPLSEVRRIAQTECFIIDDQEVNTMLNFYHDLRVIVKH-----AGTVVLQSQWLINLFKKLITV 972          
BLAST of Roc domain-containing protein vs. Ensembl Nematostella
Match: EDO27465 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T966])

HSP 1 Score: 63.929 bits (154), Expect = 2.403e-10
Identity = 56/280 (20.00%), Postives = 121/280 (43.21%), Query Frame = 3
Query: 5595 DVKSVIQILHDFGSIQYFDTEILKNYVVINPQWIVDIMANVVSV--VNQKIKNGIFYHENMKDVW--DKFESKLFNWMLNLTEEFDLTFPHPTMEPKANIVPCLLSEEEPEIEWP-------------KFSEQTLCKFYHINYKFEFLPAGLFNRIQVRLFDFTEAK-------KLWKYGMYFEKNGHHVLFMREN-----KSSLIVRAIGVRPVNVLAMVDDVIKGLVKASFHGVRYNLEISCPDCIEYGNNISNDATKYWSNISMIPSKLIKKALIKK 6347
            +++   + LHD G + ++D  +L++   ++PQW+ D++A+VV++  VN  I NG+    ++  ++  + F + L    +NL  +F++  P  +   +  +VP LL + +P    P               +  T  +     Y   ++P+G + R+  R+    E +       +L   G   E +   + F+ +      K+ + +   GV+ + +  +      G  + + H V Y  EI    C      I+        ++S++  K ++K  + K
Sbjct:   19 ELQQATKFLHDNGVLLHYDDPLLRDLYFLDPQWLCDMLAHVVTIREVNPHINNGVMKLSDLSHIFRSENFPANLIKQYINLLSKFEVALPWSS---EYLLVPSLLPDRQPISNQPIAPGGNPVVTRAMNMTAYTKTRVLRRQYIMSYIPSGFWPRLITRVIADEEVRDVVRCCCQLVMEGEAEESDKEKLAFVAQPDWSCWKTGIELSCFGVKLLRICDLQGLPFYGAPEDAVHPVHYRQEIHDTTCFSTVEVIA-------PSVSILMEKFVQKRRVSK 288          
BLAST of Roc domain-containing protein vs. Ensembl Medaka
Match: lrrk2 (leucine rich repeat kinase 2 [Source:NCBI gene;Acc:101155093])

HSP 1 Score: 96.6709 bits (239), Expect = 4.074e-19
Identity = 104/437 (23.80%), Postives = 197/437 (45.08%), Query Frame = 3
Query: 4914 LKYLLAKTVVCNRTKLMFVGLGEAGKTSLLHALRSDENSAKEIIEQQEKQVTDGIDITKWTVICHNEE-IQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIEHGD-LDFWLSSISCHSKYAPVFVVGTRCDQVQADMSCFSSLKKRYSQIED-------------FILVDSLSGTGIKDLKQKLIHVTLNLP-----YMHQAIPSTILDLENQ--FTSIRSQKNYITYQEFQNIAISQ----GIFEKDVKSVIQILHDFGSIQYFDTEILK--NYVVINPQWIVDIMANVVSVVNQKIK---NGIFYHENMKDVWDKF--ESKLFN-----WMLNLTEEFDLTFPHPTMEPKANIVPCLLSEEEPEIEWPKF-SEQTLCKFYHINYKFEFLPAGLFNRIQVRLFDFT------EAKKL------WKYGMYF 6071
            L+  L K V  +R KL+ VG   +GKT+L+H L       K+  +    Q   GI++  WT+   +++ +  + WDF G + +  +H  FL+ +A+Y+VV+++ +G    D L  WL +I   +  +PV +VGT  D V  ++     LKK  +++ +             +   DS S   I +L++ +     +        M Q +P + ++LE +      R    +   + +Q + + Q     + E ++   +  L + G + +F+   L+      I+PQW+ +I++  +++ +  ++    GI      + V +KF  ESK F        + L E+F +  P   +     +VP  LS+  P IE P   + + + +FY + Y     P   ++R   RL + +      + K L      W+ G+Y 
Sbjct: 1076 LQQRLKKAVPYHRMKLIVVGNPSSGKTTLIHQL------MKQKRQLNSNQNAAGINVLDWTIKDRDKKKMVLNVWDFTGGEEFSGSHLHFLTSRAVYLVVYNLSKGSSQVDALKPWLFTIKAVAPLSPVILVGTHAD-VSDELHFQDCLKKTRAELLNHQGFPAIRDHHMGYFCEDSDS---IANLRKAITREVTSFKIQGQLVMGQLVPDSYVELERRVLLERTRISPEFPVLRRYQLLQLIQECQLQLEEAELPHAVHFLSEVGILLHFNDPGLRLQELYFIDPQWLCNILSQKLTLKSCGLREQPKGIV----QRSVMEKFLSESKCFPKSHLVQFVKLLEKFQIALP---LGEDQLLVPSSLSKHRPVIELPHCENSEVIVRFYEMPY----FPMDYWSRQICRLLEVSSYLLCGQDKMLRPNRIYWRRGVYL 1491          
BLAST of Roc domain-containing protein vs. Ensembl Medaka
Match: mfhas1 (malignant fibrous histiocytoma amplified sequence 1 [Source:NCBI gene;Acc:101173528])

HSP 1 Score: 91.2781 bits (225), Expect = 1.131e-17
Identity = 122/555 (21.98%), Postives = 236/555 (42.52%), Query Frame = 3
Query: 4389 IESLPDEFGRLENMKELKLIGS-----PLYYELLKNDFI--IKSDNLE-FEYPEIGFYKVKEN--DKNPISFLPVADIFINVPRIGSGYSEPVDVNSHGGFPMAILQLKKLITLVIQHQSIRYVPDSIQQLENLEILDLSYNPLLEXXXXXXXXXXXXXXXXXXHCPSISVPPPEIIARGTS-LSYLKYLLAKT--VVCNRTKLMFVGLGEAGKTSLLHALRSDENSAKEIIEQQEKQVTDGIDITKWTVICHNEEIQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIE---HGDLDFWLSSISCHSKYAPVFVVGTRCD--------------------QVQADMSCFS-------------------------------SLKKRYSQIEDFIL---------VDSLSGTG----IKDLKQKLIHVTLN---LPYMHQAIPSTILDLENQFTSIRSQKNYITYQEFQNIAISQGIFEKDVKSVIQILHDFGSIQYF-DTEILKNYVVINPQWIVDIMANVVSVVNQKIKNGIFYHENMKDVWDKFESK 5801
            + SLP+ F RL+N++ L L G+     P  + LL+   +  + S+ L+ F    +G   ++E    +N +S +P       + ++G   +  +D NS    P +I+ L+ L  LV+Q   I  +PD+  +L  + I  +  NPL++                         PP E+  +G   ++  +  LA++   V  R KL+ +G  +AGKT L  +L            +++     G+++  W    H  ++ +  +D +G   +     FFLS  A+Y++V +++  +    H  +  +L  +     +A VFVVGT  D                    Q +AD+                                   +L++R +Q+ DF+L         V S+S TG    I+ L++KL+ V  +    P +H+ +P +   LE     ++S + ++++     + +  G+ E+ ++S +  LH+ G + YF D+  LK +V  N       +  V+ ++N      +F+  +   + D+  S+
Sbjct:  235 MASLPETFCRLQNLESLMLDGNRLSALPPSFGLLQRLKMMNLSSNQLQVFPQALLGVCGLEELYLSRNRLSHVPE-----EISQLGRLVNLWLDNNSITRLPDSIVDLENLEELVLQGNHIAVLPDNFGKLSRVNIWKVKDNPLIQ-------------------------PPYEVCMKGIPYIALYQQELAQSQLAVKPRLKLVLMGRKDAGKTLLRRSLMGT---------REDGGGNRGVELVHWEADAH-RKLTFMVFDLSGNPNFDLVKPFFLSPGALYVLVVNLKSYVPKSFHDHVGRFLRLLCAKVPHAVVFVVGTHADLCGEAELEEKTLDIHRRIGLQEEADVRSLGRLAEEVELALEQGFSVRSSSPHVLFYGVSDRNLRRRRAQL-DFLLKRRLQVLSPVLSVSCTGPQRNIQKLREKLLSVAEHRDIFPNLHRVLPKSWQMLEELL--LQSSELWLSWWSAARLGLQAGLTEERLQSALSYLHESGKLLYFEDSPALKEHVFHN-------LPRVIGILN------VFFQRDRSMLLDRLLSE 733          
BLAST of Roc domain-containing protein vs. Ensembl Medaka
Match: SPRYD3 (SPRY domain-containing protein 3 [Source:NCBI gene;Acc:101173459])

HSP 1 Score: 80.8777 bits (198), Expect = 4.105e-15
Identity = 57/150 (38.00%), Postives = 78/150 (52.00%), Query Frame = 3
Query: 1851 ILTYN-NETEVSLVVGKFPVSPDRRRFSMEILNPGASGRITIGLVPANYSVI-QPGWRENSLAYHGDDGGIFLGESVPQIIRETFSEVNNCIEVIIEYESSLDSPELVRHITWRKNGKFVEKILIQHDKE-LYPAIGMHSINEQVRLLDF 2291
            +L Y+ N  EV   V   P+S   R F + I++ G  G I +GLVP  Y +  QPGW  NS+A+H DDG ++ G +V Q      S  +      I    SLD  E    + + KNG  V  + I    + LYPA+GMHS+ E+V LLD 
Sbjct:   41 VLRYHGNSDEVGCFVAARPLSKRNRYFEVTIMDTGVRGMIAVGLVPPLYKLDHQPGWLPNSVAFHADDGKLYNGNTVGQQFGAKCSTGDR-----IGCGISLDCDEGQLTVFFTKNGAEVGSVDIPASPDALYPAVGMHSLGEEV-LLDL 184          
BLAST of Roc domain-containing protein vs. Ensembl Medaka
Match: SPRYD3 (SPRY domain-containing protein 3 [Source:NCBI gene;Acc:101173459])

HSP 1 Score: 79.7221 bits (195), Expect = 1.132e-14
Identity = 57/150 (38.00%), Postives = 78/150 (52.00%), Query Frame = 3
Query: 1851 ILTYN-NETEVSLVVGKFPVSPDRRRFSMEILNPGASGRITIGLVPANYSVI-QPGWRENSLAYHGDDGGIFLGESVPQIIRETFSEVNNCIEVIIEYESSLDSPELVRHITWRKNGKFVEKILIQHDKE-LYPAIGMHSINEQVRLLDF 2291
            +L Y+ N  EV   V   P+S   R F + I++ G  G I +GLVP  Y +  QPGW  NS+A+H DDG ++ G +V Q      S  +      I    SLD  E    + + KNG  V  + I    + LYPA+GMHS+ E+V LLD 
Sbjct:   41 VLRYHGNSDEVGCFVAARPLSKRNRYFEVTIMDTGVRGMIAVGLVPPLYKLDHQPGWLPNSVAFHADDGKLYNGNTVGQQFGAKCSTGDR-----IGCGISLDCDEGQLTVFFTKNGAEVGSVDIPASPDALYPAVGMHSLGEEV-LLDL 184          
BLAST of Roc domain-containing protein vs. Ensembl Medaka
Match: spryd3 (SPRY domain-containing protein 3 [Source:NCBI gene;Acc:101156411])

HSP 1 Score: 66.2402 bits (160), Expect = 2.199e-10
Identity = 55/166 (33.13%), Postives = 85/166 (51.20%), Query Frame = 3
