Protocadherin-1

Overview
NameProtocadherin-1
Smed IDSMED30005004
Length (bp)3647
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin-1 (SMED30005004) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin-1 (SMED30005004) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin-1 (SMED30005004) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin-1 (SMED30005004) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005004

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30005004SMESG000007877.1 SmedASXL_016790SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30005004SMESG000007877.1 dd_Smed_v4_13961_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30005004SMESG000007877.1 dd_Smed_v6_13961_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30005004SMESG000007877.1 OX_Smed_1.0.11034ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin-1 vs. Ensembl Human
Match: PCDH1 (protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655])

HSP 1 Score: 96.2857 bits (238), Expect = 2.114e-46
Identity = 92/350 (26.29%), Postives = 161/350 (46.00%), Query Frame = 3
Query:  276 YFILQSHSG-ILKQRNNIDRETM--CKH---ADVCQKIILISI-----NG--QVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQG-PLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENS--TAVTIEIEDCNDHAPNIAIYK--------STASIRENDRTPLVLTSVMVNDDDKGINSQFNC 1247
            Y  +   +G I     +IDRE +  C++    D C     +SI     NG  ++LE  + + D NDN P F+    TL+I EN++IGS   +P A D D+ PN +  Y ++             +A   F + +      K P L ++  +DRE  D ++L +  +D G   +  S  + V+++D NDN+P++   +    + E    G  +++++A D D  +  N +I+Y         E++ RL  +  ++  ++ QG    +  + + F + A D G    S    V + ++D ND+AP I I            A+I E+      +  V V+D D+G N+   C
Sbjct:   98 YLRVDGKTGDIFTTETSIDREGLRECQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQ----------AGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGA--NAEIEYTFHQ---APEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTC 432          

HSP 2 Score: 78.9518 bits (193), Expect = 2.114e-46
Identity = 82/264 (31.06%), Postives = 124/264 (46.97%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFK-QQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQL----QNDGRLILTKNL-REREGIRLPDRLIIRASDNGTPPKAELVTVNI 2438
            +DRE ++ Y L ++A D G PSL  T TV + +LD ND  P F    Y + + E   +  +  + G VT  D D GEN  V  ++ Q       QN  G  L  ++           DREQ  +   ++ A D G P  SA   V ++VLD NDN P    P N  + + ++  +++G+ ++   AED D G N  + YSI          PY L     + G + L K + R   G+    RL+++ SD G PP+     V++
Sbjct:  570 LDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVME--NMPALSPV-GMVTVIDGDKGENAQVQLSVEQDNGDFVIQNGTGTILSSLS----------FDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKL-LTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGN------PYGLFQIGSHSGAITLEKEIERRHHGLH---RLVVKVSDRGKPPRYGTALVHL 810          

HSP 3 Score: 53.5286 bits (127), Expect = 2.114e-46
Identity = 36/109 (33.03%), Postives = 48/109 (44.04%), Query Frame = 1
Query: 1348 TFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI-LNNDENYYFTITI-LGKIEAKWKL 1668
            T  D E +  Y++ I  +D G PPL       V ++D NDNAP F          ENN  G  I  + A D DS  N  + Y +         FTI+   G+I+ K  L
Sbjct:  462 TPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSL 570          

HSP 4 Score: 61.2326 bits (147), Expect = 4.590e-22
Identity = 31/80 (38.75%), Postives = 40/80 (50.00%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSY 1593
             DRE    Y + I+  D G PP     L  VT++D NDNAPKF        L+EN+ IG  +  V+A D D   N  + Y
Sbjct:  238 LDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEY 317          

HSP 5 Score: 56.6102 bits (135), Expect = 4.590e-22
Identity = 58/209 (27.75%), Postives = 96/209 (45.93%), Query Frame = 3
Query: 1656 QMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTA------DDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSI 2264
            Q  +DRE       +++AKD G    +    V + + D+ND  P  + +    +T  +G+A I   + + TA       D+D GEN  V   +        RQ +   +  K            +D E++     EI+A D+G P LS+  ++ V V+DVNDN P F   + ++ F     +++ G+V+A   A D D G N  + YS+
Sbjct:  342 QGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTT--PLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAF---PENNKPGEVIAEITASDADSGSNAELVYSL 545          

HSP 6 Score: 28.8758 bits (63), Expect = 4.590e-22
Identity = 17/52 (32.69%), Postives = 26/52 (50.00%), Query Frame = 3
Query: 1098 IEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDL 1253
            IE++D ND+ PN A    T +I EN     +    + +D D G N   + +L
Sbjct:  156 IEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYEL 207          

HSP 7 Score: 58.5362 bits (140), Expect = 9.819e-18
Identity = 73/332 (21.99%), Postives = 136/332 (40.96%), Query Frame = 3
Query:  285 LQSHSGILKQRNNIDRETMCK-HADVCQKIILISINGQVLEVMVYINDENDNIPQFSMRHKTLSIQENS------DIGSE--LSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCT--ITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLV-ELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGR--ENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQ 1238
            L  ++G++  +  +DRE +      V  K    +      +V+V + D NDN P   +R   L   ++       D+  E  ++L    D D   N+ +   +       +R+ ++  +      F++T              +D E++  + + ++A DSG    S T  + V ++DVNDN+P +          E ++ G ++ E+ A D D  S  N ++ Y +      K     LF I+  +  +  +     + +      + A D G    + +  V + + DCND+ P   +     S+ EN      +  V V D DKG N+Q
Sbjct:  332 LDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTT-----------PLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGS--NAELVYSLEPEPAAK----GLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQ 646          

HSP 8 Score: 49.6766 bits (117), Expect = 9.819e-18
Identity = 32/95 (33.68%), Postives = 44/95 (46.32%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAP--KFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
            FDRE  S Y+  ++ +D G PP       T+ ++DENDNAP     S+     LT    +G  +  V A D DS  N  + Y I   +    F I
Sbjct:  673 FDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKLLTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPYGLFQI 767          

HSP 9 Score: 23.483 bits (49), Expect = 9.819e-18
Identity = 10/36 (27.78%), Postives = 17/36 (47.22%), Query Frame = 3
Query: 1656 QMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRI 1763
            + EI+R     + L +   D G+P    T  VH+ +
Sbjct:  777 EKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYV 812          

HSP 10 Score: 60.8474 bits (146), Expect = 1.182e-13
Identity = 65/223 (29.15%), Postives = 108/223 (48.43%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQ-QYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFI-------NISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQ 2309
            +DRE  D Y LTI  +D G P    +  + + +LD ND  P F++  Y  +++E + +   H+++ +V A+D D G N  + Y   Q  +   R       L      G++ + G VDRE + +++  ++A D G    SA A V+V V D+NDN P  +  I  +  +       NIS D      +A  +  D D+GEN  +T  +        ++P+QL+
Sbjct:  238 LDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIG--HSVI-QVKANDSDQGANAEIEYTFHQAPEVVRR------LLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIE--IRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAG------DVPFQLR 443          

HSP 11 Score: 37.3502 bits (85), Expect = 1.182e-13
Identity = 26/82 (31.71%), Postives = 37/82 (45.12%), Query Frame = 1
Query: 1369 LSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDE 1614
            L F   +   +  G P L+  +   + + D NDN P F S  I   + EN NIG+      A D D+  NG  SY++    E
Sbjct:  134 LEFEVSITDLVQNGSPRLLEGQ---IEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPE 212          

HSP 12 Score: 72.4034 bits (176), Expect = 5.128e-12
Identity = 75/284 (26.41%), Postives = 127/284 (44.72%), Query Frame = 3
Query:  411 VYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQ--QGSCTITVSIIDVNDNSPQWPTVNISKTVKE-CDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTAS--IRENDRTPLVLTSVMVNDDDKGINSQF 1241
            V + D NDN P F+     ++  EN+  G  ++  TA D DS  N+ + Y ++           +  A   FTI  +T        +++   +DRE+ + +EL ++A D G    QG+ T+ V+++D NDN P++     + +V E      P+  +   D D     N Q++  +       E  N  F I   +  + S      + ++  TF + AVDGG   R     VTI + D ND+AP I    +T+   +    R    ++ V   D D G+N++ 
Sbjct:  494 VQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEP----------EPAAKGLFTISPETGE------IQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGE--NAQVQLSV-------EQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKLLTPQTRLGETVSQVAAEDFDSGVNAEL 752          

HSP 13 Score: 54.299 bits (129), Expect = 2.823e-11
Identity = 33/104 (31.73%), Postives = 48/104 (46.15%), Query Frame = 1
Query: 1348 TFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYF---TITILGKI 1650
            T  DRE    Y + +   D G P L G     V ++D NDN PKF      F++ EN    +P+G V   D D  EN +V   +  ++ ++     T TIL  +
Sbjct:  568 TSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQDNGDFVIQNGTGTILSSL 671          

HSP 14 Score: 35.8094 bits (81), Expect = 2.823e-11
Identity = 28/92 (30.43%), Postives = 39/92 (42.39%), Query Frame = 3
Query: 1653 SQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILG----KVTADDKDLGENGTVYYAI 1916
            S +  DRE +  Y+  + A D G P  +    V I +LD ND  P             + L T    LG    +V A+D D G N  + Y+I
Sbjct:  669 SSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPS----NTSHKLLTPQTRLGETVSQVAAEDFDSGVNAELIYSI 756          

HSP 15 Score: 68.9366 bits (167), Expect = 5.609e-11
Identity = 88/300 (29.33%), Postives = 142/300 (47.33%), Query Frame = 3
Query: 1635 YFRENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYF-YQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFI---NISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYIPNNLTPRNNALPPGINKKSNDKNRF 2522
            YF +  + ++ ++ +KD Y++ I+A D+G P L+ T ++ ++++DVND  PVF Q        E N       ++ ++TA D D G N  + Y++         +             G + +   +DREQ  S + +++A D G P L   A V+V+VLD NDN PKF   ++  NF    N+   S VG V       D DKGEN  +  S+      + N  + +QN    IL+    +RE  +      ++A D G PP++  V V I  +  N    +NA  P I   SN  ++ 
Sbjct:  456 YFLQTTTPLDYEK-VKD-YTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGE---VIAEITASDADSGSNAELVYSLEP-------EPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFM--LSGYNFSVMENMPALSPVGMVTVI----DGDKGENAQVQLSV-----EQDNGDFVIQNGTGTILSSLSFDRE-QQSTYTFQLKAVDGGVPPRSAYVGVTINVLDEN----DNA--PYITAPSNTSHKL 725          
BLAST of Protocadherin-1 vs. Ensembl Human
Match: PCDH1 (protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655])

HSP 1 Score: 95.9005 bits (237), Expect = 3.871e-46
Identity = 92/350 (26.29%), Postives = 161/350 (46.00%), Query Frame = 3
Query:  276 YFILQSHSG-ILKQRNNIDRETM--CKH---ADVCQKIILISI-----NG--QVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQG-PLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENS--TAVTIEIEDCNDHAPNIAIYK--------STASIRENDRTPLVLTSVMVNDDDKGINSQFNC 1247
            Y  +   +G I     +IDRE +  C++    D C     +SI     NG  ++LE  + + D NDN P F+    TL+I EN++IGS   +P A D D+ PN +  Y ++             +A   F + +      K P L ++  +DRE  D ++L +  +D G   +  S  + V+++D NDN+P++   +    + E    G  +++++A D D  +  N +I+Y         E++ RL  +  ++  ++ QG    +  + + F + A D G    S    V + ++D ND+AP I I            A+I E+      +  V V+D D+G N+   C
Sbjct:   98 YLRVDGKTGDIFTTETSIDREGLRECQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQ----------AGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGA--NAEIEYTFHQ---APEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTC 432          

HSP 2 Score: 78.5666 bits (192), Expect = 3.871e-46
Identity = 82/264 (31.06%), Postives = 124/264 (46.97%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFK-QQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQL----QNDGRLILTKNL-REREGIRLPDRLIIRASDNGTPPKAELVTVNI 2438
            +DRE ++ Y L ++A D G PSL  T TV + +LD ND  P F    Y + + E   +  +  + G VT  D D GEN  V  ++ Q       QN  G  L  ++           DREQ  +   ++ A D G P  SA   V ++VLD NDN P    P N  + + ++  +++G+ ++   AED D G N  + YSI          PY L     + G + L K + R   G+    RL+++ SD G PP+     V++
Sbjct:  570 LDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVME--NMPALSPV-GMVTVIDGDKGENAQVQLSVEQDNGDFVIQNGTGTILSSLS----------FDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKL-LTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGN------PYGLFQIGSHSGAITLEKEIERRHHGLH---RLVVKVSDRGKPPRYGTALVHL 810          

HSP 3 Score: 53.5286 bits (127), Expect = 3.871e-46
Identity = 36/109 (33.03%), Postives = 48/109 (44.04%), Query Frame = 1
Query: 1348 TFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI-LNNDENYYFTITI-LGKIEAKWKL 1668
            T  D E +  Y++ I  +D G PPL       V ++D NDNAP F          ENN  G  I  + A D DS  N  + Y +         FTI+   G+I+ K  L
Sbjct:  462 TPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSL 570          

HSP 4 Score: 60.8474 bits (146), Expect = 8.734e-22
Identity = 31/80 (38.75%), Postives = 40/80 (50.00%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSY 1593
             DRE    Y + I+  D G PP     L  VT++D NDNAPKF        L+EN+ IG  +  V+A D D   N  + Y
Sbjct:  238 LDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEY 317          

HSP 5 Score: 55.8398 bits (133), Expect = 8.734e-22
Identity = 58/209 (27.75%), Postives = 96/209 (45.93%), Query Frame = 3
Query: 1656 QMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTA------DDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSI 2264
            Q  +DRE       +++AKD G    +    V + + D+ND  P  + +    +T  +G+A I   + + TA       D+D GEN  V   +        RQ +   +  K            +D E++     EI+A D+G P LS+  ++ V V+DVNDN P F   + ++ F     +++ G+V+A   A D D G N  + YS+
Sbjct:  342 QGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTT--PLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAF---PENNKPGEVIAEITASDADSGSNAELVYSL 545          

HSP 6 Score: 28.4906 bits (62), Expect = 8.734e-22
Identity = 17/52 (32.69%), Postives = 26/52 (50.00%), Query Frame = 3
Query: 1098 IEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDL 1253
            IE++D ND+ PN A    T +I EN     +    + +D D G N   + +L
Sbjct:  156 IEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYEL 207          

HSP 7 Score: 57.3806 bits (137), Expect = 2.313e-17
Identity = 73/332 (21.99%), Postives = 136/332 (40.96%), Query Frame = 3
Query:  285 LQSHSGILKQRNNIDRETMCK-HADVCQKIILISINGQVLEVMVYINDENDNIPQFSMRHKTLSIQENS------DIGSE--LSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCT--ITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLV-ELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGR--ENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQ 1238
            L  ++G++  +  +DRE +      V  K    +      +V+V + D NDN P   +R   L   ++       D+  E  ++L    D D   N+ +   +       +R+ ++  +      F++T              +D E++  + + ++A DSG    S T  + V ++DVNDN+P +          E ++ G ++ E+ A D D  S  N ++ Y +      K     LF I+  +  +  +     + +      + A D G    + +  V + + DCND+ P   +     S+ EN      +  V V D DKG N+Q
Sbjct:  332 LDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTT-----------PLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGS--NAELVYSLEPEPAAK----GLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQ 646          

HSP 8 Score: 49.2914 bits (116), Expect = 2.313e-17
Identity = 32/95 (33.68%), Postives = 44/95 (46.32%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAP--KFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
            FDRE  S Y+  ++ +D G PP       T+ ++DENDNAP     S+     LT    +G  +  V A D DS  N  + Y I   +    F I
Sbjct:  673 FDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKLLTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPYGLFQI 767          

HSP 9 Score: 23.483 bits (49), Expect = 2.313e-17
Identity = 10/36 (27.78%), Postives = 17/36 (47.22%), Query Frame = 3
Query: 1656 QMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRI 1763
            + EI+R     + L +   D G+P    T  VH+ +
Sbjct:  777 EKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYV 812          

HSP 10 Score: 60.8474 bits (146), Expect = 1.504e-13
Identity = 65/223 (29.15%), Postives = 108/223 (48.43%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQ-QYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFI-------NISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQ 2309
            +DRE  D Y LTI  +D G P    +  + + +LD ND  P F++  Y  +++E + +   H+++ +V A+D D G N  + Y   Q  +   R       L      G++ + G VDRE + +++  ++A D G    SA A V+V V D+NDN P  +  I  +  +       NIS D      +A  +  D D+GEN  +T  +        ++P+QL+
Sbjct:  238 LDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIG--HSVI-QVKANDSDQGANAEIEYTFHQAPEVVRR------LLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIE--IRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAG------DVPFQLR 443          

HSP 11 Score: 36.965 bits (84), Expect = 1.504e-13
Identity = 21/57 (36.84%), Postives = 28/57 (49.12%), Query Frame = 1
Query: 1444 VTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDE 1614
            + + D NDN P F S  I   + EN NIG+      A D D+  NG  SY++    E
Sbjct:  156 IEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPE 212          

HSP 12 Score: 72.0182 bits (175), Expect = 7.226e-12
Identity = 75/284 (26.41%), Postives = 127/284 (44.72%), Query Frame = 3
Query:  411 VYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQ--QGSCTITVSIIDVNDNSPQWPTVNISKTVKE-CDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTAS--IRENDRTPLVLTSVMVNDDDKGINSQF 1241
            V + D NDN P F+     ++  EN+  G  ++  TA D DS  N+ + Y ++           +  A   FTI  +T        +++   +DRE+ + +EL ++A D G    QG+ T+ V+++D NDN P++     + +V E      P+  +   D D     N Q++  +       E  N  F I   +  + S      + ++  TF + AVDGG   R     VTI + D ND+AP I    +T+   +    R    ++ V   D D G+N++ 
Sbjct:  494 VQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEP----------EPAAKGLFTISPETGE------IQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGE--NAQVQLSV-------EQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKLLTPQTRLGETVSQVAAEDFDSGVNAEL 752          

HSP 13 Score: 53.9138 bits (128), Expect = 3.829e-11
Identity = 33/104 (31.73%), Postives = 48/104 (46.15%), Query Frame = 1
Query: 1348 TFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYF---TITILGKI 1650
            T  DRE    Y + +   D G P L G     V ++D NDN PKF      F++ EN    +P+G V   D D  EN +V   +  ++ ++     T TIL  +
Sbjct:  568 TSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQDNGDFVIQNGTGTILSSL 671          

HSP 14 Score: 35.8094 bits (81), Expect = 3.829e-11
Identity = 28/92 (30.43%), Postives = 39/92 (42.39%), Query Frame = 3
Query: 1653 SQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILG----KVTADDKDLGENGTVYYAI 1916
            S +  DRE +  Y+  + A D G P  +    V I +LD ND  P             + L T    LG    +V A+D D G N  + Y+I
Sbjct:  669 SSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPS----NTSHKLLTPQTRLGETVSQVAAEDFDSGVNAELIYSI 756          

HSP 15 Score: 68.5514 bits (166), Expect = 7.357e-11
Identity = 88/300 (29.33%), Postives = 142/300 (47.33%), Query Frame = 3
Query: 1635 YFRENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYF-YQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFI---NISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYIPNNLTPRNNALPPGINKKSNDKNRF 2522
            YF +  + ++ ++ +KD Y++ I+A D+G P L+ T ++ ++++DVND  PVF Q        E N       ++ ++TA D D G N  + Y++         +             G + +   +DREQ  S + +++A D G P L   A V+V+VLD NDN PKF   ++  NF    N+   S VG V       D DKGEN  +  S+      + N  + +QN    IL+    +RE  +      ++A D G PP++  V V I  +  N    +NA  P I   SN  ++ 
Sbjct:  456 YFLQTTTPLDYEK-VKD-YTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGE---VIAEITASDADSGSNAELVYSLEP-------EPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFM--LSGYNFSVMENMPALSPVGMVTVI----DGDKGENAQVQLSV-----EQDNGDFVIQNGTGTILSSLSFDRE-QQSTYTFQLKAVDGGVPPRSAYVGVTINVLDEN----DNA--PYITAPSNTSHKL 725          
BLAST of Protocadherin-1 vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 88.9669 bits (219), Expect = 4.113e-44
Identity = 110/441 (24.94%), Postives = 186/441 (42.18%), Query Frame = 3
Query:   78 LSISIIFGILIEMLIC------KTFYIKLKISENKGSGEDLINLKNYIIIHKLPINSSGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCK---HADVCQKIILISING----QVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCT--ITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLV-ELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAPNIAI------YKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYFTMVKECLQSIKWTAALYVQYQ 1334
            LS + IF +L+  ++       K + I+ ++ EN   G DL+   N  +I    + ++  + ++    D+    I +    I      IDRE +C      + C   + ++I      +++++   I D NDN P F      +SI ENS I S+ +LP A D D   N +  Y +  I S++I  ++           I+T    K+P L + KE+DREE D + + +  ED G  Q S T  + VS+ D NDN P +    I  ++ E    G  V +L A D D     N +I +  S+      +  RLF++  ++  ++ +     +        + A DGG       V + + D ND+ P+I I         T  + EN      +  + V D D   N +  C  +    F +            A Y+ Y+
Sbjct:    4 LSGTYIFAVLLACVVFHSGAQEKNYTIREEMPENVLIG-DLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYEL--IKSQNIFGLD----------VIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGE--NAKIHFSFSNLV--SNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLETAAYLDYE 427          

HSP 2 Score: 73.1738 bits (178), Expect = 4.113e-44
Identity = 78/257 (30.35%), Postives = 121/257 (47.08%), Query Frame = 3
Query: 1662 EIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQ-QYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVV------DREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLRERE-GIRLPDRLIIRASDNGTP 2408
            ++DRE +D+Y  TI+AKDNG P L    TV + I+D ND  PVF   +Y + + E       H  +G +T  D D G+N  V  +I  + D                   I +  GV+      DRE+  S    + A D G+   S+ A V ++V+DVNDNKP F  P +  ++  +   +  G V+    A D D G N  + YSI+      ++L    Q  G + L +     + G+    R++++A+D G P
Sbjct:  527 KLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPEN---LPRHGTVGLITVTDPDYGDNSAVTLSILDENDD----------------FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGN--TRDLFAIDQETGNITLMEKCDVTDLGLH---RVLVKANDLGQP 759          

HSP 3 Score: 59.3066 bits (142), Expect = 4.113e-44
Identity = 28/82 (34.15%), Postives = 44/82 (53.66%), Query Frame = 1
Query: 1348 TFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSY 1593
             + D ES   Y++ +   D G+PPL    +  + + DENDNAP F    +  ++ ENN+ G  +  V A D DS  N +++Y
Sbjct:  422 AYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINY 503          

HSP 4 Score: 63.1586 bits (152), Expect = 3.719e-26
Identity = 75/294 (25.51%), Postives = 122/294 (41.50%), Query Frame = 3
Query:  405 VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKE-IDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVE----------LQAFDRDDSSTPNGQIKYKISDNSP--KKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVT-IEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFN 1244
            + V + D NDN P F      +SI EN+ +G+ ++   A D D   N+ I +   ++ S   RR+    A+                 L  IKE +DREE    +L+++A D G       + V++ DVNDN    P+++I   V   +    L E          +   D+D     NG++        P   + + +  F +  ++             K Y    + A  G    N +A+  I+++D ND+AP       T SI EN+   + LT V   D D G N++ N
Sbjct:  235 LQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTG---------------LITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDN---VPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADH--NGRVTCFTDHEIPFRLRPVFSNQFLLETAAYLDYEST------KEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKIN 502          

HSP 5 Score: 54.299 bits (129), Expect = 3.719e-26
Identity = 36/93 (38.71%), Postives = 46/93 (49.46%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
             DRE    Y   I   D G PPL       V+IID+NDN+P F  ++  F + EN      +G +   DPD  +N  V+  IL  DEN  FTI
Sbjct:  528 LDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSIL--DENDDFTI 618          

HSP 6 Score: 42.743 bits (99), Expect = 3.719e-26
Identity = 28/92 (30.43%), Postives = 45/92 (48.91%), Query Frame = 3
Query: 1650 RSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF---KQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAI 1916
            R  +  DRE ++ Y+  + A+D G  S + +  V I ++DVND  PVF        Y++   +       ++ +V A D D G N  V Y+I
Sbjct:  626 RPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPS--TNPGTVVFQVIAVDNDTGMNAEVRYSI 715          

HSP 7 Score: 66.2402 bits (160), Expect = 4.617e-15
Identity = 66/223 (29.60%), Postives = 101/223 (45.29%), Query Frame = 3
Query: 1608 RRKLLFYNHYFRENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFI---NISTDSQVGKVLANFEAEDPDKGENGTITYSII 2267
            R + +F N +  E  + +  D E   +Y++ ++A D G+P LN +  + I++ D ND  PVF Q +       N    I   L KV+A D D G N  + Y +                       G+L +   +DRE+       I+A DNG P L++   V V ++D NDN P F +  N+ NF    N+     VG +       DPD G+N  +T SI+
Sbjct:  407 RLRPVFSNQFLLETAAYL--DYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQ--LTKVSAMDADSGPNAKINYLLGPD---------APPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTH--NEYNFYVPENLPRHGTVGLITVT----DPDYGDNSAVTLSIL 610          

HSP 8 Score: 36.5798 bits (83), Expect = 4.617e-15
Identity = 32/107 (29.91%), Postives = 45/107 (42.06%), Query Frame = 1
Query: 1306 GRQLFMYNIKKIPDTF---FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRF---------TLTENNNIGAPIGYVRAYDPDSNENGRVS 1590
             R+LF  N      T     DRE    + +L+   D G  P     +  V + D NDN P   S DIR+          L+EN  +   I  +   D D++ NGRV+
Sbjct:  296 ARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMP--ARAMVLVNVTDVNDNVP---SIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVT 397          

HSP 9 Score: 81.6481 bits (200), Expect = 6.846e-15
Identity = 81/290 (27.93%), Postives = 131/290 (45.17%), Query Frame = 3
Query:  393 QVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKE-CDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTAS---IRENDRTPLVLTSVMVNDDDKGINSQ 1238
            Q   + + + DENDN P F+    T+SI EN+  G +L+  +A D DS PN+ I Y +               A   F++  +T        L ++K++DRE+ D++   ++A+D+G      + T+ VSIID NDNSP +     +  V E   R G +  +   D D     N  +   I D        N  F I   +  +        + +   TF++ A DGG   R +S  VTI + D ND+ P   +  S  S   +  +     V+  V+  D+D G+N++
Sbjct:  448 QSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGP------------DAPPEFSLDCRT------GMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGD--NSAVTLSILDE-------NDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAE 710          

HSP 10 Score: 51.9878 bits (123), Expect = 5.946e-10
Identity = 27/86 (31.40%), Postives = 45/86 (52.33%), Query Frame = 3
Query: 1656 QMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYA 1913
            Q E+DRE KD Y + +  +D G P  + T  + + + D ND  PVFK+         N  A +   + ++ A D D+GEN  ++++
Sbjct:  204 QKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPEN--APVGTSVTQLHATDADIGENAKIHFS 287          

HSP 11 Score: 33.4982 bits (75), Expect = 5.946e-10
Identity = 19/53 (35.85%), Postives = 29/53 (54.72%), Query Frame = 1
Query: 1450 IIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNN 1608
            I D NDNAP F +  I  ++ EN+ I +      A DPD   NG  +Y+++ +
Sbjct:  129 IEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKS 181          
BLAST of Protocadherin-1 vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 88.5817 bits (218), Expect = 1.282e-43
Identity = 110/441 (24.94%), Postives = 186/441 (42.18%), Query Frame = 3
Query:   78 LSISIIFGILIEMLIC------KTFYIKLKISENKGSGEDLINLKNYIIIHKLPINSSGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMC---KHADVCQKIILISING----QVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCT--ITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLV-ELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAPNIAI------YKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYFTMVKECLQSIKWTAALYVQYQ 1334
            LS + IF +L+  ++       K + I+ ++ EN   G DL+   N  +I    + ++  + ++    D+    I +    I      IDRE +C      + C   + ++I      +++++   I D NDN P F      +SI ENS I S+ +LP A D D   N +  Y +  I S++I  ++           I+T    K+P L + KE+DREE D + + +  ED G  Q S T  + VS+ D NDN P +    I  ++ E    G  V +L A D D     N +I +  S+      +  RLF++  ++  ++ +     +        + A DGG       V + + D ND+ P+I I         T  + EN      +  + V D D   N +  C  +    F +            A Y+ Y+
Sbjct:    4 LSGTYIFAVLLACVVFHSGAQEKNYTIREEMPENVLIG-DLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYEL--IKSQNIFGLD----------VIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGE--NAKIHFSFSNLV--SNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLETAAYLDYE 427          

HSP 2 Score: 71.633 bits (174), Expect = 1.282e-43
Identity = 78/257 (30.35%), Postives = 121/257 (47.08%), Query Frame = 3
Query: 1662 EIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQ-QYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVV------DREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLRERE-GIRLPDRLIIRASDNGTP 2408
            ++DRE +D+Y  TI+AKDNG P L    TV + I+D ND  PVF   +Y + + E       H  +G +T  D D G+N  V  +I  + D                   I +  GV+      DRE+  S    + A D G+   S+ A V ++V+DVNDNKP F  P +  ++  +   +  G V+    A D D G N  + YSI+      ++L    Q  G + L +     + G+    R++++A+D G P
Sbjct:  527 KLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPEN---LPRHGTVGLITVTDPDYGDNSAVTLSILDEND----------------DFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGN--TRDLFAIDQETGNITLMEKCDVTDLGLH---RVLVKANDLGQP 759          

HSP 3 Score: 59.3066 bits (142), Expect = 1.282e-43
Identity = 31/95 (32.63%), Postives = 50/95 (52.63%), Query Frame = 1
Query: 1348 TFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
             + D ES   Y++ +   D G+PPL    +  + + DENDNAP F    +  ++ ENN+ G  +  V A D DS  N +++Y +L  D    F++
Sbjct:  422 AYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINY-LLGPDAPPEFSL 515          

HSP 4 Score: 63.1586 bits (152), Expect = 6.639e-26
Identity = 74/293 (25.26%), Postives = 122/293 (41.64%), Query Frame = 3
Query:  405 VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVE----------LQAFDRDDSSTPNGQIKYKISDNSP--KKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVT-IEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFN 1244
            + V + D NDN P F      +SI EN+ +G+ ++   A D D   N+ I +   ++ S   RR+    A+    I IK             + +DREE    +L+++A D G       + V++ DVNDN    P+++I   V   +    L E          +   D+D     NG++        P   + + +  F +  ++             K Y    + A  G    N +A+  I+++D ND+AP       T SI EN+   + LT V   D D G N++ N
Sbjct:  235 LQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGL-ITIK-------------EPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDN---VPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADH--NGRVTCFTDHEIPFRLRPVFSNQFLLETAAYLDYEST------KEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKIN 502          

HSP 5 Score: 54.299 bits (129), Expect = 6.639e-26
Identity = 36/93 (38.71%), Postives = 46/93 (49.46%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
             DRE    Y   I   D G PPL       V+IID+NDN+P F  ++  F + EN      +G +   DPD  +N  V+  IL  DEN  FTI
Sbjct:  528 LDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSIL--DENDDFTI 618          

HSP 6 Score: 42.3578 bits (98), Expect = 6.639e-26
Identity = 28/92 (30.43%), Postives = 45/92 (48.91%), Query Frame = 3
Query: 1650 RSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF---KQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAI 1916
            R  +  DRE ++ Y+  + A+D G  S + +  V I ++DVND  PVF        Y++   +       ++ +V A D D G N  V Y+I
Sbjct:  626 RPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPS--TNPGTVVFQVIAVDNDTGMNAEVRYSI 715          