Query: 1836 LQELG-ILTY-NNETEVSLVVGKFPVSPDRRRFSMEILNPGASGRITIGLVPANYSVI-QPGWRENSLAYHGDDGGIFLGESVPQIIRETFSEVNNCIEVIIEYESSLDSPELVRHITWRKNGKFVEKILIQHDKE-LYPAIGMHSINEQVRLLDFEVWADTECSS 2321
            LQ+ G +L+Y  N  EV   V   P+S     F + I+  G  G I +GLVP  Y +  QPGW  +S+AYH D+G ++ G  V +      +   + I   I  E +L++   +  I + KNG+ V  + +    E L+PA+GMHS+ E+V++     W   E  S
Sbjct:   29 LQKSGDLLSYQGNSDEVGCYVAGHPLSEGNSFFEVTIVESGVRGTIAVGLVPRFYRLDHQPGWLPHSVAYHADNGKLYNGSPVGKQFGPKCTR-GDRIGCGIGSE-NLNTG--LTKIFFTKNGEEVGSVEVAVSAEGLFPAVGMHSLGEEVKVDLQAEWLSEEGDS 190          
BLAST of Roc domain-containing protein vs. Planmine SMEST
Match: SMESG000073246.1 (SMESG000073246.1)

HSP 1 Score: 5564.96 bits (14435), Expect = 0.000e+0
Identity = 2804/2809 (99.82%), Postives = 2806/2809 (99.89%), Query Frame = 3
Query:   27 SSKEMEVETAESSNLMKFIVLCYGANCQKVYDDIIQLDWSLKLKGFVDNLQELISNIKEKSSELIDFNDCLKLSEAYRQLEQLNDFIKDFKERISFFKTETINKQVVSELLSCIENNIEKEMAICPFRYTSNVLDAIGQKIIQSGKNYVTMEFLNRVNVAKSTKVSTEIFEKLFAEGRGFYIKKFQFFILNIKWFDSILADIISKMPNESNYRVHGVHRNCKVWDYKNLIELFSRFQIEPKDNSMWIEFIMDLGILIKLPCIRKSINDEFYLFVNPMAEGTGKKLHLDYIKSVAELISHKFEXXXXXXXXFQDLYSIYPQFLSKIVSIGQLQLISPVATVIHISGGIELLIESELDCISMTIYFKPPEMSQPSSKFNMNIMDYIRSVMHLGTDSFEAILSQQNILSNKISSIPKESLKNYSVCYNHKWVNDVEFNNICSLCGNCSSVDGIECPYNRIISQRKGVCLCLKQSRICGSCGICQSCAANHWKNHCESDPNRLIICNANYVNVPTRPISQFMGSKFTVDIYQENSNTFAGLLINDTDIMVDIFGITNSCKNGAAIFADNLNNIPSPLPISVLSFEISESYFYKSDLYQFSKCSGINVLQELGILTYNNETEVSLVVGKFPVSPDRRRFSMEILNPGASGRITIGLVPANYSVIQPGWRENSLAYHGDDGGIFLGESVPQIIRETFSEVNNCIEVIIEYESSLDSPELVRHITWRKNGKFVEKILIQHDKELYPAIGMHSINEQVRLLDFEVWADTECSSNVENNIKIENTVTVSPESIIYLEANEGFSGIFYIIPKTDLMKSLEFKIFHKYDGTETVGWMLESHNKLLNSNKTPGKWLFDIFSNSNIEFFTFGLKTSITTNIHDWMLKLTVLTTTDKSKTFQWQLSSCDWLVMSNENVFSIKEVPDQHTVAAKPSXXXXXXXNSSVDLEKPDLRKTNTSGQIRYYHIPIADYKLFFRADKQNAWIRCSNYMKPNFTRSFQIGNLIALDKIPALILQVNKSKEQLKLSGKDELINFNDSRLKPIMQSGKPXXXXXXXXNRKYNQFSITNKGLLSVPTPSRPWLFAFNWENDNTFPIDELYFSTDCSEYHGMNICLLNSISTVEEEVPPNDKLDNIVTLPFNQNEKEMENFLWEHSMLHLISWDKLLFYPFCPGKSTIYDSKPHLVNTEGIELFEVNSSPSEICKAVFFNPKLLLCHKLILNYKFLLPKYNRILRKEITDFSQDEIEYLIFSILNKITSYMVLTNLFFDEKYAFTQSLKVNWNKYFENNNNHSLVLESHGVSCKLHSSLYDEQINLDDIIGAPETNQKDNEIIMENHSIFDYAKCSQSIILSGKTVKELPAELFVKFINLCSLELRNMFQLKCLPRTIYSLKGLQRLIINQVKINTLPDIYEFPNLKYLQIEKCPIKTYNDSNECXXXXXXXXXXXXXQTISNFICXXXXXXXXXXXXHGIESLPDEFGRLENMKELKLIGSPLYYELLKNDFIIKSDNLEFEYPEIGFYKVKENDKNPISFLPVADIFINVPRIGSGYSEPVDVNSHGGFPMAILQLKKLITLVIQHQSIRYVPDSIQQLENLEILDLSYNPLLEXXXXXXXXXXXXXXXXXXHCPSISVPPPEIIARGTSLSYLKYLLAKTVVCNRTKLMFVGLGEAGKTSLLHALRSDENSAKEIIEQQEKQVTDGIDITKWTVICHNEEIQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIEHGDLDFWLSSISCHSKYAPVFVVGTRCDQVQADMSCFSSLKKRYSQIEDFILVDSLSGTGIKDLKQKLIHVTLNLPYMHQAIPSTILDLENQFTSIRSQKNYITYQEFQNIAISQGIFEKDVKSVIQILHDFGSIQYFDTEILKNYVVINPQWIVDIMANVVSVVNQKIKNGIFYHENMKDVWDKFESKLFNWMLNLTEEFDLTFPHPTMEPKANIVPCLLSEEEPEIEWPKFSEQTLCKFYHINYKFEFLPAGLFNRIQVRLFDFTEAKKLWKYGMYFEKNGHHVLFMRENKSSLIVRAIGVRPVNVLAMVDDVIKGLVKASFHGVRYNLEISCPDCIEYGNNISNDATKYWSNISMIPSKLIKKALIKKVEYLQCEELHLNSIKSIKENTPETASAEEFINDLISKVQTVKSLYASSDKLVTFLHSTKDLTDLSAMPMKEFDNLFSDCNIVCIKINETSEVKWKTSISNCQLCLICLSENFIQIPKMNEMLEYXXXXXXXXXXXXXSSDKEIRQKWEYYPYFMTVFIKINATHPKASTEKILEIKKAIQDSIVSSTVNETAGETYDCFVSYCWANSQDAVNKGTKAIPGAIISPDADPRKLARYLIDNGIKCWIDDSHMDKTXXXXXXXXXXXXXXKMMLAFVSDEYDKSDNCKMELNFMVEELRRPVSYVLVGSNMEWRFNSEVGLIMQKRHRSEILDFTNNNNISESRLLEELKVRLRNCPDIAYEKNDQNKIQGHNTALMEQLELISRQILNQLISFITDNCPRLIVIDVDPDDGTDSQIDNDIIMDSTLQSSLRASVSGNKLVLKVICEGETNWHIADEAYPLSIEDKDEIIEKCAVYLYMIYQVFEYKNPGLRCLQPDNISNMEFITKITQIAGSSTMTFKESYSNMVKYYMKYDPKIANCSLERYRLPSGREFWMCKKHADQNPRCKLIERDRAAIDTFAIPIDNYDTSLLGDIKSKISSDTLQHNDSFHSIVQRFKTTDAASNRTTKHDLILPKKKLFFRSDTILNLEKDIVTNKKDTYDIPIRISSEVNARNVYNQIPSKPVNRRLSAMNRPNLVGSRICTIQ 8453
            SSKEMEVETAESSNLMKFIVLCYGANCQKVYDDIIQLDWSLKLKGFVDNLQELISNIKEKSSELIDFNDCLKLSEAYRQLEQLNDFIKDFKERISFFKTETINKQVVSELLSCIENNIEKEMAICPFRYTSNVLDAIGQKIIQSGKNYVTMEFLNRVNVAKSTKVSTEIFEKLFAEGRGFYIKKFQFFILNIKWFDSILADIISKMPNESNYRVHGVHRNCKVWDYKNLIELFSRFQIEPKDNSMWIEFIMDLGILIKLPCIRKSINDEFYLFVNPMAEGTGKKLHLDYIKSVAELISHKFEVKVKYKKVFQDLYSIYPQFLSKIVSIGQLQLISPVATVIHISGGIELLIESELDCISMTIYFKPPEMSQPSSKFNMNIMDYIRSVMHL TDSFEAILSQQNILSNKISSIPKESLKNYSVCYNHKWVNDVEFNNICSLCGNCSSVDGIECPYNRIISQRKGVCLCLKQSRICGSCGICQSCAANHWKNHCESDPNRLIICNANYVNVPTRPISQFMGSKFTVDIYQENSNTFAGLLINDTDIMVDIFGITNSCKNGAAIFADNLNNIPSPLPISVLSFEISESYFYKSDLYQFSKCSGINVLQELGILTYNNETEVSLVVGKFPVSPDRRRFSMEILNPGASGRITIGLVPANYSVIQPGWRENSLAYHGDDGGIFLGESVPQIIRETFSEVNNCIEVIIEYESSLDSPELVRHITWRKNGKFVEKILIQHDKELYPAIGMHSINEQVRLLDFEVWADTECSSNVENNIKIENTVTVSPESIIYLEANEGFSGIFYIIPKTDLMKSLEFKIFHKYDGTETVGWMLESHNKLLNSNKTPGKWLFDIFSNSNIEFFTFGLKTSITTNIHDWMLKLTVLTTTDKSKTFQWQLSSCDWLVMSNENVFSIKEVPDQHTVAAKPSLLLTTTLNSSVDLEKPDLRKTNTSGQIRYYHIPIADYKLFFRADKQNAWIRCSNYMKPNFTRSFQIGNLIALDKIPALILQVNKSKEQLKLSGKDELINFNDSRLKPIMQSGKPLLSLKLSKNRKYNQFSITNKGLLSVPTPSRPWLFAFNWENDNTFPIDELYFSTDCSEYHGMNICLLNSISTVEEEVPPNDKLDNIVTLPFNQNEKEMENFLWEHSMLHLISWDKLLFYPFCPGKSTIYDSKPHLVNTEGIELFEVNSSPSEICKAVFFNPKLLLCHKLILNYKFLLPKYNRILRKEITDFSQDEIEYLIFSILNKITSYMVLTNLFFDEKYAFTQSLKVNWNKYFENNNNHSLVLESHGVSCKLHSSLYDEQINLDDIIGAPETNQKDNEIIMENHSIFDYAKCSQSIILSGKTVKELPAELFVKFINLCSLELRNMFQLKCLPRTIYSLKGLQRLIINQVKINTLPDIYEFPNLKYLQIEKCPIKTYNDSNECLKLETLKLLALPLQTISNFICLQENLVVVELQLHGIESLPDEFGRLENMKELKLIGSPLYYELLKNDFIIKSDNLEFEYPEIGFYKVKENDKNPISFLPVADIFINVPRIGSGYSEPVDVNSHGGFPMAILQLKKLITLVIQHQSIRYVPDSIQQLENLEILDLSYNPLLEKVSAQISSIISIKQLILVHCPSISVPPPEIIARGTSLSYLKYLLAKTVVCNRTKLMFVGLGEAGKTSLLHALRSDENSAKEIIEQQEKQVTDGIDITKWTVICHNEEIQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIEHGDLDFWLSSISCHSKYAPVFVVGTRCDQVQADMSCFSSLKKRYSQIEDFILVDSLSGTGIKDLKQKLIHVTLNLPYMHQAIPSTILDLENQFTSIRSQKNYITYQEFQNIAISQGIFEKDVKSVIQILHDFGSIQYFDTEILKNYVVINPQWIVDIMANVVSVVNQKIKNGIFYHENMKDVWDKFESKLFNWMLNLTEEFDLTFPHPTMEPKANIVPCLLSEEEPEIEWPKFSEQTLCKFYHINYKFEFLPAGLFNRIQVRLFDFTEAKKLWKYGMYFEKNGHHVLFMRENKSSLIVRAIGVRPVNVLA+VDDVIKGLVKASFHGVRYNLEISCPDCIEYGNNISNDATKYWSNISMIPSKLIKKALIKKVEYLQCEELHLNSIKSIKENTPETASAEEFINDLISKVQTVKSLYASSDKLVTFLHSTKDLTDLSAMPMKEFDNLFSDCNIVCIKINETSEVKWKTSISNCQLCLICLSENFIQIPKMNEMLEYIKLLKKKFILLILSSDKEIRQKWEYYPYFMTVFIKINATHPKASTEKILEIKKAIQDSIVSSTVNETAGETYDCFVSYCWANSQDAVNKGTKAIPGAIISPDADPRKLARYLIDNGIKCWIDDSHMDKTSGLNSQLSLNLRNSKMMLAFVSDEYDKSDNCKMELNFMVEELRRPVSYVLVGSNMEWRFNSEVGLIMQKRHRSEILDFTNNNNISESRLLEELKVRLRNCPDIAYEKNDQNKIQGHNTALMEQLELISRQILNQLISFITDNCPRLIVIDVDPDDGTDSQIDNDIIMDSTLQSSLRASVSGNKL LKVICEGETNWHIADEAYPLSIEDKDEIIEKCAVYLYMIYQVFEYKNPGLRCLQPDNISNMEFITKITQIAGSSTMTFKESYSNMVKYYMKYDPK+ NCSLERYRLPSGREFWMCKKHADQNPRCKLIERDRAAIDTFAIPIDNYDTSLLGDIKSKISSDTLQHNDSFHSIVQRFKTTDAASNRTTKHDLILPKKKLFFRSDTILNLEKDIVTNKKDTYDIPIRISSEVNARNVYNQIPSKPVNRRLSAMNRPNLVGSRICTIQ