HSP 7 Score: 81.6481 bits (200), Expect = 8.806e-15
Identity = 81/290 (27.93%), Postives = 131/290 (45.17%), Query Frame = 3
Query:  393 QVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKE-CDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTAS---IRENDRTPLVLTSVMVNDDDKGINSQ 1238
            Q   + + + DENDN P F+    T+SI EN+  G +L+  +A D DS PN+ I Y +               A   F++  +T        L ++K++DRE+ D++   ++A+D+G      + T+ VSIID NDNSP +     +  V E   R G +  +   D D     N  +   I D        N  F I   +  +        + +   TF++ A DGG   R +S  VTI + D ND+ P   +  S  S   +  +     V+  V+  D+D G+N++
Sbjct:  448 QSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGP------------DAPPEFSLDCRTG------MLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGD--NSAVTLSILDE-------NDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAE 710          

HSP 8 Score: 65.855 bits (159), Expect = 8.905e-15
Identity = 66/223 (29.60%), Postives = 101/223 (45.29%), Query Frame = 3
Query: 1608 RRKLLFYNHYFRENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFI---NISTDSQVGKVLANFEAEDPDKGENGTITYSII 2267
            R + +F N +  E  + +  D E   +Y++ ++A D G+P LN +  + I++ D ND  PVF Q +       N    I   L KV+A D D G N  + Y +                       G+L +   +DRE+       I+A DNG P L++   V V ++D NDN P F +  N+ NF    N+     VG +       DPD G+N  +T SI+
Sbjct:  407 RLRPVFSNQFLLETAAYL--DYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQ--LTKVSAMDADSGPNAKINYLLGPD---------APPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTH--NEYNFYVPENLPRHGTVGLITVT----DPDYGDNSAVTLSIL 610          

HSP 9 Score: 36.1946 bits (82), Expect = 8.905e-15
Identity = 26/88 (29.55%), Postives = 38/88 (43.18%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRF---------TLTENNNIGAPIGYVRAYDPDSNENGRVS 1590
             DRE    + +L+   D G  P     +  V + D NDN P     DIR+          L+EN  +   I  +   D D++ NGRV+
Sbjct:  315 LDREETPNHKLLVLASDGGLMP--ARAMVLVNVTDVNDNVPSI---DIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVT 397          

HSP 10 Score: 51.9878 bits (123), Expect = 6.947e-10
Identity = 27/86 (31.40%), Postives = 45/86 (52.33%), Query Frame = 3
Query: 1656 QMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYA 1913
            Q E+DRE KD Y + +  +D G P  + T  + + + D ND  PVFK+         N  A +   + ++ A D D+GEN  ++++
Sbjct:  204 QKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPEN--APVGTSVTQLHATDADIGENAKIHFS 287          

HSP 11 Score: 33.113 bits (74), Expect = 6.947e-10
Identity = 19/53 (35.85%), Postives = 29/53 (54.72%), Query Frame = 1
Query: 1450 IIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNN 1608
            I D NDNAP F +  I  ++ EN+ I +      A DPD   NG  +Y+++ +
Sbjct:  129 IEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKS 181          
BLAST of Protocadherin-1 vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 88.5817 bits (218), Expect = 1.368e-43
Identity = 110/441 (24.94%), Postives = 186/441 (42.18%), Query Frame = 3
Query:   78 LSISIIFGILIEMLIC------KTFYIKLKISENKGSGEDLINLKNYIIIHKLPINSSGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMC---KHADVCQKIILISING----QVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCT--ITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLV-ELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAPNIAI------YKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYFTMVKECLQSIKWTAALYVQYQ 1334
            LS + IF +L+  ++       K + I+ ++ EN   G DL+   N  +I    + ++  + ++    D+    I +    I      IDRE +C      + C   + ++I      +++++   I D NDN P F      +SI ENS I S+ +LP A D D   N +  Y +  I S++I  ++           I+T    K+P L + KE+DREE D + + +  ED G  Q S T  + VS+ D NDN P +    I  ++ E    G  V +L A D D     N +I +  S+      +  RLF++  ++  ++ +     +        + A DGG       V + + D ND+ P+I I         T  + EN      +  + V D D   N +  C  +    F +            A Y+ Y+
Sbjct:    4 LSGTYIFAVLLACVVFHSGAQEKNYTIREEMPENVLIG-DLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYEL--IKSQNIFGLD----------VIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGE--NAKIHFSFSNLV--SNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLETAAYLDYE 427          

HSP 2 Score: 71.633 bits (174), Expect = 1.368e-43
Identity = 78/257 (30.35%), Postives = 121/257 (47.08%), Query Frame = 3
Query: 1662 EIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQ-QYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVV------DREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLRERE-GIRLPDRLIIRASDNGTP 2408
            ++DRE +D+Y  TI+AKDNG P L    TV + I+D ND  PVF   +Y + + E       H  +G +T  D D G+N  V  +I  + D                   I +  GV+      DRE+  S    + A D G+   S+ A V ++V+DVNDNKP F  P +  ++  +   +  G V+    A D D G N  + YSI+      ++L    Q  G + L +     + G+    R++++A+D G P
Sbjct:  527 KLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPEN---LPRHGTVGLITVTDPDYGDNSAVTLSILDEND----------------DFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGN--TRDLFAIDQETGNITLMEKCDVTDLGLH---RVLVKANDLGQP 759          

HSP 3 Score: 59.3066 bits (142), Expect = 1.368e-43
Identity = 31/95 (32.63%), Postives = 50/95 (52.63%), Query Frame = 1
Query: 1348 TFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
             + D ES   Y++ +   D G+PPL    +  + + DENDNAP F    +  ++ ENN+ G  +  V A D DS  N +++Y +L  D    F++
Sbjct:  422 AYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINY-LLGPDAPPEFSL 515          

HSP 4 Score: 63.1586 bits (152), Expect = 7.141e-26
Identity = 74/293 (25.26%), Postives = 122/293 (41.64%), Query Frame = 3
Query:  405 VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVE----------LQAFDRDDSSTPNGQIKYKISDNSP--KKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVT-IEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFN 1244
            + V + D NDN P F      +SI EN+ +G+ ++   A D D   N+ I +   ++ S   RR+    A+    I IK             + +DREE    +L+++A D G       + V++ DVNDN    P+++I   V   +    L E          +   D+D     NG++        P   + + +  F +  ++             K Y    + A  G    N +A+  I+++D ND+AP       T SI EN+   + LT V   D D G N++ N
Sbjct:  235 LQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGL-ITIK-------------EPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDN---VPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADH--NGRVTCFTDHEIPFRLRPVFSNQFLLETAAYLDYEST------KEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKIN 502          

HSP 5 Score: 53.9138 bits (128), Expect = 7.141e-26
Identity = 36/93 (38.71%), Postives = 46/93 (49.46%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
             DRE    Y   I   D G PPL       V+IID+NDN+P F  ++  F + EN      +G +   DPD  +N  V+  IL  DEN  FTI
Sbjct:  528 LDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSIL--DENDDFTI 618          

HSP 6 Score: 42.3578 bits (98), Expect = 7.141e-26
Identity = 28/92 (30.43%), Postives = 45/92 (48.91%), Query Frame = 3
Query: 1650 RSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF---KQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAI 1916
            R  +  DRE ++ Y+  + A+D G  S + +  V I ++DVND  PVF        Y++   +       ++ +V A D D G N  V Y+I
Sbjct:  626 RPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPS--TNPGTVVFQVIAVDNDTGMNAEVRYSI 715          

HSP 7 Score: 81.6481 bits (200), Expect = 8.408e-15
Identity = 81/290 (27.93%), Postives = 131/290 (45.17%), Query Frame = 3
Query:  393 QVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKE-CDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTAS---IRENDRTPLVLTSVMVNDDDKGINSQ 1238
            Q   + + + DENDN P F+    T+SI EN+  G +L+  +A D DS PN+ I Y +               A   F++  +T        L ++K++DRE+ D++   ++A+D+G      + T+ VSIID NDNSP +     +  V E   R G +  +   D D     N  +   I D        N  F I   +  +        + +   TF++ A DGG   R +S  VTI + D ND+ P   +  S  S   +  +     V+  V+  D+D G+N++
Sbjct:  448 QSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGP------------DAPPEFSLDCRTG------MLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGD--NSAVTLSILDE-------NDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAE 710          

HSP 8 Score: 65.855 bits (159), Expect = 1.023e-14
Identity = 66/223 (29.60%), Postives = 101/223 (45.29%), Query Frame = 3
Query: 1608 RRKLLFYNHYFRENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFI---NISTDSQVGKVLANFEAEDPDKGENGTITYSII 2267
            R + +F N +  E  + +  D E   +Y++ ++A D G+P LN +  + I++ D ND  PVF Q +       N    I   L KV+A D D G N  + Y +                       G+L +   +DRE+       I+A DNG P L++   V V ++D NDN P F +  N+ NF    N+     VG +       DPD G+N  +T SI+
Sbjct:  407 RLRPVFSNQFLLETAAYL--DYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQ--LTKVSAMDADSGPNAKINYLLGPD---------APPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTH--NEYNFYVPENLPRHGTVGLITVT----DPDYGDNSAVTLSIL 610          

HSP 9 Score: 36.1946 bits (82), Expect = 1.023e-14
Identity = 26/88 (29.55%), Postives = 38/88 (43.18%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRF---------TLTENNNIGAPIGYVRAYDPDSNENGRVS 1590
             DRE    + +L+   D G  P     +  V + D NDN P     DIR+          L+EN  +   I  +   D D++ NGRV+
Sbjct:  315 LDREETPNHKLLVLASDGGLMP--ARAMVLVNVTDVNDNVPSI---DIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVT 397          

HSP 10 Score: 51.9878 bits (123), Expect = 7.232e-10
Identity = 27/86 (31.40%), Postives = 45/86 (52.33%), Query Frame = 3
Query: 1656 QMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYA 1913
            Q E+DRE KD Y + +  +D G P  + T  + + + D ND  PVFK+         N  A +   + ++ A D D+GEN  ++++
Sbjct:  204 QKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPEN--APVGTSVTQLHATDADIGENAKIHFS 287          

HSP 11 Score: 33.113 bits (74), Expect = 7.232e-10
Identity = 19/53 (35.85%), Postives = 29/53 (54.72%), Query Frame = 1
Query: 1450 IIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNN 1608
            I D NDNAP F +  I  ++ EN+ I +      A DPD   NG  +Y+++ +
Sbjct:  129 IEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKS 181          
BLAST of Protocadherin-1 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 66.6254 bits (161), Expect = 2.648e-27
Identity = 75/286 (26.22%), Postives = 127/286 (44.41%), Query Frame = 3
Query:  423 DENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQ--GSCTITVSIIDVNDNSPQWPTVNISKTV-KECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYF 1271
            D ND+ P      K ++++EN  IG E+    A D DS PN II+Y                + S  F I   +        +K  K +DRE   R+ L + A D G      S TI V + D+NDN+P +     + T+ +E  R   ++ L+A D D+    + +I Y+I +    +E+ + L      ++   S  L+  D K  +   I+A D GG +    V + I+D N  AP    +  +  I E+      + ++   D D+G N++    ++ + +F
Sbjct:  112 DINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKY--------------SMEGSEDFIIDEDS------GLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDE----DQKITYRIEE--ADREVFSILDIGDQGAILSVSGELKRQDHKVRVE--ISATDQGGLQGRCVVNVFIDDVNS-APYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFF 368          

HSP 2 Score: 50.447 bits (119), Expect = 2.648e-27
Identity = 28/80 (35.00%), Postives = 39/80 (48.75%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSY 1593
             DRE  + +SV++   D   PPL       V + D NDN+P+F S     T++E+  +G     V A D D   NG V Y
Sbjct:  383 LDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDY 462          

HSP 3 Score: 45.8246 bits (107), Expect = 2.648e-27
Identity = 29/90 (32.22%), Postives = 45/90 (50.00%), Query Frame = 3
Query: 1650 RSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQ-QYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAI 1916
            R   ++DRE      L I A+D G PSL+    + + + DVND  P F+Q  Y   I E    + + + +G + A D D G+N  + + I
Sbjct:  486 RVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAEN---SPVGSTVGTIVARDADEGDNADISFRI 572          

HSP 4 Score: 54.299 bits (129), Expect = 5.281e-17
Identity = 88/350 (25.14%), Postives = 151/350 (43.14%), Query Frame = 3
Query:  231 SGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHA--DVCQKIILISINGQVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQG-PLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEI--EDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTT 1265
            SG   II    + +  FI+   SG++K    +DRET  +++     + +   S+N     + V + D NDN P F  +   ++I E    GS++   T   +D++ +  I Y I+             +A R     +   ++  I  L +  E+ R++  +  + + A D G  QG C + V I DVN ++P +     S  + E    G P++ L+A D D     N +I Y I D+S       + F I  SS  +S       + +   +  +TA D      +T+  IE+  +D ND++P        A+I E+         V   D D G N   +  LN+++
Sbjct:  149 SGPNGIIKYSMEGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTT-IAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQII--TLKAVDNDEDQKITYRIE-------------EADREVFSILDIGDQGAI--LSVSGELKRQD-HKVRVEISATDQGGLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGD--NARIVYSI-DSS-------QFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESS 468          

HSP 5 Score: 53.9138 bits (128), Expect = 5.281e-17
Identity = 29/93 (31.18%), Postives = 44/93 (47.31%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
             DRE  +   + I   D G P L      T+T+ D NDNAP F        + EN+ +G+ +G + A D D  +N  +S++I    +   F I
Sbjct:  491 LDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDI 583          

HSP 6 Score: 58.5362 bits (140), Expect = 6.479e-17
Identity = 70/255 (27.45%), Postives = 124/255 (48.63%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF-KQQYFYQITE----GNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFK-YPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPP 2411
            +DRE   +YSL + A+D G PSLN + T+ + + D+ND  P F K++Y   I+E    G+ + T+ A+         D  E+  + Y I +    ++R+    L++        ++  G + R+    ++ EI A D G  Q      V+   +D  ++ P F  +P +    + I   S +G  +   +AED D+G+N  I YSI S +    +      + G + ++ +L +RE  R    +I+ ASD+ +PP
Sbjct:  180 LDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAV---------DNDEDQKITYRIEE----ADREVFSILDIGDQGAILSVS--GELKRQDH-KVRVEISATDQGGLQ---GRCVVNVFIDDVNSAPYFNDHPFS----VKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRID-----PSSGDISVSSDL-DRED-RATFSVIVTASDHASPP 404          

HSP 7 Score: 49.2914 bits (116), Expect = 6.479e-17
Identity = 27/78 (34.62%), Postives = 40/78 (51.28%), Query Frame = 1
Query: 1381 SVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDE 1614
            + +IR  D  +P L      T+ +ID ND+AP   +     TL EN  IG  +G V A D DS  NG + Y +  +++
Sbjct:   87 TAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED 164          

HSP 8 Score: 67.3958 bits (163), Expect = 9.867e-16
Identity = 59/205 (28.78%), Postives = 97/205 (47.32%), Query Frame = 3
Query: 1662 EIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF-KQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNF-INISTDSQVGKVLANFEAEDPDKGENGTITYSIIS 2270
            ++DRE +  +S+ + A D+  P LN +  + + + D+ND  P F    Y   I+E   + T      +V+A D D+G NG V Y + +     + Q                     +DREQ   I   I A D G P LSA + + + + DVNDN P F+    ++++ + I+ +S VG  +    A D D+G+N  I++ I  
Sbjct:  382 DLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFL---QVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSK-----LDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFE----QLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFG 574          

HSP 9 Score: 36.5798 bits (83), Expect = 9.867e-16
Identity = 19/60 (31.67%), Postives = 32/60 (53.33%), Query Frame = 1
Query: 1453 IDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
            ID+ ++AP F        + E++ IG P+  ++A D D  +N R+ Y I   D + +F I
Sbjct:  314 IDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI---DSSQFFRI 370          

HSP 10 Score: 50.447 bits (119), Expect = 4.382e-13
Identity = 24/55 (43.64%), Postives = 32/55 (58.18%), Query Frame = 1
Query: 1435 LFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
            +  +T++D NDNAP F SD    T+ EN  I A I  V+A D D   NG+V Y +
Sbjct:    1 MVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSM 55          

HSP 11 Score: 44.2838 bits (103), Expect = 4.382e-13
Identity = 53/188 (28.19%), Postives = 83/188 (44.15%), Query Frame = 3
Query: 1701 IMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSI 2264
            I AKD  +P+L+ T  + I ++D+ND  P           E N    I   +G+V A D+D G NG + Y++    D    +++  +   K           ++DRE       ++ A D G P L+    + V + D+NDN P F     K   + IS +   G  +   +A D D  E+  ITY I
Sbjct:   90 IRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEEN--VAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDSGLIKTTK-----------LLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFD---KKEYNVTISEEMPRGSQIITLKAVDND--EDQKITYRI 259          

HSP 12 Score: 50.447 bits (119), Expect = 4.949e-11
Identity = 29/96 (30.21%), Postives = 48/96 (50.00%), Query Frame = 1
Query: 1351 FFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITI 1638
              DRE+ + YS+ +   D+G P L       V + D NDNAP F   +   T++E    G+ I  ++A D D  E+ +++Y+I   D   +  + I
Sbjct:  179 LLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDND--EDQKITYRIEEADREVFSILDI 272          

HSP 13 Score: 37.3502 bits (85), Expect = 4.949e-11
Identity = 69/264 (26.14%), Postives = 108/264 (40.91%), Query Frame = 3
Query: 1659 MEIDREIKDQ---YSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYF-YQITEGNGLATIHAILG----KVTADDKDLGENGTVYYAIRQ----KYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQL-QNDGRLILTKNL-REREGIRLPDRLIIRASDNGTP 2408
            + +  E+K Q     + I A D G   L   C V++ I DVN   P F    F  +I E       H+ +G     + A+D D G+N  + Y+I      + D S+   ++  +               +DRE   +    + A D+  P L+    + V + D+NDN P+F    +      IS D  VG       A D D G NG + Y +           ++L +  G L ++  L RE+  + +   L I A D GTP
Sbjct:  279 LSVSGELKRQDHKVRVEISATDQG--GLQGRCVVNVFIDDVNS-APYFNDHPFSVKIPE-------HSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRIDPSSGDISVSSD---------------LDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQF---TSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIV---LPIFARDRGTP 511          

HSP 14 Score: 58.5362 bits (140), Expect = 3.255e-8
Identity = 82/347 (23.63%), Postives = 141/347 (40.63%), Query Frame = 3
Query:  138 IKLKISENKGSGEDLINLKNYIIIHKLPINSSGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQV-------LEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCT--ITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYI---AXXXXXXXXXXXXXMDLKTYIT--FFITAVDGGGRENSTAVTIEIEDCNDHAPNI 1136
              +KI E+   G  +I LK     H    N+   Y+I     D + +F +   SG +   +++DRE      D     ++++ +           ++ V ++D NDN PQF+      +I E+  +G+     +A D D  PN I+ YF           +N+  +S    +F   ++R     L++  ++DRE+     L + A D G    S    IT+++ DVNDN+P +  ++    + E    G  V      RD     N  I ++I   +  K     LF I   A  +  +        D +      FF      G   ++  V I + D ND+ P +
Sbjct:  328 FSVKIPEHSPIGYPVITLKAED--HDRGDNARIVYSI-----DSSQFFRIDPSSGDISVSSDLDRE------DRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYF-----------LNESSSSPSIQLF--RLDRTS-GTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVG-TIVARDADEGDNADISFRIFGGADAK-----LFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQLSSTVPVRIHVSDVNDNKPAL 641          
BLAST of Protocadherin-1 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 66.6254 bits (161), Expect = 2.956e-27
Identity = 75/286 (26.22%), Postives = 127/286 (44.41%), Query Frame = 3
Query:  423 DENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQ--GSCTITVSIIDVNDNSPQWPTVNISKTV-KECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYF 1271
            D ND+ P      K ++++EN  IG E+    A D DS PN II+Y                + S  F I   +        +K  K +DRE   R+ L + A D G      S TI V + D+NDN+P +     + T+ +E  R   ++ L+A D D+    + +I Y+I +    +E+ + L      ++   S  L+  D K  +   I+A D GG +    V + I+D N  AP    +  +  I E+      + ++   D D+G N++    ++ + +F
Sbjct:  471 DINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKY--------------SMEGSEDFIIDEDS------GLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDE----DQKITYRIEE--ADREVFSILDIGDQGAILSVSGELKRQDHKVRVE--ISATDQGGLQGRCVVNVFIDDVNS-APYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFF 727          

HSP 2 Score: 50.0618 bits (118), Expect = 2.956e-27
Identity = 28/80 (35.00%), Postives = 39/80 (48.75%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSY 1593
             DRE  + +SV++   D   PPL       V + D NDN+P+F S     T++E+  +G     V A D D   NG V Y
Sbjct:  742 LDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDY 821          

HSP 3 Score: 46.2098 bits (108), Expect = 2.956e-27
Identity = 29/90 (32.22%), Postives = 45/90 (50.00%), Query Frame = 3
Query: 1650 RSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQ-QYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAI 1916
            R   ++DRE      L I A+D G PSL+    + + + DVND  P F+Q  Y   I E    + + + +G + A D D G+N  + + I
Sbjct:  845 RVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAEN---SPVGSTVGTIVARDADEGDNADISFRI 931          

HSP 4 Score: 73.559 bits (179), Expect = 8.723e-27
Identity = 82/333 (24.62%), Postives = 146/333 (43.84%), Query Frame = 3
Query:  273 NYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQV-------LEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLK-TYITFFITAVDGGGRENSTAV--TIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINS 1235
            N F L + SG ++   ++DRE + KH      I+ ++   +V         V+V++ D  DN P F        I+E++ IG+ +    A DLDS  N  I Y + + + +++  +N                  K   ++    +DRE +    L +IA D G  K++ +  + ++++DVNDN+P + + + + T+ E +   P V       D+    NG++ Y ++ +S        +  +            + +D K + IT  I A DG     S+ V  TI + D NDHAP +   +   ++ EN      +  V   D+D G N 
Sbjct:  211 NLFTLDTMSGEIRLAKSMDREVLDKH------ILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAIN-----------------AKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILE-NITIPAVIATVKATDEDFGTNGKVHYSMASSS-------GIGGLTIDYSTGEVTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNG 512          

HSP 5 Score: 50.447 bits (119), Expect = 8.723e-27
Identity = 29/96 (30.21%), Postives = 48/96 (50.00%), Query Frame = 1
Query: 1351 FFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITI 1638
              DRE+ + YS+ +   D+G P L       V + D NDNAP F   +   T++E    G+ I  ++A D D  E+ +++Y+I   D   +  + I
Sbjct:  538 LLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDND--EDQKITYRIEEADREVFSILDI 631          

HSP 6 Score: 37.3502 bits (85), Expect = 8.723e-27
Identity = 69/264 (26.14%), Postives = 108/264 (40.91%), Query Frame = 3
Query: 1659 MEIDREIKDQ---YSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYF-YQITEGNGLATIHAILG----KVTADDKDLGENGTVYYAIRQ----KYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQL-QNDGRLILTKNL-REREGIRLPDRLIIRASDNGTP 2408
            + +  E+K Q     + I A D G   L   C V++ I DVN   P F    F  +I E       H+ +G     + A+D D G+N  + Y+I      + D S+   ++  +               +DRE   +    + A D+  P L+    + V + D+NDN P+F    +      IS D  VG       A D D G NG + Y +           ++L +  G L ++  L RE+  + +   L I A D GTP
Sbjct:  638 LSVSGELKRQDHKVRVEISATDQG--GLQGRCVVNVFIDDVNS-APYFNDHPFSVKIPE-------HSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRIDPSSGDISVSSD---------------LDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQF---TSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIV---LPIFARDRGTP 870          

HSP 7 Score: 62.3882 bits (150), Expect = 4.304e-18
Identity = 38/104 (36.54%), Postives = 52/104 (50.00%), Query Frame = 1
Query: 1297 QSNGRQLFMYNIKK-IPDTF--FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
            + NG+ L   N K  +  T    DRE+LS   + +   D G P      +  +T++D NDNAP F SD    T+ EN  I A I  V+A D D   NG+V Y +
Sbjct:  311 EGNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSM 414          

HSP 8 Score: 44.669 bits (104), Expect = 4.304e-18
Identity = 53/188 (28.19%), Postives = 83/188 (44.15%), Query Frame = 3
Query: 1701 IMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSI 2264
            I AKD  +P+L+ T  + I ++D+ND  P           E N    I   +G+V A D+D G NG + Y++    D    +++  +   K           ++DRE       ++ A D G P L+    + V + D+NDN P F     K   + IS +   G  +   +A D D  E+  ITY I
Sbjct:  449 IRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEEN--VAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDSGLIKTTK-----------LLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFD---KKEYNVTISEEMPRGSQIITLKAVDND--EDQKITYRI 618          

HSP 9 Score: 24.6386 bits (52), Expect = 4.304e-18
Identity = 16/59 (27.12%), Postives = 24/59 (40.68%), Query Frame = 3
Query: 1083 STAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLND 1259
            ST V + + D  D++P          IRE+      + SV   D D G N +    L +
Sbjct:  253 STTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGE 311          

HSP 10 Score: 70.4774 bits (171), Expect = 5.453e-18
Identity = 78/265 (29.43%), Postives = 114/265 (43.02%), Query Frame = 3
Query: 1650 RSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQ-QYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKY-------DHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVS----IQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTP 2408
            ++   +DRE      L ++A D G P    T  V I ++DVND  PVF    Y   I E     TI A++  V A D+D G NG V+Y++           D+S  +                    V  RE++ +    I A I A D  +P LS+   + ++V+D+ND+ P     I     I +  +  +G+ +    A D D G NG I YS      ME +  + +  D  LI T  L +RE       L + A D GTP
Sbjct:  328 QTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILEN---ITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGE--------------------VTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTL---IAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYS------MEGSEDFIIDEDSGLIKTTKLLDRETTARYS-LKVTARDMGTP 559          

HSP 11 Score: 40.817 bits (94), Expect = 5.453e-18
Identity = 24/81 (29.63%), Postives = 37/81 (45.68%), Query Frame = 1
Query: 1357 DRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
            DRE L  + + +   +   P +       V ++D  DN+P F  D     + E+  IG  +  V A D DS ENG + Y +
Sbjct:  229 DREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSL 309          

HSP 12 Score: 54.6842 bits (130), Expect = 4.507e-17
Identity = 88/350 (25.14%), Postives = 151/350 (43.14%), Query Frame = 3
Query:  231 SGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHA--DVCQKIILISINGQVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQG-PLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEI--EDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTT 1265
            SG   II    + +  FI+   SG++K    +DRET  +++     + +   S+N     + V + D NDN P F  +   ++I E    GS++   T   +D++ +  I Y I+             +A R     +   ++  I  L +  E+ R++  +  + + A D G  QG C + V I DVN ++P +     S  + E    G P++ L+A D D     N +I Y I D+S       + F I  SS  +S       + +   +  +TA D      +T+  IE+  +D ND++P        A+I E+         V   D D G N   +  LN+++
Sbjct:  508 SGPNGIIKYSMEGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTT-IAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQII--TLKAVDNDEDQKITYRIE-------------EADREVFSILDIGDQGAI--LSVSGELKRQD-HKVRVEISATDQGGLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGD--NARIVYSI-DSS-------QFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESS 827          

HSP 13 Score: 53.9138 bits (128), Expect = 4.507e-17
Identity = 29/93 (31.18%), Postives = 44/93 (47.31%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
             DRE  +   + I   D G P L      T+T+ D NDNAP F        + EN+ +G+ +G + A D D  +N  +S++I    +   F I
Sbjct:  850 LDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDI 942          

HSP 14 Score: 58.5362 bits (140), Expect = 7.546e-17
Identity = 70/255 (27.45%), Postives = 124/255 (48.63%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF-KQQYFYQITE----GNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFK-YPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPP 2411
            +DRE   +YSL + A+D G PSLN + T+ + + D+ND  P F K++Y   I+E    G+ + T+ A+         D  E+  + Y I +    ++R+    L++        ++  G + R+    ++ EI A D G  Q      V+   +D  ++ P F  +P +    + I   S +G  +   +AED D+G+N  I YSI S +    +      + G + ++ +L +RE  R    +I+ ASD+ +PP
Sbjct:  539 LDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAV---------DNDEDQKITYRIEE----ADREVFSILDIGDQGAILSVS--GELKRQDH-KVRVEISATDQGGLQ---GRCVVNVFIDDVNSAPYFNDHPFS----VKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRID-----PSSGDISVSSDL-DRED-RATFSVIVTASDHASPP 763          

HSP 15 Score: 48.9062 bits (115), Expect = 7.546e-17
Identity = 27/78 (34.62%), Postives = 40/78 (51.28%), Query Frame = 1
Query: 1381 SVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDE 1614
            + +IR  D  +P L      T+ +ID ND+AP   +     TL EN  IG  +G V A D DS  NG + Y +  +++
Sbjct:  446 TAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED 523          

HSP 16 Score: 67.3958 bits (163), Expect = 1.008e-15
Identity = 59/205 (28.78%), Postives = 97/205 (47.32%), Query Frame = 3
Query: 1662 EIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF-KQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNF-INISTDSQVGKVLANFEAEDPDKGENGTITYSIIS 2270
            ++DRE +  +S+ + A D+  P LN +  + + + D+ND  P F    Y   I+E   + T      +V+A D D+G NG V Y + +     + Q                     +DREQ   I   I A D G P LSA + + + + DVNDN P F+    ++++ + I+ +S VG  +    A D D+G+N  I++ I  
Sbjct:  741 DLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFL---QVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSK-----LDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFE----QLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFG 933          

HSP 17 Score: 36.5798 bits (83), Expect = 1.008e-15
Identity = 19/60 (31.67%), Postives = 32/60 (53.33%), Query Frame = 1
Query: 1453 IDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
            ID+ ++AP F        + E++ IG P+  ++A D D  +N R+ Y I   D + +F I
Sbjct:  673 IDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI---DSSQFFRI 729          

HSP 18 Score: 72.0182 bits (175), Expect = 2.899e-12
Identity = 83/278 (29.86%), Postives = 128/278 (46.04%), Query Frame = 3
Query: 1644 ENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF-KQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFK---YPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKN-----LRER-EGIRLPDRLIIRASDNGTPPKAELVTVNIRYI 2447
            E R    +DRE+ D++ L + A +  +P+++ + TV + +LDV D  P+F K  YF +I E    A I   +  V A D D GENG + Y++ +    +         L      G++     +DRE +  I+ ++IA D G P+  + A V + V+DVNDN P F    Y +  +  I I        V+A  +A D D G NG + YS+ S   +           G L +  +     LRER +    P   +IRA D   P  +  V + I  I
Sbjct:  221 EIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIRED---APIGTTVLSVFARDLDSGENGEIEYSLGEGNGKN--------LLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPA------VIATVKATDEDFGTNGKVHYSMASSSGI-----------GGLTIDYSTGEVTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVI 470          

HSP 19 Score: 62.7734 bits (151), Expect = 1.851e-9
Identity = 57/194 (29.38%), Postives = 90/194 (46.39%), Query Frame = 3
Query:  669 LKLIKEIDREEIDRFELILIAEDSGKQ--QGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGG--RENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQ 1238
            ++L K +DRE +D+  L + A +        S T+ V ++DV DNSP +   +    ++E    G  V L  F RD  S  NG+I+Y + + + K      L  I   S  + +      +  + I   + A D G   RE++  V I + D ND+AP  A      +I EN   P V+ +V   D+D G N +
Sbjct:  222 IRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTV-LSVFARDLDSGENGEIEYSLGEGNGKN-----LLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGK 409          

HSP 20 Score: 58.9214 bits (141), Expect = 3.171e-8
Identity = 82/347 (23.63%), Postives = 141/347 (40.63%), Query Frame = 3
Query:  138 IKLKISENKGSGEDLINLKNYIIIHKLPINSSGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQV-------LEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCT--ITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYI---AXXXXXXXXXXXXXMDLKTYIT--FFITAVDGGGRENSTAVTIEIEDCNDHAPNI 1136
              +KI E+   G  +I LK     H    N+   Y+I     D + +F +   SG +   +++DRE      D     ++++ +           ++ V ++D NDN PQF+      +I E+  +G+     +A D D  PN I+ YF           +N+  +S    +F   ++R     L++  ++DRE+     L + A D G    S    IT+++ DVNDN+P +  ++    + E    G  V      RD     N  I ++I   +  K     LF I   A  +  +        D +      FF      G   ++  V I + D ND+ P +
Sbjct:  687 FSVKIPEHSPIGYPVITLKAED--HDRGDNARIVYSI-----DSSQFFRIDPSSGDISVSSDLDRE------DRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYF-----------LNESSSSPSIQLF--RLDRTS-GTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVG-TIVARDADEGDNADISFRIFGGADAK-----LFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQLSSTVPVRIHVSDVNDNKPAL 1000          
BLAST of Protocadherin-1 vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 70.8626 bits (172), Expect = 2.564e-18
Identity = 76/260 (29.23%), Postives = 122/260 (46.92%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYF-YQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIR 2441
            +D E    Y L + A D G P  +   T+ I +LDVND  P F++ ++  ++ E +   T   I+GKV A DKD  ENG + Y I    ++      +G    K +          +DRE +  +   I+A D G P  S+ A+  + VLDVNDN P        +  I +   S +   +    A DPDKG NG++ Y       ++ +L + ++++G + L + L   +      RL +  SD G P K+ +  V +R
Sbjct:  900 LDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKT---IVGKVVARDKDSLENGQIVYRITNGSEYFGIDEKLGNVYTKRS----------IDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPS----CLSITPIVVPAGSPLSTAIGTIVAMDPDKGLNGSVLY----RAQLQSSL-FVVKSNGDVYLRRQLNASD--ERHQRLSVIVSDQGVPRKSVVCHVPVR 1135          

HSP 2 Score: 41.5874 bits (96), Expect = 2.564e-18
Identity = 19/55 (34.55%), Postives = 31/55 (56.36%), Query Frame = 1
Query: 1444 VTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNN 1608
            + I D NDN P+F S  +  ++ E+  +  P   V+A D D  +NG V Y I+++
Sbjct:  825 IFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISS 879          

HSP 3 Score: 57.7658 bits (138), Expect = 8.045e-17
Identity = 33/95 (34.74%), Postives = 48/95 (50.53%), Query Frame = 1
Query: 1348 TFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
            +  D E+   Y + ++  DLG PP        + ++D NDNAP+F        + EN+     +G V A D DS ENG++ Y+I N  E  YF I
Sbjct:  898 SLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSE--YFGI 990          

HSP 4 Score: 49.6766 bits (117), Expect = 8.045e-17
Identity = 29/86 (33.72%), Postives = 45/86 (52.33%), Query Frame = 3
Query: 1653 SQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYY 1910
            ++  IDRE+     ++I+A+D G P  + T +  I +LDVND  P         +  G+ L+T    +G + A D D G NG+V Y
Sbjct:  999 TKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSITPIVVPAGSPLST---AIGTIVAMDPDKGLNGSVLY 1081          

HSP 5 Score: 74.7146 bits (182), Expect = 4.385e-13
Identity = 62/242 (25.62%), Postives = 112/242 (46.28%), Query Frame = 3
Query:  225 NSSGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQ--GSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGP-LVELQAFDRDDSSTPNGQIKYKISDNS 941
            +++  Y ++  +   + +  +   SG +    ++D E   K   V  K+     +G+ ++++V ++DENDN P F+ +   L I E + +G+  +LPT  D D     + R+ I            Q   +  F +  + +N      L +  ++DRE  D++EL++ A+D GK    G    ++ IID NDN+P +     + +V      G  L+ +QA D D     N +I Y I   S
Sbjct:   51 SAAPKYFVVFPDEQTSKFLKVDERSGEISTIAHLDYEKRSKFDIVAVKV---EESGETIDILVEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVIL-----------QGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGE--NSRISYDIKKTS 276          

HSP 6 Score: 58.9214 bits (141), Expect = 1.539e-11
Identity = 33/93 (35.48%), Postives = 49/93 (52.69%), Query Frame = 3
Query: 1662 EIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSN 1940
            ++DRE +D+Y L I A+D G+P+        I I+D ND  PVF +  +      N   +I + L  V A D D+GEN  + Y I++    SN
Sbjct:  190 QLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSAN--ISIGSHLITVQATDADIGENSRISYDIKKTSAPSN 280          

HSP 7 Score: 30.8018 bits (68), Expect = 1.539e-11
Identity = 17/63 (26.98%), Postives = 27/63 (42.86%), Query Frame = 1
Query: 1444 VTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
            V + DENDNAP F    ++  ++E   +G         D D  +     + IL  + N  F +
Sbjct:  110 VEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQGNVNNVFKL 172          

HSP 8 Score: 69.3218 bits (168), Expect = 2.139e-11
Identity = 78/323 (24.15%), Postives = 136/323 (42.11%), Query Frame = 3
Query:  402 EVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQ----WPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPL--VLTSVMVNDDDKGINSQFNCDLNDTTYFTMVKECLQSIKWTAALYVQYQKN 1340
            +V+++I D NDN PQFS     +SI+E+  +     +  A D D + N  +RY I   H      ++QF                    L     +D E    ++L + A D G   +  + T+ + ++DVNDN+P+    W T+ + +        G +V      RD  S  NGQI Y+I++ S         F I      + ++     ++ +++   I A D G   R ++ +  I + D ND+ P+     S   I     +PL   + +++  D DKG+N           Y   ++  L  +K    +Y++ Q N
Sbjct:  822 QVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQ-----------------LSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVA-----RDKDSLENGQIVYRITNGS-------EYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCL---SITPIVVPAGSPLSTAIGTIVAMDPDKGLN-------GSVLYRAQLQSSLFVVKSNGDVYLRRQLN 1105          

HSP 9 Score: 62.3882 bits (150), Expect = 2.748e-9
Identity = 39/116 (33.62%), Postives = 58/116 (50.00%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNND--ENYYFTITILGKIEAKWKLIEKSKTNIL 1695
             DRE    Y +LI   D G+P  +G+   ++ IID NDNAP F       +++ N +IG+ +  V+A D D  EN R+SY I       N  F I+  G I     L+  S  +++
Sbjct:  191 LDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAISQSGVITTTASLLPASTHDVI 306          

HSP 10 Score: 43.1282 bits (100), Expect = 1.111e-7
Identity = 55/233 (23.61%), Postives = 99/233 (42.49%), Query Frame = 3
Query:  612 ASRYFTIFI--KTINRMKI----PYLKLIKEIDREEIDRFELILI-AEDSGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXM------DLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTT 1265
            A +YF +F   +T   +K+      +  I  +D E+  +F+++ +  E+SG+   +  I V + D NDN+P +    +   + E  + G    L      D        K+ +      +  +N +F +A   +    Q   ++      + +      I A DGG   +      +IEI D ND+AP  +  + TAS+  N      L +V   D D G NS+ + D+  T+
Sbjct:   53 APKYFVVFPDEQTSKFLKVDERSGEISTIAHLDYEKRSKFDIVAVKVEESGE---TIDILVEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGP------KFDVHRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTS 276          

HSP 11 Score: 31.187 bits (69), Expect = 1.111e-7
Identity = 47/208 (22.60%), Postives = 82/208 (39.42%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGE-----PSLNDTCTVHIRILDVNDCVPVFKQQYFY---QITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSI 2264
            +DRE   ++ L  + + +G+     P L       + I D+ND  P +     +     T+G            +TA D DLG+NG + Y++                +      G + +   +D      I+  + A D G P LS    V+ D+LD     P+F+  + +   + I  D+ +G  L    A +   G +  I YS+
Sbjct:  401 LDRETASEHHLKFLLEKDGQIIIEHPQL-------LTIGDINDNAPQWHSSQIHISLNRTQGGSRT--------LTAKDPDLGQNGWIRYSV-----------LDTELVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQ---VEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSL 579          

HSP 12 Score: 21.1718 bits (43), Expect = 1.111e-7
Identity = 16/66 (24.24%), Postives = 30/66 (45.45%), Query Frame = 1
Query: 1372 SFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFT-------LTENNNIGAPIGYV 1548
            S + V++   D G P L    + T+T++    ++P     DI +        L EN+ +G+ +  V
Sbjct:  301 STHDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPL---DIIWLVESNSAHLMENSTLGSIVARV 363          

HSP 13 Score: 53.9138 bits (128), Expect = 9.769e-7
Identity = 79/307 (25.73%), Postives = 136/307 (44.30%), Query Frame = 3
Query:  204 IIHKLPINSSG-TYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQV-LEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTI--FIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQW--PTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEI 1106
             I KL    +G TY+I+  E +I++ F + S  G+++    +DRE + +++    K+I      Q+   V V +N+ NDN+P F M  K   + EN  +GS ++   A D+D+   + +RYF+    S         Q   +F I  F  TI+        L   +D E +    L + A D G       +T+ + D+NDN+P +  P    + +        P  +++A D D      G + Y +   S      + +F +A  S  L  + L     +  +T  +TA D G    ST+V + +
Sbjct: 1850 FIAKLQPELAGLTYSIV--EGNIDSAFSVDSE-GVIRTNLELDREILERYS---LKVIGTGSGQQIGTRVDVRVNNLNDNVPSFPMS-KPRRVPENLRVGSYVATVGAKDVDNL--APLRYFLVSDSSG--------QTPTHFNIDQFTGTIH--------LTAPLDFEVLPEHTLTIKATD-GSFDTFTNLTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLD----ARGALTYSLGQGS------SSIFRVAPESGALFMKVLPPAGERYLVT--VTATDNGVPSFSTSVPVSV 2118          

HSP 14 Score: 51.9878 bits (123), Expect = 3.890e-6
Identity = 29/59 (49.15%), Postives = 37/59 (62.71%), Query Frame = 1
Query: 1444 VTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILN-NDEN 1617
            V ++DENDN P F S     +L ++   G  IG + A D DS ENGRVSY+IL+ ND N
Sbjct: 2218 VIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLN 2276          
BLAST of Protocadherin-1 vs. Ensembl Celegans
Match: cdh-4 (Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI5])

HSP 1 Score: 58.9214 bits (141), Expect = 2.633e-14
Identity = 31/82 (37.80%), Postives = 45/82 (54.88%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
             D E+LS   + +   D G PPL  E    ++++DENDNAPKF  +     + EN+  G  +  V+A D DS   G VSY++
Sbjct: 3174 LDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYEL 3255          

HSP 2 Score: 40.0466 bits (92), Expect = 2.633e-14
Identity = 26/81 (32.10%), Postives = 38/81 (46.91%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVY 1907
            ID E   +Y+L ++AKD G P L     + I + D ND  P F       + +  G A  H +L K +  D D  +NG  +
Sbjct: 3284 IDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTFDDCNMTALVQ-EGEAIGHRLL-KFSVSDLDGPKNGAPF 3362          

HSP 3 Score: 68.5514 bits (166), Expect = 3.785e-11
Identity = 78/282 (27.66%), Postives = 132/282 (46.81%), Query Frame = 3
Query:  426 ENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSC--TITVSIIDVNDNSPQWPTVNISKTVKECDRQGP-LVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLN 1256
            EN + P FS   + + + E++ IG+ ++   A+D D+  N  IRY I DI       +   + S   T+             KL+KE  + E+   +L + A D+G    S   T+ + I DVN++SPQ+  V+    + E ++ G  + ++ A D D  +  NG+IK+ + +N  K  +I+    I   +  +        + +   TF I A D G   R + T +TI +ED ND+ P   +  S A I E+      ++ +   D+D G NS+    LN
Sbjct:  601 ENKHSPVFSSFPEIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEVLTVDEQSGEITVASD--------LSKLMKE--KLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGN--NGKIKFSLGNNQEKSSVIS----IDAKTGIVKLLKSLDREDQDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQHSRARIPEDLPHGAFVSCMAAFDEDIGQNSKLKFLLN 866          

HSP 4 Score: 37.7354 bits (86), Expect = 5.776e-10
Identity = 28/93 (30.11%), Postives = 42/93 (45.16%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
             DRE    ++  I   D G P  V     T+++ D NDN PK      R  + E+   GA +  + A+D D  +N ++ +  L N E   F I
Sbjct:  784 LDREDQDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQHSRARIPEDLPHGAFVSCMAAFDEDIGQNSKLKF--LLNSEKVPFRI 874          

HSP 5 Score: 35.039 bits (79), Expect = 5.776e-10
Identity = 80/361 (22.16%), Postives = 146/361 (40.44%), Query Frame = 3
Query:  252 SNEPDINNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQVLE--VMVYINDENDNIPQFS---MRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDI------HSRDI------RRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELI------NRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIE--IEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLND 1259
            S+ P+    F + S +GIL+    I+R     +  V     L  IN ++ E  V + I D ND+ P FS   MR   + I +  D+   + +   D  + E   I+  F  ++      ++ +I      ++ N + A+ +       ++RM    L   K   +    + + I+I E   K     +    I++V +++P    V                +LQA D D     NG I+Y I D +     +      +    +A     L  + L+++D++      ++A+D G    S+  T++  I+D N+H+P          I EN++    +  V  ND D G N +    L +
Sbjct:  427 SDLPNATLPFAIGSKNGILRVSAKINRSERVYNFKVIAS--LHGINEKLAEKDVSIEILDSNDHAPVFSAKWMRQTPIVIGKPGDV--LVKVDATDQDEGENGKIVYKFTSELPLEINANTGEITLVEVPKKGNSWPATVWAIDLGLPLSRMSALNLMFYKNGTKIPA-KPKPIIIQESENKHSPVFSSFPEIVEVTEDAPIGTVV---------------AKLQANDEDTGY--NGFIRYVIHDIAGSSHEVLTVDEQSGEITVASDLSKLMKEKLEVLDVQ----LKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGN 761          

HSP 6 Score: 30.4166 bits (67), Expect = 5.776e-10
Identity = 24/96 (25.00%), Postives = 48/96 (50.00%), Query Frame = 3
Query: 1689 YSLTIMAKDNGEPSLNDTCTVHIRILDVN------DCVPVFKQQYFYQITE-GNGLATIHAILGKVTADDKD----------LGENGTVYYAIRQK 1925
            ++L+I   D+G+P L+ +C +H+ ++D+       +   V K+   Y+ +E G  +  I A   K T D++           +G +G  +++I QK
Sbjct:  898 FNLSIEVADHGDPILSTSCHLHVELVDIAHNHLAIEFDDVAKEASVYENSEIGTEVIMIEA---KETGDEQKVKAENLEYRIIGGDGWPHFSIDQK 990          

HSP 7 Score: 63.1586 bits (152), Expect = 1.746e-9
Identity = 50/191 (26.18%), Postives = 88/191 (46.07%), Query Frame = 3
Query:  252 SNEPDINNYFILQSHSGILKQRNNIDRE-----TMCKHADVCQKIILISINGQVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQW 809
            S E D    F ++  +G +  ++++DRE      M   AD    +  I+       V V I D NDN P F   ++  +I E++ +G+ +++ +A D D  P+  IR+ +              + + YF +           +L +  ++DRE+ID ++LI  A D G        T+ + DVND+ PQ+
Sbjct: 2648 SEESDSFLPFSVERSTGKIIVKSSLDRERKNQWKMTIRADAAGGVHAITT------VTVDIGDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSL-------------VEENPYFDL------NENSGWLTVASQLDREKIDHYKLIARATDEGGFNTDLPFTIVVSDVNDSPPQF 2813          

HSP 8 Score: 41.5874 bits (96), Expect = 8.328e-9
Identity = 54/211 (25.59%), Postives = 90/211 (42.65%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF-KQQYFYQITE----GNGLATIHAI------LGKVTADDKDLGENGT----VYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQ-VGKVLANFEAEDPDKGENGT 2249
            +D E      LT++AKD+G P L     V I ++D ND  P F K++Y  ++ E    G  + T+ A+       G V+ + + + E  T    + +AI    D    Q+                    +D E++     ++IA D G+P L + A + + V D ND+ P F    +  N   +  + + +G  L  F   D D  +NG 
Sbjct: 3174 LDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSNGDVLISQS--------------------IDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTF----DDCNMTALVQEGEAIGHRLLKFSVSDLDGPKNGA 3360          

HSP 9 Score: 38.891 bits (89), Expect = 8.328e-9
Identity = 23/74 (31.08%), Postives = 35/74 (47.30%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNE 1575
             D E L F+++ +   D        +    VT+ID+NDNAP F        + E+ +IG  + + RA   D NE
Sbjct: 3074 LDSEILGFFNLTVVASD---GEFEDKATILVTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGDQNE 3144          

HSP 10 Score: 57.3806 bits (137), Expect = 8.830e-8
Identity = 72/283 (25.44%), Postives = 125/283 (44.17%), Query Frame = 3
Query:  405 VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIK-EIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVEL-QAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGIN--SQF 1241
            V V I  E+  +P+FS  H   S+ E++D+G+ +       +++E +  IR+ I          +   + S  F  F    +  KI    ++K  +DRE  +++++ + A+ +G      T+TV I DVNDN+P +       T+ E    G  V +  A DRDDS  P+G+I++ + + +P  +L     ++  +S     +         +      A D GG       TI + D ND  P     +    +     +P++  S  + DDD   N  SQF
Sbjct: 2594 VEVNIASESVKVPRFSNSHYLFSVMEDADVGNVIG--RVQQMETEIDE-IRFTI----------VPGSEESDSFLPFSVERSTGKI----IVKSSLDRERKNQWKMTIRADAAGGVHAITTVTVDIGDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDS--PSGRIRFSLVEENPYFDLNENSGWLTVASQLDREKID-------HYKLIARATDEGGFNTDLPFTIVVSDVNDSPPQFEKEEFNIDLHLPSTSPILHFS--IKDDDLSPNNVSQF 2848          

HSP 11 Score: 55.8398 bits (133), Expect = 2.267e-7
Identity = 79/383 (20.63%), Postives = 157/383 (40.99%), Query Frame = 3
Query:  264 DINNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQV------LEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPY-------LKLIKEIDREEIDRFELILIAEDSGKQ--QGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKY--KISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFIT--AVDGGGRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYFTMVKECLQSIKWTAALYVQYQKNPRHLF 1355
            D+ ++  L + +GIL     +D ET+        K+ +++ +  V       +V + + DENDN P+F        ++ENS  G ++    A D+DSE    + Y ++ +                      T +   +P+       + + + ID E+I ++ L +IA+D G+   +    + + + D ND++P +   N++  V+E +  G    L  F   D   P     +  +I  +  K   +N    +            + ++ +    + +T  A D  G+     +TI I   + HAP +   K   +  +N+    ++  +  +D+D+        D N    F +V+  +QS +      VQ  ++  HLF
Sbjct: 3154 DVTSFVNLNAQTGILTLAKPLDFETLS-----ALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSE-------------------TTTDTPVLPFAINSNGDVLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTFDDCNMTALVQEGEAIGH--RLLKFSVSDLDGPKNGAPFTVEIQGDGAKSFKVNEKLEL---------LTAKKLEYRKKDKYLLTVIAKDVKGKTTDCPLTIFIRQTSRHAPTMKPMKIQINTLQNELPEGIIGRLKASDEDEE-------DQNGLLRFGLVEGSIQSPR----AQVQESRS-THLF 3489          

HSP 12 Score: 55.0694 bits (131), Expect = 4.371e-7
Identity = 84/295 (28.47%), Postives = 136/295 (46.10%), Query Frame = 3
Query: 1650 RSQMEIDREIKDQYSLTIMAKDNG-----EPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYIPNNL--TPRNNA-LPPGINKKSND 2510
            R+   +DRE K  Y +T+ A+D+      +P   D   V IRILD ND  PV K+  +      N  A +  ++ KV A D D  +N      +  K +  + Q+   ++L    +         +DRE+    +  +   D G+PQL +   VIV+VLD NDN P F   I+     + S  S+    L    A D D+GEN  +TY+I      E +  + + N+G +I ++ +   E       L ++A+D+GTP + +     +    N+    PR +   PP I+ K +D
Sbjct:  994 RTTHLLDRETKSAYWITVEARDSKTDLYKDPRRRDVLHVFIRILDRNDHRPVAKKPMYIASVAENSPANV--VIVKVEATDADDVDN-DAAAPLMFKIERGDPQSFFRIDLTSGYITTSGIRR--LDREKQSEHELWVSICDGGEPQLCSNVIVIVNVLDENDNSPTFTQAIH-----HYSVRSKFAGKLCRIFAVDADEGENARLTYNI-----TEGDARFSIDNNGNIIASEAIHGDESY----ALTVQATDHGTPGQ-QFAATRVVLTANSAGQKPRKSKNSPPEISGKKSD 1268          

HSP 13 Score: 40.0466 bits (92), Expect = 1.126e-6
Identity = 26/76 (34.21%), Postives = 37/76 (48.68%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQY-FYQITEGNGLATIHAILGKVTADDKDLG 1889
            +DRE K+Q+ +TI A   G   ++   TV + I DVND  P F   Y  + I+E   + T   I   +  DD   G
Sbjct: 2672 LDRERKNQWKMTIRADAAG--GVHAITTVTVDIGDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSPSG 2745          

HSP 14 Score: 33.113 bits (74), Expect = 1.126e-6
Identity = 17/65 (26.15%), Postives = 31/65 (47.69%), Query Frame = 1
Query: 1381 SVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNE 1575
            S+ I+  D   PP        V I  E+   P+F +    F++ E+ ++G  IG V+  + + +E
Sbjct: 2575 SLTIKATDSANPPHHATTTVEVNIASESVKVPRFSNSHYLFSVMEDADVGNVIGRVQQMETEIDE 2639          

HSP 15 Score: 52.7582 bits (125), Expect = 2.182e-6
Identity = 51/172 (29.65%), Postives = 77/172 (44.77%), Query Frame = 3
Query:  384 INGQVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG-KQQGSCT-ITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVE-LQAFDRD 890
            +   V  + + I D N++ PQF      L I EN   G ++   TA+D D   N  I++ +           N  + S   +I  KT        +KL+K +DRE+ D     +IA D G   + S T +T+S+ DVNDN P+    +    + E    G  V  + AFD D
Sbjct:  699 VKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLG----------NNQEKSSVISIDAKT------GIVKLLKSLDREDQDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQHSRARIPEDLPHGAFVSCMAAFDED 854          

HSP 16 Score: 45.0542 bits (105), Expect = 2.300e-6
Identity = 32/108 (29.63%), Postives = 47/108 (43.52%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITILGKIEAKWKLIEK 1677
             D E +  Y++ +   D GRPPL  E L  + + DEND+AP F   ++   + E   IG  +      D D  +NG              FT+ I G     +K+ EK
Sbjct: 3284 IDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTFDDCNMTALVQEGEAIGHRLLKFSVSDLDGPKNG------------APFTVEIQGDGAKSFKVNEK 3379          

HSP 17 Score: 26.5646 bits (57), Expect = 2.300e-6
Identity = 25/89 (28.09%), Postives = 41/89 (46.07%), Query Frame = 3
Query: 1680 KDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKD-LGENGTVYYAIRQKYDHSNR 1943
            KD+Y LT++AKD    + +  C + I I   +   P  K       T  N L     I+G++ A D+D   +NG + + + +    S R
Sbjct: 3393 KDKYLLTVIAKDVKGKTTD--CPLTIFIRQTSRHAPTMKPMKIQINTLQNELP--EGIIGRLKASDEDEEDQNGLLRFGLVEGSIQSPR 3477          

HSP 18 Score: 51.9878 bits (123), Expect = 3.437e-6
Identity = 83/324 (25.62%), Postives = 137/324 (42.28%), Query Frame = 3
Query:  270 NNYFILQSHSGILK------------QRNNIDRETMCKHADVCQKIILISINGQVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIR-RMNQFQASRYFTIF-IKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKY--KISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAV--DGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRT 1181
             N F++   +GI+K            Q+    R T+  +++VC+++I            V I + NDN P+   +   +SI EN        LPT++D       I R   +D    +I+ RM       +  +F I  IN +    + ++K +D E +  F L ++A D G+ +   TI V++ID NDN+P +     S  V E +  G   EL  F R      N  I+Y  K SD +          ++  ++        + +D +T     +T V  D G    E    V I + D ND+AP     K    ++EN ++
Sbjct: 2951 GNVFVVNFRNGIVKVKESDQIDYEKNQQLEFHRLTIQDNSEVCKELI-----------TVVIENLNDNRPKIIEKLLKVSIDEN--------LPTSEDAR---QYITRIVAEDADFDEIKFRM----VDDFGGLFQIDDINGV----VTVVKPLDSEILGFFNLTVVASD-GEFEDKATILVTVIDQNDNAPTFEKSTYSMKVMESESIG--YELAHF-RASGGDQNETIEYYLKPSDVTS---------FVNLNAQTGILTLAKPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKS 3231          

HSP 19 Score: 39.6614 bits (91), Expect = 4.658e-6
Identity = 26/88 (29.55%), Postives = 40/88 (45.45%), Query Frame = 1
Query: 1360 RESLSFYSVLIR--CIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDEN 1617
            +E L    V ++   ID G P     K   + I D N+++P+F        ++EN   G  I  V A D D   NG++ + + NN E 
Sbjct:  678 KEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNNQEK 765          

HSP 20 Score: 31.187 bits (69), Expect = 4.658e-6
Identity = 24/85 (28.24%), Postives = 40/85 (47.06%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVP-VFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAI 1916
            +DRE +D ++  I+A D G P       + I + DVND  P    Q    +I E        A +  + A D+D+G+N  + + +
Sbjct:  784 LDREDQDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQHSRARIPED---LPHGAFVSCMAAFDEDIGQNSKLKFLL 865          
BLAST of Protocadherin-1 vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 57.3806 bits (137), Expect = 2.165e-12
Identity = 31/108 (28.70%), Postives = 54/108 (50.00%), Query Frame = 1
Query: 1291 YNQSNGRQLFMYN-----IKKIPDTFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
            Y QS  R+ F+ +     +   P   FDRE+     V ++  D G  PL+G   F+V ++D NDN+P+F       +++    +G  +  V A+D D+  N  ++Y +
Sbjct:  911 YTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSL 1018          

HSP 2 Score: 35.4242 bits (80), Expect = 2.165e-12
Identity = 77/315 (24.44%), Postives = 122/315 (38.73%), Query Frame = 3
Query:  399 LEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQ---QGSCTITVSIIDVNDNSPQW-PTVNISKTVKECDRQG--PLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYI----AXXXXXXXXXXXXXMDLKTYITFFITAVDGGG--------RENSTAVTIEIEDCNDHA---PNIAIYKSTASIREN--DRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYFT 1274
            +++ + I+D NDN+P F+    T  ++E+  +   +   TA D D+  NS I Y + D H+  I    +  A            R+    L      +R  + RF   + A D G+      S  I +   + ND S  + PT   +  V E D QG  P++++QA D D       ++ Y   D + +      LF I        L        L + +  I   +   D G           +   + I IED N++    P+ A Y   A I E      P  +  V   DDD    S  N D+  + Y+T
Sbjct:  626 VDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSV-DNHNFSINSNGEISAKV----------RLDADQLN-----ERHFVYRFN--VTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAE-DAQGGTPVIQIQARDAD-----RDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDD----SSANGDIVYSLYYT 912          

HSP 3 Score: 72.0182 bits (175), Expect = 3.452e-12
Identity = 103/408 (25.25%), Postives = 184/408 (45.10%), Query Frame = 3
Query:  147 KISENKGSGEDLINLKNYIIIHKLPINSSGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQ---VLEVMVYINDENDNIPQFSM-RHKTLSIQENSDIGSELSLPTADDLDS-EPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEID-----RFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPT---VNISKTVKECDRQGP-LVELQAFDRDDSSTPNGQIKYKISDNSPKKELIN--RLFYIAXXXXXXXXXXXXXMDLKTYITFFIT--AVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVND-DDKGINSQFNCDLNDTT---YFTMVKECLQS 1298
            ++ E++G G D+I +K     H L  +S+  Y++I         F +++ SG +  +  +D E   ++      ++LI+ +G+      V ++I D NDN PQF   ++ T  I+E+ DI   L    A D D  E +S I Y ++   + ++ R+ ++  +                 ++L+K +DR+         F +  I +D     G   + V++ D+NDNSP +P      I +  +     G   +++QA D DD +T N  I+Y I  N    +LIN   +F I  ++  + +      ++ +   F I   A D G   RE    VTI++ D ND+AP     +   S+ E       + S    D D++  ++ F   L++ +   Y T  K+  QS
Sbjct: 1343 RVKESEGEGHDVITIK----AHDLDKHSNLRYHLIGAGGG-RIPFGVRTDSGTIFVKEPLDFEASDQY-----HLVLIASDGRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGT-----------------IELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRN----KLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQS 1719          

HSP 4 Score: 58.5362 bits (140), Expect = 4.059e-8
Identity = 64/250 (25.60%), Postives = 106/250 (42.40%), Query Frame = 3
Query:  399 LEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRD-DSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYI---TFFITAV--DGGGRENSTAVTIEIEDCNDHAP 1130
            ++V + IND NDN P F  +     ++E+   G ++    A DLD   N  +RY +       I    +  +    TIF+K             + +D E  D++ L+LIA D G+   +  + + I DVNDN+PQ+     + TV E D   P V       D D    + +I Y++     + +  + +F I   S  +        D    +    F + A+  DG G      V + + D ND++P
Sbjct: 1319 VKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSN--LRYHLIGAGGGRIPFGVRTDSG---TIFVK-------------EPLDFEASDQYHLVLIASD-GRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRL-----EGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSP 1544          

HSP 5 Score: 39.2762 bits (90), Expect = 2.306e-7
Identity = 80/275 (29.09%), Postives = 115/275 (41.82%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQ-YFYQITEGNGLATIHAILGKVTADDKDLGENGT--VYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFIN-----ISTDSQVGKVLANFEAEDPD--KGENGTITYSIISHKHMEQNLPYQL-QNDGRLILTKNL-----REREGIRLPDRLIIRASDNGTPPKAELVTVNIR 2441
            +D E  DQY L ++A D      N T  V+I I DVND  P F+QQ Y   + E +    I  +L  V A D D  E  +  VY    Q  D   R       +  +         GV     +V       A D+    L   A+V V+V D+NDN P F  P     +I      I +D   G    + +A D D    EN  I Y I+ +K +     +++ QN G++   ++L      ERE I     + +RA+D G P +     V I+
Sbjct: 1397 LDFEASDQYHLVLIASDGRH---NATTNVYIHIEDVNDNAPQFEQQKYATTVIEED--VDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQ------AIDDDGNGLVGYADVQVNVRDINDNSPIF--PERLFGYIEENREPIHSD---GVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFI-----IEVRANDRGVPSREGFANVTIK 1650          

HSP 6 Score: 35.8094 bits (81), Expect = 2.306e-7
Identity = 27/111 (24.32%), Postives = 46/111 (41.44%), Query Frame = 1
Query: 1288 VYNQSNGRQLFMYNIKKI-----PDTFFDRESLSFYSVLIRCIDLGRPPLVGEK-------LFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGR 1584
            +  ++NG +   + I ++     P+  FDRE +  Y + +   D     L G            + I D NDNAP F        + E+   G  +  ++A+D D + N R
Sbjct: 1259 IVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLR 1369          