Sbjct:  477 SSKEMEVETAESSNLMKFIVLCYGANCQKVYDDIIQLDWSLKLKGFVDNLQELISNIKEKSSELIDFNDCLKLSEAYRQLEQLNDFIKDFKERISFFKTETINKQVVSELLSCIENNIEKEMAICPFRYTSNVLDAIGQKIIQSGKNYVTMEFLNRVNVAKSTKVSTEIFEKLFAEGRGFYIKKFQFFILNIKWFDSILADIISKMPNESNYRVHGVHRNCKVWDYKNLIELFSRFQIEPKDNSMWIEFIMDLGILIKLPCIRKSINDEFYLFVNPMAEGTGKKLHLDYIKSVAELISHKFEVKVKYKKVFQDLYSIYPQFLSKIVSIGQLQLISPVATVIHISGGIELLIESELDCISMTIYFKPPEMSQPSSKFNMNIMDYIRSVMHLCTDSFEAILSQQNILSNKISSIPKESLKNYSVCYNHKWVNDVEFNNICSLCGNCSSVDGIECPYNRIISQRKGVCLCLKQSRICGSCGICQSCAANHWKNHCESDPNRLIICNANYVNVPTRPISQFMGSKFTVDIYQENSNTFAGLLINDTDIMVDIFGITNSCKNGAAIFADNLNNIPSPLPISVLSFEISESYFYKSDLYQFSKCSGINVLQELGILTYNNETEVSLVVGKFPVSPDRRRFSMEILNPGASGRITIGLVPANYSVIQPGWRENSLAYHGDDGGIFLGESVPQIIRETFSEVNNCIEVIIEYESSLDSPELVRHITWRKNGKFVEKILIQHDKELYPAIGMHSINEQVRLLDFEVWADTECSSNVENNIKIENTVTVSPESIIYLEANEGFSGIFYIIPKTDLMKSLEFKIFHKYDGTETVGWMLESHNKLLNSNKTPGKWLFDIFSNSNIEFFTFGLKTSITTNIHDWMLKLTVLTTTDKSKTFQWQLSSCDWLVMSNENVFSIKEVPDQHTVAAKPSLLLTTTLNSSVDLEKPDLRKTNTSGQIRYYHIPIADYKLFFRADKQNAWIRCSNYMKPNFTRSFQIGNLIALDKIPALILQVNKSKEQLKLSGKDELINFNDSRLKPIMQSGKPLLSLKLSKNRKYNQFSITNKGLLSVPTPSRPWLFAFNWENDNTFPIDELYFSTDCSEYHGMNICLLNSISTVEEEVPPNDKLDNIVTLPFNQNEKEMENFLWEHSMLHLISWDKLLFYPFCPGKSTIYDSKPHLVNTEGIELFEVNSSPSEICKAVFFNPKLLLCHKLILNYKFLLPKYNRILRKEITDFSQDEIEYLIFSILNKITSYMVLTNLFFDEKYAFTQSLKVNWNKYFENNNNHSLVLESHGVSCKLHSSLYDEQINLDDIIGAPETNQKDNEIIMENHSIFDYAKCSQSIILSGKTVKELPAELFVKFINLCSLELRNMFQLKCLPRTIYSLKGLQRLIINQVKINTLPDIYEFPNLKYLQIEKCPIKTYNDSNECLKLETLKLLALPLQTISNFICLQENLVVVELQLHGIESLPDEFGRLENMKELKLIGSPLYYELLKNDFIIKSDNLEFEYPEIGFYKVKENDKNPISFLPVADIFINVPRIGSGYSEPVDVNSHGGFPMAILQLKKLITLVIQHQSIRYVPDSIQQLENLEILDLSYNPLLEKVSAQISSIISIKQLILVHCPSISVPPPEIIARGTSLSYLKYLLAKTVVCNRTKLMFVGLGEAGKTSLLHALRSDENSAKEIIEQQEKQVTDGIDITKWTVICHNEEIQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIEHGDLDFWLSSISCHSKYAPVFVVGTRCDQVQADMSCFSSLKKRYSQIEDFILVDSLSGTGIKDLKQKLIHVTLNLPYMHQAIPSTILDLENQFTSIRSQKNYITYQEFQNIAISQGIFEKDVKSVIQILHDFGSIQYFDTEILKNYVVINPQWIVDIMANVVSVVNQKIKNGIFYHENMKDVWDKFESKLFNWMLNLTEEFDLTFPHPTMEPKANIVPCLLSEEEPEIEWPKFSEQTLCKFYHINYKFEFLPAGLFNRIQVRLFDFTEAKKLWKYGMYFEKNGHHVLFMRENKSSLIVRAIGVRPVNVLALVDDVIKGLVKASFHGVRYNLEISCPDCIEYGNNISNDATKYWSNISMIPSKLIKKALIKKVEYLQCEELHLNSIKSIKENTPETASAEEFINDLISKVQTVKSLYASSDKLVTFLHSTKDLTDLSAMPMKEFDNLFSDCNIVCIKINETSEVKWKTSISNCQLCLICLSENFIQIPKMNEMLEYIKLLKKKFILLILSSDKEIRQKWEYYPYFMTVFIKINATHPKASTEKILEIKKAIQDSIVSSTVNETAGETYDCFVSYCWANSQDAVNKGTKAIPGAIISPDADPRKLARYLIDNGIKCWIDDSHMDKTSGLNSQLSLNLRNSKMMLAFVSDEYDKSDNCKMELNFMVEELRRPVSYVLVGSNMEWRFNSEVGLIMQKRHRSEILDFTNNNNISESRLLEELKVRLRNCPDIAYEKNDQNKIQGHNTALMEQLELISRQILNQLISFITDNCPRLIVIDVDPDDGTDSQIDNDIIMDSTLQSSLRASVSGNKLALKVICEGETNWHIADEAYPLSIEDKDEIIEKCAVYLYMIYQVFEYKNPGLRCLQPDNISNMEFITKITQIAGSSTMTFKESYSNMVKYYMKYDPKLVNCSLERYRLPSGREFWMCKKHADQNPRCKLIERDRAAIDTFAIPIDNYDTSLLGDIKSKISSDTLQHNDSFHSIVQRFKTTDAASNRTTKHDLILPKKKLFFRSDTILNLEKDIVTNKKDTYDIPIRISSEVNARNVYNQIPSKPVNRRLSAMNRPNLVGSRICTIQ 3285          
BLAST of Roc domain-containing protein vs. Planmine SMEST
Match: SMESG000073246.1 (SMESG000073246.1)

HSP 1 Score: 5489.85 bits (14240), Expect = 0.000e+0
Identity = 2775/2809 (98.79%), Postives = 2779/2809 (98.93%), Query Frame = 3
Query:   27 SSKEMEVETAESSNLMKFIVLCYGANCQKVYDDIIQLDWSLKLKGFVDNLQELISNIKEKSSELIDFNDCLKLSEAYRQLEQLNDFIKDFKERISFFKTETINKQVVSELLSCIENNIEKEMAICPFRYTSNVLDAIGQKIIQSGKNYVTMEFLNRVNVAKSTKVSTEIFEKLFAEGRGFYIKKFQFFILNIKWFDSILADIISKMPNESNYRVHGVHRNCKVWDYKNLIELFSRFQIEPKDNSMWIEFIMDLGILIKLPCIRKSINDEFYLFVNPMAEGTGKKLHLDYIKSVAELISHKFEXXXXXXXXFQDLYSIYPQFLSKIVSIGQLQLISPVATVIHISGGIELLIESELDCISMTIYFKPPEMSQPSSKFNMNIMDYIRSVMHLGTDSFEAILSQQNILSNKISSIPKESLKNYSVCYNHKWVNDVEFNNICSLCGNCSSVDGIECPYNRIISQRKGVCLCLKQSRICGSCGICQSCAANHWKNHCESDPNRLIICNANYVNVPTRPISQFMGSKFTVDIYQENSNTFAGLLINDTDIMVDIFGITNSCKNGAAIFADNLNNIPSPLPISVLSFEISESYFYKSDLYQFSKCSGINVLQELGILTYNNETEVSLVVGKFPVSPDRRRFSMEILNPGASGRITIGLVPANYSVIQPGWRENSLAYHGDDGGIFLGESVPQIIRETFSEVNNCIEVIIEYESSLDSPELVRHITWRKNGKFVEKILIQHDKELYPAIGMHSINEQVRLLDFEVWADTECSSNVENNIKIENTVTVSPESIIYLEANEGFSGIFYIIPKTDLMKSLEFKIFHKYDGTETVGWMLESHNKLLNSNKTPGKWLFDIFSNSNIEFFTFGLKTSITTNIHDWMLKLTVLTTTDKSKTFQWQLSSCDWLVMSNENVFSIKEVPDQHTVAAKPSXXXXXXXNSSVDLEKPDLRKTNTSGQIRYYHIPIADYKLFFRADKQNAWIRCSNYMKPNFTRSFQIGNLIALDKIPALILQVNKSKEQLKLSGKDELINFNDSRLKPIMQSGKPXXXXXXXXNRKYNQFSITNKGLLSVPTPSRPWLFAFNWENDNTFPIDELYFSTDCSEYHGMNICLLNSISTVEEEVPPNDKLDNIVTLPFNQNEKEMENFLWEHSMLHLISWDKLLFYPFCPGKSTIYDSKPHLVNTEGIELFEVNSSPSEICKAVFFNPKLLLCHKLILNYKFLLPKYNRILRKEITDFSQDEIEYLIFSILNKITSYMVLTNLFFDEKYAFTQSLKVNWNKYFENNNNHSLVLESHGVSCKLHSSLYDEQINLDDIIGAPETNQKDNEIIMENHSIFDYAKCSQSIILSGKTVKELPAELFVKFINLCSLELRNMFQLKCLPRTIYSLKGLQRLIINQVKINTLPDIYEFPNLKYLQIEKCPIKTYNDSNECXXXXXXXXXXXXXQTISNFICXXXXXXXXXXXXHGIESLPDEFGRLENMKELKLIGSPLYYELLKNDFIIKSDNLEFEYPEIGFYKVKENDKNPISFLPVADIFINVPRIGSGYSEPVDVNSHGGFPMAILQLKKLITLVIQHQSIRYVPDSIQQLENLEILDLSYNPLLEXXXXXXXXXXXXXXXXXXHCPSISVPPPEIIARGTSLSYLKYLLAKTVVCNRTKLMFVGLGEAGKTSLLHALRSDENSAKEIIEQQEKQVTDGIDITKWTVICHNEEIQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIEHGDLDFWLSSISCHSKYAPVFVVGTRCDQVQADMSCFSSLKKRYSQIEDFILVDSLSGTGIKDLKQKLIHVTLNLPYMHQAIPSTILDLENQFTSIRSQKNYITYQEFQNIAISQGIFEKDVKSVIQILHDFGSIQYFDTEILKNYVVINPQWIVDIMANVVSVVNQKIKNGIFYHENMKDVWDKFESKLFNWMLNLTEEFDLTFPHPTMEPKANIVPCLLSEEEPEIEWPKFSEQTLCKFYHINYKFEFLPAGLFNRIQVRLFDFTEAKKLWKYGMYFEKNGHHVLFMRENKSSLIVRAIGVRPVNVLAMVDDVIKGLVKASFHGVRYNLEISCPDCIEYGNNISNDATKYWSNISMIPSKLIKKALIKKVEYLQCEELHLNSIKSIKENTPETASAEEFINDLISKVQTVKSLYASSDKLVTFLHSTKDLTDLSAMPMKEFDNLFSDCNIVCIKINETSEVKWKTSISNCQLCLICLSENFIQIPKMNEMLEYXXXXXXXXXXXXXSSDKEIRQKWEYYPYFMTVFIKINATHPKASTEKILEIKKAIQDSIVSSTVNETAGETYDCFVSYCWANSQDAVNKGTKAIPGAIISPDADPRKLARYLIDNGIKCWIDDSHMDKTXXXXXXXXXXXXXXKMMLAFVSDEYDKSDNCKMELNFMVEELRRPVSYVLVGSNMEWRFNSEVGLIMQKRHRSEILDFTNNNNISESRLLEELKVRLRNCPDIAYEKNDQNKIQGHNTALMEQLELISRQILNQLISFITDNCPRLIVIDVDPDDGTDSQIDNDIIMDSTLQSSLRASVSGNKLVLKVICEGETNWHIADEAYPLSIEDKDEIIEKCAVYLYMIYQVFEYKNPGLRCLQPDNISNMEFITKITQIAGSSTMTFKESYSNMVKYYMKYDPKIANCSLERYRLPSGREFWMCKKHADQNPRCKLIERDRAAIDTFAIPIDNYDTSLLGDIKSKISSDTLQHNDSFHSIVQRFKTTDAASNRTTKHDLILPKKKLFFRSDTILNLEKDIVTNKKDTYDIPIRISSEVNARNVYNQIPSKPVNRRLSAMNRPNLVGSRICTIQ 8453
            SSKEMEVETAESSNLMKFIVLCYGANCQKVYDDIIQLDWSLKLKGFVDNLQELISNIKEKSSELIDFNDCLKLSEAYRQLEQLNDFIKDFKERISFFKTETINKQVVSELLSCIENNIEKEMAICPFRYTSNVLDAIGQKIIQSGKNYVTMEFLNRVNVAKSTKVSTEIFEKLFAEGRGFYIKKFQFFILNIKWFDSILADIISKMPNESNYRVHGVHRNCKVWDYKNLIELFSRFQIEPKDNSMWIEFIMDLGILIKLPCIRKSINDEFYLFVNPMAEGTGKKLHLDYIKSVAELISHKFEVKVKYKKVFQDLYSIYPQFLSKIVSIGQLQLISPVATVIHISGGIELLIESELDCISMTIYFKPPEMSQPSSKFNMNIMDYIRSVMHL TDSFEAILSQQNILSNKISSIPKESLKNYSVCYNHKWVNDVEFNNICSLCGNCSSVDGIECPYNRIISQRKGVCLCLKQSRICGSCGICQSCAANHWKNHCESDPNRLIICNANYVNVPTRPISQFMGSKFTVDIYQENSNTFAGLLINDTDIMVDIFGITNSCKNGAAIFADNLNNIPSPLPISVLSFEISESYFYKSDLYQFSKCSGINVLQELGILTYNNETEVSLVVGKFPVSPDRRRFSMEILNPGASGRITIGLVPANYSVIQPGWRENSLAYHGDDGGIFLGESVPQIIRETFSEVNNCIEVIIEYESSLDSPELVRHITWRKNGKFVEKILIQHDKELYPAIGMHSINEQ                   N ++I       