HSP 7 Score: 52.373 bits (124), Expect = 2.883e-6
Identity = 71/310 (22.90%), Postives = 129/310 (41.61%), Query Frame = 3
Query:  273 NYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQV-----------LEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPT-----ADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQ--GSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKIS-DNSPKKELINRL-FYIAXXXXXXXXXXXXXMDLKTY-ITFFITAVDGG---GRENSTAVTIEIEDCNDHAP 1130
            N F +  H+G++K R+ +    + +  +     +++  +G               +++ I D N+N P+F    K   I +  +   +   PT     A D DS  N  I Y +            Q ++ + F I  +T      P++      DRE   R ++ + A D G +   G C  +V ++D+NDNSPQ+   +   +V   +  G  V +  F  D+ +  N +I Y +  D +  +E  N L F+   +        ++ + +KT    F + A D G     ++S  VT+ + D    AP
Sbjct:  796 NLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLY---------YTQSESRKAFVIDRQTGVLTPSPHVVF----DRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSV-ITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAP 1091          
BLAST of Protocadherin-1 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0078045)

HSP 1 Score: 91.6633 bits (226), Expect = 1.353e-39
Identity = 92/353 (26.06%), Postives = 153/353 (43.34%), Query Frame = 3
Query:  231 SGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKE--IDREEIDRFELILIAEDSGKQ--QGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGR--ENSTAVTIEIEDCNDHAPNIAIY----KSTASIRENDRTPLVLTSVMVND-DDKGINSQFNCDLN 1256
            SG   II  E  +     +   +G ++ +  +DRET   ++     ++ I ++G+ + V+V + DENDN P F      +   EN+    + +L  A DLD EP +  RY I   +  D  R++  +             R  + YL L     +DRE    + L++ A D G    +G  T+ ++I DVNDN P +       TV E    G  V LQ +  D  +  NG ++Y I+     KE   ++F I   +  +        + K      + A D G +  E +  V+I + D ND+ P I +      ++  I E+ +    +  + V+D D K   +  N  LN
Sbjct:  107 SGPPYIIVAEAGVETDLAIDRATGEIRTKVKLDRETRASYS-----LVAIPLSGRNIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHR------------ERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSV-LQVYASDTDADENGLVEYAINRRQSDKE---QMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLN 438          

HSP 2 Score: 64.6994 bits (156), Expect = 1.353e-39
Identity = 66/209 (31.58%), Postives = 102/209 (48.80%), Query Frame = 3
Query: 1653 SQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKF---KYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIIS 2270
            ++  ID E +    LT++A+D G P L+ T TV + I DVND  P+F Q  FY ++          IL KV+A D D G N  V Y I + + H              +  G + I G +D E+  S +  ++A D G   LS  A + + + DVNDN+P F   +Y ++       S+ +    ++A   A DPD G  G ++Y I++
Sbjct:  565 TRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQS-FYNVSVAENEPVGRCIL-KVSASDPDCGVNAMVNYTIGEGFKH-------LTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGG--LSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVA-VVATDPDYGNFGQVSYRIVA 761          

HSP 3 Score: 48.521 bits (114), Expect = 1.353e-39
Identity = 30/95 (31.58%), Postives = 45/95 (47.37%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENY--YFTI 1632
             DRE +S Y++ +   D G PPL   K   + I D NDN P+F  D     + E  + G  +  V A+D D   N  ++Y +    E +  +F I
Sbjct:  462 LDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQI 556          

HSP 4 Score: 75.485 bits (184), Expect = 1.113e-26
Identity = 91/364 (25.00%), Postives = 153/364 (42.03%), Query Frame = 3
Query:  204 IIHKLPINSSGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQVLEVMVY--------INDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSC--TITVSIIDVNDNSPQWPTVNISKTVKECDR-QGPLVELQAFDRDDSSTPNGQIKYKISD-------NSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINS 1235
            + H+ P+     Y+I S +PD   YF ++++SG ++    +D E   +        +L++I   + E  VY        + D NDN P+F      +S+ E++++G+ L    A D DS  +  + Y +     + +           F I  ++       +L L + +D E   R  LI+ A D G    S   TI V + DVNDN P +     S  V E       ++++ A D D  +  N +I Y+I D       NS     +++ F I  +S ++  +     + +      + A D G       T V + + D ND+ P     K    I EN R   V+  V  +D D G N+
Sbjct:  856 VAHRSPVR----YSIYSGDPD--GYFSIETNSGNIRIAKPLDHEAKSQ--------VLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGL-----------FAIDARS------GHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGN--NARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENA 1186          

HSP 5 Score: 45.4394 bits (106), Expect = 1.113e-26
Identity = 52/217 (23.96%), Postives = 96/217 (44.24%), Query Frame = 3
Query: 1650 RSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYF-YQITEGNGLATIHAILGKVTADDK--DLGENGT--VYYAIRQKYD-HSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYD---NGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISH 2273
            R+++ +D E +  Y L + A D G P       + + +LD+ND  P F      +++ E    A +  ++G ++  ++  D+  N     +  +R  Y  +   ++ I          G L +  ++DRE     + EI A D   +  PQ SA+   I      ++     + PI+    + +S  + VG ++ NF A D D G NG + Y +I +
Sbjct: 1318 RTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVRED---AALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPID----LQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRY 1527          

HSP 6 Score: 40.817 bits (94), Expect = 1.113e-26
Identity = 27/98 (27.55%), Postives = 46/98 (46.94%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFG--SDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQIL---NNDENYYFTI 1632
             DRE    Y +++   D G P         + + D NDNAP+     +D+  ++ E    G  +  VRA D D  +N  ++Y I+   ++D +  F+I
Sbjct: 1214 LDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDV-VSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSI 1310          

HSP 7 Score: 78.9518 bits (193), Expect = 5.749e-26
Identity = 86/263 (32.70%), Postives = 126/263 (47.91%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF-KQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAI----RQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNI 2438
            +D E   +++L + A D G PSL+   T+ + + DVND  PVF K +Y   ++E     +I+A + +V A D D G N  + Y I         +S   +++  +       G + +   +DRE     Q  ++A DNG P   A   VIV VLD NDN PKF+   +K  F  I  + + G V+    A D D GEN  I YS++      Q  P   +   R  L + LRE     L D L++ A D GTP ++  V V I
Sbjct:  994 LDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESR---SINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQK--SKYEF-RIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTGEISTREPLDRELRE-----LYD-LVVEARDQGTPVRSARVPVRI 1244          

HSP 8 Score: 59.6918 bits (143), Expect = 5.749e-26
Identity = 30/93 (32.26%), Postives = 50/93 (53.76%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
             D E+ S   + I+   LG PP+ G     + + D NDNAP+F +  +R ++ E+  +GAP+    A+D DS  +G+V+Y ++       F I
Sbjct:  890 LDHEAKSQVLLNIQAT-LGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAI 981          

HSP 9 Score: 58.151 bits (139), Expect = 1.730e-17
Identity = 28/78 (35.90%), Postives = 45/78 (57.69%), Query Frame = 3
Query: 1650 RSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKD 1883
            R+ + +DREI+D Y L I+A D G P +  T T+ ++I+DVND  P F       ++E   L    A++  ++A+D D
Sbjct: 2381 RTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEATELG---AVITSISANDVD 2455          

HSP 10 Score: 51.9878 bits (123), Expect = 1.730e-17
Identity = 28/85 (32.94%), Postives = 43/85 (50.59%), Query Frame = 1
Query: 1390 IRCIDLGR----PPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
            IR + + R    P L       + + DENDN+PKF       T++E NN G  +  V A+D D+  N R+ Y I++ + +  F I
Sbjct: 2288 IRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVI 2372          

HSP 11 Score: 48.521 bits (114), Expect = 3.522e-17
Identity = 47/191 (24.61%), Postives = 84/191 (43.98%), Query Frame = 3
Query:  687 IDREEIDRFELILIAEDSGKQ--QGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQG-PLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFN 1244
            +DRE +  + L ++A D G      S +I + I DVNDN P++        V E    G  ++++ A DRD+    N  + Y +++     E   + F I   +  ++++     + +      + A DGG     ++  V + I D ND+ P         S+ EN+     +  V  +D D G+N+  N
Sbjct:  462 LDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGL--NSALTYSLAETP---ETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVN 647          

HSP 12 Score: 44.669 bits (104), Expect = 3.522e-17
Identity = 73/275 (26.55%), Postives = 116/275 (42.18%), Query Frame = 3
Query: 1638 FRENRSQMEI--------DREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF-KQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQ-MVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTV 2432
            FR +RS  EI            +  + L I A D G    N    V + I+D     P+F K +Y Y + E     T   ++G V A   D+     V Y+I     +S   +             I        + Q +++IQA +     G+P +     V ++V DVNDN P+F+     M  I++   +++G  L    A D D G +G +TYS++  K   + L       G LIL+++L      R    LI+ A+D G P  +  +T+
Sbjct:  768 FRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGT---VVGSVIAASGDVAHRSPVRYSI-----YSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATL-----GEPPVYGHTQVNIEVEDVNDNAPEFE---ASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLV--KESGKGLFAIDARSGHLILSQHLDYESSQR--HTLIVTATDGGVPSLSTNLTI 1022          

HSP 13 Score: 35.4242 bits (80), Expect = 3.522e-17
Identity = 30/98 (30.61%), Postives = 43/98 (43.88%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGA-----PIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
             D E  S Y   +   D G   L    +  + + D NDN P F   + + +L E+    +     PI  V A DPD    G+VSY+I+  +E   F I
Sbjct:  675 LDFERRSSYEFPVLATDRGG--LSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRI 770          

HSP 14 Score: 86.6557 bits (213), Expect = 1.217e-16
Identity = 78/251 (31.08%), Postives = 125/251 (49.80%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF-KQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPK 2414
            +DRE +D+Y LT++A DNG P+ +    V +R+LD ND  P F K +Y ++I E     +   ++G VTA D DLGEN  + Y++     +S+ Q +     +             +DRE        + A D G P  SA   V + V DVNDN P+   P  + + +++  +   G  +    A D D G+N +ITYSI+  +  + +  + +     +I T+ + + E  R   RL + ASD G PP+
Sbjct: 1111 LDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGS---VVGVVTASDLDLGENAAIRYSLLPI--NSSFQVHPVTGEISTREP--------LDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADP--QEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEE-RSIYRLGVAASDGGNPPR 1345          

HSP 15 Score: 67.3958 bits (163), Expect = 3.905e-16
Identity = 64/206 (31.07%), Postives = 101/206 (49.03%), Query Frame = 3
Query: 1656 QMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQ-YFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINIST--DSQVGKVLANFEAEDPDKGENGTITYSI 2264
             + +DREI   Y+L+++A D G P L+ + ++ +RI DVND  P F+Q  Y   + E   +A     + +V A D+D G N  + Y++ +  +   +   I      I           +D E     Q  ++A D G P LS+ A V+V + DVNDN+P F       +F N+S   +  VG+ +    A DPD G N  + Y+I
Sbjct:  459 HLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVME---VADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSH------IDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIF-----DQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTI 650          

HSP 16 Score: 38.1206 bits (87), Expect = 3.905e-16
Identity = 29/119 (24.37%), Postives = 52/119 (43.70%), Query Frame = 1
Query: 1297 QSNGRQLFMYNIKKIP---DTFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPK----FGSDDIRFTLTENNNIGAPIGYVRAYDPDSN-ENGRVSYQILNNDENYYFT 1629
            QS+  Q+F  + +      +   D E+   + +++   D G  PL      ++ + D NDN P     F SDD    ++E+   G  +  +  +DPDS  E   V+  +   D ++  T
Sbjct:  329 QSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALT 447          

HSP 17 Score: 84.7297 bits (208), Expect = 5.321e-16
Identity = 91/357 (25.49%), Postives = 158/357 (44.26%), Query Frame = 3
Query:  210 HKLPINSSG--TYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQV------LEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDI-RRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGK--QQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVE-LQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGG--RENSTAVTIEIEDCNDHAPNIA-IYKSTASIRENDRTPLVLTSVMVNDDDKGINS 1235
            H     SSG  TY+++         F + + SG L    ++D E+  +H      +I+ + +G V      L ++V + D NDN P F     ++++ E+  I +++    A DLD+  N+ I Y I D    ++   ++    S++F IF  +       ++ L   +DRE  DR++L ++A D+G         + V ++D NDN P++        ++E  R+G +V  + A D D     N  I+Y +         IN  F +   +  +S++     +L+      + A D G   R     V I + D ND+AP IA   +   S+RE       +  V   D D G N+
Sbjct:  956 HDKDSGSSGQVTYSLVKESG--KGLFAIDARSGHLILSQHLDYESSQRHT-----LIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNS------GWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGE--NAAIRYSLLP-------INSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNA 1290          

HSP 18 Score: 65.0846 bits (157), Expect = 1.339e-13
Identity = 93/371 (25.07%), Postives = 157/371 (42.32%), Query Frame = 3
Query:  225 NSSGTYNIISN-EPDINNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQ-----VLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSL--PTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDS----GKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVE-LQAFDRDDSSTPNGQIKYKISDNSPK----KELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGR-----ENSTAVTIEIEDCNDHAPNIAIYKS----TASIRENDRTPL--VLTSVMVNDDDKGINSQFNCDL 1253
            N+S TY+I+   + D +  F +   SG+++ R  +D E       + +  +  S  G      V  + V + D NDN P F+       ++E++ +G  +    P     D   NS+   F +D+  R    +N          F   I+R     L + + +DRE    F L + A D+      Q  + T+ + + DVNDN+P+WP   I   V E    G ++    A D D  +  NG ++Y++    P+    +E    LF +   +  LS Q     +        + A+D         + S  V + I D NDHAP+     S    TAS+  +D T +  V+  ++  D+D G N Q   ++
Sbjct: 1289 NASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHE----ERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESF-EDL--RVTYTLNPLTKDLIEAAF--DIDRHS-GNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGT--NGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEI 1647          

HSP 19 Score: 31.9574 bits (71), Expect = 1.339e-13
Identity = 26/102 (25.49%), Postives = 44/102 (43.14%), Query Frame = 1
Query: 1330 IKKIPDTFFDRESLSFYSVLIRCIDLGRPPLVGEKL-FTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
            +K +P    D E    ++++I   D G+P      L   + +   ++N P+F     R T+ EN   G+ +  V A      EN  +SY+I     N  F +
Sbjct: 1668 VKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHV 1769          

HSP 20 Score: 51.9878 bits (123), Expect = 3.026e-13
Identity = 28/83 (33.73%), Postives = 39/83 (46.99%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQIL 1602
             DRE+   Y + +   D G P    +    V ++D NDN PKF      F + EN   G+ +G V A D D  EN  + Y +L
Sbjct: 1111 LDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLL 1193          

HSP 21 Score: 43.8986 bits (102), Expect = 3.026e-13
Identity = 34/116 (29.31%), Postives = 55/116 (47.41%), Query Frame = 3
Query: 1608 RRKLLFYNHYFR------ENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFK--QQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYD 1931
            R  LL  N  F+      E  ++  +DRE+++ Y L + A+D G P  +    V I + DVND  P     Q+    + E     T    + +V A D+D G+N ++ Y+I +  D
Sbjct: 1189 RYSLLPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGT---EVVRVRAVDRDHGQNASITYSIVKGRD 1301          

HSP 22 Score: 74.7146 bits (182), Expect = 5.816e-13
Identity = 80/292 (27.40%), Postives = 131/292 (44.86%), Query Frame = 3
Query:  402 EVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQ--GSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLV-ELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAP---------NIAIYKSTASIRENDRTPLVLTSVMVND-DDKGINSQ 1238
            E+++ + DENDN P+FS +    ++ E ++ G+ ++   A D D+  N+ +RY     H  D    N F     F+  ++T          ++  +DRE  D ++L +IA D G  Q  G+ TI V I+DVNDN P +P  N+  TV E    G ++  + A D D        + Y++   S        +F +   S  L  +     +L+      + A D    E  T +T+ + D ND+AP           AI  + + I E+      L +V   D D +G NS+
Sbjct: 2307 ELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRY-----HIVDGNHDNAFVIEPAFSGIVRT---------NIV--LDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLV-TVSEATELGAVITSISANDVDTYPA----LTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASD-AAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSK 2576          

HSP 23 Score: 73.9442 bits (180), Expect = 1.014e-12
Identity = 92/331 (27.79%), Postives = 145/331 (43.81%), Query Frame = 3
Query:  243 NIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQ-----VLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSI--IDVNDNSPQW--PTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGG--RENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSV 1202
            N IS+  D++ +F +  +SG +  R  +DRET     D  Q  +L + NG         V+V + D NDN P+F        I+EN   GS + + TA DLD   N+ IRY +  I+S        FQ     T  I T            + +DRE  + ++L++ A D G    S  + V I   DVNDN+P+   P  ++    +E      +V ++A DRD     N  I Y I          + LF I  +S  + ++ +   + ++     + A DGG   RE    + +E+ D ND+ P          +RE+     V+ S+
Sbjct: 1085 NSISSS-DVSQHFGIFPNSGWIYLRAPLDRETR----DRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINS-------SFQVHP-VTGEIST-----------REPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQ--NASITYSIVKGRDSDG--HGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSI 1387          

HSP 24 Score: 71.2478 bits (173), Expect = 6.642e-12
Identity = 88/372 (23.66%), Postives = 158/372 (42.47%), Query Frame = 3
Query:  219 PINSSGTYNIISNEPDINNYFILQSH---SGIL----KQRNNIDRETMCKHADVCQKIILISINGQV------LEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQ--QGSCTITVSIIDVNDNSPQWPTVNI-------SKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGR--ENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDT 1262
            P N+   YNI+S   ++N+ F L SH    G+L    +    +DRET   ++     +++ +++G        + V + I D NDN P F+      ++ EN+ +G+ +    A D D++ N ++ Y I    S D  +M +    R   I+I              K +D E  +  EL+++A+D G+Q  + +  +++ + DVNDN P   T+N+       S  + E  + G  V   +    DS T    +   ++       L  R      S   +        ++ +  T  + A D G      S ++ + I D ND+ P        A++ E       +  V+ +D D+G+NS     L +T
Sbjct:  205 PYNTQ-RYNIVSG--NVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYS-----LLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQS-DKEQMFRIDP-RTGAIYIN-------------KALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQP---TINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTR----DNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAET 546          

HSP 25 Score: 60.4622 bits (145), Expect = 3.599e-10
Identity = 76/261 (29.12%), Postives = 117/261 (44.83%), Query Frame = 3
Query: 1653 SQMEIDREIKDQYSLTIMAKDNGEP-SLNDTCTVHIRILDVNDCVPVFK-QQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQL-SAXXXXXXXXXXXXXXKPKF-KYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAEL 2423
            S   +DRE   +Y+L I A D G+P S    C + I + D ND  P FK  +Y   + E   L T    + +++A D DLG N  + Y++  +                    G++   G +DRE   S    ++A D G+ ++ SA   V ++VLD+NDN+P F +YP        +    Q G+ L   +A D D G N  I YS+ +             + G L  +++L    G  L   L + A D G PP++ L
Sbjct: 1905 SARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGT---SVVQISAVDADLGVNARLVYSLANE---------TQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPY----IGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLL--HLEVVARDKGNPPQSSL 2147          

HSP 26 Score: 25.0238 bits (53), Expect = 3.599e-10
Identity = 22/74 (29.73%), Postives = 36/74 (48.65%), Query Frame = 1
Query: 1444 VTIIDENDNAPKFGSDDI-RFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI-TILGKIEAK 1659
            +T+ D NDN+P+F        ++ EN+  G  I  V A D D   N  + Y I   +    F+I +  G++ A+
Sbjct: 1835 ITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSAR 1907          

HSP 27 Score: 64.6994 bits (156), Expect = 7.373e-10
Identity = 39/96 (40.62%), Postives = 50/96 (52.08%), Query Frame = 1
Query: 1351 FFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI--LNNDENYYFTI 1632
            F DRE+   YS+LI  +D G PPL G     +TI D NDN P F       T+ EN  +G  +  V A D D++ENG V Y I    +D+   F I
Sbjct:  243 FLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRI 338          

HSP 28 Score: 64.3142 bits (155), Expect = 9.574e-10
Identity = 79/349 (22.64%), Postives = 148/349 (42.41%), Query Frame = 3
Query:  222 INSSGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQV------LEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQG------PLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFF--ITAVDGGG-RENSTAVT-IEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDD 1220
            +NS+ TY++         +F +   +G++  R++ID ET     +   ++ +++ +G V        V+V I+D NDN P F      +S+ EN  +G  +   +A D D   N+++ Y I +      + + +F+             R     + +  E+D E    +E  ++A D G    +  I + + DVNDN P +       +++E  +        P+V + A D D  +   GQ+ Y+I   +        +F I  S+  +      ++ ++T       I+A DGG  R N+ AV  + I D     P     +    ++E+     V+ SV+    D
Sbjct:  535 LNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCET-----EPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGE----GFKHLTEFEV------------RSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNF--GQVSYRIVAGNEAG-----IFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGD 855          

HSP 29 Score: 63.1586 bits (152), Expect = 1.756e-9
Identity = 85/279 (30.47%), Postives = 119/279 (42.65%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYP-INKMNFINISTDSQVGKVLANFEAEDPD-KGENGTITYSIISHKHMEQNLPYQLQNDGRLILTK--NLREREGIRLP-DRLIIR-------ASDNGTPPKAELVTVNIRYIPNNLTP 2465
            +DRE    YSL I A D G P L    TV+I I DVND  P+F Q  ++     N  AT+   + +V A D D  ENG V YAI +      RQ++           G + I   +D E     +  ++A D+G+  L   A V + V DVNDN+P      ++      IS  +Q G+ +A     DPD K E   +  ++                DG   LT   N      + LP DR I+        A+D GTPP     ++ +R    N  P
Sbjct:  244 LDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPEN--ATVGTSVLQVYASDTDADENGLVEYAINR------RQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNG-------------GDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNP 501          

HSP 30 Score: 44.2838 bits (103), Expect = 3.185e-8
Identity = 33/114 (28.95%), Postives = 53/114 (46.49%), Query Frame = 1
Query: 1279 SKNVYNQSNGRQLFMYNIKKIPDTFFDRESLSF------YSVLIR-CIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
            S+ VY+ ++G    M+ I  +    F    L +      Y ++IR C    + PL   + F + + DENDN PKF   +    L EN  +G+ +    A D D    G+++Y I
Sbjct: 2788 SEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSI 2901          

HSP 31 Score: 34.2686 bits (77), Expect = 3.185e-8
Identity = 22/94 (23.40%), Postives = 41/94 (43.62%), Query Frame = 3
Query: 1653 SQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDH 1934
            S    D E + +Y + ++A D G      +  V + I   ++  P F ++ +  +           ++G+VTA D D G +G V Y +   + H
Sbjct: 2925 SAFVFDYEQRQRYDMELLASDMG--GKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPHSH 3016          

HSP 32 Score: 41.9726 bits (97), Expect = 4.091e-8
Identity = 25/86 (29.07%), Postives = 40/86 (46.51%), Query Frame = 1
Query: 1351 FFDRESLSFYSVLIRCIDLGRP--PLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQIL 1602
              DRE  S + + IR +D      P        + + D NDNAP++  D I   ++E   +G  I    A D D+  NG + Y+++
Sbjct: 1440 LLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLI 1525          

HSP 33 Score: 36.5798 bits (83), Expect = 4.091e-8
Identity = 30/98 (30.61%), Postives = 43/98 (43.88%), Query Frame = 3
Query: 1656 QMEIDREIKDQYSLTIMAKD---NGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLAT--------IHAILGKVTADDKDLGENGTVYYAI 1916
            Q  +D E   +Y L + A D   N    L  + TV +RILD ND  P F        + G   A+        I  ++  + A D+D G+NG + Y I
Sbjct: 1554 QAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPN----SSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEI 1647          

HSP 34 Score: 56.225 bits (134), Expect = 2.635e-7
Identity = 79/307 (25.73%), Postives = 130/307 (42.35%), Query Frame = 3
Query:  399 LEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFI-----KDIHSRDIRR-----MNQF----QASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQW-PTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG---GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTT 1265
            L + + +   ++N P+F       +I EN   GS +   TA  L    N+ + Y I      D+   D +R       QF    QAS    ++++  NR        +++       R    +    +G+     TI +++ DVNDNSP++ P      +V E    G +  + A D D+   PN  + Y I+  +     +   F I  SS  LS++ L       Y T  I A D G    R+    +TI +ED ND+AP   + K T S++E+      +  +   D D G+N++    L + T
Sbjct: 1703 LNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRK------QRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVVASDLDEG--PNADLIYSITGGN-----LGNKFSIDSSSGELSARPLDREQHSRY-TLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANET 1995          

HSP 35 Score: 53.5286 bits (127), Expect = 1.545e-6
Identity = 57/237 (24.05%), Postives = 111/237 (46.84%), Query Frame = 3
Query:  264 DINNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQV------LEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGK---QQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQG-PLVELQAFDRDDSSTPNGQIKYKI-SDNS 941
            ++ N F + S SG L  R  +DRE   ++    Q     S  GQ         + +++ D+NDN P+F +   T S+QE++ +G+ +   +A D D   N+ + Y + +          Q+Q    F I  ++        +  + ++DRE    +  +++A D G+   +  +  + ++++D+NDN P +        V    + G  L+++QA D D  +  N +I Y + ++NS
Sbjct: 1890 NLGNKFSIDSSSGELSARP-LDREQHSRYTLQIQA----SDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLAN--------ETQWQ----FAIDGQS------GLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGA--NAEIVYSLNAENS 2101          

HSP 36 Score: 42.3578 bits (98), Expect = 1.758e-6
Identity = 25/72 (34.72%), Postives = 36/72 (50.00%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDS 1569
             DRE    Y + I   D G P + G     V I+D NDN P F  +++  T++E   +GA I  + A D D+
Sbjct: 2386 LDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVDT 2456          

HSP 37 Score: 30.4166 bits (67), Expect = 1.758e-6
Identity = 15/59 (25.42%), Postives = 29/59 (49.15%), Query Frame = 3
Query: 1092 VTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTY 1268
            + IE+ED ND++P  +  +  A++ E +     +  V   D D G N++    + D  +
Sbjct: 2308 LVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNH 2366          

HSP 38 Score: 53.1434 bits (126), Expect = 2.256e-6
Identity = 69/249 (27.71%), Postives = 109/249 (43.78%), Query Frame = 3
Query:  405 VMVYINDENDNIPQFSMRHK-TLSIQENSDIGSELSLPTADDLDSE--PNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREE-IDRFELILIAEDSGKQQGSCTIT---VSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAP 1130
            V++ I D NDN P F    K    I E + +   ++   A D D E  PNS + Y   DI S +   M        FTI + T        L +   +D +     +ELI+ A DS  Q+  C++    + + D NDN P++P       + E +  G  V  +A   D    P GQ+ Y I   +P  E   ++F +   S  ++S  +   + +      + A D GG++ S AV +EIE  ++  P
Sbjct: 2738 VIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVY---DITSGNDEHM--------FTIDLVT------GVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSV-FRAHASDLDKGPFGQLNYSIGP-APSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKKASVAVRVEIESRDEFTP 2967          

HSP 39 Score: 52.7582 bits (125), Expect = 2.539e-6
Identity = 80/276 (28.99%), Postives = 113/276 (40.94%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYF-YQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSI-----------ISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYIPNN 2456
            +D E K Q  L I A   GEP +     V+I + DVND  P F+       + E    A + A L    A DKD G +G V Y++ ++   S +            +      Y    R  ++     + A D G P LS    ++VDV DVNDN P F+        +N+S    +   +    A D D G N  ITY I           IS   + Q+      N G + L   L +RE  R   +L + A+DNGTP       V +R +  N
Sbjct:  890 LDHEAKSQVLLNIQAT-LGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPES---AELGAPLYAAHAHDKDSGSSGQVTYSLVKE---SGKGLFAIDARSGHLILSQHLDYESSQRHTLI-----VTATDGGVPSLSTNLTILVDVQDVNDNPPVFE---KDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGI-FPNSGWIYLRAPL-DRE-TRDRYQLTVLATDNGTPAAHAKTRVIVRVLDAN 1147          

HSP 40 Score: 51.2174 bits (121), Expect = 9.363e-6
Identity = 67/283 (23.67%), Postives = 117/283 (41.34%), Query Frame = 3
Query:  405 VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDR-------TPLVLTSVMVNDDDKG 1226
            + + I D NDN P+F       ++ E +D G+ +    A D D   NS + Y + +              +++F I  +T        +     ID E     +L ++A D G      + T+ V+I DVNDN P +     + +V E +  G  + L+    D     N  + Y I +    K L    F +  +S  +   G    + ++   F + A D GG   +  + +++ D ND+ P     +   S+RE+ +       TP+V  +V+  D D G
Sbjct:  490 IFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETH---------AQWFQIDPQT------GLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCI-LKVSASDPDCGVNAMVNYTIGEGF--KHLTE--FEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIV--AVVATDPDYG 750          
BLAST of Protocadherin-1 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0343249)

HSP 1 Score: 91.6633 bits (226), Expect = 1.353e-39
Identity = 92/353 (26.06%), Postives = 153/353 (43.34%), Query Frame = 3
Query:  231 SGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKE--IDREEIDRFELILIAEDSGKQ--QGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGR--ENSTAVTIEIEDCNDHAPNIAIY----KSTASIRENDRTPLVLTSVMVND-DDKGINSQFNCDLN 1256
            SG   II  E  +     +   +G ++ +  +DRET   ++     ++ I ++G+ + V+V + DENDN P F      +   EN+    + +L  A DLD EP +  RY I   +  D  R++  +             R  + YL L     +DRE    + L++ A D G    +G  T+ ++I DVNDN P +       TV E    G  V LQ +  D  +  NG ++Y I+     KE   ++F I   +  +        + K      + A D G +  E +  V+I + D ND+ P I +      ++  I E+ +    +  + V+D D K   +  N  LN
Sbjct:  107 SGPPYIIVAEAGVETDLAIDRATGEIRTKVKLDRETRASYS-----LVAIPLSGRNIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHR------------ERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSV-LQVYASDTDADENGLVEYAINRRQSDKE---QMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLN 438          

HSP 2 Score: 64.6994 bits (156), Expect = 1.353e-39
Identity = 66/209 (31.58%), Postives = 102/209 (48.80%), Query Frame = 3
Query: 1653 SQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKF---KYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIIS 2270
            ++  ID E +    LT++A+D G P L+ T TV + I DVND  P+F Q  FY ++          IL KV+A D D G N  V Y I + + H              +  G + I G +D E+  S +  ++A D G   LS  A + + + DVNDN+P F   +Y ++       S+ +    ++A   A DPD G  G ++Y I++
Sbjct:  565 TRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQS-FYNVSVAENEPVGRCIL-KVSASDPDCGVNAMVNYTIGEGFKH-------LTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGG--LSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVA-VVATDPDYGNFGQVSYRIVA 761          

HSP 3 Score: 48.521 bits (114), Expect = 1.353e-39
Identity = 30/95 (31.58%), Postives = 45/95 (47.37%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENY--YFTI 1632
             DRE +S Y++ +   D G PPL   K   + I D NDN P+F  D     + E  + G  +  V A+D D   N  ++Y +    E +  +F I
Sbjct:  462 LDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQI 556          

HSP 4 Score: 75.485 bits (184), Expect = 1.113e-26
Identity = 91/364 (25.00%), Postives = 153/364 (42.03%), Query Frame = 3
Query:  204 IIHKLPINSSGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQVLEVMVY--------INDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSC--TITVSIIDVNDNSPQWPTVNISKTVKECDR-QGPLVELQAFDRDDSSTPNGQIKYKISD-------NSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINS 1235
            + H+ P+     Y+I S +PD   YF ++++SG ++    +D E   +        +L++I   + E  VY        + D NDN P+F      +S+ E++++G+ L    A D DS  +  + Y +     + +           F I  ++       +L L + +D E   R  LI+ A D G    S   TI V + DVNDN P +     S  V E       ++++ A D D  +  N +I Y+I D       NS     +++ F I  +S ++  +     + +      + A D G       T V + + D ND+ P     K    I EN R   V+  V  +D D G N+
Sbjct:  856 VAHRSPVR----YSIYSGDPD--GYFSIETNSGNIRIAKPLDHEAKSQ--------VLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGL-----------FAIDARS------GHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGN--NARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENA 1186          

HSP 5 Score: 45.4394 bits (106), Expect = 1.113e-26
Identity = 52/217 (23.96%), Postives = 96/217 (44.24%), Query Frame = 3
Query: 1650 RSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYF-YQITEGNGLATIHAILGKVTADDK--DLGENGT--VYYAIRQKYD-HSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYD---NGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISH 2273
            R+++ +D E +  Y L + A D G P       + + +LD+ND  P F      +++ E    A +  ++G ++  ++  D+  N     +  +R  Y  +   ++ I          G L +  ++DRE     + EI A D   +  PQ SA+   I      ++     + PI+    + +S  + VG ++ NF A D D G NG + Y +I +
Sbjct: 1318 RTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVRED---AALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPID----LQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRY 1527          

HSP 6 Score: 40.817 bits (94), Expect = 1.113e-26
Identity = 27/98 (27.55%), Postives = 46/98 (46.94%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFG--SDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQIL---NNDENYYFTI 1632
             DRE    Y +++   D G P         + + D NDNAP+     +D+  ++ E    G  +  VRA D D  +N  ++Y I+   ++D +  F+I
Sbjct: 1214 LDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDV-VSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSI 1310          

HSP 7 Score: 78.9518 bits (193), Expect = 5.749e-26
Identity = 86/263 (32.70%), Postives = 126/263 (47.91%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF-KQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAI----RQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNI 2438
            +D E   +++L + A D G PSL+   T+ + + DVND  PVF K +Y   ++E     +I+A + +V A D D G N  + Y I         +S   +++  +       G + +   +DRE     Q  ++A DNG P   A   VIV VLD NDN PKF+   +K  F  I  + + G V+    A D D GEN  I YS++      Q  P   +   R  L + LRE     L D L++ A D GTP ++  V V I
Sbjct:  994 LDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESR---SINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQK--SKYEF-RIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTGEISTREPLDRELRE-----LYD-LVVEARDQGTPVRSARVPVRI 1244          

HSP 8 Score: 59.6918 bits (143), Expect = 5.749e-26
Identity = 30/93 (32.26%), Postives = 50/93 (53.76%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
             D E+ S   + I+   LG PP+ G     + + D NDNAP+F +  +R ++ E+  +GAP+    A+D DS  +G+V+Y ++       F I
Sbjct:  890 LDHEAKSQVLLNIQAT-LGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAI 981          

HSP 9 Score: 58.151 bits (139), Expect = 1.730e-17
Identity = 28/78 (35.90%), Postives = 45/78 (57.69%), Query Frame = 3
Query: 1650 RSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKD 1883
            R+ + +DREI+D Y L I+A D G P +  T T+ ++I+DVND  P F       ++E   L    A++  ++A+D D
Sbjct: 2381 RTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEATELG---AVITSISANDVD 2455          

HSP 10 Score: 51.9878 bits (123), Expect = 1.730e-17
Identity = 28/85 (32.94%), Postives = 43/85 (50.59%), Query Frame = 1
Query: 1390 IRCIDLGR----PPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
            IR + + R    P L       + + DENDN+PKF       T++E NN G  +  V A+D D+  N R+ Y I++ + +  F I
Sbjct: 2288 IRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVI 2372          

HSP 11 Score: 48.521 bits (114), Expect = 3.522e-17
Identity = 47/191 (24.61%), Postives = 84/191 (43.98%), Query Frame = 3
Query:  687 IDREEIDRFELILIAEDSGKQ--QGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQG-PLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFN 1244
            +DRE +  + L ++A D G      S +I + I DVNDN P++        V E    G  ++++ A DRD+    N  + Y +++     E   + F I   +  ++++     + +      + A DGG     ++  V + I D ND+ P         S+ EN+     +  V  +D D G+N+  N
Sbjct:  462 LDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGL--NSALTYSLAETP---ETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVN 647          

HSP 12 Score: 44.669 bits (104), Expect = 3.522e-17
Identity = 73/275 (26.55%), Postives = 116/275 (42.18%), Query Frame = 3
Query: 1638 FRENRSQMEI--------DREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF-KQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQ-MVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTV 2432
            FR +RS  EI            +  + L I A D G    N    V + I+D     P+F K +Y Y + E     T   ++G V A   D+     V Y+I     +S   +             I        + Q +++IQA +     G+P +     V ++V DVNDN P+F+     M  I++   +++G  L    A D D G +G +TYS++  K   + L       G LIL+++L      R    LI+ A+D G P  +  +T+
Sbjct:  768 FRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGT---VVGSVIAASGDVAHRSPVRYSI-----YSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATL-----GEPPVYGHTQVNIEVEDVNDNAPEFE---ASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLV--KESGKGLFAIDARSGHLILSQHLDYESSQR--HTLIVTATDGGVPSLSTNLTI 1022          

HSP 13 Score: 35.4242 bits (80), Expect = 3.522e-17
Identity = 30/98 (30.61%), Postives = 43/98 (43.88%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGA-----PIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
             D E  S Y   +   D G   L    +  + + D NDN P F   + + +L E+    +     PI  V A DPD    G+VSY+I+  +E   F I
Sbjct:  675 LDFERRSSYEFPVLATDRGG--LSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRI 770          

HSP 14 Score: 86.6557 bits (213), Expect = 1.217e-16
Identity = 78/251 (31.08%), Postives = 125/251 (49.80%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF-KQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPK 2414
            +DRE +D+Y LT++A DNG P+ +    V +R+LD ND  P F K +Y ++I E     +   ++G VTA D DLGEN  + Y++     +S+ Q +     +             +DRE        + A D G P  SA   V + V DVNDN P+   P  + + +++  +   G  +    A D D G+N +ITYSI+  +  + +  + +     +I T+ + + E  R   RL + ASD G PP+
Sbjct: 1111 LDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGS---VVGVVTASDLDLGENAAIRYSLLPI--NSSFQVHPVTGEISTREP--------LDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADP--QEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEE-RSIYRLGVAASDGGNPPR 1345          

HSP 15 Score: 67.3958 bits (163), Expect = 3.905e-16
Identity = 64/206 (31.07%), Postives = 101/206 (49.03%), Query Frame = 3
Query: 1656 QMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQ-YFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINIST--DSQVGKVLANFEAEDPDKGENGTITYSI 2264
             + +DREI   Y+L+++A D G P L+ + ++ +RI DVND  P F+Q  Y   + E   +A     + +V A D+D G N  + Y++ +  +   +   I      I           +D E     Q  ++A D G P LS+ A V+V + DVNDN+P F       +F N+S   +  VG+ +    A DPD G N  + Y+I
Sbjct:  459 HLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVME---VADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSH------IDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIF-----DQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTI 650          

HSP 16 Score: 38.1206 bits (87), Expect = 3.905e-16
Identity = 29/119 (24.37%), Postives = 52/119 (43.70%), Query Frame = 1
Query: 1297 QSNGRQLFMYNIKKIP---DTFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPK----FGSDDIRFTLTENNNIGAPIGYVRAYDPDSN-ENGRVSYQILNNDENYYFT 1629
            QS+  Q+F  + +      +   D E+   + +++   D G  PL      ++ + D NDN P     F SDD    ++E+   G  +  +  +DPDS  E   V+  +   D ++  T
Sbjct:  329 QSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALT 447          

HSP 17 Score: 84.7297 bits (208), Expect = 5.321e-16
Identity = 91/357 (25.49%), Postives = 158/357 (44.26%), Query Frame = 3
Query:  210 HKLPINSSG--TYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQV------LEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDI-RRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGK--QQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVE-LQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGG--RENSTAVTIEIEDCNDHAPNIA-IYKSTASIRENDRTPLVLTSVMVNDDDKGINS 1235
            H     SSG  TY+++         F + + SG L    ++D E+  +H      +I+ + +G V      L ++V + D NDN P F     ++++ E+  I +++    A DLD+  N+ I Y I D    ++   ++    S++F IF  +       ++ L   +DRE  DR++L ++A D+G         + V ++D NDN P++        ++E  R+G +V  + A D D     N  I+Y +         IN  F +   +  +S++     +L+      + A D G   R     V I + D ND+AP IA   +   S+RE       +  V   D D G N+
Sbjct:  956 HDKDSGSSGQVTYSLVKESG--KGLFAIDARSGHLILSQHLDYESSQRHT-----LIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNS------GWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGE--NAAIRYSLLP-------INSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNA 1290          

HSP 18 Score: 65.0846 bits (157), Expect = 1.339e-13
Identity = 93/371 (25.07%), Postives = 157/371 (42.32%), Query Frame = 3
Query:  225 NSSGTYNIISN-EPDINNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQ-----VLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSL--PTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDS----GKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVE-LQAFDRDDSSTPNGQIKYKISDNSPK----KELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGR-----ENSTAVTIEIEDCNDHAPNIAIYKS----TASIRENDRTPL--VLTSVMVNDDDKGINSQFNCDL 1253
            N+S TY+I+   + D +  F +   SG+++ R  +D E       + +  +  S  G      V  + V + D NDN P F+       ++E++ +G  +    P     D   NS+   F +D+  R    +N          F   I+R     L + + +DRE    F L + A D+      Q  + T+ + + DVNDN+P+WP   I   V E    G ++    A D D  +  NG ++Y++    P+    +E    LF +   +  LS Q     +        + A+D         + S  V + I D NDHAP+     S    TAS+  +D T +  V+  ++  D+D G N Q   ++
Sbjct: 1289 NASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHE----ERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESF-EDL--RVTYTLNPLTKDLIEAAF--DIDRHS-GNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGT--NGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEI 1647          

HSP 19 Score: 31.9574 bits (71), Expect = 1.339e-13
Identity = 26/102 (25.49%), Postives = 44/102 (43.14%), Query Frame = 1
Query: 1330 IKKIPDTFFDRESLSFYSVLIRCIDLGRPPLVGEKL-FTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
            +K +P    D E    ++++I   D G+P      L   + +   ++N P+F     R T+ EN   G+ +  V A      EN  +SY+I     N  F +
Sbjct: 1668 VKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHV 1769          

HSP 20 Score: 51.9878 bits (123), Expect = 3.026e-13
Identity = 28/83 (33.73%), Postives = 39/83 (46.99%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQIL 1602
             DRE+   Y + +   D G P    +    V ++D NDN PKF      F + EN   G+ +G V A D D  EN  + Y +L
Sbjct: 1111 LDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLL 1193          

HSP 21 Score: 43.8986 bits (102), Expect = 3.026e-13
Identity = 34/116 (29.31%), Postives = 55/116 (47.41%), Query Frame = 3
Query: 1608 RRKLLFYNHYFR------ENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFK--QQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYD 1931
            R  LL  N  F+      E  ++  +DRE+++ Y L + A+D G P  +    V I + DVND  P     Q+    + E     T    + +V A D+D G+N ++ Y+I +  D
Sbjct: 1189 RYSLLPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGT---EVVRVRAVDRDHGQNASITYSIVKGRD 1301          

HSP 22 Score: 74.7146 bits (182), Expect = 5.816e-13
Identity = 80/292 (27.40%), Postives = 131/292 (44.86%), Query Frame = 3
Query:  402 EVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQ--GSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLV-ELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAP---------NIAIYKSTASIRENDRTPLVLTSVMVND-DDKGINSQ 1238
            E+++ + DENDN P+FS +    ++ E ++ G+ ++   A D D+  N+ +RY     H  D    N F     F+  ++T          ++  +DRE  D ++L +IA D G  Q  G+ TI V I+DVNDN P +P  N+  TV E    G ++  + A D D        + Y++   S        +F +   S  L  +     +L+      + A D    E  T +T+ + D ND+AP           AI  + + I E+      L +V   D D +G NS+
Sbjct: 2307 ELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRY-----HIVDGNHDNAFVIEPAFSGIVRT---------NIV--LDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLV-TVSEATELGAVITSISANDVDTYPA----LTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASD-AAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSK 2576          

HSP 23 Score: 73.9442 bits (180), Expect = 1.014e-12
Identity = 92/331 (27.79%), Postives = 145/331 (43.81%), Query Frame = 3
Query:  243 NIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQ-----VLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSI--IDVNDNSPQW--PTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGG--RENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSV 1202
            N IS+  D++ +F +  +SG +  R  +DRET     D  Q  +L + NG         V+V + D NDN P+F        I+EN   GS + + TA DLD   N+ IRY +  I+S        FQ     T  I T            + +DRE  + ++L++ A D G    S  + V I   DVNDN+P+   P  ++    +E      +V ++A DRD     N  I Y I          + LF I  +S  + ++ +   + ++     + A DGG   RE    + +E+ D ND+ P          +RE+     V+ S+
Sbjct: 1085 NSISSS-DVSQHFGIFPNSGWIYLRAPLDRETR----DRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINS-------SFQVHP-VTGEIST-----------REPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQ--NASITYSIVKGRDSDG--HGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSI 1387          

HSP 24 Score: 71.2478 bits (173), Expect = 6.642e-12
Identity = 88/372 (23.66%), Postives = 158/372 (42.47%), Query Frame = 3
Query:  219 PINSSGTYNIISNEPDINNYFILQSH---SGIL----KQRNNIDRETMCKHADVCQKIILISINGQV------LEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQ--QGSCTITVSIIDVNDNSPQWPTVNI-------SKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGR--ENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDT 1262
            P N+   YNI+S   ++N+ F L SH    G+L    +    +DRET   ++     +++ +++G        + V + I D NDN P F+      ++ EN+ +G+ +    A D D++ N ++ Y I    S D  +M +    R   I+I              K +D E  +  EL+++A+D G+Q  + +  +++ + DVNDN P   T+N+       S  + E  + G  V   +    DS T    +   ++       L  R      S   +        ++ +  T  + A D G      S ++ + I D ND+ P        A++ E       +  V+ +D D+G+NS     L +T
Sbjct:  205 PYNTQ-RYNIVSG--NVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYS-----LLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQS-DKEQMFRIDP-RTGAIYIN-------------KALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQP---TINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTR----DNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAET 546          

HSP 25 Score: 60.4622 bits (145), Expect = 3.599e-10
Identity = 76/261 (29.12%), Postives = 117/261 (44.83%), Query Frame = 3
Query: 1653 SQMEIDREIKDQYSLTIMAKDNGEP-SLNDTCTVHIRILDVNDCVPVFK-QQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQL-SAXXXXXXXXXXXXXXKPKF-KYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAEL 2423
            S   +DRE   +Y+L I A D G+P S    C + I + D ND  P FK  +Y   + E   L T    + +++A D DLG N  + Y++  +                    G++   G +DRE   S    ++A D G+ ++ SA   V ++VLD+NDN+P F +YP        +    Q G+ L   +A D D G N  I YS+ +             + G L  +++L    G  L   L + A D G PP++ L
Sbjct: 1905 SARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGT---SVVQISAVDADLGVNARLVYSLANE---------TQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPY----IGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLL--HLEVVARDKGNPPQSSL 2147          

HSP 26 Score: 25.0238 bits (53), Expect = 3.599e-10
Identity = 22/74 (29.73%), Postives = 36/74 (48.65%), Query Frame = 1
Query: 1444 VTIIDENDNAPKFGSDDI-RFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI-TILGKIEAK 1659
            +T+ D NDN+P+F        ++ EN+  G  I  V A D D   N  + Y I   +    F+I +  G++ A+
Sbjct: 1835 ITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSAR 1907          

HSP 27 Score: 64.6994 bits (156), Expect = 7.373e-10
Identity = 39/96 (40.62%), Postives = 50/96 (52.08%), Query Frame = 1
Query: 1351 FFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI--LNNDENYYFTI 1632
            F DRE+   YS+LI  +D G PPL G     +TI D NDN P F       T+ EN  +G  +  V A D D++ENG V Y I    +D+   F I
Sbjct:  243 FLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRI 338          

HSP 28 Score: 64.3142 bits (155), Expect = 9.574e-10
Identity = 79/349 (22.64%), Postives = 148/349 (42.41%), Query Frame = 3
Query:  222 INSSGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQV------LEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQG------PLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFF--ITAVDGGG-RENSTAVT-IEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDD 1220
            +NS+ TY++         +F +   +G++  R++ID ET     +   ++ +++ +G V        V+V I+D NDN P F      +S+ EN  +G  +   +A D D   N+++ Y I +      + + +F+             R     + +  E+D E    +E  ++A D G    +  I + + DVNDN P +       +++E  +        P+V + A D D  +   GQ+ Y+I   +        +F I  S+  +      ++ ++T       I+A DGG  R N+ AV  + I D     P     +    ++E+     V+ SV+    D
Sbjct:  535 LNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCET-----EPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGE----GFKHLTEFEV------------RSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNF--GQVSYRIVAGNEAG-----IFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGD 855          

HSP 29 Score: 63.1586 bits (152), Expect = 1.756e-9
Identity = 85/279 (30.47%), Postives = 119/279 (42.65%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYP-INKMNFINISTDSQVGKVLANFEAEDPD-KGENGTITYSIISHKHMEQNLPYQLQNDGRLILTK--NLREREGIRLP-DRLIIR-------ASDNGTPPKAELVTVNIRYIPNNLTP 2465
            +DRE    YSL I A D G P L    TV+I I DVND  P+F Q  ++     N  AT+   + +V A D D  ENG V YAI +      RQ++           G + I   +D E     +  ++A D+G+  L   A V + V DVNDN+P      ++      IS  +Q G+ +A     DPD K E   +  ++                DG   LT   N      + LP DR I+        A+D GTPP     ++ +R    N  P
Sbjct:  244 LDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPEN--ATVGTSVLQVYASDTDADENGLVEYAINR------RQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNG-------------GDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNP 501          

HSP 30 Score: 44.2838 bits (103), Expect = 3.185e-8
Identity = 33/114 (28.95%), Postives = 53/114 (46.49%), Query Frame = 1
Query: 1279 SKNVYNQSNGRQLFMYNIKKIPDTFFDRESLSF------YSVLIR-CIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
            S+ VY+ ++G    M+ I  +    F    L +      Y ++IR C    + PL   + F + + DENDN PKF   +    L EN  +G+ +    A D D    G+++Y I
Sbjct: 2788 SEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSI 2901          

HSP 31 Score: 34.2686 bits (77), Expect = 3.185e-8
Identity = 22/94 (23.40%), Postives = 41/94 (43.62%), Query Frame = 3
Query: 1653 SQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDH 1934
            S    D E + +Y + ++A D G      +  V + I   ++  P F ++ +  +           ++G+VTA D D G +G V Y +   + H
Sbjct: 2925 SAFVFDYEQRQRYDMELLASDMG--GKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPHSH 3016          

HSP 32 Score: 41.9726 bits (97), Expect = 4.091e-8
Identity = 25/86 (29.07%), Postives = 40/86 (46.51%), Query Frame = 1
Query: 1351 FFDRESLSFYSVLIRCIDLGRP--PLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQIL 1602
              DRE  S + + IR +D      P        + + D NDNAP++  D I   ++E   +G  I    A D D+  NG + Y+++
Sbjct: 1440 LLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLI 1525          

HSP 33 Score: 36.5798 bits (83), Expect = 4.091e-8
Identity = 30/98 (30.61%), Postives = 43/98 (43.88%), Query Frame = 3
Query: 1656 QMEIDREIKDQYSLTIMAKD---NGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLAT--------IHAILGKVTADDKDLGENGTVYYAI 1916
            Q  +D E   +Y L + A D   N    L  + TV +RILD ND  P F        + G   A+        I  ++  + A D+D G+NG + Y I
Sbjct: 1554 QAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPN----SSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEI 1647          

HSP 34 Score: 56.225 bits (134), Expect = 2.635e-7
Identity = 79/307 (25.73%), Postives = 130/307 (42.35%), Query Frame = 3
Query:  399 LEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFI-----KDIHSRDIRR-----MNQF----QASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQW-PTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG---GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTT 1265
            L + + +   ++N P+F       +I EN   GS +   TA  L    N+ + Y I      D+   D +R       QF    QAS    ++++  NR        +++       R    +    +G+     TI +++ DVNDNSP++ P      +V E    G +  + A D D+   PN  + Y I+  +     +   F I  SS  LS++ L       Y T  I A D G    R+    +TI +ED ND+AP   + K T S++E+      +  +   D D G+N++    L + T
Sbjct: 1703 LNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRK------QRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVVASDLDEG--PNADLIYSITGGN-----LGNKFSIDSSSGELSARPLDREQHSRY-TLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANET 1995          

HSP 35 Score: 53.5286 bits (127), Expect = 1.545e-6
Identity = 57/237 (24.05%), Postives = 111/237 (46.84%), Query Frame = 3
Query:  264 DINNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQV------LEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGK---QQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQG-PLVELQAFDRDDSSTPNGQIKYKI-SDNS 941
            ++ N F + S SG L  R  +DRE   ++    Q     S  GQ         + +++ D+NDN P+F +   T S+QE++ +G+ +   +A D D   N+ + Y + +          Q+Q    F I  ++        +  + ++DRE    +  +++A D G+   +  +  + ++++D+NDN P +        V    + G  L+++QA D D  +  N +I Y + ++NS
Sbjct: 1890 NLGNKFSIDSSSGELSARP-LDREQHSRYTLQIQA----SDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLAN--------ETQWQ----FAIDGQS------GLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGA--NAEIVYSLNAENS 2101          

HSP 36 Score: 42.3578 bits (98), Expect = 1.758e-6
Identity = 25/72 (34.72%), Postives = 36/72 (50.00%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDS 1569
             DRE    Y + I   D G P + G     V I+D NDN P F  +++  T++E   +GA I  + A D D+
Sbjct: 2386 LDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVDT 2456          

HSP 37 Score: 30.4166 bits (67), Expect = 1.758e-6
Identity = 15/59 (25.42%), Postives = 29/59 (49.15%), Query Frame = 3
Query: 1092 VTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTY 1268
            + IE+ED ND++P  +  +  A++ E +     +  V   D D G N++    + D  +
Sbjct: 2308 LVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNH 2366          

HSP 38 Score: 53.1434 bits (126), Expect = 2.256e-6
Identity = 69/249 (27.71%), Postives = 109/249 (43.78%), Query Frame = 3
Query:  405 VMVYINDENDNIPQFSMRHK-TLSIQENSDIGSELSLPTADDLDSE--PNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREE-IDRFELILIAEDSGKQQGSCTIT---VSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAP 1130
            V++ I D NDN P F    K    I E + +   ++   A D D E  PNS + Y   DI S +   M        FTI + T        L +   +D +     +ELI+ A DS  Q+  C++    + + D NDN P++P       + E +  G  V  +A   D    P GQ+ Y I   +P  E   ++F +   S  ++S  +   + +      + A D GG++ S AV +EIE  ++  P
Sbjct: 2738 VIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVY---DITSGNDEHM--------FTIDLVT------GVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSV-FRAHASDLDKGPFGQLNYSIGP-APSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKKASVAVRVEIESRDEFTP 2967          

HSP 39 Score: 52.7582 bits (125), Expect = 2.539e-6
Identity = 80/276 (28.99%), Postives = 113/276 (40.94%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYF-YQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSI-----------ISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYIPNN 2456
            +D E K Q  L I A   GEP +     V+I + DVND  P F+       + E    A + A L    A DKD G +G V Y++ ++   S +            +      Y    R  ++     + A D G P LS    ++VDV DVNDN P F+        +N+S    +   +    A D D G N  ITY I           IS   + Q+      N G + L   L +RE  R   +L + A+DNGTP       V +R +  N
Sbjct:  890 LDHEAKSQVLLNIQAT-LGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPES---AELGAPLYAAHAHDKDSGSSGQVTYSLVKE---SGKGLFAIDARSGHLILSQHLDYESSQRHTLI-----VTATDGGVPSLSTNLTILVDVQDVNDNPPVFE---KDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGI-FPNSGWIYLRAPL-DRE-TRDRYQLTVLATDNGTPAAHAKTRVIVRVLDAN 1147          

HSP 40 Score: 51.2174 bits (121), Expect = 9.363e-6
Identity = 67/283 (23.67%), Postives = 117/283 (41.34%), Query Frame = 3
Query:  405 VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDR-------TPLVLTSVMVNDDDKG 1226
            + + I D NDN P+F       ++ E +D G+ +    A D D   NS + Y + +              +++F I  +T        +     ID E     +L ++A D G      + T+ V+I DVNDN P +     + +V E +  G  + L+    D     N  + Y I +    K L    F +  +S  +   G    + ++   F + A D GG   +  + +++ D ND+ P     +   S+RE+ +       TP+V  +V+  D D G
Sbjct:  490 IFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETH---------AQWFQIDPQT------GLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCI-LKVSASDPDCGVNAMVNYTIGEGF--KHLTE--FEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIV--AVVATDPDYG 750          
BLAST of Protocadherin-1 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304900)

HSP 1 Score: 90.5077 bits (223), Expect = 1.263e-37
Identity = 79/293 (26.96%), Postives = 129/293 (44.03%), Query Frame = 3
Query:  402 EVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQG-PLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFIT--AVDGGGRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTT 1265
            +++V + D NDN P+F       S+ EN  +G  +    A D D   N+ I Y I +   RD            F + +      +  +++ IK +DREE  RF   ++A+D G   +  S ++ +++ DVNDN P +        V E    G P+  + A D D+ S    ++ Y+I+  + +       F I   +        Q +D K    F +T  A D GGR ++  V I I D N+ AP       +AS+ E+      +  V   D D G+N+Q    LN+ +
Sbjct:  674 QLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISE---RDDN----------FPLAVDP----RTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDS----RLHYEITTGNTRGR-----FAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEES 940          

HSP 2 Score: 55.4546 bits (132), Expect = 1.263e-37
Identity = 31/89 (34.83%), Postives = 46/89 (51.69%), Query Frame = 3
Query: 1650 RSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAI 1916
            R+   +DRE    + LT +A D G P L+ T  V IR+ DVND  P F           N  + + +++G++ A D D G N  V+Y+I
Sbjct: 1066 RTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPEN--SPVGSVVGEIHAHDPDEGVNAVVHYSI 1152          

HSP 3 Score: 52.373 bits (124), Expect = 1.263e-37
Identity = 32/94 (34.04%), Postives = 47/94 (50.00%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNND-ENYYFTI 1632
             DRE+ S Y + +   D G P L       + + D NDNAP F S   + ++ E+  +G  +  V A DPD   NGR+ Y + + D E+  F I
Sbjct:  965 LDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVI 1058          

HSP 4 Score: 77.0258 bits (188), Expect = 1.933e-37
Identity = 80/268 (29.85%), Postives = 123/268 (45.90%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQ-YFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYIPNNLTP 2465
            +D + + ++ LT+ A D+G  S  DT TVHI I D N+  P+F+   Y   + E   + T   +   V+A D D+G N  + Y++ ++   S                G +     +DRE        + A D G P LS   +V + V DVNDN P FK P+ + + +    D+ VG  +    A DPD G NG I Y ++S + +E    + +      I T    +RE + +   L   A D G+PP +  V V IR    N +P
Sbjct:  857 LDYKQEKRFLLTVAATDSGGRS--DTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLV---VSATDSDVGVNAQITYSLNEE---SINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILE---DALVGTSVIQVAASDPDVGLNGRIKY-LLSDRDIEDG-SFVIDPTSGTIRTNKGLDRESVAV-FHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSP 1110          

HSP 5 Score: 72.7886 bits (177), Expect = 1.933e-37
Identity = 87/361 (24.10%), Postives = 151/361 (41.83%), Query Frame = 3
Query:  219 PINSSGTYNIISN-EPDINNYFILQSHSGILKQRNNIDRETMCKHA-DVCQKIILISINGQVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAED-----SGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQG-----PLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLND 1259
            P +S   Y+++S  +    + F + S +G++    ++DRE M  H   V               + V + D ND+ P F       SI+E + +GS +    A D D   N+ I Y I+ +   D   + Q Q    F I  ++        +     +DRE  D + L++ A D     S ++  + ++ V ++D NDN PQ+     +  V E D+ G      +  ++A D D  +  N  I+Y I   + + +     F I   S  +S       +        I A DGG   R N+T + + + D ND+AP     +   S+ EN      +  V   D D+G N++    +++
Sbjct:  386 PEDSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAV--TDGAGLAQDQEMPIFRIDSRS------GVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPE-DQWGGTEDNTVAHIRATDADQGN--NAAIRYAIIGGNTQSQ-----FSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISE 730          

HSP 6 Score: 48.521 bits (114), Expect = 1.933e-37
Identity = 29/94 (30.85%), Postives = 41/94 (43.62%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTIT 1635
             DRE    ++  +   D G PP        +T+ D NDN P F        + E+   G P+  V A DPD  E+ R+ Y+I   +    F IT
Sbjct:  752 LDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAIT 843          

HSP 7 Score: 93.2041 bits (230), Expect = 1.259e-18
Identity = 90/329 (27.36%), Postives = 156/329 (47.42%), Query Frame = 3
Query:  279 FILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQ----VLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSE---LSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCT--ITVSIIDVNDNSPQWPTVNISKTVKECDRQG-PLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTY--ITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDK 1223
            F + S SG++  R+++DRET   +  +     L S   +       V V + D+NDN PQFS R  T+ + E+   G+E   ++   A D D   N+ IRY I   +++     +QF           +I+ M    + L+K +D E +  + L++ A+D G    S T  + V++ID NDN+P++ T    ++V E    G  ++ +QA+D D+ +  N +I Y IS+           F +A        Q ++ +D +      F + A DGG   +  S++V I ++D ND+ P        A++ E+      +T+V   D D+
Sbjct:  521 FRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQ-----SQF-----------SIDSMS-GDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGA--NAEITYSISERDDN-------FPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDE 823          

HSP 8 Score: 90.5077 bits (223), Expect = 1.029e-17
Identity = 83/250 (33.20%), Postives = 118/250 (47.20%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQ-NLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPP 2411
            +DRE    Y LT+ AKD G PSL+DT  V I + DVND  P FK   +      + L     I  +V A D D+G NG      R KY  S+R    G  ++      I    G +DRE +       IA D G P LS+   V + + DVND+ P F    +K+  + +  +S VG V+    A DPD+G N  + YSII        +L  +  ++   +LT    + E  R    L++RA+   +PP
Sbjct:  965 LDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVI--QVAASDPDVGLNG------RIKYLLSDRDIEDGSFVIDPTSGTIRTNKG-LDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFAS--DKIT-LYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAA---SPP 1199          

HSP 9 Score: 60.4622 bits (145), Expect = 1.673e-14
Identity = 74/273 (27.11%), Postives = 120/273 (43.96%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYIPNNLTPRNNALP 2483
            +D E    Y L I A+D G PS ++T  + + ++D ND  P F    F +    N     + I  +V A D D G N  + Y+I ++ D+          L      G +     +DRE+      +++A D G P  SA ++V++ V DVNDN P F     K    N+  D   G  +    A DPD  E+  + Y I +     +         G + + ++L  ++  R    L + A+D+G   +++  TV+I     N+T  NN  P
Sbjct:  647 LDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNII--RVQAYDSDEGANAEITYSISERDDN--------FPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFN---PKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRF--LLTVAATDSGG--RSDTATVHI-----NITDANNFAP 895          

HSP 10 Score: 39.6614 bits (91), Expect = 1.673e-14
Identity = 25/99 (25.25%), Postives = 41/99 (41.41%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPP---LVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGA---PIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
             DRE+   Y +L+   DL               V ++D+NDN P+F        + E+   G     + ++RA D D   N  + Y I+  +    F+I
Sbjct:  536 LDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSI 634          