PESIIYLEANEGFSGIFYIIPKTDLMKSLEFKIFHKYDGTETVGWMLESHNKLLNSNKTPGKWLFDIFSNSNIEFFTFGLKTSITTNIHDWMLKLTVLTTTDKSKTFQWQLSSCDWLVMSNENVFSIKEVPDQHTVAAKPSLLLTTTLNSSVDLEKPDLRKTNTSGQIRYYHIPIADYKLFFRADKQNAWIRCSNYMKPNFTRSFQIGNLIALDKIPALILQVNKSKEQLKLSGKDELINFNDSRLKPIMQSGKPLLSLKLSKNRKYNQFSITNKGLLSVPTPSRPWLFAFNWENDNTFPIDELYFSTDCSEYHGMNICLLNSISTVEEEVPPNDKLDNIVTLPFNQNEKEMENFLWEHSMLHLISWDKLLFYPFCPGKSTIYDSKPHLVNTEGIELFEVNSSPSEICKAVFFNPKLLLCHKLILNYKFLLPKYNRILRKEITDFSQDEIEYLIFSILNKITSYMVLTNLFFDEKYAFTQSLKVNWNKYFENNNNHSLVLESHGVSCKLHSSLYDEQINLDDIIGAPETNQKDNEIIMENHSIFDYAKCSQSIILSGKTVKELPAELFVKFINLCSLELRNMFQLKCLPRTIYSLKGLQRLIINQVKINTLPDIYEFPNLKYLQIEKCPIKTYNDSNECLKLETLKLLALPLQTISNFICLQENLVVVELQLHGIESLPDEFGRLENMKELKLIGSPLYYELLKNDFIIKSDNLEFEYPEIGFYKVKENDKNPISFLPVADIFINVPRIGSGYSEPVDVNSHGGFPMAILQLKKLITLVIQHQSIRYVPDSIQQLENLEILDLSYNPLLEKVSAQISSIISIKQLILVHCPSISVPPPEIIARGTSLSYLKYLLAKTVVCNRTKLMFVGLGEAGKTSLLHALRSDENSAKEIIEQQEKQVTDGIDITKWTVICHNEEIQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIEHGDLDFWLSSISCHSKYAPVFVVGTRCDQVQADMSCFSSLKKRYSQIEDFILVDSLSGTGIKDLKQKLIHVTLNLPYMHQAIPSTILDLENQFTSIRSQKNYITYQEFQNIAISQGIFEKDVKSVIQILHDFGSIQYFDTEILKNYVVINPQWIVDIMANVVSVVNQKIKNGIFYHENMKDVWDKFESKLFNWMLNLTEEFDLTFPHPTMEPKANIVPCLLSEEEPEIEWPKFSEQTLCKFYHINYKFEFLPAGLFNRIQVRLFDFTEAKKLWKYGMYFEKNGHHVLFMRENKSSLIVRAIGVRPVNVLA+VDDVIKGLVKASFHGVRYNLEISCPDCIEYGNNISNDATKYWSNISMIPSKLIKKALIKKVEYLQCEELHLNSIKSIKENTPETASAEEFINDLISKVQTVKSLYASSDKLVTFLHSTKDLTDLSAMPMKEFDNLFSDCNIVCIKINETSEVKWKTSISNCQLCLICLSENFIQIPKMNEMLEYIKLLKKKFILLILSSDKEIRQKWEYYPYFMTVFIKINATHPKASTEKILEIKKAIQDSIVSSTVNETAGETYDCFVSYCWANSQDAVNKGTKAIPGAIISPDADPRKLARYLIDNGIKCWIDDSHMDKTSGLNSQLSLNLRNSKMMLAFVSDEYDKSDNCKMELNFMVEELRRPVSYVLVGSNMEWRFNSEVGLIMQKRHRSEILDFTNNNNISESRLLEELKVRLRNCPDIAYEKNDQNKIQGHNTALMEQLELISRQILNQLISFITDNCPRLIVIDVDPDDGTDSQIDNDIIMDSTLQSSLRASVSGNKL LKVICEGETNWHIADEAYPLSIEDKDEIIEKCAVYLYMIYQVFEYKNPGLRCLQPDNISNMEFITKITQIAGSSTMTFKESYSNMVKYYMKYDPK+ NCSLERYRLPSGREFWMCKKHADQNPRCKLIERDRAAIDTFAIPIDNYDTSLLGDIKSKISSDTLQHNDSFHSIVQRFKTTDAASNRTTKHDLILPKKKLFFRSDTILNLEKDIVTNKKDTYDIPIRISSEVNARNVYNQIPSKPVNRRLSAMNRPNLVGSRICTIQ
Sbjct:  477 SSKEMEVETAESSNLMKFIVLCYGANCQKVYDDIIQLDWSLKLKGFVDNLQELISNIKEKSSELIDFNDCLKLSEAYRQLEQLNDFIKDFKERISFFKTETINKQVVSELLSCIENNIEKEMAICPFRYTSNVLDAIGQKIIQSGKNYVTMEFLNRVNVAKSTKVSTEIFEKLFAEGRGFYIKKFQFFILNIKWFDSILADIISKMPNESNYRVHGVHRNCKVWDYKNLIELFSRFQIEPKDNSMWIEFIMDLGILIKLPCIRKSINDEFYLFVNPMAEGTGKKLHLDYIKSVAELISHKFEVKVKYKKVFQDLYSIYPQFLSKIVSIGQLQLISPVATVIHISGGIELLIESELDCISMTIYFKPPEMSQPSSKFNMNIMDYIRSVMHLCTDSFEAILSQQNILSNKISSIPKESLKNYSVCYNHKWVNDVEFNNICSLCGNCSSVDGIECPYNRIISQRKGVCLCLKQSRICGSCGICQSCAANHWKNHCESDPNRLIICNANYVNVPTRPISQFMGSKFTVDIYQENSNTFAGLLINDTDIMVDIFGITNSCKNGAAIFADNLNNIPSPLPISVLSFEISESYFYKSDLYQFSKCSGINVLQELGILTYNNETEVSLVVGKFPVSPDRRRFSMEILNPGASGRITIGLVPANYSVIQPGWRENSLAYHGDDGGIFLGESVPQIIRETFSEVNNCIEVIIEYESSLDSPELVRHITWRKNGKFVEKILIQHDKELYPAIGMHSINEQ-------------------NALQI-------PESIIYLEANEGFSGIFYIIPKTDLMKSLEFKIFHKYDGTETVGWMLESHNKLLNSNKTPGKWLFDIFSNSNIEFFTFGLKTSITTNIHDWMLKLTVLTTTDKSKTFQWQLSSCDWLVMSNENVFSIKEVPDQHTVAAKPSLLLTTTLNSSVDLEKPDLRKTNTSGQIRYYHIPIADYKLFFRADKQNAWIRCSNYMKPNFTRSFQIGNLIALDKIPALILQVNKSKEQLKLSGKDELINFNDSRLKPIMQSGKPLLSLKLSKNRKYNQFSITNKGLLSVPTPSRPWLFAFNWENDNTFPIDELYFSTDCSEYHGMNICLLNSISTVEEEVPPNDKLDNIVTLPFNQNEKEMENFLWEHSMLHLISWDKLLFYPFCPGKSTIYDSKPHLVNTEGIELFEVNSSPSEICKAVFFNPKLLLCHKLILNYKFLLPKYNRILRKEITDFSQDEIEYLIFSILNKITSYMVLTNLFFDEKYAFTQSLKVNWNKYFENNNNHSLVLESHGVSCKLHSSLYDEQINLDDIIGAPETNQKDNEIIMENHSIFDYAKCSQSIILSGKTVKELPAELFVKFINLCSLELRNMFQLKCLPRTIYSLKGLQRLIINQVKINTLPDIYEFPNLKYLQIEKCPIKTYNDSNECLKLETLKLLALPLQTISNFICLQENLVVVELQLHGIESLPDEFGRLENMKELKLIGSPLYYELLKNDFIIKSDNLEFEYPEIGFYKVKENDKNPISFLPVADIFINVPRIGSGYSEPVDVNSHGGFPMAILQLKKLITLVIQHQSIRYVPDSIQQLENLEILDLSYNPLLEKVSAQISSIISIKQLILVHCPSISVPPPEIIARGTSLSYLKYLLAKTVVCNRTKLMFVGLGEAGKTSLLHALRSDENSAKEIIEQQEKQVTDGIDITKWTVICHNEEIQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIEHGDLDFWLSSISCHSKYAPVFVVGTRCDQVQADMSCFSSLKKRYSQIEDFILVDSLSGTGIKDLKQKLIHVTLNLPYMHQAIPSTILDLENQFTSIRSQKNYITYQEFQNIAISQGIFEKDVKSVIQILHDFGSIQYFDTEILKNYVVINPQWIVDIMANVVSVVNQKIKNGIFYHENMKDVWDKFESKLFNWMLNLTEEFDLTFPHPTMEPKANIVPCLLSEEEPEIEWPKFSEQTLCKFYHINYKFEFLPAGLFNRIQVRLFDFTEAKKLWKYGMYFEKNGHHVLFMRENKSSLIVRAIGVRPVNVLALVDDVIKGLVKASFHGVRYNLEISCPDCIEYGNNISNDATKYWSNISMIPSKLIKKALIKKVEYLQCEELHLNSIKSIKENTPETASAEEFINDLISKVQTVKSLYASSDKLVTFLHSTKDLTDLSAMPMKEFDNLFSDCNIVCIKINETSEVKWKTSISNCQLCLICLSENFIQIPKMNEMLEYIKLLKKKFILLILSSDKEIRQKWEYYPYFMTVFIKINATHPKASTEKILEIKKAIQDSIVSSTVNETAGETYDCFVSYCWANSQDAVNKGTKAIPGAIISPDADPRKLARYLIDNGIKCWIDDSHMDKTSGLNSQLSLNLRNSKMMLAFVSDEYDKSDNCKMELNFMVEELRRPVSYVLVGSNMEWRFNSEVGLIMQKRHRSEILDFTNNNNISESRLLEELKVRLRNCPDIAYEKNDQNKIQGHNTALMEQLELISRQILNQLISFITDNCPRLIVIDVDPDDGTDSQIDNDIIMDSTLQSSLRASVSGNKLALKVICEGETNWHIADEAYPLSIEDKDEIIEKCAVYLYMIYQVFEYKNPGLRCLQPDNISNMEFITKITQIAGSSTMTFKESYSNMVKYYMKYDPKLVNCSLERYRLPSGREFWMCKKHADQNPRCKLIERDRAAIDTFAIPIDNYDTSLLGDIKSKISSDTLQHNDSFHSIVQRFKTTDAASNRTTKHDLILPKKKLFFRSDTILNLEKDIVTNKKDTYDIPIRISSEVNARNVYNQIPSKPVNRRLSAMNRPNLVGSRICTIQ 3259          
BLAST of Roc domain-containing protein vs. Planmine SMEST
Match: SMESG000066553.1 (SMESG000066553.1)

HSP 1 Score: 524.242 bits (1349), Expect = 1.617e-149
Identity = 365/1174 (31.09%), Postives = 598/1174 (50.94%), Query Frame = 3
Query: 4659 FPMAILQLKKLITLVIQHQSIRYVPDSIQQLENLE--ILDLSYNPLLEXXXXXXXXXXXXXXXXXXHCPSISVPPPEIIARGTS--LSYLKYLLAKTVVCNRTKLMFVGLGEAGKTSLLHALRSDENSAKEIIEQQEKQVTDGIDITKWTVICHNEEIQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIEHGDLDFWLSSISCHSKYAPVFVVGTRCDQVQADMSCFSSLKKRYSQIEDFILVDSLSGTGIKDLKQKLIHVTLNLPYMHQAIPSTILDLENQFTSIRSQKNYITYQEFQNIAISQGIFEKDVKSVIQILHDFGSIQYFDTEILKNYVVINPQWIVDIMANVVSVVNQKIKNGIFYHENMKDVWDKFESKLFNWMLNLTEEFDLTFPHPTMEPKANIVPCLLSEEEPEIEWPKFSEQTLCKFYHINYKFEFLPAGLFNRIQVRLFDFTEAKKLWKYGMYFEKNGHHVLFMRENKSSLIVRAIGVRPVNVLAMVDDVIKGLVKASFHGVRYNLEISCPDCIEYGNNISNDATKYWSNISMIPSKLIKKALIKKVEYLQCEE-LHLNSIKSIKENTPE-----------------TASAEEFINDLI-----SKVQTVKSLYASSDKLVTFLHSTKDLTDLSAMPMKEFDNLFSDCNIVCIKINETSEVKWKTSISNCQLCLICLSENFIQIPKMNEMLEYXXXXXXXXXXXXXSSDKEIRQKWEYYPYFMTVFIKINATHPKASTEKILEIKKAIQDSIVSSTVNETAGETYDCFVSYCWANSQDAVNKGTKAIPGAIISPDADPRKLARYLIDNGIKCWIDDSHMDKTXXXXXXXXXXXXXXKMMLAFVSDEYDKSDNCKMELNFMVEELRRPVSYVLVGSNMEWRFNSEVGLIMQKRHRSEILDFTNNNNISESRLLEELKVRLRNCPDIAYE-KNDQNKIQGHNTALMEQLELISRQILNQLISFITDN----CPRLIVIDVDPDDGTDSQIDNDIIMDST--LQSSLRASVSGN-KLVLKVICEGETNWHIADEAYP--LSIEDKDEIIEKCAVYLYMIYQVFEYKNP-GLRCLQPD-NISNMEFITKITQIAGSSTMTFKESYSNMVKYYMKYDPKIANCSLERYRLPSGREFWMCKKHADQNPRCKLIERDRAA 8063
            FP+ IL    L TL+  +Q    VPD IQ L+NL+  ++D   N  +    +     + ++ L   +C ++  PP EI  +G    ++YL  L++ +  C RTKLM VGLG AGKTSL+ AL +    A +I E+    +TDGIDI  W+       +QYS WDFAGQ +YYNTHQFFL+ +AIY+++W+VRQG EH  LDFWL+S++CH+  AP+F+VGT  D+V       +  + RY  +  F  V SL+G G+K+L  K+I  T   PY+ + +P+  L  E +  S RS  +Y+ ++  + +A +  I++ ++   I+ LHD GSIQYF+  +LK++V+IN QW+VD+MA VVSV N  I+NG   H  +K VW K+   +  W+L LTE FDLTF  P  E   N +PCLL  ++PE  WP+F +    +  ++ Y+FE+LP GLFNR QVRL  F+++  +W+ G    KN    L  + N ++L V A G  P N+L +V ++ + L+  +F GV+Y  +ISC  CI        +   +  N S     ++++A   K  ++QC    H+ ++  I+E+TP                  +A+ E+  + ++     S  Q   SL  +S +LV  LH  K+  ++   P+ E      D  I  +  +E        + +N +LC+     + I + K   +    K      + L  + DK I             F ++N    K S E + +++  + +    +TV          F+SYCW NSQ A + G   +         DPR +  Y+   G+ CW+D   +  +  + S ++  LRNS++M+A +S EY +SD CK E  F  + L  P+    VG + EW   +E+GL+  +  +   + F  +N  +   + + +  ++   P +A   + + N ++ +  A  E  ELI R+I   L S I        PRL  ID+  D+  ++ I ND +M +       L +S + N  L  K++CE E+ WH  D+  P  LS  + + ++   + YLY I  + ++     +R    + N    +++ ++ +    S    K  ++ +  + M  D  +    L+   L +G+  W+C +H++  P   +IE + + 