HSP 11 Score: 72.4034 bits (176), Expect = 2.959e-12
Identity = 81/282 (28.72%), Postives = 134/282 (47.52%), Query Frame = 3
Query: 1653 SQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFK-QQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSN-RQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQ---LSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVG---KVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQN-DGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYI-PNNLTPR 2468
            +   +DRE+ D +   ++A D+  P  + T T+ + +LD ND  P F+ +Q+   I EG   AT+ + +  + A D+D+G+N  + Y I    D +   Q+         +  G+++    +DRE   S    + A D    Q    +A A+V V VLD NDN P+F     +   + +  D   G     +A+  A D D+G N  I Y+II      Q   + + +  G + L K L + E +R   RL+IRA D G+P ++    + +  I  N+  PR
Sbjct:  418 TSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREG---ATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFS---ERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQ---FSIDSMSGDVSLVKPL-DYESVR-SYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPR 688          

HSP 12 Score: 68.9366 bits (167), Expect = 3.212e-11
Identity = 76/301 (25.25%), Postives = 137/301 (45.51%), Query Frame = 3
Query:  405 VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCT--ITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITA--VDGGGRENSTAVTIEI--EDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDL---NDTTYFTMV 1280
            V + I D N+  P F     + S+ E++ +G+ + + +A D D   N+ I Y + +        +N   +   F+I  +T        +     +DRE    + L + A+D G    S T  + + + DVNDN+P + +     ++ E    G  V +Q    D     NG+IKY +SD    +++ +  F I       + +  + +D ++   F +TA  VD G    S+ V ++I  ED ND  P  A  K T  + EN     V+  +  +D D+G+N+  +  +   +D+  F++V
Sbjct:  883 VHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNE------ESINGLGSPDPFSINPQT------GAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSV-IQVAASDPDVGLNGRIKYLLSD----RDIEDGSFVI--DPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLV 1164          

HSP 13 Score: 66.6254 bits (161), Expect = 1.747e-10
Identity = 31/93 (33.33%), Postives = 51/93 (54.84%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
             DRES++ + +    +D G PPL       + + D ND+ P F SD I   + EN+ +G+ +G + A+DPD   N  V Y I+  D++  F++
Sbjct: 1071 LDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSL 1163          

HSP 14 Score: 63.1586 bits (152), Expect = 1.993e-9
Identity = 32/89 (35.96%), Postives = 47/89 (52.81%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENY 1620
             D ES+  Y ++IR  D G P         V +ID NDNAP+F +   + ++ EN  +G  I  V+AYD D   N  ++Y I   D+N+
Sbjct:  647 LDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNF 735          

HSP 15 Score: 59.3066 bits (142), Expect = 2.903e-8
Identity = 83/324 (25.62%), Postives = 128/324 (39.51%), Query Frame = 3
Query:  222 INSSGTYNIISNEPDINNY-----FILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQ---------VLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSII--DVNDNSPQWPTVNISKTVKECDRQGPLV-ELQAFDRDDSSTPNGQIKYKI--SDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGR--ENSTAVTIEIEDCNDHAP 1130
            +N+  TY++  NE  IN       F +   +G +     +DRET   +        L+++  +           +V + + D NDN P F       SI E++ +G+ +    A D D   N  I+Y + D   RDI   +        TI             +  K +DRE +  F L  IA D G    S T+ V I   DVND+ P + +  I+  V E    G +V E+ A D D+    N  + Y I   D+S    L+ R       S       +  +D ++    F   V        N   + I + D ND+AP
Sbjct:  928 VNAQITYSL--NEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGY--------LLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSD---RDIEDGSFVIDPTSGTI-------------RTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGV--NAVVHYSIIGGDDSNAFSLVTR-----PGSERAQLLTMTELDYESTRKRFELVVRAASPPLRNDAHIEILVTDVNDNAP 1218          
BLAST of Protocadherin-1 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304899)

HSP 1 Score: 90.5077 bits (223), Expect = 1.359e-37
Identity = 79/293 (26.96%), Postives = 129/293 (44.03%), Query Frame = 3
Query:  402 EVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQG-PLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFIT--AVDGGGRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTT 1265
            +++V + D NDN P+F       S+ EN  +G  +    A D D   N+ I Y I +   RD            F + +      +  +++ IK +DREE  RF   ++A+D G   +  S ++ +++ DVNDN P +        V E    G P+  + A D D+ S    ++ Y+I+  + +       F I   +        Q +D K    F +T  A D GGR ++  V I I D N+ AP       +AS+ E+      +  V   D D G+N+Q    LN+ +
Sbjct:  674 QLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISE---RDDN----------FPLAVDP----RTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDS----RLHYEITTGNTRGR-----FAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEES 940          

HSP 2 Score: 55.4546 bits (132), Expect = 1.359e-37
Identity = 31/89 (34.83%), Postives = 46/89 (51.69%), Query Frame = 3
Query: 1650 RSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAI 1916
            R+   +DRE    + LT +A D G P L+ T  V IR+ DVND  P F           N  + + +++G++ A D D G N  V+Y+I
Sbjct: 1066 RTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPEN--SPVGSVVGEIHAHDPDEGVNAVVHYSI 1152          

HSP 3 Score: 52.373 bits (124), Expect = 1.359e-37
Identity = 32/94 (34.04%), Postives = 47/94 (50.00%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNND-ENYYFTI 1632
             DRE+ S Y + +   D G P L       + + D NDNAP F S   + ++ E+  +G  +  V A DPD   NGR+ Y + + D E+  F I
Sbjct:  965 LDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVI 1058          

HSP 4 Score: 77.0258 bits (188), Expect = 2.047e-37
Identity = 80/268 (29.85%), Postives = 123/268 (45.90%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQ-YFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYIPNNLTP 2465
            +D + + ++ LT+ A D+G  S  DT TVHI I D N+  P+F+   Y   + E   + T   +   V+A D D+G N  + Y++ ++   S                G +     +DRE        + A D G P LS   +V + V DVNDN P FK P+ + + +    D+ VG  +    A DPD G NG I Y ++S + +E    + +      I T    +RE + +   L   A D G+PP +  V V IR    N +P
Sbjct:  857 LDYKQEKRFLLTVAATDSGGRS--DTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLV---VSATDSDVGVNAQITYSLNEE---SINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILE---DALVGTSVIQVAASDPDVGLNGRIKY-LLSDRDIEDG-SFVIDPTSGTIRTNKGLDRESVAV-FHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSP 1110          

HSP 5 Score: 72.7886 bits (177), Expect = 2.047e-37
Identity = 87/361 (24.10%), Postives = 151/361 (41.83%), Query Frame = 3
Query:  219 PINSSGTYNIISN-EPDINNYFILQSHSGILKQRNNIDRETMCKHA-DVCQKIILISINGQVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAED-----SGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQG-----PLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLND 1259
            P +S   Y+++S  +    + F + S +G++    ++DRE M  H   V               + V + D ND+ P F       SI+E + +GS +    A D D   N+ I Y I+ +   D   + Q Q    F I  ++        +     +DRE  D + L++ A D     S ++  + ++ V ++D NDN PQ+     +  V E D+ G      +  ++A D D  +  N  I+Y I   + + +     F I   S  +S       +        I A DGG   R N+T + + + D ND+AP     +   S+ EN      +  V   D D+G N++    +++
Sbjct:  386 PEDSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAV--TDGAGLAQDQEMPIFRIDSRS------GVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPE-DQWGGTEDNTVAHIRATDADQGN--NAAIRYAIIGGNTQSQ-----FSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISE 730          

HSP 6 Score: 48.1358 bits (113), Expect = 2.047e-37
Identity = 29/94 (30.85%), Postives = 41/94 (43.62%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTIT 1635
             DRE    ++  +   D G PP        +T+ D NDN P F        + E+   G P+  V A DPD  E+ R+ Y+I   +    F IT
Sbjct:  752 LDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAIT 843          

HSP 7 Score: 93.2041 bits (230), Expect = 1.281e-18
Identity = 90/329 (27.36%), Postives = 156/329 (47.42%), Query Frame = 3
Query:  279 FILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQ----VLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSE---LSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCT--ITVSIIDVNDNSPQWPTVNISKTVKECDRQG-PLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTY--ITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDK 1223
            F + S SG++  R+++DRET   +  +     L S   +       V V + D+NDN PQFS R  T+ + E+   G+E   ++   A D D   N+ IRY I   +++     +QF           +I+ M    + L+K +D E +  + L++ A+D G    S T  + V++ID NDN+P++ T    ++V E    G  ++ +QA+D D+ +  N +I Y IS+           F +A        Q ++ +D +      F + A DGG   +  S++V I ++D ND+ P        A++ E+      +T+V   D D+
Sbjct:  521 FRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQ-----SQF-----------SIDSMS-GDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGA--NAEITYSISERDDN-------FPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDE 823          

HSP 8 Score: 90.5077 bits (223), Expect = 1.046e-17
Identity = 83/250 (33.20%), Postives = 118/250 (47.20%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQ-NLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPP 2411
            +DRE    Y LT+ AKD G PSL+DT  V I + DVND  P FK   +      + L     I  +V A D D+G NG      R KY  S+R    G  ++      I    G +DRE +       IA D G P LS+   V + + DVND+ P F    +K+  + +  +S VG V+    A DPD+G N  + YSII        +L  +  ++   +LT    + E  R    L++RA+   +PP
Sbjct:  965 LDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVI--QVAASDPDVGLNG------RIKYLLSDRDIEDGSFVIDPTSGTIRTNKG-LDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFAS--DKIT-LYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAA---SPP 1199          

HSP 9 Score: 60.4622 bits (145), Expect = 1.728e-14
Identity = 74/273 (27.11%), Postives = 120/273 (43.96%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYIPNNLTPRNNALP 2483
            +D E    Y L I A+D G PS ++T  + + ++D ND  P F    F +    N     + I  +V A D D G N  + Y+I ++ D+          L      G +     +DRE+      +++A D G P  SA ++V++ V DVNDN P F     K    N+  D   G  +    A DPD  E+  + Y I +     +         G + + ++L  ++  R    L + A+D+G   +++  TV+I     N+T  NN  P
Sbjct:  647 LDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNII--RVQAYDSDEGANAEITYSISERDDN--------FPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFN---PKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRF--LLTVAATDSGG--RSDTATVHI-----NITDANNFAP 895          

HSP 10 Score: 39.6614 bits (91), Expect = 1.728e-14
Identity = 25/99 (25.25%), Postives = 41/99 (41.41%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPP---LVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGA---PIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
             DRE+   Y +L+   DL               V ++D+NDN P+F        + E+   G     + ++RA D D   N  + Y I+  +    F+I
Sbjct:  536 LDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSI 634          

HSP 11 Score: 72.4034 bits (176), Expect = 3.061e-12
Identity = 81/282 (28.72%), Postives = 134/282 (47.52%), Query Frame = 3
Query: 1653 SQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFK-QQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSN-RQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQ---LSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVG---KVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQN-DGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYI-PNNLTPR 2468
            +   +DRE+ D +   ++A D+  P  + T T+ + +LD ND  P F+ +Q+   I EG   AT+ + +  + A D+D+G+N  + Y I    D +   Q+         +  G+++    +DRE   S    + A D    Q    +A A+V V VLD NDN P+F     +   + +  D   G     +A+  A D D+G N  I Y+II      Q   + + +  G + L K L + E +R   RL+IRA D G+P ++    + +  I  N+  PR
Sbjct:  418 TSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREG---ATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFS---ERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQ---FSIDSMSGDVSLVKPL-DYESVR-SYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPR 688          

HSP 12 Score: 68.9366 bits (167), Expect = 3.185e-11
Identity = 76/301 (25.25%), Postives = 137/301 (45.51%), Query Frame = 3
Query:  405 VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCT--ITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITA--VDGGGRENSTAVTIEI--EDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDL---NDTTYFTMV 1280
            V + I D N+  P F     + S+ E++ +G+ + + +A D D   N+ I Y + +        +N   +   F+I  +T        +     +DRE    + L + A+D G    S T  + + + DVNDN+P + +     ++ E    G  V +Q    D     NG+IKY +SD    +++ +  F I       + +  + +D ++   F +TA  VD G    S+ V ++I  ED ND  P  A  K T  + EN     V+  +  +D D+G+N+  +  +   +D+  F++V
Sbjct:  883 VHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNE------ESINGLGSPDPFSINPQT------GAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSV-IQVAASDPDVGLNGRIKYLLSD----RDIEDGSFVI--DPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLV 1164          

HSP 13 Score: 66.6254 bits (161), Expect = 1.900e-10
Identity = 31/93 (33.33%), Postives = 51/93 (54.84%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
             DRES++ + +    +D G PPL       + + D ND+ P F SD I   + EN+ +G+ +G + A+DPD   N  V Y I+  D++  F++
Sbjct: 1071 LDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSL 1163          

HSP 14 Score: 63.1586 bits (152), Expect = 2.150e-9
Identity = 32/89 (35.96%), Postives = 47/89 (52.81%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENY 1620
             D ES+  Y ++IR  D G P         V +ID NDNAP+F +   + ++ EN  +G  I  V+AYD D   N  ++Y I   D+N+
Sbjct:  647 LDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNF 735          

HSP 15 Score: 59.3066 bits (142), Expect = 2.927e-8
Identity = 83/324 (25.62%), Postives = 128/324 (39.51%), Query Frame = 3
Query:  222 INSSGTYNIISNEPDINNY-----FILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQ---------VLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSII--DVNDNSPQWPTVNISKTVKECDRQGPLV-ELQAFDRDDSSTPNGQIKYKI--SDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGR--ENSTAVTIEIEDCNDHAP 1130
            +N+  TY++  NE  IN       F +   +G +     +DRET   +        L+++  +           +V + + D NDN P F       SI E++ +G+ +    A D D   N  I+Y + D   RDI   +        TI             +  K +DRE +  F L  IA D G    S T+ V I   DVND+ P + +  I+  V E    G +V E+ A D D+    N  + Y I   D+S    L+ R       S       +  +D ++    F   V        N   + I + D ND+AP
Sbjct:  928 VNAQITYSL--NEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGY--------LLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSD---RDIEDGSFVIDPTSGTI-------------RTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGV--NAVVHYSIIGGDDSNAFSLVTR-----PGSERAQLLTMTELDYESTRKRFELVVRAASPPLRNDAHIEILVTDVNDNAP 1218          
BLAST of Protocadherin-1 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0300578)

HSP 1 Score: 90.5077 bits (223), Expect = 1.359e-37
Identity = 79/293 (26.96%), Postives = 129/293 (44.03%), Query Frame = 3
Query:  402 EVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQG-PLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFIT--AVDGGGRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTT 1265
            +++V + D NDN P+F       S+ EN  +G  +    A D D   N+ I Y I +   RD            F + +      +  +++ IK +DREE  RF   ++A+D G   +  S ++ +++ DVNDN P +        V E    G P+  + A D D+ S    ++ Y+I+  + +       F I   +        Q +D K    F +T  A D GGR ++  V I I D N+ AP       +AS+ E+      +  V   D D G+N+Q    LN+ +
Sbjct:  674 QLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISE---RDDN----------FPLAVDP----RTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDS----RLHYEITTGNTRGR-----FAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEES 940          

HSP 2 Score: 55.4546 bits (132), Expect = 1.359e-37
Identity = 31/89 (34.83%), Postives = 46/89 (51.69%), Query Frame = 3
Query: 1650 RSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAI 1916
            R+   +DRE    + LT +A D G P L+ T  V IR+ DVND  P F           N  + + +++G++ A D D G N  V+Y+I
Sbjct: 1066 RTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPEN--SPVGSVVGEIHAHDPDEGVNAVVHYSI 1152          

HSP 3 Score: 52.373 bits (124), Expect = 1.359e-37
Identity = 32/94 (34.04%), Postives = 47/94 (50.00%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNND-ENYYFTI 1632
             DRE+ S Y + +   D G P L       + + D NDNAP F S   + ++ E+  +G  +  V A DPD   NGR+ Y + + D E+  F I
Sbjct:  965 LDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVI 1058          

HSP 4 Score: 77.0258 bits (188), Expect = 2.047e-37
Identity = 80/268 (29.85%), Postives = 123/268 (45.90%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQ-YFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYIPNNLTP 2465
            +D + + ++ LT+ A D+G  S  DT TVHI I D N+  P+F+   Y   + E   + T   +   V+A D D+G N  + Y++ ++   S                G +     +DRE        + A D G P LS   +V + V DVNDN P FK P+ + + +    D+ VG  +    A DPD G NG I Y ++S + +E    + +      I T    +RE + +   L   A D G+PP +  V V IR    N +P
Sbjct:  857 LDYKQEKRFLLTVAATDSGGRS--DTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLV---VSATDSDVGVNAQITYSLNEE---SINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILE---DALVGTSVIQVAASDPDVGLNGRIKY-LLSDRDIEDG-SFVIDPTSGTIRTNKGLDRESVAV-FHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSP 1110          

HSP 5 Score: 72.7886 bits (177), Expect = 2.047e-37
Identity = 87/361 (24.10%), Postives = 151/361 (41.83%), Query Frame = 3
Query:  219 PINSSGTYNIISN-EPDINNYFILQSHSGILKQRNNIDRETMCKHA-DVCQKIILISINGQVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAED-----SGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQG-----PLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLND 1259
            P +S   Y+++S  +    + F + S +G++    ++DRE M  H   V               + V + D ND+ P F       SI+E + +GS +    A D D   N+ I Y I+ +   D   + Q Q    F I  ++        +     +DRE  D + L++ A D     S ++  + ++ V ++D NDN PQ+     +  V E D+ G      +  ++A D D  +  N  I+Y I   + + +     F I   S  +S       +        I A DGG   R N+T + + + D ND+AP     +   S+ EN      +  V   D D+G N++    +++
Sbjct:  386 PEDSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAV--TDGAGLAQDQEMPIFRIDSRS------GVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPE-DQWGGTEDNTVAHIRATDADQGN--NAAIRYAIIGGNTQSQ-----FSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISE 730          

HSP 6 Score: 48.1358 bits (113), Expect = 2.047e-37
Identity = 29/94 (30.85%), Postives = 41/94 (43.62%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTIT 1635
             DRE    ++  +   D G PP        +T+ D NDN P F        + E+   G P+  V A DPD  E+ R+ Y+I   +    F IT
Sbjct:  752 LDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAIT 843          

HSP 7 Score: 93.2041 bits (230), Expect = 1.281e-18
Identity = 90/329 (27.36%), Postives = 156/329 (47.42%), Query Frame = 3
Query:  279 FILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQ----VLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSE---LSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCT--ITVSIIDVNDNSPQWPTVNISKTVKECDRQG-PLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTY--ITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDK 1223
            F + S SG++  R+++DRET   +  +     L S   +       V V + D+NDN PQFS R  T+ + E+   G+E   ++   A D D   N+ IRY I   +++     +QF           +I+ M    + L+K +D E +  + L++ A+D G    S T  + V++ID NDN+P++ T    ++V E    G  ++ +QA+D D+ +  N +I Y IS+           F +A        Q ++ +D +      F + A DGG   +  S++V I ++D ND+ P        A++ E+      +T+V   D D+
Sbjct:  521 FRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQ-----SQF-----------SIDSMS-GDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGA--NAEITYSISERDDN-------FPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDE 823          

HSP 8 Score: 90.5077 bits (223), Expect = 1.046e-17
Identity = 83/250 (33.20%), Postives = 118/250 (47.20%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQ-NLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPP 2411
            +DRE    Y LT+ AKD G PSL+DT  V I + DVND  P FK   +      + L     I  +V A D D+G NG      R KY  S+R    G  ++      I    G +DRE +       IA D G P LS+   V + + DVND+ P F    +K+  + +  +S VG V+    A DPD+G N  + YSII        +L  +  ++   +LT    + E  R    L++RA+   +PP
Sbjct:  965 LDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVI--QVAASDPDVGLNG------RIKYLLSDRDIEDGSFVIDPTSGTIRTNKG-LDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFAS--DKIT-LYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAA---SPP 1199          

HSP 9 Score: 60.4622 bits (145), Expect = 1.728e-14
Identity = 74/273 (27.11%), Postives = 120/273 (43.96%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYIPNNLTPRNNALP 2483
            +D E    Y L I A+D G PS ++T  + + ++D ND  P F    F +    N     + I  +V A D D G N  + Y+I ++ D+          L      G +     +DRE+      +++A D G P  SA ++V++ V DVNDN P F     K    N+  D   G  +    A DPD  E+  + Y I +     +         G + + ++L  ++  R    L + A+D+G   +++  TV+I     N+T  NN  P
Sbjct:  647 LDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNII--RVQAYDSDEGANAEITYSISERDDN--------FPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFN---PKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRF--LLTVAATDSGG--RSDTATVHI-----NITDANNFAP 895          

HSP 10 Score: 39.6614 bits (91), Expect = 1.728e-14
Identity = 25/99 (25.25%), Postives = 41/99 (41.41%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPP---LVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGA---PIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
             DRE+   Y +L+   DL               V ++D+NDN P+F        + E+   G     + ++RA D D   N  + Y I+  +    F+I
Sbjct:  536 LDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSI 634          

HSP 11 Score: 72.4034 bits (176), Expect = 3.061e-12
Identity = 81/282 (28.72%), Postives = 134/282 (47.52%), Query Frame = 3
Query: 1653 SQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFK-QQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSN-RQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQ---LSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVG---KVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQN-DGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYI-PNNLTPR 2468
            +   +DRE+ D +   ++A D+  P  + T T+ + +LD ND  P F+ +Q+   I EG   AT+ + +  + A D+D+G+N  + Y I    D +   Q+         +  G+++    +DRE   S    + A D    Q    +A A+V V VLD NDN P+F     +   + +  D   G     +A+  A D D+G N  I Y+II      Q   + + +  G + L K L + E +R   RL+IRA D G+P ++    + +  I  N+  PR
Sbjct:  418 TSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREG---ATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFS---ERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQ---FSIDSMSGDVSLVKPL-DYESVR-SYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPR 688          

HSP 12 Score: 68.9366 bits (167), Expect = 3.185e-11
Identity = 76/301 (25.25%), Postives = 137/301 (45.51%), Query Frame = 3
Query:  405 VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCT--ITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITA--VDGGGRENSTAVTIEI--EDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDL---NDTTYFTMV 1280
            V + I D N+  P F     + S+ E++ +G+ + + +A D D   N+ I Y + +        +N   +   F+I  +T        +     +DRE    + L + A+D G    S T  + + + DVNDN+P + +     ++ E    G  V +Q    D     NG+IKY +SD    +++ +  F I       + +  + +D ++   F +TA  VD G    S+ V ++I  ED ND  P  A  K T  + EN     V+  +  +D D+G+N+  +  +   +D+  F++V
Sbjct:  883 VHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNE------ESINGLGSPDPFSINPQT------GAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSV-IQVAASDPDVGLNGRIKYLLSD----RDIEDGSFVI--DPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLV 1164          

HSP 13 Score: 66.6254 bits (161), Expect = 1.900e-10
Identity = 31/93 (33.33%), Postives = 51/93 (54.84%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
             DRES++ + +    +D G PPL       + + D ND+ P F SD I   + EN+ +G+ +G + A+DPD   N  V Y I+  D++  F++
Sbjct: 1071 LDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSL 1163          

HSP 14 Score: 63.1586 bits (152), Expect = 2.150e-9
Identity = 32/89 (35.96%), Postives = 47/89 (52.81%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENY 1620
             D ES+  Y ++IR  D G P         V +ID NDNAP+F +   + ++ EN  +G  I  V+AYD D   N  ++Y I   D+N+
Sbjct:  647 LDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNF 735          

HSP 15 Score: 59.3066 bits (142), Expect = 2.927e-8
Identity = 83/324 (25.62%), Postives = 128/324 (39.51%), Query Frame = 3
Query:  222 INSSGTYNIISNEPDINNY-----FILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQ---------VLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSII--DVNDNSPQWPTVNISKTVKECDRQGPLV-ELQAFDRDDSSTPNGQIKYKI--SDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGR--ENSTAVTIEIEDCNDHAP 1130
            +N+  TY++  NE  IN       F +   +G +     +DRET   +        L+++  +           +V + + D NDN P F       SI E++ +G+ +    A D D   N  I+Y + D   RDI   +        TI             +  K +DRE +  F L  IA D G    S T+ V I   DVND+ P + +  I+  V E    G +V E+ A D D+    N  + Y I   D+S    L+ R       S       +  +D ++    F   V        N   + I + D ND+AP
Sbjct:  928 VNAQITYSL--NEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGY--------LLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSD---RDIEDGSFVIDPTSGTI-------------RTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGV--NAVVHYSIIGGDDSNAFSLVTR-----PGSERAQLLTMTELDYESTRKRFELVVRAASPPLRNDAHIEILVTDVNDNAP 1218          
BLAST of Protocadherin-1 vs. Ensembl Zebrafish
Match: pcdh2ab9 (protocadherin 2 alpha b 9 [Source:ZFIN;Acc:ZDB-GENE-041118-8])

HSP 1 Score: 122.865 bits (307), Expect = 4.734e-53
Identity = 105/353 (29.75%), Postives = 165/353 (46.74%), Query Frame = 3
Query:  240 YNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISING--QVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQ--GSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKI-SDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENST--AVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYFTM 1277
            + I+S   D  + F++  ++G+L+ +  IDRE +C     C   + I +    ++  + V I D ND+ P F+ + K L I EN+ IG+   L  A D DS  NS+  Y              +   + +F + I+     K+P+L L K +DRE      LIL A D G  Q  G+  ITV ++DVNDN P +     S TV E  + G LV L+    D    PNG++ Y    DNS   + I  +F +   +  +   G    +        I AVD G    +T   V I+I D ND+ P I +   +  + E+ +   +++ + V D D GIN +  C L++   F +
Sbjct:   66 FRIVSGSDD--SQFVVNPNNGVLRVQRKIDREELCDGIGACLINLKIVVENPLEIHYIAVEITDVNDHSPTFTEKEKRLEISENTLIGTRFQLQAARDPDSGVNSVRSY--------------KLSQNEHFDLEIRDRAEDKLPFLVLQKPLDRENKAEHYLILTAIDGGNPQRSGTLNITVIVLDVNDNRPMFSHDVYSSTVHENVQLGTLV-LKVMASDSDYGPNGEVSYSFGGDNS---DNIFHIFSLDRITGEIRVTGEVDFEKNNVYKLDIQAVDSGQPPLNTDCRVIIKILDLNDNKPTIEVTSLSNVVSEDSKPGTLISLISVTDRDTGINGRVVCSLSEHVPFEL 398          

HSP 2 Score: 77.0258 bits (188), Expect = 4.734e-53
Identity = 37/86 (43.02%), Postives = 52/86 (60.47%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNND 1611
             DRE+LS + + I   DLG+PPL   K  +V + D NDN P+F  + +   + ENN  GAPI  + A+D D NEN  +SYQI+  +
Sbjct:  415 LDRETLSHFDITITATDLGQPPLSSYKTLSVQVSDVNDNPPEFSLNPVELYMIENNAAGAPILTLSAFDKDLNENAIISYQIIKGN 500          

HSP 3 Score: 50.8322 bits (120), Expect = 4.734e-53
Identity = 31/100 (31.00%), Postives = 50/100 (50.00%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAI---------LGKVTADDKDLGENGTVYYAIRQKYDHS 1937
             D E   ++   I+A D+G PSL+   TV++ ILD ND VPV      Y ++       +  I         + KV A D D+G NG + +++++  +HS
Sbjct:  525 FDFETVKKFQFHILATDSGSPSLSSNVTVNVFILDQNDNVPVI----LYPVSANGSAEGVEEIPRNVNAGHLVTKVRAYDADIGYNGWLLFSLQEVSEHS 620          

HSP 4 Score: 64.6994 bits (156), Expect = 6.891e-20
Identity = 73/266 (27.44%), Postives = 118/266 (44.36%), Query Frame = 3
Query: 1644 ENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPD-RLIIRASDNGTPPKAELVTVNI 2438
            E R   E+D E  + Y L I A D+G+P LN  C V I+ILD+ND  P  +      +   +  +    ++  ++  D+D G NG V  ++ +      + +        +         G +DRE +      I A D G+P LS+   + V V DVNDN P+F   +N +    I  ++  G  +    A D D  EN  I+Y II     + +L   L  +        L+  +   +   +  I A+D+G+P  +  VTVN+
Sbjct:  302 EIRVTGEVDFEKNNVYKLDIQAVDSGQPPLNTDCRVIIKILDLNDNKPTIEVTSLSNVVSED--SKPGTLISLISVTDRDTGINGRVVCSLSEHVPFELKPSVQENMFSLVTK-------GKLDRETLSHFDITITATDLGQPPLSSYKTLSVQVSDVNDNPPEFS--LNPVELYMIENNA-AGAPILTLSAFDKDLNENAIISYQIIKGNGSQSDLTSFLNVNSETGAVYALKSFDFETVKKFQFHILATDSGSPSLSSNVTVNV 555          

HSP 5 Score: 53.9138 bits (128), Expect = 6.891e-20
Identity = 34/105 (32.38%), Postives = 52/105 (49.52%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITILGKIEAKWKL 1668
             DRE+ + + +++  ID G P   G    TV ++D NDN P F  D    T+ EN  +G  +  V A D D   NG VSY    ++ +  F I  L +I  + ++
Sbjct:  201 LDRENKAEHYLILTAIDGGNPQRSGTLNITVIVLDVNDNRPMFSHDVYSSTVHENVQLGTLVLKVMASDSDYGPNGEVSYSFGGDNSDNIFHIFSLDRITGEIRV 305          

HSP 6 Score: 71.2478 bits (173), Expect = 5.866e-18
Identity = 82/277 (29.60%), Postives = 136/277 (49.10%), Query Frame = 3
Query: 1656 QMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYIPNNLTPRNNALPP 2486
            Q  +DRE K ++ L + A D G P  + T  + + +LDVND  P+F    +      N    +  ++ KV A D D G NG V Y+     D+S+    I        + G + + G VD E+    + +I A D+G+P L+    VI+ +LD+NDNKP  +  +  ++ + +S DS+ G +++     D D G NG +  S+  H   E  L   +Q +   ++TK   +RE +   D + I A+D G PP +   T++++    N  P   +L P
Sbjct:  198 QKPLDRENKAEHYLILTAIDGGNPQRSGTLNITVIVLDVNDNRPMFSHDVYSSTVHEN--VQLGTLVLKVMASDSDYGPNGEVSYSFGG--DNSDN---IFHIFSLDRITGEIRVTGEVDFEKNNVYKLDIQAVDSGQPPLNTDCRVIIKILDLNDNKPTIE--VTSLSNV-VSEDSKPGTLISLISVTDRDTGINGRVVCSLSEHVPFE--LKPSVQENMFSLVTKGKLDRETLSHFD-ITITATDLGQPPLSSYKTLSVQVSDVNDNPPEFSLNP 461          

HSP 7 Score: 41.2022 bits (95), Expect = 5.866e-18
Identity = 25/74 (33.78%), Postives = 36/74 (48.65%), Query Frame = 1
Query: 1438 FTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITILGKIEAK 1659
              V I D ND++P F   + R  ++EN  IG       A DPDS  N   SY++    +N +F + I  + E K
Sbjct:  121 IAVEITDVNDHSPTFTEKEKRLEISENTLIGTRFQLQAARDPDSGVNSVRSYKL---SQNEHFDLEIRDRAEDK 191          

HSP 8 Score: 67.781 bits (164), Expect = 8.785e-11
Identity = 79/315 (25.08%), Postives = 142/315 (45.08%), Query Frame = 3
Query:  324 IDRETMCKHADVCQKIILISINGQ------VLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQ--QGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVEL-QAFDRDDSSTPNGQIKYKISDNSP---KKELINRLFYIAXXXXXXXXXXXXXMDLKTYITF--FITAVDGGGRENST--AVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDD 1220
            +DRE   +H      +IL +I+G        L + V + D NDN P FS    + ++ EN  +G+ +    A D D  PN  + Y     +S +I           F IF  +++R+    +++  E+D E+ + ++L + A DSG+      C + + I+D+NDN P     ++S  V E  + G L+ L    DRD  +  NG++   +S++ P   K  +   +F +              +D +T   F   ITA D G    S+   +++++ D ND+ P  ++      + EN+     + ++   D D
Sbjct:  201 LDRENKAEH-----YLILTAIDGGNPQRSGTLNITVIVLDVNDNRPMFSHDVYSSTVHENVQLGTLVLKVMASDSDYGPNGEVSYSFGGDNSDNI-----------FHIF--SLDRIT-GEIRVTGEVDFEKNNVYKLDIQAVDSGQPPLNTDCRVIIKILDLNDNKPTIEVTSLSNVVSEDSKPGTLISLISVTDRD--TGINGRVVCSLSEHVPFELKPSVQENMFSLVTKGK---------LDRETLSHFDITITATDLGQPPLSSYKTLSVQVSDVNDNPPEFSLNPVELYMIENNAAGAPILTLSAFDKD 485          

HSP 9 Score: 53.5286 bits (127), Expect = 1.935e-6
Identity = 70/318 (22.01%), Postives = 131/318 (41.19%), Query Frame = 3
Query:  405 VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSC--TITVSIIDVNDNSPQWPTVNISKTVKECDRQG-PLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYFTMVKECLQSIKWTAALYVQYQKNPRH 1349
            V++ I D NDN P   +   +  + E+S  G+ +SL +  D D+  N  +   + +    +++   Q      F++  K              ++DRE +  F++ + A D G+   S   T++V + DVNDN P++    +   + E +  G P++ L AFD+D +   N  I Y+I   +  +  +     +   +  + +      +      F I A D G    S+ VT+          N+ I      + +ND  P++L  V  N   +G+  +   ++N     T V+     I +   L    Q+   H
Sbjct:  337 VIIKILDLNDNKPTIEVTSLSNVVSEDSKPGTLISLISVTDRDTGINGRVVCSLSEHVPFELKPSVQ---ENMFSLVTK-------------GKLDRETLSHFDITITATDLGQPPLSSYKTLSVQVSDVNDNPPEFSLNPVELYMIENNAAGAPILTLSAFDKDLNE--NAIISYQIIKGNGSQSDLTSFLNVNSETGAVYALKSFDFETVKKFQFHILATDSGSPSLSSNVTV----------NVFI------LDQNDNVPVILYPVSANGSAEGV-EEIPRNVNAGHLVTKVRAYDADIGYNGWLLFSLQEVSEH 619          

HSP 10 Score: 51.2174 bits (121), Expect = 8.608e-6
Identity = 61/209 (29.19%), Postives = 98/209 (46.89%), Query Frame = 3
Query:  306 LKQRNNIDRETMCKHADVCQKIILISINGQVLE----VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVS--IIDVNDNSP--QWPTV--NISKTVKECDR---QGPLV-ELQAFDRD 890
            L  +  +DRET+  H D+   I    +    L     + V ++D NDN P+FS+    L + EN+  G+ +   +A D D   N+II Y         I + N  Q+    T F+   +     Y   +K  D E + +F+  ++A DSG    S  +TV+  I+D NDN P   +P      ++ V+E  R    G LV +++A+D D
Sbjct:  409 LVTKGKLDRETLS-HFDIT--ITATDLGQPPLSSYKTLSVQVSDVNDNPPEFSLNPVELYMIENNAAGAPILTLSAFDKDLNENAIISY--------QIIKGNGSQSD--LTSFLNVNSETGAVY--ALKSFDFETVKKFQFHILATDSGSPSLSSNVTVNVFILDQNDNVPVILYPVSANGSAEGVEEIPRNVNAGHLVTKVRAYDAD 602          
BLAST of Protocadherin-1 vs. Ensembl Zebrafish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 93.5893 bits (231), Expect = 1.315e-44
Identity = 93/336 (27.68%), Postives = 150/336 (44.64%), Query Frame = 3
Query:  324 IDRETM--CKHA--------DVCQKIILISINGQVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKIS---DNSPKKELINR---LFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENS--TAVTIEIEDCNDHAPNIAIYK--------STASIRENDRTPLVLTSVMVNDDDKGINSQFNC 1247
            IDRET+  C++         +V    ++ + + +++E  + + D NDN PQF     TLS+ EN+ +G+  S+P A D D+E N +  Y +              +A   F + +      K+P L ++  +DRE  D ++L + A D G   +  S  + V I D NDN+P++   +    V E    G  V LQ    D    PNG+I+Y +    D  PK   I+R   + Y+ G                  + F++ A D G    S  T V+I++ D ND+AP + I            A+I E+      +  V V+D D+G N+   C
Sbjct:   80 IDRETLKDCRNKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTL----------TAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSV-LQVKANDSDLGPNGEIEYTLHQAIDPVPKLLRIDRSSGIIYVKGPLDREEINN---------LKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTC 395          

HSP 2 Score: 83.9593 bits (206), Expect = 1.315e-44
Identity = 90/267 (33.71%), Postives = 126/267 (47.19%), Query Frame = 3
Query: 1644 ENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFK-QQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNL-REREGIRLPDRLIIRASDNGTPPKAELVTVNI 2438
            E R++  +DRE KD+Y   + A D G PS   T TV I++LD ND  P F    Y + + E   +  +  + G VT  D D GEN  V  ++         QN  G  L  I+           DRE+  S    + A D G P  S+   V ++VLD NDN P    P N  +FI +S  +    V+   EAED D G N  + YSI        +L Y   ++G + LTK L R+  G+    RL+I+ SD G P +  +  V+I
Sbjct:  526 EVRARSPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSGYSFSVLEN--MPPLSPV-GMVTVQDMDEGENAQVQLSVEPDVGKFVIQNGTGTILSSIS----------FDREKESSYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVVTKPSNS-SFIRLSPMAAPDSVVEVVEAEDIDSGSNAELVYSIAGGN--PHDLFYISPSNGEITLTKELTRKHSGLH---RLVIKVSDRGKPSRHAIALVHI 773          

HSP 3 Score: 44.669 bits (104), Expect = 1.315e-44
Identity = 31/100 (31.00%), Postives = 40/100 (40.00%), Query Frame = 1
Query: 1303 NGRQLFMYNIKKIPDTFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQIL 1602
            N R+ F+        T  D E +  Y V I  +D G P L       V + D NDN+P F          E N  G  +  V A D DS  N  + Y I+
Sbjct:  415 NKRKYFLQTT-----TPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVVASDADSGTNAELVYSII 509          

HSP 4 Score: 52.373 bits (124), Expect = 3.537e-18
Identity = 85/298 (28.52%), Postives = 132/298 (44.30%), Query Frame = 3
Query: 1635 YFRENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYF-YQITEGN--GLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFI-NISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNL-PYQLQNDGRLILTKNL--REREGIRLPDRLIIRASDNGTPPKAELVTVNIRYIPNNLTPRNNALPPGINKKSN 2507
            YF +  + ++ +R ++D Y + I+A D+G P+L+ T ++ +++ D ND  P+F    F  +  E N  G   +     +V A D D G N  + Y+I    D S R                      +DRE     +  + A D G P     A V++ VLD NDN PKF       + + N+   S VG V      +D D+GEN  +  S+      E ++  + +QN    IL+     RE+E         ++A D G PP++  V V I    N L   +NA  P + K SN
Sbjct:  419 YFLQTTTPLDYER-VRD-YRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVV-----EVVASDADSGTNAELVYSIIA--DSSTRGLFEIDPNSGEVRARSP-----LDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVT----VQDMDEGENAQVQLSV------EPDVGKFVIQNGTGTILSSISFDREKESSYT---FRLKAVDGGDPPRSSYVGVTI----NVLDENDNA--PVVTKPSN 683          

HSP 5 Score: 47.7506 bits (112), Expect = 3.537e-18
Identity = 50/191 (26.18%), Postives = 78/191 (40.84%), Query Frame = 3
Query:  771 VSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQ-AFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMD--LKTYITFFITAVDGGG--RENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYFTMVKECLQSIKWTAALYVQ 1328
            + + D+NDN+PQ+P+  ++ +V E    G L  +  A D+D     NG   Y ++       L                  L  +D  LK      I AVDGG   R +S  + + I D ND+AP        A + EN      +  V  ND D G N +    L+       V + L+  + +  +YV+
Sbjct:  119 IEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTER--NGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQA--IDPVPKLLRIDRSSGIIYVK 305          

HSP 6 Score: 32.7278 bits (73), Expect = 3.537e-18
Identity = 21/87 (24.14%), Postives = 36/87 (41.38%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPK--------FGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVS 1590
             DRE ++     +   D G  P   +   ++ + D+NDNAP             D    ++E+  +G  +  V+  D D  EN  V+
Sbjct:  308 LDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVT 394          

HSP 7 Score: 76.2554 bits (186), Expect = 3.435e-17
Identity = 71/223 (31.84%), Postives = 111/223 (49.78%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF-KQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFI-------NISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQ 2309
            +DRE+KD Y LTI A D G P    +  + + I D ND  P F K  Y  ++ E + +   H++L +V A+D DLG NG + Y + Q  D   +       L      GI+ + G +DRE++ +++  ++A D G    S+   V +DV D NDN P  +  I  +  +       NIS D  VG  +A  +  D D+GEN  +T  +        ++P+QL+
Sbjct:  201 LDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIG--HSVL-QVKANDSDLGPNGEIEYTLHQAIDPVPK------LLRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVE--IRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAG------DVPFQLR 406          

HSP 8 Score: 33.4982 bits (75), Expect = 3.435e-17
Identity = 18/57 (31.58%), Postives = 28/57 (49.12%), Query Frame = 1
Query: 1444 VTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDE 1614
            + + D NDN P+F S  +  ++ EN ++GA      A D D+  NG   Y +    E
Sbjct:  119 IEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTLTAGPE 175          

HSP 9 Score: 57.3806 bits (137), Expect = 6.283e-16
Identity = 71/292 (24.32%), Postives = 129/292 (44.18%), Query Frame = 3
Query:  405 VMVYINDENDNIPQFSMRHKTL--------SIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCT--ITVSIIDVNDNSPQW-PTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKI-SDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQ 1238
            V + + D+NDN P   +R   L        +I E+  +G+ ++L    D D   N+++   +       +R  +             +++  +  +L+    +D E +  + + ++A DSG    S T  + V + D NDNSP + PT+   +  +E      +VE+ A D D  +  N ++ Y I +D+S +      LF I  +S  + ++     + K    F +TA D G      +  V I++ D ND+ P   +   + S+ EN      +  V V D D+G N+Q
Sbjct:  336 VSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASD-----------SSVDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVVASDADSGT--NAELVYSIIADSSTRG-----LFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMDEGENAQ 609          

HSP 10 Score: 43.8986 bits (102), Expect = 6.283e-16
Identity = 33/101 (32.67%), Postives = 47/101 (46.53%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKF----GSDDIRFTLTENNNIGAP---IGYVRAYDPDSNENGRVSYQILNNDENYYFTIT 1635
            FDRE  S Y+  ++ +D G PP       T+ ++DENDNAP       S  IR +      + AP   +  V A D DS  N  + Y I   + +  F I+
Sbjct:  636 FDREKESSYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVVTKPSNSSFIRLS-----PMAAPDSVVEVVEAEDIDSGSNAELVYSIAGGNPHDLFYIS 731          

HSP 11 Score: 23.483 bits (49), Expect = 6.283e-16
Identity = 11/34 (32.35%), Postives = 17/34 (50.00%), Query Frame = 3
Query: 1662 EIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRI 1763
            E+ R+    + L I   D G+PS +    VHI +
Sbjct:  742 ELTRKHSGLHRLVIKVSDRGKPSRHAIALVHIYV 775          

HSP 12 Score: 60.4622 bits (145), Expect = 1.463e-8
Identity = 74/288 (25.69%), Postives = 123/288 (42.71%), Query Frame = 3
Query:  411 VYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRY-FIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKE-CDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPL-----VLTSVMVNDDDKGINSQF 1241
            V + D NDN P FS     +   E +  G ++    A D DS  N+ + Y  I D  +R +  ++                R + P       +DRE  DR+E  + A D G    +G+ T+ + ++D NDN P++     S +V E      P+  +   D D+    N Q++  +  +  K       F I   +  + S      + ++  TF + AVDGG   R +   VTI + D ND+AP +    +++ IR    +P+     V+  V   D D G N++ 
Sbjct:  457 VQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVVASDADSGTNAELVYSIIADSSTRGLFEIDPNSGEV----------RARSP-------LDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMDEGE--NAQVQLSVEPDVGK-------FVIQNGTGTILSSISFDREKESSYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVVTKPSNSSFIR---LSPMAAPDSVVEVVEAEDIDSGSNAEL 715          

HSP 13 Score: 59.3066 bits (142), Expect = 2.883e-8
Identity = 35/102 (34.31%), Postives = 47/102 (46.08%), Query Frame = 1
Query: 1306 GRQLFMYNIKKIPDTF----FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
            G Q+     +K+P        DRE    Y + I+ +D G PP     L  V I D NDNAPKF        + EN+ IG  +  V+A D D   NG + Y +
Sbjct:  181 GLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTL 282          
BLAST of Protocadherin-1 vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 106.301 bits (264), Expect = 1.414e-44
Identity = 99/349 (28.37%), Postives = 165/349 (47.28%), Query Frame = 3
Query:  276 YFILQSHSG-ILKQRNNIDRETM--CKH---ADVCQKIILISI-------NGQVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGK--QQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTA--VTIEIEDCNDHAPNIAIYK--------STASIRENDRTPLVLTSVMVNDDDKGINSQFNC 1247
            Y  +   +G I    N+IDRE++  C++    D C     +SI         +++E  + I DENDN PQFS    TLSI EN+ +G+  ++P A D DS  N I  Y +              +A+  F++ +   +  K+P L ++  +DRE  D ++L +   D G   +Q S  + ++I D NDN P++   +    + E    G  V LQ    D    PNG++ Y +  + P   ++ RL  I  ++  +  +G    +  + + F++ A D G +  S+   VTI ++D ND+AP+I I            A+I E+      +  V V+D D+G N+   C
Sbjct:   84 YLRVDGKTGDIYTTENSIDRESLKDCRNLFEGDPCFLEFEVSITDLMKGTGPRLIEGRIEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYAL----------TTGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSV-LQVKANDSDMGPNGEVTYSL--HQPSSPVM-RLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTC 418          

HSP 2 Score: 70.8626 bits (172), Expect = 1.414e-44
Identity = 78/268 (29.10%), Postives = 122/268 (45.52%), Query Frame = 3
Query: 1644 ENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFK-QQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPIN-KMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLRERE-GIRLPDRLIIRASDNGTPPKAELVTVNI 2438
            E R   ++DRE  D Y   + A D G PSL  T TV +++LD ND  P F    Y + + E   +  +  + G VT +D D GEN  V  ++         QN     L  I+           DRE+  +    + A D G P  S+   + ++VLD NDN P    P N    F++  T  +    + + EAED D G N  + ++I+        L +++ ++G + L K    +  G+    RL+++  D GTPP+     V+I
Sbjct:  549 EVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQE--NMPPLSPV-GMVTVNDHDEGENARVQLSVEPDNGKFMIQNGTYTILSTIS----------FDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPETH--VESVEAEDIDIGLNSELDFNIVGGN--PHGL-FRISSEGEITLAKEFTPKHIGLH---RLVVKVKDKGTPPRQTTALVHI 795          

HSP 3 Score: 45.0542 bits (105), Expect = 1.414e-44
Identity = 28/84 (33.33%), Postives = 35/84 (41.67%), Query Frame = 1
Query: 1348 TFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
            T  D E +  Y + I  +D G P L       V + D NDNAP F          E N  G  +  V A D DS  N  ++Y I
Sbjct:  448 TLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSI 531          

HSP 4 Score: 64.3142 bits (155), Expect = 1.950e-22
Identity = 88/306 (28.76%), Postives = 139/306 (45.42%), Query Frame = 3
Query: 1635 YFRENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQ-----QYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFI---NISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNL--REREGIRLPDRLIIRASDNGTPPKAELVTVNIRYIPNNLTPRNNALPPGINKKSNDKNRF 2522
            YF +  + ++ +R IK +Y + I+A D+G P+L+ T ++ +++ D+ND  PVF       ++F +   G+ +         V A D D G N  + Y+I          +            G + +   +DREQ+   Q  + A D G P L   A V+V VLD NDN PKF   +N  +F    N+   S VG V  N    D D+GEN  +  S+        N  + +QN    IL+     RE+E         ++A D G PP++  V + I  +  N    +NA  P + K +N   +F
Sbjct:  442 YFLQTTTLLDYER-IK-EYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVL-------DVVATDADSGTNAELTYSITGG-------SVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFM--LNGYSFSVQENMPPLSPVGMVTVN----DHDEGENARVQLSV-----EPDNGKFMIQNGTYTILSTISFDREKESTY---SFRLKAVDGGDPPRSSYVGITINVLDEN----DNA--PYVTKPANSSYKF 711          

HSP 5 Score: 44.2838 bits (103), Expect = 1.950e-22
Identity = 45/174 (25.86%), Postives = 69/174 (39.66%), Query Frame = 3
Query:  771 VSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQ-AFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMD--LKTYITFFITAVDGGG--RENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYFTM 1277
            + I+D NDN+PQ+ +  ++ ++ E    G L  +  A DRD  S  NG   Y ++       L +                L  +D  L+      I  VDGG   R++S  + I I D ND+ P          + EN      +  V  ND D G N +    L+  +   M
Sbjct:  142 IEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGS--NGIADYALTTGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSSPVM 313          

HSP 6 Score: 38.5058 bits (88), Expect = 1.950e-22
Identity = 24/86 (27.91%), Postives = 38/86 (44.19%), Query Frame = 1
Query: 1357 DRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKF--------GSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVS 1590
            DRE +S     ++  D G      + L T+T+ D+NDNAP            +D    ++E+  +G  +  V   D D  EN  V+
Sbjct:  332 DREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVT 417          

HSP 7 Score: 75.8702 bits (185), Expect = 1.162e-19
Identity = 75/238 (31.51%), Postives = 118/238 (49.58%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYF-YQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFI-------NISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLRERE 2354
            +DRE++D Y L I   D G P    +  + I I D ND VP F++ ++  ++ E + +   H++L +V A+D D+G NG V Y++ Q      R       L      GI+ + G VDRE++  ++  + A DNG    S+ A V + V D NDN P  +  I  +  +       NIS D  VG  +A  E  D D+GEN  +T  +        ++P+QL++      T N R+R+
Sbjct:  224 LDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVG--HSVL-QVKANDSDMGPNGEVTYSLHQPSSPVMR------LLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIR--IRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAG------DVPFQLRSASE---TGNDRKRK 441          

HSP 8 Score: 41.9726 bits (97), Expect = 1.162e-19
Identity = 21/57 (36.84%), Postives = 30/57 (52.63%), Query Frame = 1
Query: 1444 VTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDE 1614
            + I+DENDN P+F S  +  ++ EN ++GA      A D DS  NG   Y +    E
Sbjct:  142 IEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPE 198          

HSP 9 Score: 58.9214 bits (141), Expect = 7.061e-19
Identity = 31/82 (37.80%), Postives = 41/82 (50.00%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
             DRE    Y + I+ +D G PP     L  +TI D NDN PKF        L EN+ +G  +  V+A D D   NG V+Y +
Sbjct:  224 LDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSL 305          

HSP 10 Score: 56.225 bits (134), Expect = 7.061e-19
Identity = 73/278 (26.26%), Postives = 120/278 (43.17%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTA------DDKDLGEN--------GTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYIPNN 2456
            +DRE        + AKDNG  S +    V I + D ND  P  + +    +T  +G+A I   +   TA       D+D GEN        G V + +R   +  N +                    ++D E++   + EI+A D+G P LS+  ++ V V D+NDN P F   + ++ F     ++Q G  + +  A D D G N  +TYSI     + + L     N G + +   L +RE +    + ++ A+D G P      TV ++ +  N
Sbjct:  331 VDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTT----------LLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFE---ENQPGDKVLDVVATDADSGTNAELTYSITGGS-VPEGLFEINPNTGEVRVMSQL-DREQLDH-YQFLVAAADKGVPSLRGTATVVVKVLDRN 592          

HSP 11 Score: 63.929 bits (154), Expect = 9.148e-18
Identity = 76/356 (21.35%), Postives = 151/356 (42.42%), Query Frame = 3
Query:  225 NSSGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQVLE-----VMVYINDENDNIPQFSMRHKTL--------SIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCT--ITVSIIDVNDNSPQW-PTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQ 1238
            N   TY++      +     +  ++GI+  + ++DRE +     + +  +    NG   +     V + + D+NDN P   +R   L        +I E+  +G+ ++L    D D   N+++   +       +R  ++    R    F++T   +           D E I  + + ++A DSG    S T  + V + D+NDN+P + PT+   +  +E      ++++ A D D  +  N ++ Y I+  S    +   LF I  ++  +        +   +  F + A D G      +  V +++ D ND+ P   +   + S++EN      +  V VND D+G N++
Sbjct:  298 NGEVTYSLHQPSSPVMRLLSIDRNTGIIFVKGSVDREEIS----ILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLL-----------DYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGT--NAELTYSITGGS----VPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENAR 632          

HSP 12 Score: 44.669 bits (104), Expect = 9.148e-18
Identity = 32/102 (31.37%), Postives = 49/102 (48.04%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAP---KFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITILGKI 1650
            FDRE  S YS  ++ +D G PP       T+ ++DENDNAP   K  +   +F L    +    +  V A D D   N  + + I+  + +  F I+  G+I
Sbjct:  659 FDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKF-LDPRTSPETHVESVEAEDIDIGLNSELDFNIVGGNPHGLFRISSEGEI 759          

HSP 13 Score: 22.7126 bits (47), Expect = 9.148e-18
Identity = 9/25 (36.00%), Postives = 12/25 (48.00%), Query Frame = 3
Query: 1689 YSLTIMAKDNGEPSLNDTCTVHIRI 1763
            + L +  KD G P    T  VHI +
Sbjct:  773 HRLVVKVKDKGTPPRQTTALVHIYV 797          

HSP 14 Score: 61.2326 bits (147), Expect = 7.843e-9
Identity = 70/288 (24.31%), Postives = 129/288 (44.79%), Query Frame = 3
Query:  411 VYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKE-CDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTP--LVLTSVMVNDDDKGINSQFNCDL 1253
            V + D NDN P FS     +   E +  G ++    A D DS  N+ + Y I                S    +F    N  ++   +++ ++DRE++D ++ ++ A D G    +G+ T+ V ++D NDN P++     S +V+E      P+  +   D D+    N +++  +       E  N  F I   +  + S      + ++  +F + AVDGG   R +   +TI + D ND+AP +    +++    + RT     + SV   D D G+NS+ + ++
Sbjct:  480 VQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITG-------------GSVPEGLFEINPNTGEV---RVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGE--NARVQLSV-------EPDNGKFMIQNGTYTILSTISFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPETHVESVEAEDIDIGLNSELDFNI 742          

HSP 15 Score: 60.077 bits (144), Expect = 1.755e-8
Identity = 36/102 (35.29%), Postives = 48/102 (47.06%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYF---TITILGKI 1650
             DRE L  Y  L+   D G P L G     V ++D NDN PKF  +   F++ EN    +P+G V   D D  EN RV   +  ++  +     T TIL  I
Sbjct:  556 LDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPDNGKFMIQNGTYTILSTI 657          
BLAST of Protocadherin-1 vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 106.301 bits (264), Expect = 1.549e-44
Identity = 99/349 (28.37%), Postives = 165/349 (47.28%), Query Frame = 3
Query:  276 YFILQSHSG-ILKQRNNIDRETM--CKH---ADVCQKIILISI-------NGQVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGK--QQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTA--VTIEIEDCNDHAPNIAIYK--------STASIRENDRTPLVLTSVMVNDDDKGINSQFNC 1247
            Y  +   +G I    N+IDRE++  C++    D C     +SI         +++E  + I DENDN PQFS    TLSI EN+ +G+  ++P A D DS  N I  Y +              +A+  F++ +   +  K+P L ++  +DRE  D ++L +   D G   +Q S  + ++I D NDN P++   +    + E    G  V LQ    D    PNG++ Y +  + P   ++ RL  I  ++  +  +G    +  + + F++ A D G +  S+   VTI ++D ND+AP+I I            A+I E+      +  V V+D D+G N+   C
Sbjct:   90 YLRVDGKTGDIYTTENSIDRESLKDCRNLFEGDPCFLEFEVSITDLMKGTGPRLIEGRIEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYAL----------TTGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSV-LQVKANDSDMGPNGEVTYSL--HQPSSPVM-RLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTC 424          

HSP 2 Score: 70.4774 bits (171), Expect = 1.549e-44
Identity = 78/268 (29.10%), Postives = 122/268 (45.52%), Query Frame = 3
Query: 1644 ENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFK-QQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPIN-KMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLRERE-GIRLPDRLIIRASDNGTPPKAELVTVNI 2438
            E R   ++DRE  D Y   + A D G PSL  T TV +++LD ND  P F    Y + + E   +  +  + G VT +D D GEN  V  ++         QN     L  I+           DRE+  +    + A D G P  S+   + ++VLD NDN P    P N    F++  T  +    + + EAED D G N  + ++I+        L +++ ++G + L K    +  G+    RL+++  D GTPP+     V+I
Sbjct:  555 EVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQE--NMPPLSPV-GMVTVNDHDEGENARVQLSVEPDNGKFMIQNGTYTILSTIS----------FDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPETH--VESVEAEDIDIGLNSELDFNIVGGN--PHGL-FRISSEGEITLAKEFTPKHIGLH---RLVVKVKDKGTPPRQTTALVHI 801          

HSP 3 Score: 45.0542 bits (105), Expect = 1.549e-44
Identity = 28/84 (33.33%), Postives = 35/84 (41.67%), Query Frame = 1
Query: 1348 TFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
            T  D E +  Y + I  +D G P L       V + D NDNAP F          E N  G  +  V A D DS  N  ++Y I
Sbjct:  454 TLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSI 537          

HSP 4 Score: 63.929 bits (154), Expect = 2.187e-22
Identity = 88/306 (28.76%), Postives = 139/306 (45.42%), Query Frame = 3
Query: 1635 YFRENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQ-----QYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFI---NISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNL--REREGIRLPDRLIIRASDNGTPPKAELVTVNIRYIPNNLTPRNNALPPGINKKSNDKNRF 2522
            YF +  + ++ +R IK +Y + I+A D+G P+L+ T ++ +++ D+ND  PVF       ++F +   G+ +         V A D D G N  + Y+I          +            G + +   +DREQ+   Q  + A D G P L   A V+V VLD NDN PKF   +N  +F    N+   S VG V  N    D D+GEN  +  S+        N  + +QN    IL+     RE+E         ++A D G PP++  V + I  +  N    +NA  P + K +N   +F
Sbjct:  448 YFLQTTTLLDYER-IK-EYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVL-------DVVATDADSGTNAELTYSITGG-------SVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFM--LNGYSFSVQENMPPLSPVGMVTVN----DHDEGENARVQLSV-----EPDNGKFMIQNGTYTILSTISFDREKESTY---SFRLKAVDGGDPPRSSYVGITINVLDEN----DNA--PYVTKPANSSYKF 717          

HSP 5 Score: 44.669 bits (104), Expect = 2.187e-22
Identity = 45/174 (25.86%), Postives = 69/174 (39.66%), Query Frame = 3
Query:  771 VSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQ-AFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMD--LKTYITFFITAVDGGG--RENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYFTM 1277
            + I+D NDN+PQ+ +  ++ ++ E    G L  +  A DRD  S  NG   Y ++       L +                L  +D  L+      I  VDGG   R++S  + I I D ND+ P          + EN      +  V  ND D G N +    L+  +   M
Sbjct:  148 IEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGS--NGIADYALTTGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSSPVM 319          

HSP 6 Score: 38.5058 bits (88), Expect = 2.187e-22
Identity = 24/86 (27.91%), Postives = 38/86 (44.19%), Query Frame = 1
Query: 1357 DRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKF--------GSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVS 1590
            DRE +S     ++  D G      + L T+T+ D+NDNAP            +D    ++E+  +G  +  V   D D  EN  V+
Sbjct:  338 DREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVT 423          

HSP 7 Score: 75.8702 bits (185), Expect = 1.283e-19
Identity = 75/238 (31.51%), Postives = 118/238 (49.58%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFY-QITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFI-------NISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLRERE 2354
            +DRE++D Y L I   D G P    +  + I I D ND VP F++ ++  ++ E + +   H++L +V A+D D+G NG V Y++ Q      R       L      GI+ + G VDRE++  ++  + A DNG    S+ A V + V D NDN P  +  I  +  +       NIS D  VG  +A  E  D D+GEN  +T  +        ++P+QL++      T N R+R+
Sbjct:  230 LDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVG--HSVL-QVKANDSDMGPNGEVTYSLHQPSSPVMR------LLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIR--IRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAG------DVPFQLRSASE---TGNDRKRK 447          

HSP 8 Score: 41.9726 bits (97), Expect = 1.283e-19
Identity = 21/57 (36.84%), Postives = 30/57 (52.63%), Query Frame = 1
Query: 1444 VTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDE 1614
            + I+DENDN P+F S  +  ++ EN ++GA      A D DS  NG   Y +    E
Sbjct:  148 IEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPE 204          

HSP 9 Score: 59.3066 bits (142), Expect = 1.005e-18
Identity = 31/82 (37.80%), Postives = 41/82 (50.00%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
             DRE    Y + I+ +D G PP     L  +TI D NDN PKF        L EN+ +G  +  V+A D D   NG V+Y +
Sbjct:  230 LDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSL 311          

HSP 10 Score: 55.8398 bits (133), Expect = 1.005e-18
Identity = 74/282 (26.24%), Postives = 121/282 (42.91%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTA------DDKDLGEN--------GTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQL----QNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYIPNN 2456
            +DRE        + AKDNG  S +    V I + D ND  P  + +    +T  +G+A I   +   TA       D+D GEN        G V + +R   +  N +                    ++D E++   + EI+A D+G P LS+  ++ V V D+NDN P F   + ++ F     ++Q G  + +  A D D G N  +TYSI        ++P  L     N G + +   L +RE +    + ++ A+D G P      TV ++ +  N
Sbjct:  337 VDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTT----------LLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFE---ENQPGDKVLDVVATDADSGTNAELTYSITG-----GSVPEGLFEINPNTGEVRVMSQL-DREQLDH-YQFLVAAADKGVPSLRGTATVVVKVLDRN 598          

HSP 11 Score: 63.5438 bits (153), Expect = 1.067e-17
Identity = 76/356 (21.35%), Postives = 151/356 (42.42%), Query Frame = 3
Query:  225 NSSGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQVLE-----VMVYINDENDNIPQFSMRHKTL--------SIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCT--ITVSIIDVNDNSPQW-PTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQ 1238
            N   TY++      +     +  ++GI+  + ++DRE +     + +  +    NG   +     V + + D+NDN P   +R   L        +I E+  +G+ ++L    D D   N+++   +       +R  ++    R    F++T   +           D E I  + + ++A DSG    S T  + V + D+NDN+P + PT+   +  +E      ++++ A D D  +  N ++ Y I+  S    +   LF I  ++  +        +   +  F + A D G      +  V +++ D ND+ P   +   + S++EN      +  V VND D+G N++
Sbjct:  304 NGEVTYSLHQPSSPVMRLLSIDRNTGIIFVKGSVDREEIS----ILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLL-----------DYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGT--NAELTYSITGGS----VPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENAR 638          

HSP 12 Score: 44.669 bits (104), Expect = 1.067e-17
Identity = 32/102 (31.37%), Postives = 49/102 (48.04%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAP---KFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITILGKI 1650
            FDRE  S YS  ++ +D G PP       T+ ++DENDNAP   K  +   +F L    +    +  V A D D   N  + + I+  + +  F I+  G+I
Sbjct:  665 FDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKF-LDPRTSPETHVESVEAEDIDIGLNSELDFNIVGGNPHGLFRISSEGEI 765          