Sbjct: 1691 FPVEILHCTNLQTLIFSNQGFSIVPDEIQSLKNLKKFVIDGCANLQI---LSSYVGTLPLEVLSCQNCDNLKTPPYEIRRQGMRNMIAYLLRLVSGSETCYRTKLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEA---ITDGIDINSWSTKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFEHAGLDFWLNSVTCHAPSAPIFIVGTHSDKVDKSEIPTTHFQSRYPSVVGFFFVSSLTGKGVKELHDKIIEETKGQPYIGELVPNAWLRFEKELISQRSSADYLNWEAVKKLANNNAIYDGEINQAIRFLHDLGSIQYFEFPLLKDFVIINSQWLVDVMACVVSVKNSIIENGKLEHSKIKLVWSKYPESIHKWLLRLTEIFDLTFSVPGQE--FNFIPCLLPNKQPEFSWPEFVDFNQTREANMFYQFEYLPPGLFNRAQVRLSQFSDSFIIWQNGSLLNKNDDKALLTKLNDTTLRVCARGFWPENILFIVHEMFETLISEAFSGVKYEYQISCKKCIA-----EREPEPFVFNKS-----ILQRATQSKTIFIQCHRNFHIITMTEIQESTPPDSIEDYDLQFKKSVHFISANREQHNHSIMILVSESDYQNDSSLLNTSKRLVKDLH--KNQYNVWCEPLIE--GTPEDKYIDMLTRSEAVISVISGNFTNNRLCMNLFKLSKITLRKNIILARIDKNYTDGALGLETAGDKYIN------------FERVNVYDQKFS-ELLHDLRTQLDEPDSKTTVVPKP----RVFISYCWDNSQRAFDSGNSKVLNKNAIGWGDPRDIKDYIEQKGLSCWLDVEMIGLS--VYSDITSGLRNSEIMVACLSTEYAQSDACKKEFMFARQNLNLPIVIAEVGCSQEW-IKTEIGLLSIEYPK---IQFQTSNPSAFEDIFQLVSNKI---PSVAPNGETESNLVKMNKIASQEDFELIQRKIFRLLSSGIGSEESRLYPRLFFIDIK-DEIEETTIINDDLMSTNPLFNGHLLSSNTPNMSLCFKILCESESGWHTVDDGIPINLSHSELERLLILGSPYLYRITLLLKFSGGENIRLFNSEINQEITKYVMELLEANSKSWSYMKPIHNALRTHIMSRDINLRYGGLQSCCLNNGKVVWLCNEHSNL-PYISVIESEESG 2814          
BLAST of Roc domain-containing protein vs. Planmine SMEST
Match: SMESG000066553.1 (SMESG000066553.1)

HSP 1 Score: 524.242 bits (1349), Expect = 2.039e-149
Identity = 365/1174 (31.09%), Postives = 598/1174 (50.94%), Query Frame = 3
Query: 4659 FPMAILQLKKLITLVIQHQSIRYVPDSIQQLENLE--ILDLSYNPLLEXXXXXXXXXXXXXXXXXXHCPSISVPPPEIIARGTS--LSYLKYLLAKTVVCNRTKLMFVGLGEAGKTSLLHALRSDENSAKEIIEQQEKQVTDGIDITKWTVICHNEEIQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIEHGDLDFWLSSISCHSKYAPVFVVGTRCDQVQADMSCFSSLKKRYSQIEDFILVDSLSGTGIKDLKQKLIHVTLNLPYMHQAIPSTILDLENQFTSIRSQKNYITYQEFQNIAISQGIFEKDVKSVIQILHDFGSIQYFDTEILKNYVVINPQWIVDIMANVVSVVNQKIKNGIFYHENMKDVWDKFESKLFNWMLNLTEEFDLTFPHPTMEPKANIVPCLLSEEEPEIEWPKFSEQTLCKFYHINYKFEFLPAGLFNRIQVRLFDFTEAKKLWKYGMYFEKNGHHVLFMRENKSSLIVRAIGVRPVNVLAMVDDVIKGLVKASFHGVRYNLEISCPDCIEYGNNISNDATKYWSNISMIPSKLIKKALIKKVEYLQCEE-LHLNSIKSIKENTPE-----------------TASAEEFINDLI-----SKVQTVKSLYASSDKLVTFLHSTKDLTDLSAMPMKEFDNLFSDCNIVCIKINETSEVKWKTSISNCQLCLICLSENFIQIPKMNEMLEYXXXXXXXXXXXXXSSDKEIRQKWEYYPYFMTVFIKINATHPKASTEKILEIKKAIQDSIVSSTVNETAGETYDCFVSYCWANSQDAVNKGTKAIPGAIISPDADPRKLARYLIDNGIKCWIDDSHMDKTXXXXXXXXXXXXXXKMMLAFVSDEYDKSDNCKMELNFMVEELRRPVSYVLVGSNMEWRFNSEVGLIMQKRHRSEILDFTNNNNISESRLLEELKVRLRNCPDIAYE-KNDQNKIQGHNTALMEQLELISRQILNQLISFITDN----CPRLIVIDVDPDDGTDSQIDNDIIMDST--LQSSLRASVSGN-KLVLKVICEGETNWHIADEAYP--LSIEDKDEIIEKCAVYLYMIYQVFEYKNP-GLRCLQPD-NISNMEFITKITQIAGSSTMTFKESYSNMVKYYMKYDPKIANCSLERYRLPSGREFWMCKKHADQNPRCKLIERDRAA 8063
            FP+ IL    L TL+  +Q    VPD IQ L+NL+  ++D   N  +    +     + ++ L   +C ++  PP EI  +G    ++YL  L++ +  C RTKLM VGLG AGKTSL+ AL +    A +I E+    +TDGIDI  W+       +QYS WDFAGQ +YYNTHQFFL+ +AIY+++W+VRQG EH  LDFWL+S++CH+  AP+F+VGT  D+V       +  + RY  +  F  V SL+G G+K+L  K+I  T   PY+ + +P+  L  E +  S RS  +Y+ ++  + +A +  I++ ++   I+ LHD GSIQYF+  +LK++V+IN QW+VD+MA VVSV N  I+NG   H  +K VW K+   +  W+L LTE FDLTF  P  E   N +PCLL  ++PE  WP+F +    +  ++ Y+FE+LP GLFNR QVRL  F+++  +W+ G    KN    L  + N ++L V A G  P N+L +V ++ + L+  +F GV+Y  +ISC  CI        +   +  N S     ++++A   K  ++QC    H+ ++  I+E+TP                  +A+ E+  + ++     S  Q   SL  +S +LV  LH  K+  ++   P+ E      D  I  +  +E        + +N +LC+     + I + K   +    K      + L  + DK I             F ++N    K S E + +++  + +    +TV          F+SYCW NSQ A + G   +         DPR +  Y+   G+ CW+D   +  +  + S ++  LRNS++M+A +S EY +SD CK E  F  + L  P+    VG + EW   +E+GL+  +  +   + F  +N  +   + + +  ++   P +A   + + N ++ +  A  E  ELI R+I   L S I        PRL  ID+  D+  ++ I ND +M +       L +S + N  L  K++CE E+ WH  D+  P  LS  + + ++   + YLY I  + ++     +R    + N    +++ ++ +    S    K  ++ +  + M  D  +    L+   L +G+  W+C +H++  P   +IE + + 
Sbjct: 1697 FPVEILHCTNLQTLIFSNQGFSIVPDEIQSLKNLKKFVIDGCANLQI---LSSYVGTLPLEVLSCQNCDNLKTPPYEIRRQGMRNMIAYLLRLVSGSETCYRTKLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEA---ITDGIDINSWSTKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFEHAGLDFWLNSVTCHAPSAPIFIVGTHSDKVDKSEIPTTHFQSRYPSVVGFFFVSSLTGKGVKELHDKIIEETKGQPYIGELVPNAWLRFEKELISQRSSADYLNWEAVKKLANNNAIYDGEINQAIRFLHDLGSIQYFEFPLLKDFVIINSQWLVDVMACVVSVKNSIIENGKLEHSKIKLVWSKYPESIHKWLLRLTEIFDLTFSVPGQE--FNFIPCLLPNKQPEFSWPEFVDFNQTREANMFYQFEYLPPGLFNRAQVRLSQFSDSFIIWQNGSLLNKNDDKALLTKLNDTTLRVCARGFWPENILFIVHEMFETLISEAFSGVKYEYQISCKKCIA-----EREPEPFVFNKS-----ILQRATQSKTIFIQCHRNFHIITMTEIQESTPPDSIEDYDLQFKKSVHFISANREQHNHSIMILVSESDYQNDSSLLNTSKRLVKDLH--KNQYNVWCEPLIE--GTPEDKYIDMLTRSEAVISVISGNFTNNRLCMNLFKLSKITLRKNIILARIDKNYTDGALGLETAGDKYIN------------FERVNVYDQKFS-ELLHDLRTQLDEPDSKTTVVPKP----RVFISYCWDNSQRAFDSGNSKVLNKNAIGWGDPRDIKDYIEQKGLSCWLDVEMIGLS--VYSDITSGLRNSEIMVACLSTEYAQSDACKKEFMFARQNLNLPIVIAEVGCSQEW-IKTEIGLLSIEYPK---IQFQTSNPSAFEDIFQLVSNKI---PSVAPNGETESNLVKMNKIASQEDFELIQRKIFRLLSSGIGSEESRLYPRLFFIDIK-DEIEETTIINDDLMSTNPLFNGHLLSSNTPNMSLCFKILCESESGWHTVDDGIPINLSHSELERLLILGSPYLYRITLLLKFSGGENIRLFNSEINQEITKYVMELLEANSKSWSYMKPIHNALRTHIMSRDINLRYGGLQSCCLNNGKVVWLCNEHSNL-PYISVIESEESG 2820          
BLAST of Roc domain-containing protein vs. Planmine SMEST
Match: SMESG000056130.1 (SMESG000056130.1)

HSP 1 Score: 114.775 bits (286), Expect = 1.146e-24
Identity = 140/585 (23.93%), Postives = 264/585 (45.13%), Query Frame = 3
Query: 4719 IRYVPDSIQQLENLEILDLSYNPLLEXXXXXXXXXXXXXXXXXXHCPSISVPPPEIIARGTSLS-YLKYL---LAKTVVCNRTKLMFVGLGEAGKTSLLHALRSDENSAKEIIEQQEKQVTDGIDITKWTVICHNEE----IQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIEH-GDLDFWLSSISCHSKYAPVFVVGTRCDQVQAD---MSCF---SSLKK-----RYSQIEDFILVDSLS-GTGIKDLKQKLI-----HVTLNLPYMHQAIPSTILDLENQF----TSIRSQKNYITYQEFQNIAISQ--GIFEKDVKSVIQILHDFGSIQYFD--TEILKNYVVINPQWIVDIMANVVSV--VNQKIKNG-IFYHENMKDVWDKFESK---------LFNWMLNLTEEFDLTFPHPTMEPKANIVPCLLSEEEPEIEWPKFSEQTLCKFYHINYKFEFLPAGLFNRIQVR----------LFDFTEAK-KLWKYGMYFEKNGHHVLFMRENKS----------SLIVRAIGVR-PVNVLAMVDDVIK----GLVKASFHGVR-YNLEISCPDCIE 6254
            ++ +   I  L +L +LD+S+NP L+ +  +I  +       LV    +++  P+ I++   L   LKY    L  +V  N  +L+ +GL   GKTS+L+ L+  +      ++ +    +  I+++ W V     E     + + WD +GQD ++  H+ FLS++A Y++V+ + +  E    L   L ++ C + +APVF+VGT  D+++ +     C    S++ K      + +I   + VD+ +    I +LK K++     H   N   + +  PS+ L LE  F     ++      +T +E +++ +     + ++++K  +Q LH+ G I +F+   E L N   + PQWI  I+   +++  ++  I+NG I  ++ +    D F SK         L    L + E +D+ F +   E    I+P  L  + P       +   + +     + F FLP G + R+  R          LFD  + + KLW+ G+         L +   K           S+    +G++  V ++  +D +++    GL     HG R  N  + C +C E
Sbjct: 1330 LKRISSEIGNLSSLTLLDISHNPNLKSLPDEIGLLKGKNLNSLVR-DGLNLNIPKHISKNAQLREILKYYYDRLKHSVEYNGLRLVVLGLKGRGKTSVLNLLQGSK------LKPKNNNKSSEIEVSIWKVQSKLSEKAVDYKLTCWDISGQDEFFCNHECFLSQRAFYLLVFDITKETEEIHKLKPLLWNLKCQAPHAPVFIVGTHLDKMKENNRKTQCRHMESNILKLCSTPGFPKISKIVFVDATNFNQTITNLKNKILTVLNDHTIQNDHLLFEKQPSSYLKLEELFQEALKTLPENCPILTEKEVKDLVVKHKLDLNDEELKLAVQFLHNCGVIVHFNDTMENLNNLYFLKPQWICSIIIKTITMNRLDTFIQNGSISLNDFLSLFKDHFFSKETENFKKETLVKQCLKVLELYDVVFRNSNNEI---IIPSKLPIQAPTNLSENLNTSKISRI----FAFSFLPTGFWPRLIARISVLAKSFKHLFDICKLEFKLWRTGVIISMEDSIYLILEGKKDTEKNLEIIEISVTKSELGIKILVQIVDCIDVLVEEWYAGLTDDDLHGNRIMNCYVRCLECAE 1900          
The following BLAST results are available for this feature:
BLAST of Roc domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LRRK21.192e-2525.44leucine rich repeat kinase 2 [Source:HGNC Symbol;A... [more]
LRRK11.089e-1923.02leucine rich repeat kinase 1 [Source:HGNC Symbol;A... [more]
MFHAS17.194e-1721.92malignant fibrous histiocytoma amplified sequence ... [more]
MFHAS17.194e-1721.92malignant fibrous histiocytoma amplified sequence ... [more]
MFHAS19.921e-1721.92malignant fibrous histiocytoma amplified sequence ... [more]
back to top
BLAST of Roc domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
lrk-13.727e-2123.32Leucine-rich repeat serine/threonine-protein kinas... [more]
back to top
BLAST of Roc domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Lrrk2.790e-2021.93gene:FBgn0038816 transcript:FBtr0334640[more]
Lrrk2.819e-2021.93gene:FBgn0038816 transcript:FBtr0112788[more]
Lrrk2.836e-2021.93gene:FBgn0038816 transcript:FBtr0334641[more]
back to top
BLAST of Roc domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mfhas11.909e-1722.08malignant fibrous histiocytoma amplified sequence ... [more]
mfhas11.909e-1722.08malignant fibrous histiocytoma amplified sequence ... [more]
mfhas12.334e-1722.08malignant fibrous histiocytoma amplified sequence ... [more]
BX511222.11.219e-1621.72malignant fibrous histiocytoma amplified sequence ... [more]
spryd39.122e-1434.73SPRY domain containing 3 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Roc domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hes21.757e-3024.41hes family bHLH transcription factor 2 [Source:Xen... [more]
hes22.054e-3024.41hes family bHLH transcription factor 2 [Source:Xen... [more]
hes22.079e-3024.41hes family bHLH transcription factor 2 [Source:Xen... [more]
hes22.217e-3024.41hes family bHLH transcription factor 2 [Source:Xen... [more]
hes22.352e-3024.41hes family bHLH transcription factor 2 [Source:Xen... [more]
back to top
BLAST of Roc domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lrrk21.805e-2623.98leucine-rich repeat kinase 2 [Source:MGI Symbol;Ac... [more]
Lrrk15.910e-2023.31leucine-rich repeat kinase 1 [Source:MGI Symbol;Ac... [more]
Mfhas12.873e-1822.38malignant fibrous histiocytoma amplified sequence ... [more]
Mfhas13.707e-1822.20malignant fibrous histiocytoma amplified sequence ... [more]
Spryd32.334e-1435.48SPRY domain containing 3 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Roc domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q55E58|PATS1_DICDI4.846e-5829.52Probable serine/threonine-protein kinase pats1 OS=... [more]
sp|Q6XHB2|ROCO4_DICDI1.120e-4730.36Probable serine/threonine-protein kinase roco4 OS=... [more]
sp|Q8MVR1|GBPC_DICDI3.719e-3523.97Cyclic GMP-binding protein C OS=Dictyostelium disc... [more]
sp|Q1ZXD6|ROCO5_DICDI4.198e-3426.41Probable serine/threonine-protein kinase roco5 OS=... [more]
sp|Q54WS5|ROCO6_DICDI1.951e-2828.20Probable serine/threonine-protein kinase roco6 OS=... [more]
back to top
BLAST of Roc domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1QX072.566e-1931.74Putative serine/threonine-protein kinase pats1 OS=... [more]
A0A2R2MQS50.000e+032.86uncharacterized protein LOC106160503 OS=Lingula un... [more]
A0A2T7PMT60.000e+033.66Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A1I8GAN00.000e+032.21Roc domain-containing protein OS=Macrostomum ligna... [more]
A0A267ECV51.806e-1232.21Roc domain-containing protein OS=Macrostomum ligna... [more]
back to top
BLAST of Roc domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrk22.090e-1421.93leucine-rich repeat kinase 2 [Source:ZFIN;Acc:ZDB-... [more]
spryd39.494e-1432.54SPRY domain containing 3 [Source:NCBI gene;Acc:103... [more]
spryd31.100e-1333.53SPRY domain containing 3 [Source:NCBI gene;Acc:103... [more]
spryd31.225e-1333.53SPRY domain containing 3 [Source:NCBI gene;Acc:103... [more]
mfhas15.804e-1322.37malignant fibrous histiocytoma amplified sequence ... [more]
back to top
BLAST of Roc domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000004441.15.983e-1130.20pep scaffold:Pmarinus_7.0:GL477554:92318:114375:1 ... [more]
back to top
BLAST of Roc domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Roc domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO319718.191e-3526.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO300913.692e-1623.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470696.592e-1124.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO274652.403e-1020.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Roc domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrk24.074e-1923.80leucine rich repeat kinase 2 [Source:NCBI gene;Acc... [more]
mfhas11.131e-1721.98malignant fibrous histiocytoma amplified sequence ... [more]
SPRYD34.105e-1538.00SPRY domain-containing protein 3 [Source:NCBI gene... [more]
SPRYD31.132e-1438.00SPRY domain-containing protein 3 [Source:NCBI gene... [more]
spryd32.199e-1033.13SPRY domain-containing protein 3 [Source:NCBI gene... [more]
back to top
BLAST of Roc domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000073246.10.000e+099.82SMESG000073246.1[more]
SMESG000073246.10.000e+098.79SMESG000073246.1[more]
SMESG000066553.11.617e-14931.09SMESG000066553.1[more]
SMESG000066553.12.039e-14931.09SMESG000066553.1[more]
SMESG000056130.11.146e-2423.93SMESG000056130.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005007 ID=SMED30005007|Name=Roc domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=8614bp
CTCTTCCGATCTCTTAGATTCAATTTTCATCTAAAGAAATGGAAGTAGAA
ACAGCAGAATCTTCAAATTTAATGAAATTTATAGTGCTATGCTATGGCGC
CAACTGCCAAAAGGTTTACGATGATATTATACAACTTGATTGGAGCCTTA
AATTAAAGGGTTTTGTTGACAATTTACAAGAATTGATCTCGAATATAAAA
GAAAAAAGTTCGGAACTGATTGACTTCAATGATTGTCTCAAATTAAGTGA
AGCTTATAGACAACTGGAGCAATTGAATGATTTCATAAAAGATTTTAAAG
AAAGAATTTCATTTTTTAAAACCGAAACGATAAATAAACAAGTAGTAAGT
GAACTTCTTTCGTGTATTGAAAACAACATTGAAAAAGAGATGGCAATATG
TCCATTCAGGTACACATCGAATGTGCTTGATGCCATTGGTCAAAAAATAA
TACAATCTGGTAAAAATTATGTTACAATGGAATTTTTAAATCGCGTTAAC
GTTGCAAAAAGCACAAAAGTGTCCACTGAAATATTTGAAAAATTATTCGC
AGAGGGGCGAGGATTCTATATAAAAAAGTTTCAATTTTTTATTTTAAACA
TAAAATGGTTCGACTCAATTCTGGCGGATATAATTTCCAAAATGCCAAAT
GAGTCGAATTACAGAGTTCACGGAGTTCACAGAAATTGCAAAGTCTGGGA
TTACAAAAATTTAATTGAATTGTTTAGTCGGTTCCAAATTGAACCGAAAG
ATAATTCCATGTGGATTGAATTTATTATGGATTTGGGAATTCTGATCAAA
TTGCCTTGTATAAGGAAATCAATAAATGATGAATTTTATTTATTTGTAAA
TCCTATGGCAGAAGGCACTGGAAAAAAATTACACTTGGATTATATTAAAA
GTGTTGCTGAGCTTATTTCTCATAAATTCGAAGTAAAAGTCAAATATAAA
AAGGTTTTCCAAGATCTCTATTCCATTTATCCGCAATTTTTGTCTAAAAT
CGTTTCGATTGGTCAATTGCAATTAATTTCGCCTGTTGCTACAGTGATTC
ACATCAGCGGAGGCATTGAGTTGTTGATAGAATCAGAACTGGACTGCATC
TCAATGACAATATACTTTAAACCACCGGAAATGAGCCAACCTTCCAGTAA
ATTTAATATGAATATCATGGATTACATAAGGAGTGTTATGCACTTGGGCA
CAGATTCCTTCGAGGCTATATTGTCTCAACAAAACATATTATCGAATAAA
ATTTCTAGTATTCCGAAAGAATCATTAAAAAATTATTCGGTTTGTTATAA
TCATAAGTGGGTGAATGATGTGGAATTTAATAATATATGTTCGTTGTGTG
GTAACTGCTCAAGTGTGGATGGTATTGAATGTCCATATAATAGAATTATT
AGCCAACGTAAAGGGGTTTGTTTATGTTTGAAGCAAAGTAGGATATGTGG
CTCTTGTGGTATTTGCCAATCATGCGCTGCAAATCATTGGAAAAATCATT
GTGAGAGTGACCCAAACCGACTGATCATTTGCAACGCCAACTATGTCAAC
GTTCCGACGAGACCTATAAGCCAATTTATGGGTTCAAAATTTACAGTTGA
TATTTATCAAGAAAATTCCAATACTTTTGCCGGTTTATTGATAAATGACA
CAGATATCATGGTTGACATTTTTGGAATAACCAATTCGTGTAAAAACGGT
GCGGCAATATTCGCTGACAACCTAAACAACATCCCATCACCATTGCCTAT
ATCCGTATTATCCTTTGAGATTTCTGAATCATATTTCTATAAGTCAGACT
TGTACCAGTTCTCAAAATGCTCTGGAATCAATGTTTTACAAGAGCTAGGG
ATATTGACTTATAATAATGAAACAGAAGTCAGTTTAGTTGTTGGAAAGTT
TCCAGTGTCGCCGGATAGAAGACGATTTTCGATGGAAATTTTAAATCCCG
GTGCAAGCGGTAGAATCACAATTGGATTGGTTCCTGCGAACTATTCTGTC
ATCCAGCCTGGCTGGCGAGAAAATTCTTTAGCATATCATGGTGATGATGG
CGGAATTTTTCTTGGAGAAAGTGTTCCTCAAATAATCAGGGAGACTTTTT
CGGAAGTCAACAATTGTATCGAAGTTATTATTGAATATGAAAGTTCCCTA
GATTCACCCGAATTGGTCCGACATATAACGTGGAGAAAAAATGGGAAATT
CGTGGAAAAGATTTTAATACAACACGACAAAGAGTTATATCCCGCAATTG
GGATGCATTCCATCAACGAACAAGTACGACTGTTGGATTTTGAAGTGTGG
GCAGACACAGAATGCTCTTCAAATGTTGAAAATAATATCAAAATAGAAAA
TACAGTTACTGTTAGTCCAGAAAGTATCATATACTTAGAAGCTAATGAAG
GCTTTTCGGGAATATTCTACATAATTCCAAAAACGGACTTGATGAAATCA
TTAGAATTTAAGATTTTCCACAAATATGACGGCACTGAGACGGTTGGCTG
GATGCTGGAAAGCCATAACAAATTATTAAATTCAAATAAAACTCCAGGAA
AATGGCTTTTTGATATTTTTTCTAATTCAAACATTGAATTCTTCACGTTT
GGTTTGAAAACTTCAATAACTACAAATATTCACGATTGGATGCTCAAGCT
AACAGTGTTAACAACTACGGACAAAAGTAAAACTTTCCAGTGGCAGCTTA
GTAGTTGTGATTGGTTAGTGATGTCGAATGAAAACGTTTTCTCCATTAAA
GAAGTTCCTGATCAACACACTGTAGCAGCAAAACCGTCACTATTGCTCAC
GACAACTCTAAACTCATCAGTAGACCTTGAAAAACCAGATCTAAGAAAGA
CCAATACGAGTGGACAAATAAGATATTACCATATTCCAATAGCGGATTAT
AAATTATTCTTCAGAGCCGACAAACAAAACGCATGGATCCGATGTTCAAA
TTATATGAAACCGAATTTTACACGTTCTTTTCAAATTGGTAATTTAATCG
CACTCGATAAAATCCCAGCTCTGATATTACAAGTCAATAAGTCAAAGGAG
CAATTAAAATTATCCGGCAAAGATGAACTCATAAACTTCAACGATTCTCG
ATTGAAGCCAATTATGCAATCAGGAAAGCCATTGTTATCCTTAAAGCTTT
CCAAGAATCGAAAATATAATCAGTTCTCTATTACAAATAAAGGATTACTA
AGTGTTCCTACCCCATCCAGACCGTGGTTGTTTGCATTCAATTGGGAAAA
CGACAATACCTTTCCAATTGATGAGTTATATTTTTCTACTGATTGTAGCG
AATATCACGGAATGAATATTTGCCTTTTGAATTCAATTTCAACAGTTGAG
GAGGAAGTTCCTCCCAACGATAAGCTCGATAATATTGTTACTTTGCCTTT
TAATCAAAATGAAAAGGAAATGGAAAATTTCTTATGGGAACACAGTATGC
TTCATTTAATATCATGGGATAAACTTTTATTCTATCCATTTTGTCCTGGG
AAATCCACTATTTATGATTCTAAACCACATCTTGTCAATACTGAAGGAAT
CGAACTGTTTGAAGTAAATTCAAGCCCCTCTGAAATTTGTAAGGCAGTCT
TTTTCAATCCGAAACTCCTTCTATGTCATAAGTTAATTTTAAATTACAAA
TTTTTGCTACCGAAATATAATAGAATTCTACGAAAGGAGATAACAGATTT
TTCACAAGACGAAATCGAATATCTAATATTTTCGATTTTAAATAAAATTA
CAAGTTACATGGTGCTTACTAATTTATTTTTCGATGAAAAATATGCATTT
ACGCAATCTCTGAAGGTGAATTGGAATAAATATTTTGAGAATAATAATAA
TCATTCATTGGTTCTCGAATCTCATGGCGTTTCTTGTAAACTACATTCTA
GCTTATACGATGAACAAATTAATCTTGATGATATCATTGGGGCCCCTGAA
ACAAACCAAAAAGACAATGAAATTATTATGGAAAATCATTCGATTTTTGA
TTATGCTAAATGTTCACAATCAATTATCCTTTCTGGAAAGACTGTCAAAG
AACTTCCTGCCGAATTATTTGTTAAATTTATCAATCTCTGTTCGCTGGAG
TTACGAAACATGTTTCAGTTGAAATGTTTACCGAGAACAATATACAGCCT
AAAGGGCTTACAAAGACTCATAATAAATCAAGTAAAAATAAATACTTTAC
CAGATATCTATGAGTTTCCTAATTTGAAATATCTACAAATCGAGAAATGC
CCCATCAAAACATACAATGACAGCAATGAATGTCTTAAATTAGAAACATT
AAAATTATTGGCTCTTCCACTTCAAACAATTTCTAATTTTATTTGTCTTC
AAGAAAACCTGGTAGTTGTTGAACTTCAACTTCACGGAATTGAAAGTCTT
CCGGATGAGTTTGGCAGATTGGAAAACATGAAAGAACTGAAGCTTATTGG
AAGCCCTCTTTATTATGAATTATTAAAAAATGATTTTATTATCAAAAGTG
ACAACTTGGAATTTGAATATCCAGAAATAGGATTTTACAAAGTAAAAGAA
AATGATAAAAATCCCATTAGCTTTTTACCAGTTGCTGATATTTTTATTAA
TGTCCCAAGAATTGGATCTGGTTATTCAGAACCAGTCGATGTTAACTCTC
ATGGAGGCTTTCCCATGGCAATATTGCAATTGAAAAAATTAATTACTCTC
GTCATTCAGCATCAAAGCATCAGGTATGTTCCGGATTCAATACAGCAGCT
TGAAAACCTAGAAATCCTCGATCTCTCCTATAATCCTTTATTAGAAAAGG
TTTCCGCTCAGATAAGCTCAATTATATCTATTAAACAATTGATTCTTGTT
CATTGTCCCTCAATTTCAGTTCCTCCGCCAGAGATTATTGCTCGTGGAAC
TTCACTATCATACTTGAAGTATTTACTTGCTAAAACTGTCGTATGTAATC
GCACTAAACTCATGTTCGTGGGTCTTGGAGAAGCTGGAAAAACAAGTCTT
CTTCATGCGCTTAGATCCGATGAGAATTCAGCAAAGGAAATTATTGAACA
GCAAGAAAAACAAGTAACTGACGGAATAGATATAACAAAATGGACAGTTA
TTTGCCACAATGAAGAAATCCAGTATTCTGCTTGGGACTTTGCTGGACAA
GATGTGTATTATAATACCCATCAATTCTTTCTTTCTGAAAAAGCTATTTA
TATCGTTGTTTGGTCTGTTCGACAAGGAATCGAACATGGAGATTTGGATT
TCTGGTTATCCTCGATAAGTTGCCATAGTAAATACGCACCCGTTTTTGTC
GTAGGAACCAGATGTGATCAGGTTCAAGCTGATATGAGCTGTTTTAGCAG
CCTCAAAAAGAGATATTCACAAATCGAAGACTTTATTCTGGTTGATTCTT
TAAGTGGAACGGGAATTAAAGATTTAAAACAAAAACTGATTCACGTGACA
TTAAATCTCCCCTACATGCACCAGGCAATTCCTTCTACAATTTTAGATTT
AGAAAACCAGTTCACAAGCATCAGAAGTCAAAAGAATTACATCACTTACC
AAGAATTTCAAAACATCGCAATTTCTCAAGGGATATTCGAAAAAGATGTG
AAAAGTGTAATACAAATTCTCCATGATTTTGGTAGCATTCAATATTTTGA
TACGGAAATTTTGAAAAATTACGTCGTAATAAATCCCCAATGGATCGTGG
ATATTATGGCTAATGTGGTTTCAGTAGTCAATCAAAAAATAAAAAATGGA
ATTTTCTATCATGAAAATATGAAAGATGTTTGGGATAAATTTGAAAGTAA
ACTTTTTAATTGGATGCTTAATTTAACGGAAGAATTTGATCTTACATTTC
CTCATCCAACAATGGAACCTAAAGCTAATATAGTTCCGTGTCTATTATCA
GAAGAAGAACCAGAAATCGAGTGGCCCAAATTTTCCGAACAAACTTTGTG
CAAATTTTATCACATCAATTATAAGTTTGAGTTTTTACCCGCTGGACTAT
TTAATAGAATTCAAGTGCGACTATTTGATTTTACAGAGGCGAAAAAGCTT
TGGAAATATGGAATGTATTTTGAAAAAAACGGACATCATGTTTTGTTTAT
GAGAGAAAATAAAAGTAGTCTAATTGTAAGAGCGATCGGAGTCCGTCCAG
TGAATGTGTTAGCAATGGTTGATGATGTGATTAAAGGCTTGGTTAAGGCT
TCATTTCACGGAGTTCGCTATAATTTAGAAATATCTTGCCCGGATTGTAT
TGAATACGGTAACAATATATCAAATGATGCCACAAAATATTGGAGCAACA
TATCAATGATTCCGTCGAAATTAATTAAAAAAGCTTTAATAAAAAAAGTT
GAATATTTGCAATGTGAAGAATTGCATTTGAATTCAATCAAATCAATTAA
AGAAAATACACCTGAAACAGCCTCGGCTGAAGAATTTATCAATGATCTCA
TCTCAAAAGTCCAAACCGTTAAAAGCCTTTACGCTTCGTCAGATAAACTG
GTCACCTTCTTGCATTCAACGAAAGATCTTACCGATTTATCTGCAATGCC
AATGAAAGAATTTGATAATTTATTCAGTGATTGCAACATAGTTTGCATAA
AAATCAACGAAACGTCCGAAGTGAAATGGAAAACTTCAATTTCGAATTGC
CAATTGTGCTTGATATGCCTGTCAGAAAATTTTATTCAGATCCCCAAAAT
GAATGAAATGCTTGAATATATCAAATTATTGAAAAAGAAATTCATTTTGC
TAATTTTGAGTTCCGATAAAGAAATACGACAGAAATGGGAGTATTATCCA
TATTTTATGACGGTTTTTATTAAAATTAATGCCACACATCCTAAAGCTAG
CACAGAAAAAATACTAGAAATAAAAAAAGCTATTCAAGATTCTATAGTTT
CATCTACAGTAAATGAGACTGCTGGAGAAACATATGATTGTTTTGTTAGT
TACTGTTGGGCAAATTCGCAGGATGCAGTAAATAAGGGGACAAAAGCAAT
TCCTGGAGCTATTATTTCTCCTGACGCAGATCCTAGAAAATTAGCACGAT
ATTTAATAGATAATGGAATAAAATGTTGGATTGATGACAGCCATATGGAT
AAGACCTCTGGTCTCAATTCGCAATTATCACTCAATTTGCGTAACTCCAA
AATGATGCTGGCTTTTGTTTCCGATGAGTATGACAAGTCCGATAACTGCA
AAATGGAACTGAATTTTATGGTGGAGGAATTGCGAAGGCCTGTGAGTTAC
GTTCTTGTCGGGTCAAATATGGAATGGCGTTTCAACTCTGAAGTTGGACT
TATTATGCAAAAAAGACATAGATCAGAAATACTTGATTTCACCAATAATA
ATAATATTTCCGAATCTCGTTTGCTAGAGGAGTTGAAAGTTAGATTGAGA
AATTGCCCAGATATTGCTTATGAGAAAAATGATCAGAACAAGATTCAAGG
TCATAACACAGCCTTAATGGAACAGTTGGAACTAATATCAAGGCAAATTT
TAAATCAACTTATTTCATTTATCACTGATAATTGCCCCCGACTTATCGTA
ATTGACGTGGATCCTGACGATGGAACTGATTCACAAATTGATAATGATAT
CATAATGGATTCCACCCTTCAATCTTCATTGCGGGCGTCGGTTTCAGGTA
ATAAGTTAGTTCTAAAGGTGATCTGTGAAGGGGAAACTAATTGGCACATT
GCTGATGAGGCATACCCTTTATCAATTGAAGACAAGGATGAAATTATAGA
AAAATGTGCCGTTTACCTTTATATGATTTATCAAGTATTTGAATACAAAA
ATCCGGGACTGAGGTGTCTCCAACCGGATAACATCAGTAATATGGAATTT
ATTACCAAGATTACTCAAATTGCAGGATCATCAACCATGACCTTTAAAGA
ATCATATTCCAATATGGTCAAATATTACATGAAATATGACCCGAAAATTG
CTAATTGTTCCTTAGAACGATATCGTCTCCCAAGTGGAAGAGAATTTTGG
ATGTGCAAAAAGCATGCTGATCAAAATCCTCGATGCAAGTTGATTGAAAG
GGATCGTGCAGCGATTGATACCTTTGCAATACCAATCGATAATTACGATA
CTTCTCTACTGGGGGATATTAAATCTAAAATCAGTTCTGATACCTTACAA
CATAATGATTCATTTCACTCTATCGTTCAAAGATTTAAAACGACGGACGC
CGCAAGCAACAGAACAACAAAACATGATTTGATATTGCCAAAGAAAAAAT
TATTTTTCAGAAGCGACACAATTCTTAATCTAGAAAAAGATATCGTGACA
AATAAGAAAGATACCTATGATATCCCTATAAGAATTAGTTCAGAGGTCAA
CGCAAGAAATGTTTATAATCAAATACCTTCAAAGCCTGTCAACAGGAGAT
TGAGTGCGATGAATCGTCCTAATTTGGTGGGGTCCAGAATATGCACAATT
CAATAGATGGACAAAACCGAAACGATTAATTTAGCTTTTCCTCTGACAAT
CTTATTATTTCTTTTTTTTTACAATTACCCATAGATTATTGGAACTCTAA
CAGACTCTTATAATCATTTGAAGAAATTATGTTTTTTTAGAAATGATGAA
TAAAAATTTCCAAG
back to top

protein sequence of SMED30005007-orf-1

>SMED30005007-orf-1 ID=SMED30005007-orf-1|Name=SMED30005007-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2806bp
MEVETAESSNLMKFIVLCYGANCQKVYDDIIQLDWSLKLKGFVDNLQELI
SNIKEKSSELIDFNDCLKLSEAYRQLEQLNDFIKDFKERISFFKTETINK
QVVSELLSCIENNIEKEMAICPFRYTSNVLDAIGQKIIQSGKNYVTMEFL
NRVNVAKSTKVSTEIFEKLFAEGRGFYIKKFQFFILNIKWFDSILADIIS
KMPNESNYRVHGVHRNCKVWDYKNLIELFSRFQIEPKDNSMWIEFIMDLG
ILIKLPCIRKSINDEFYLFVNPMAEGTGKKLHLDYIKSVAELISHKFEVK
VKYKKVFQDLYSIYPQFLSKIVSIGQLQLISPVATVIHISGGIELLIESE
LDCISMTIYFKPPEMSQPSSKFNMNIMDYIRSVMHLGTDSFEAILSQQNI
LSNKISSIPKESLKNYSVCYNHKWVNDVEFNNICSLCGNCSSVDGIECPY
NRIISQRKGVCLCLKQSRICGSCGICQSCAANHWKNHCESDPNRLIICNA
NYVNVPTRPISQFMGSKFTVDIYQENSNTFAGLLINDTDIMVDIFGITNS
CKNGAAIFADNLNNIPSPLPISVLSFEISESYFYKSDLYQFSKCSGINVL
QELGILTYNNETEVSLVVGKFPVSPDRRRFSMEILNPGASGRITIGLVPA
NYSVIQPGWRENSLAYHGDDGGIFLGESVPQIIRETFSEVNNCIEVIIEY
ESSLDSPELVRHITWRKNGKFVEKILIQHDKELYPAIGMHSINEQVRLLD
FEVWADTECSSNVENNIKIENTVTVSPESIIYLEANEGFSGIFYIIPKTD
LMKSLEFKIFHKYDGTETVGWMLESHNKLLNSNKTPGKWLFDIFSNSNIE
FFTFGLKTSITTNIHDWMLKLTVLTTTDKSKTFQWQLSSCDWLVMSNENV
FSIKEVPDQHTVAAKPSLLLTTTLNSSVDLEKPDLRKTNTSGQIRYYHIP
IADYKLFFRADKQNAWIRCSNYMKPNFTRSFQIGNLIALDKIPALILQVN
KSKEQLKLSGKDELINFNDSRLKPIMQSGKPLLSLKLSKNRKYNQFSITN
KGLLSVPTPSRPWLFAFNWENDNTFPIDELYFSTDCSEYHGMNICLLNSI
STVEEEVPPNDKLDNIVTLPFNQNEKEMENFLWEHSMLHLISWDKLLFYP
FCPGKSTIYDSKPHLVNTEGIELFEVNSSPSEICKAVFFNPKLLLCHKLI
LNYKFLLPKYNRILRKEITDFSQDEIEYLIFSILNKITSYMVLTNLFFDE
KYAFTQSLKVNWNKYFENNNNHSLVLESHGVSCKLHSSLYDEQINLDDII
GAPETNQKDNEIIMENHSIFDYAKCSQSIILSGKTVKELPAELFVKFINL
CSLELRNMFQLKCLPRTIYSLKGLQRLIINQVKINTLPDIYEFPNLKYLQ
IEKCPIKTYNDSNECLKLETLKLLALPLQTISNFICLQENLVVVELQLHG
IESLPDEFGRLENMKELKLIGSPLYYELLKNDFIIKSDNLEFEYPEIGFY
KVKENDKNPISFLPVADIFINVPRIGSGYSEPVDVNSHGGFPMAILQLKK
LITLVIQHQSIRYVPDSIQQLENLEILDLSYNPLLEKVSAQISSIISIKQ
LILVHCPSISVPPPEIIARGTSLSYLKYLLAKTVVCNRTKLMFVGLGEAG
KTSLLHALRSDENSAKEIIEQQEKQVTDGIDITKWTVICHNEEIQYSAWD
FAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIEHGDLDFWLSSISCHSKYA
PVFVVGTRCDQVQADMSCFSSLKKRYSQIEDFILVDSLSGTGIKDLKQKL
IHVTLNLPYMHQAIPSTILDLENQFTSIRSQKNYITYQEFQNIAISQGIF
EKDVKSVIQILHDFGSIQYFDTEILKNYVVINPQWIVDIMANVVSVVNQK
IKNGIFYHENMKDVWDKFESKLFNWMLNLTEEFDLTFPHPTMEPKANIVP
CLLSEEEPEIEWPKFSEQTLCKFYHINYKFEFLPAGLFNRIQVRLFDFTE
AKKLWKYGMYFEKNGHHVLFMRENKSSLIVRAIGVRPVNVLAMVDDVIKG
LVKASFHGVRYNLEISCPDCIEYGNNISNDATKYWSNISMIPSKLIKKAL
IKKVEYLQCEELHLNSIKSIKENTPETASAEEFINDLISKVQTVKSLYAS
SDKLVTFLHSTKDLTDLSAMPMKEFDNLFSDCNIVCIKINETSEVKWKTS
ISNCQLCLICLSENFIQIPKMNEMLEYIKLLKKKFILLILSSDKEIRQKW
EYYPYFMTVFIKINATHPKASTEKILEIKKAIQDSIVSSTVNETAGETYD
CFVSYCWANSQDAVNKGTKAIPGAIISPDADPRKLARYLIDNGIKCWIDD
SHMDKTSGLNSQLSLNLRNSKMMLAFVSDEYDKSDNCKMELNFMVEELRR
PVSYVLVGSNMEWRFNSEVGLIMQKRHRSEILDFTNNNNISESRLLEELK
VRLRNCPDIAYEKNDQNKIQGHNTALMEQLELISRQILNQLISFITDNCP
RLIVIDVDPDDGTDSQIDNDIIMDSTLQSSLRASVSGNKLVLKVICEGET
NWHIADEAYPLSIEDKDEIIEKCAVYLYMIYQVFEYKNPGLRCLQPDNIS
NMEFITKITQIAGSSTMTFKESYSNMVKYYMKYDPKIANCSLERYRLPSG
REFWMCKKHADQNPRCKLIERDRAAIDTFAIPIDNYDTSLLGDIKSKISS
DTLQHNDSFHSIVQRFKTTDAASNRTTKHDLILPKKKLFFRSDTILNLEK
DIVTNKKDTYDIPIRISSEVNARNVYNQIPSKPVNRRLSAMNRPNLVGSR
ICTIQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR035897Toll_tir_struct_dom_sf
IPR043136B30.2/SPRY_sf
IPR039788NOL4/NOL4L
IPR032675LRR_dom_sf
IPR000157TIR_dom
IPR032171COR
IPR013684MIRO-like
IPR027417P-loop_NTPase
IPR020859ROC_dom
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0007264small GTPase mediated signal transduction
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005525GTP binding
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 71..91
NoneNo IPR availableCOILSCoilCoilcoord: 1657..1677
NoneNo IPR availablePFAMPF08477Roccoord: 1642..1763
e-value: 1.2E-20
score: 73.9
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1644..1817
e-value: 1.5E-53
score: 184.1
NoneNo IPR availableGENE3DG3DSA:1.10.10.2190coord: 1618..1873
e-value: 1.5E-53
score: 184.1
NoneNo IPR availablePANTHERPTHR12449:SF18coord: 1636..2027
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 1320..1628
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 1532..1608
e-value: 5.1E-7
score: 30.7
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 1303..1493
e-value: 5.9E-14
score: 53.3
IPR035897Toll/interleukin-1 receptor homology (TIR) domain superfamilyGENE3DG3DSA:3.40.50.10140coord: 2263..2420
e-value: 7.8E-14
score: 53.5
IPR035897Toll/interleukin-1 receptor homology (TIR) domain superfamilySUPERFAMILYSSF52200Toll/Interleukin receptor TIR domaincoord: 2298..2404
IPR043136B30.2/SPRY domain superfamilyGENE3DG3DSA:2.60.120.920coord: 599..754
e-value: 4.8E-18
score: 67.7
IPR032171C-terminal of Roc (COR) domainPFAMPF16095CORcoord: 1817..2012
e-value: 1.1E-43
score: 149.4
IPR000157Toll/interleukin-1 receptor homology (TIR) domainPFAMPF13676TIR_2coord: 2335..2416
e-value: 1.1E-8
score: 35.7
IPR039788Nucleolar protein 4 familyPANTHERPTHR12449FAMILY NOT NAMEDcoord: 1636..2027
IPR020859Roc domainPROSITEPS51424ROCcoord: 1634..1809
score: 40.92
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 1640..1821