HSP 13 Score: 22.7126 bits (47), Expect = 1.067e-17
Identity = 9/25 (36.00%), Postives = 12/25 (48.00%), Query Frame = 3
Query: 1689 YSLTIMAKDNGEPSLNDTCTVHIRI 1763
            + L +  KD G P    T  VHI +
Sbjct:  779 HRLVVKVKDKGTPPRQTTALVHIYV 803          

HSP 14 Score: 61.2326 bits (147), Expect = 7.912e-9
Identity = 70/288 (24.31%), Postives = 129/288 (44.79%), Query Frame = 3
Query:  411 VYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKE-CDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTP--LVLTSVMVNDDDKGINSQFNCDL 1253
            V + D NDN P FS     +   E +  G ++    A D DS  N+ + Y I                S    +F    N  ++   +++ ++DRE++D ++ ++ A D G    +G+ T+ V ++D NDN P++     S +V+E      P+  +   D D+    N +++  +       E  N  F I   +  + S      + ++  +F + AVDGG   R +   +TI + D ND+AP +    +++    + RT     + SV   D D G+NS+ + ++
Sbjct:  486 VQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITG-------------GSVPEGLFEINPNTGEV---RVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGE--NARVQLSV-------EPDNGKFMIQNGTYTILSTISFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPETHVESVEAEDIDIGLNSELDFNI 748          

HSP 15 Score: 60.077 bits (144), Expect = 1.770e-8
Identity = 36/102 (35.29%), Postives = 48/102 (47.06%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYF---TITILGKI 1650
             DRE L  Y  L+   D G P L G     V ++D NDN PKF  +   F++ EN    +P+G V   D D  EN RV   +  ++  +     T TIL  I
Sbjct:  562 LDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPDNGKFMIQNGTYTILSTI 663          
BLAST of Protocadherin-1 vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 106.301 bits (264), Expect = 1.950e-44
Identity = 99/349 (28.37%), Postives = 165/349 (47.28%), Query Frame = 3
Query:  276 YFILQSHSG-ILKQRNNIDRETM--CKH---ADVCQKIILISI-------NGQVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGK--QQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTA--VTIEIEDCNDHAPNIAIYK--------STASIRENDRTPLVLTSVMVNDDDKGINSQFNC 1247
            Y  +   +G I    N+IDRE++  C++    D C     +SI         +++E  + I DENDN PQFS    TLSI EN+ +G+  ++P A D DS  N I  Y +              +A+  F++ +   +  K+P L ++  +DRE  D ++L +   D G   +Q S  + ++I D NDN P++   +    + E    G  V LQ    D    PNG++ Y +  + P   ++ RL  I  ++  +  +G    +  + + F++ A D G +  S+   VTI ++D ND+AP+I I            A+I E+      +  V V+D D+G N+   C
Sbjct:   71 YLRVDGKTGDIYTTENSIDRESLKDCRNLFEGDPCFLEFEVSITDLMKGTGPRLIEGRIEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYAL----------TTGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSV-LQVKANDSDMGPNGEVTYSL--HQPSSPVM-RLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTC 405          

HSP 2 Score: 70.4774 bits (171), Expect = 1.950e-44
Identity = 78/268 (29.10%), Postives = 122/268 (45.52%), Query Frame = 3
Query: 1644 ENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFK-QQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPIN-KMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLRERE-GIRLPDRLIIRASDNGTPPKAELVTVNI 2438
            E R   ++DRE  D Y   + A D G PSL  T TV +++LD ND  P F    Y + + E   +  +  + G VT +D D GEN  V  ++         QN     L  I+           DRE+  +    + A D G P  S+   + ++VLD NDN P    P N    F++  T  +    + + EAED D G N  + ++I+        L +++ ++G + L K    +  G+    RL+++  D GTPP+     V+I
Sbjct:  536 EVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQE--NMPPLSPV-GMVTVNDHDEGENARVQLSVEPDNGKFMIQNGTYTILSTIS----------FDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPETH--VESVEAEDIDIGLNSELDFNIVGGN--PHGL-FRISSEGEITLAKEFTPKHIGLH---RLVVKVKDKGTPPRQTTALVHI 782          

HSP 3 Score: 45.0542 bits (105), Expect = 1.950e-44
Identity = 28/84 (33.33%), Postives = 35/84 (41.67%), Query Frame = 1
Query: 1348 TFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
            T  D E +  Y + I  +D G P L       V + D NDNAP F          E N  G  +  V A D DS  N  ++Y I
Sbjct:  435 TLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSI 518          

HSP 4 Score: 63.5438 bits (153), Expect = 3.890e-22
Identity = 88/306 (28.76%), Postives = 139/306 (45.42%), Query Frame = 3
Query: 1635 YFRENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQ-----QYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFI---NISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNL--REREGIRLPDRLIIRASDNGTPPKAELVTVNIRYIPNNLTPRNNALPPGINKKSNDKNRF 2522
            YF +  + ++ +R IK +Y + I+A D+G P+L+ T ++ +++ D+ND  PVF       ++F +   G+ +         V A D D G N  + Y+I          +            G + +   +DREQ+   Q  + A D G P L   A V+V VLD NDN PKF   +N  +F    N+   S VG V  N    D D+GEN  +  S+        N  + +QN    IL+     RE+E         ++A D G PP++  V + I  +  N    +NA  P + K +N   +F
Sbjct:  429 YFLQTTTLLDYER-IK-EYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVL-------DVVATDADSGTNAELTYSITGG-------SVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFM--LNGYSFSVQENMPPLSPVGMVTVN----DHDEGENARVQLSV-----EPDNGKFMIQNGTYTILSTISFDREKESTY---SFRLKAVDGGDPPRSSYVGITINVLDEN----DNA--PYVTKPANSSYKF 698          

HSP 5 Score: 44.2838 bits (103), Expect = 3.890e-22
Identity = 45/174 (25.86%), Postives = 69/174 (39.66%), Query Frame = 3
Query:  771 VSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQ-AFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMD--LKTYITFFITAVDGGG--RENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYFTM 1277
            + I+D NDN+PQ+ +  ++ ++ E    G L  +  A DRD  S  NG   Y ++       L +                L  +D  L+      I  VDGG   R++S  + I I D ND+ P          + EN      +  V  ND D G N +    L+  +   M
Sbjct:  129 IEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGS--NGIADYALTTGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSSPVM 300          

HSP 6 Score: 38.5058 bits (88), Expect = 3.890e-22
Identity = 24/86 (27.91%), Postives = 38/86 (44.19%), Query Frame = 1
Query: 1357 DRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKF--------GSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVS 1590
            DRE +S     ++  D G      + L T+T+ D+NDNAP            +D    ++E+  +G  +  V   D D  EN  V+
Sbjct:  319 DREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVT 404          

HSP 7 Score: 75.8702 bits (185), Expect = 1.416e-19
Identity = 75/238 (31.51%), Postives = 118/238 (49.58%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFY-QITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFI-------NISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLRERE 2354
            +DRE++D Y L I   D G P    +  + I I D ND VP F++ ++  ++ E + +   H++L +V A+D D+G NG V Y++ Q      R       L      GI+ + G VDRE++  ++  + A DNG    S+ A V + V D NDN P  +  I  +  +       NIS D  VG  +A  E  D D+GEN  +T  +        ++P+QL++      T N R+R+
Sbjct:  211 LDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVG--HSVL-QVKANDSDMGPNGEVTYSLHQPSSPVMR------LLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIR--IRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAG------DVPFQLRSASE---TGNDRKRK 428          

HSP 8 Score: 41.5874 bits (96), Expect = 1.416e-19
Identity = 21/57 (36.84%), Postives = 30/57 (52.63%), Query Frame = 1
Query: 1444 VTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDE 1614
            + I+DENDN P+F S  +  ++ EN ++GA      A D DS  NG   Y +    E
Sbjct:  129 IEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPE 185          

HSP 9 Score: 58.9214 bits (141), Expect = 1.030e-18
Identity = 31/82 (37.80%), Postives = 41/82 (50.00%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
             DRE    Y + I+ +D G PP     L  +TI D NDN PKF        L EN+ +G  +  V+A D D   NG V+Y +
Sbjct:  211 LDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSL 292          

HSP 10 Score: 55.8398 bits (133), Expect = 1.030e-18
Identity = 73/278 (26.26%), Postives = 120/278 (43.17%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTA------DDKDLGEN--------GTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYIPNN 2456
            +DRE        + AKDNG  S +    V I + D ND  P  + +    +T  +G+A I   +   TA       D+D GEN        G V + +R   +  N +                    ++D E++   + EI+A D+G P LS+  ++ V V D+NDN P F   + ++ F     ++Q G  + +  A D D G N  +TYSI     + + L     N G + +   L +RE +    + ++ A+D G P      TV ++ +  N
Sbjct:  318 VDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTT----------LLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFE---ENQPGDKVLDVVATDADSGTNAELTYSITGGS-VPEGLFEINPNTGEVRVMSQL-DREQLDH-YQFLVAAADKGVPSLRGTATVVVKVLDRN 579          

HSP 11 Score: 63.5438 bits (153), Expect = 1.205e-17
Identity = 76/356 (21.35%), Postives = 151/356 (42.42%), Query Frame = 3
Query:  225 NSSGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQVLE-----VMVYINDENDNIPQFSMRHKTL--------SIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCT--ITVSIIDVNDNSPQW-PTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQ 1238
            N   TY++      +     +  ++GI+  + ++DRE +     + +  +    NG   +     V + + D+NDN P   +R   L        +I E+  +G+ ++L    D D   N+++   +       +R  ++    R    F++T   +           D E I  + + ++A DSG    S T  + V + D+NDN+P + PT+   +  +E      ++++ A D D  +  N ++ Y I+  S    +   LF I  ++  +        +   +  F + A D G      +  V +++ D ND+ P   +   + S++EN      +  V VND D+G N++
Sbjct:  285 NGEVTYSLHQPSSPVMRLLSIDRNTGIIFVKGSVDREEIS----ILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLL-----------DYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGT--NAELTYSITGGS----VPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENAR 619          

HSP 12 Score: 44.669 bits (104), Expect = 1.205e-17
Identity = 32/102 (31.37%), Postives = 49/102 (48.04%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAP---KFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITILGKI 1650
            FDRE  S YS  ++ +D G PP       T+ ++DENDNAP   K  +   +F L    +    +  V A D D   N  + + I+  + +  F I+  G+I
Sbjct:  646 FDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKF-LDPRTSPETHVESVEAEDIDIGLNSELDFNIVGGNPHGLFRISSEGEI 746          

HSP 13 Score: 22.7126 bits (47), Expect = 1.205e-17
Identity = 9/25 (36.00%), Postives = 12/25 (48.00%), Query Frame = 3
Query: 1689 YSLTIMAKDNGEPSLNDTCTVHIRI 1763
            + L +  KD G P    T  VHI +
Sbjct:  760 HRLVVKVKDKGTPPRQTTALVHIYV 784          

HSP 14 Score: 60.8474 bits (146), Expect = 9.487e-9
Identity = 71/288 (24.65%), Postives = 130/288 (45.14%), Query Frame = 3
Query:  411 VYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKE-CDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRT-PLV-LTSVMVNDDDKGINSQFNCDL 1253
            V + D NDN P FS     +   E +  G ++    A D DS  N+ + Y I                S    +F    N  ++   +++ ++DRE++D ++ ++ A D G    +G+ T+ V ++D NDN P++     S +V+E      P+  +   D D+    N +++  +       E  N  F I   +  + S      + ++  +F + AVDGG   R +   +TI + D ND+AP +    +++    + RT P   + SV   D D G+NS+ + ++
Sbjct:  467 VQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITG-------------GSVPEGLFEINPNTGEV---RVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGE--NARVQLSV-------EPDNGKFMIQNGTYTILSTISFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPETHVESVEAEDIDIGLNSELDFNI 729          

HSP 15 Score: 60.077 bits (144), Expect = 1.902e-8
Identity = 36/102 (35.29%), Postives = 48/102 (47.06%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYF---TITILGKI 1650
             DRE L  Y  L+   D G P L G     V ++D NDN PKF  +   F++ EN    +P+G V   D D  EN RV   +  ++  +     T TIL  I
Sbjct:  543 LDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPDNGKFMIQNGTYTILSTI 644          
BLAST of Protocadherin-1 vs. Ensembl Xenopus
Match: ENSXETT00000027070.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:19099783:19110965:-1 gene:ENSXETG00000013163.1 transcript:ENSXETT00000027070.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 103.219 bits (256), Expect = 3.521e-49
Identity = 115/425 (27.06%), Postives = 186/425 (43.76%), Query Frame = 3
Query:   93 IFGILIEMLICKTFYIKLKISENKGSGEDLINLKNYIIIHKLPINSSGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISING--QVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKT-INRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLV-ELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYFTMVKECLQSIKWTAALYVQYQKNPRH 1349
             F  L E +IC+   ++  I E +  G  + N+ N + +    + SS  ++I+S       Y  +   +G L   + IDRE +C     C   I   +        + V I D NDN P FS     +SI E + +G+  +L +A D D   NSI  Y              +  A+ YF +  K   +  K P L L K +DRE+ +   LIL A D G   + G+  I + + D+NDN P +       TV E    G LV +L A D D+ S  N +I Y  +D     E    +F I   +  +   G    ++ T     + A DGGG  +   + I++ D ND+AP+I I   +  I E+ R   V+  V ++D D G N +    ++++  F ++       K   ++ +  +K   +
Sbjct:   22 FFSFLCESVICQ---LQYSIYEEQRLGYVIGNIANDLGVSAEEL-SSRKFHIVSRSK--KQYLNVHLENGDLYVADRIDREALCGMQQNCFLNIEAVMESPLHFYTINVEIQDVNDNSPSFSKSIFEISISELAVVGTHFALGSAKDPDLGNNSIQSY--------------KLSANDYFGMLEKVNTDGRKYPELVLEKTLDREKKNSSVLILSAFDGGTPSKTGTSLIRIVVTDINDNYPLFNKDTYRVTVSENVPIGFLVIDLHATDADEGS--NAEITYLFND---IPENAQEVFAINPENGSVQITGKLDYEVATNYEMTVEAKDGGGLVSYCKLLIQVSDVNDNAPDILITSFSDIIPEDSRVGTVIALVNLDDLDSGENGEVVGQISESLPFHLISSSGNYYKLVTSMDLDREKTSEY 421          

HSP 2 Score: 72.4034 bits (176), Expect = 3.521e-49
Identity = 72/251 (28.69%), Postives = 113/251 (45.02%), Query Frame = 3
Query: 1701 IMAKDNGEPSLNDTCTVHIRILDVNDCVPVF-KQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMN----FINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNI 2438
            I A+D G P L +  T+ + + DVND  PVF K  Y   I E N   +      +V A D D+ ENG V Y I          ++         +      +   D E +     +++A D+G P  SA A V + + D NDN PK  YP         F  I   S  G ++    A D D G N  ++Y ++  +  + +     QN G + +T++L+E + +R   R+++   DNG P  +  VT+N+
Sbjct:  533 IQAEDKGSPQLTNNKTIRLILTDVNDNAPVFEKMDYVAYIQENNPSGSS---FFRVHATDSDINENGKVVYMILTDIIEDMPLSSYISINTVSGVLYAQRSF---DYESLREFYIQVMAKDSGSPSRSANATVKICITDQNDNAPKILYPSQDSEAASVFEFIPHFSTKGYLVTKVVAVDADSGHNAWLSYHLL--QVPDPSFLIIGQNTGEIRITRDLQETDALR--QRIVVMVKDNGYPMLSSTVTLNL 773          

HSP 3 Score: 62.7734 bits (151), Expect = 3.521e-49
Identity = 36/85 (42.35%), Postives = 44/85 (51.76%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNN 1608
             DRE  S Y++ I+  D G P L   K   + + D NDNAP F   D    + ENN  G     V A DPD NENG+V Y IL +
Sbjct:  413 LDREKTSEYNITIKAEDKGSPQLTNSKTIRLILTDVNDNAPVFDKMDYVAYIQENNPSGNSFYRVHATDPDINENGKVVYMILTD 497          

HSP 4 Score: 66.6254 bits (161), Expect = 1.492e-14
Identity = 76/272 (27.94%), Postives = 123/272 (45.22%), Query Frame = 3
Query: 1653 SQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF-KQQYFYQITE----GNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQM--VSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFIN-ISTDSQVGKVLANFEAEDPDKGENGTITYSIISH--KHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNI 2438
            + M++DRE   +Y++TI A+D G P L ++ T+ + + DVND  PVF K  Y   I E    GN    +HA        D D+ ENG V Y I          ++         +      +   D E++    IQAE    D G PQL+    + + + DVNDN P F+    KM+++  I  ++  G       A D D  ENG + Y I++   + M  +    +     ++  +   + E +R    + + A D+G+P ++   TV I
Sbjct:  409 TSMDLDREKTSEYNITIKAEDKGSPQLTNSKTIRLILTDVNDNAPVFDKMDYVAYIQENNPSGNSFYRVHAT-------DPDINENGKVVYMILTDIIEDIPISSYVSINTVSGVLYAQRSF---DYEKLREFYIQAE----DKGSPQLTNNKTIRLILTDVNDNAPVFE----KMDYVAYIQENNPSGSSFFRVHATDSDINENGKVVYMILTDIIEDMPLSSYISINTVSGVLYAQRSFDYESLR-EFYIQVMAKDSGSPSRSANATVKI 661          

HSP 5 Score: 34.6538 bits (78), Expect = 1.492e-14
Identity = 30/102 (29.41%), Postives = 43/102 (42.16%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI--------LNNDENYYFTIT 1635
             D E  + Y + +   D G   LV      + + D NDNAP          + E++ +G  I  V   D DS ENG V  QI        +++  NYY  +T
Sbjct:  310 LDYEVATNYEMTVEAKDGGG--LVSYCKLLIQVSDVNDNAPDILITSFSDIIPEDSRVGTVIALVNLDDLDSGENGEVVGQISESLPFHLISSSGNYYKLVT 409          

HSP 6 Score: 52.7582 bits (125), Expect = 4.417e-13
Identity = 36/86 (41.86%), Postives = 43/86 (50.00%), Query Frame = 1
Query: 1354 FDRESL-SFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNN 1608
            FD E L  FY   I+  D G P L   K   + + D NDNAP F   D    + ENN  G+    V A D D NENG+V Y IL +
Sbjct:  523 FDYEKLREFY---IQAEDKGSPQLTNNKTIRLILTDVNDNAPVFEKMDYVAYIQENNPSGSSFFRVHATDSDINENGKVVYMILTD 605          

HSP 7 Score: 43.5134 bits (101), Expect = 4.417e-13
Identity = 34/102 (33.33%), Postives = 48/102 (47.06%), Query Frame = 3
Query: 1653 SQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGL-------ATIHAILGKVTADDKDLGENGTVYYAIRQKYDHS 1937
            +Q   D E   ++ + +MAKD+G PS +   TV I I D ND  P  K  Y  Q +E   +       +T   ++ KV A D D G N  + Y + Q  D S
Sbjct:  627 AQRSFDYESLREFYIQVMAKDSGSPSRSANATVKICITDQNDNAP--KILYPSQDSEAASVFEFIPHFSTKGYLVTKVVAVDADSGHNAWLSYHLLQVPDPS 726          

HSP 8 Score: 63.929 bits (154), Expect = 1.865e-9
Identity = 70/283 (24.73%), Postives = 128/283 (45.23%), Query Frame = 3
Query:  402 EVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIK--EIDREEIDRFELILIAEDSGKQQ--GSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTP----NGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRE--NSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDD 1220
            ++++ ++D NDN P   +   +  I E+S +G+ ++L   DDLDS  N  +              + Q   S  F +   + N     Y KL+   ++DRE+   + + + AED G  Q   S TI + + DVNDN+P +  ++    ++E +  G      +F R  ++ P    NG++ Y I  +  +   I+   Y++ +++       +  D +    F+I A D G  +  N+  + + + D ND+AP        A I+EN+ +      V   D D
Sbjct:  335 KLLIQVSDVNDNAPDILITSFSDIIPEDSRVGTVIALVNLDDLDSGENGEV--------------VGQISESLPFHLISSSGN-----YYKLVTSMDLDREKTSEYNITIKAEDKGSPQLTNSKTIRLILTDVNDNAPVFDKMDYVAYIQENNPSG-----NSFYRVHATDPDINENGKVVYMILTDIIEDIPISS--YVSINTVSGVLYAQRSFDYEKLREFYIQAEDKGSPQLTNNKTIRLILTDVNDNAPVFEKMDYVAYIQENNPSGSSFFRVHATDSD 591          

HSP 9 Score: 47.7506 bits (112), Expect = 1.082e-8
Identity = 70/254 (27.56%), Postives = 113/254 (44.49%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF-KQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQL----QNDGRLILTKNL-REREGIRLPDRLIIRASDNGTP 2408
            +DRE K+   L + A D G PS   T  + I + D+ND  P+F K  Y   ++E      I  ++  + A D D G N  + Y      +++     I      + +       G +D E   + +  + A D G   L +   +++ V DVNDN P     I   + I I  DS+VG V+A    +D D GENG +         + ++LP+ L     N  +L+ + +L RE+        + I+A D G+P
Sbjct:  203 LDREKKNSSVLILSAFDGGTPSKTGTSLIRIVVTDINDNYPLFNKDTYRVTVSEN---VPIGFLVIDLHATDADEGSNAEITYLFNDIPENAQEVFAINPENGSVQIT------GKLDYEVATNYEMTVEAKDGGG--LVSYCKLLIQVSDVNDNAPDIL--ITSFSDI-IPEDSRVGTVIALVNLDDLDSGENGEVV------GQISESLPFHLISSSGNYYKLVTSMDLDREKTSEY---NITIKAEDKGSP 433          

HSP 10 Score: 33.8834 bits (76), Expect = 1.082e-8
Identity = 19/56 (33.93%), Postives = 26/56 (46.43%), Query Frame = 1
Query: 1444 VTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNND 1611
            V I D NDN+P F       +++E   +G       A DPD   N   SY++  ND
Sbjct:  124 VEIQDVNDNSPSFSKSIFEISISELAVVGTHFALGSAKDPDLGNNSIQSYKLSAND 179          
BLAST of Protocadherin-1 vs. Ensembl Xenopus
Match: PCDHAC2 (protocadherin alpha subfamily C, 2 [Source:NCBI gene;Acc:100125023])

HSP 1 Score: 116.316 bits (290), Expect = 1.791e-45
Identity = 101/343 (29.45%), Postives = 156/343 (45.48%), Query Frame = 3
Query:  276 YFILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQVLEVM---VYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTIN-RMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLV-ELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYFTM 1277
            YF +   +G+L     IDRET+C     C  I L  + G  +EV    V I D NDN P+F      L I E++  G+   + +A D D   NSI  Y + D              + YF + +KT N   K+  + L K +DRE+    +L+L A D G   + G+  ++V ++D NDN+P +       +V E    G LV +L A D D+ S  NG + Y  S  +P+K  + +LF I      +   G    +  +    ++ A D G         V +EI D ND+AP I +  + + + EN     V+  + V D D G+N Q +  +     F +
Sbjct:   70 YFDVNIGNGVLFVNRTIDRETLCDPGPPCL-INLEVVVGNPVEVHNIEVEILDINDNAPKFPRNEYYLEISESAVPGARFPIESAQDPDLGTNSIQTYKLSD--------------NEYFALDLKTFNGNSKLIEIVLKKALDREQKPLHQLLLTAIDGGTPAKSGTAQVSVRVMDTNDNTPYFDKSTYKASVPENSPAGTLVIKLNAIDPDEGS--NGDVLYSFSSYTPQK--VRQLFTIDPQKGEIRINGAVDYEKASEYEIYVQATDKGTVPMAGHCKVLVEIVDVNDNAPEIVVTSNYSPVAENSHDETVVALMSVTDQDSGLNKQVSLRIQPNIPFKL 393          

HSP 2 Score: 62.3882 bits (150), Expect = 1.791e-45
Identity = 35/86 (40.70%), Postives = 44/86 (51.16%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNND 1611
             DRE  S Y++ +   D G PPL  +K   V + D NDN P F        + ENN  G  +  V+A D DSNEN  VSY +L  D
Sbjct:  408 LDREKSSSYNITVTVTDSGTPPLSTQKTLYVEVSDLNDNPPTFEEKSYSIYIMENNAPGVSLISVKATDLDSNENSFVSYSLLRGD 493          

HSP 3 Score: 47.3654 bits (111), Expect = 1.791e-45
Identity = 43/149 (28.86%), Postives = 68/149 (45.64%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAI---------LGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSA 2084
             D E   ++   + A+D G PSL+ + TV+I I+D ND  P       +  T  NG A+I  I         + KV A D D G+N  ++Y + Q  D    Q  +    ++   +       VVD + + +    I+  DNG+P LS+
Sbjct:  518 FDYEKLREFHFVVQAQDAGNPSLSSSATVNIFIMDQNDHAPTI----LFPST-ANGSASIEMIPRSANVGYLVAKVIAIDLDSGQNAWLFYNLSQASDPKLFQVELHTGEIRTTRK-------VVD-DSITNYNLTILVRDNGQPSLSS 653          

HSP 4 Score: 68.1662 bits (165), Expect = 3.227e-18
Identity = 92/361 (25.48%), Postives = 145/361 (40.17%), Query Frame = 3
Query:  216 LPINSSGTYNIISNEPDINNYFIL--QSHSG-------ILKQRNNIDRETMCKHADVCQKIILISINGQV------LEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITF--FITAVDGGGRENSTAVT--IEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINS 1235
            L  NS  TY +  NE     YF L  ++ +G       +LK+   +DRE    H     +++L +I+G         +V V + D NDN P F       S+ ENS  G+ +    A D D   N  + Y       + +R++        FTI  +         +++   +D E+   +E+ + A D G     G C + V I+DVNDN+P+    +    V E      +V L +    DS   N Q+  +I  N P        F +           +  +D +   ++   +T  D G    ST  T  +E+ D ND+ P       +  I EN+   + L SV   D D   NS
Sbjct:  158 LGTNSIQTYKLSDNE-----YFALDLKTFNGNSKLIEIVLKKA--LDREQKPLH-----QLLLTAIDGGTPAKSGTAQVSVRVMDTNDNTPYFDKSTYKASVPENSPAGTLVIKLNAIDPDEGSNGDVLYSFSSYTPQKVRQL--------FTIDPQKGE------IRINGAVDYEKASEYEIYVQATDKGTVPMAGHCKVLVEIVDVNDNAPEIVVTSNYSPVAENSHDETVVALMSVTDQDSGL-NKQVSLRIQPNIP--------FKLTSFKNTYKLVTVGKLDREKSSSYNITVTVTDSGTPPLSTQKTLYVEVSDLNDNPPTFEEKSYSIYIMENNAPGVSLISVKATDLDSNENS 483          

HSP 5 Score: 45.8246 bits (107), Expect = 3.227e-18
Identity = 33/120 (27.50%), Postives = 55/120 (45.83%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKF-------GSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITI-LGKIEAKWKLIEKSKTN 1689
            FD E L  +  +++  D G P L       + I+D+ND+AP         GS  I   +  + N+G  +  V A D DS +N  + Y +    +   F + +  G+I    K+++ S TN
Sbjct:  518 FDYEKLREFHFVVQAQDAGNPSLSSSATVNIFIMDQNDHAPTILFPSTANGSASIEM-IPRSANVGYLVAKVIAIDLDSGQNAWLFYNLSQASDPKLFQVELHTGEIRTTRKVVDDSITN 636          

HSP 6 Score: 52.373 bits (124), Expect = 3.653e-15
Identity = 27/80 (33.75%), Postives = 39/80 (48.75%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSY 1593
             DRE    + +L+  ID G P   G    +V ++D NDN P F     + ++ EN+  G  +  + A DPD   NG V Y
Sbjct:  196 LDREQKPLHQLLLTAIDGGTPAKSGTAQVSVRVMDTNDNTPYFDKSTYKASVPENSPAGTLVIKLNAIDPDEGSNGDVLY 275          

HSP 7 Score: 51.2174 bits (121), Expect = 3.653e-15
Identity = 76/281 (27.05%), Postives = 122/281 (43.42%), Query Frame = 3
Query: 1611 RKLLFYNHYFRENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVP-VFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLP----YQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNI 2438
            R+L   +    E R    +D E   +Y + + A D G   +   C V + I+DVND  P +     +  + E +   T+ A++   +  D+D G N  V   I         Q NI   L        L   G +DRE+  S    +   D+G P LS    + V+V D+NDN P F+    K   I I  ++  G  L + +A D D  EN  ++YS++  +   + LP      +++D   I   +  + E +R     +++A D G P  +   TVNI
Sbjct:  286 RQLFTIDPQKGEIRINGAVDYEKASEYEIYVQATDKGTVPMAGHCKVLVEIVDVNDNAPEIVVTSNYSPVAENSHDETVVALM---SVTDQDSGLNKQVSLRI---------QPNIPFKLTSFKNTYKLVTVGKLDREKSSSYNITVTVTDSGTPPLSTQKTLYVEVSDLNDNPPTFE---EKSYSIYIMENNAPGVSLISVKATDLDSNENSFVSYSLL--RGDIEGLPVSSYVSIKSDNGTIYAVHSFDYEKLRE-FHFVVQAQDAGNPSLSSSATVNI 548          

HSP 8 Score: 59.6918 bits (143), Expect = 6.010e-13
Identity = 69/254 (27.17%), Postives = 113/254 (44.49%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF-KQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQL---QNDGRLILTKNL-REREGIRLPDRLIIRASDNGTPP 2411
            +DRE K  + L + A D G P+ + T  V +R++D ND  P F K  Y   + E +   T   ++ K+ A D D G NG V Y+         RQ                   G VD E+    +  + A D G   ++    V+V+++DVNDN P+    +   N+  ++ +S    V+A     D D G N  ++  I      + N+P++L   +N  +L+    L RE+        + +  +D+GTPP
Sbjct:  196 LDREQKPLHQLLLTAIDGGTPAKSGTAQVSVRVMDTNDNTPYFDKSTYKASVPENSPAGT---LVIKLNAIDPDEGSNGDVLYSFSSYTPQKVRQLFTIDPQKGEIRIN-----GAVDYEKASEYEIYVQATDKGTVPMAGHCKVLVEIVDVNDNAPEI---VVTSNYSPVAENSHDETVVALMSVTDQDSGLNKQVSLRI------QPNIPFKLTSFKNTYKLVTVGKLDREKSSSY---NITVTVTDSGTPP 429          

HSP 9 Score: 36.1946 bits (82), Expect = 6.010e-13
Identity = 27/77 (35.06%), Postives = 39/77 (50.65%), Query Frame = 1
Query: 1444 VTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITILGKIEAKWKLIE 1674
            V I+D NDNAPKF  ++    ++E+   GA      A DPD   N   +Y++ +N+   YF +  L       KLIE
Sbjct:  117 VEILDINDNAPKFPRNEYYLEISESAVPGARFPIESAQDPDLGTNSIQTYKLSDNE---YFALD-LKTFNGNSKLIE 189          
BLAST of Protocadherin-1 vs. Ensembl Xenopus
Match: ENSXETT00000047804.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 89.7373 bits (221), Expect = 2.385e-45
Identity = 82/257 (31.91%), Postives = 124/257 (48.25%), Query Frame = 3
Query: 1662 EIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQ-QYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVV------DREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLRERE-GIRLPDRLIIRASDNGTP 2408
            ++DRE +D+Y+ T++AKDNG PSL    TV + +LD ND  P F   +Y + + E      ++  +G +T  D D GEN  V  ++    D+                  I  + GV+      DREQ  S   ++ A D G PQ S+   V + V DVNDNKP F  P N  ++  + T +  G V+A   A D D G N  + YSII      + L    +  G + L + L   + G+    +L+I+ +D+G P
Sbjct:  545 KLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPEN---LPMYGTVGLITVTDADSGENAVVTLSLVNARDN----------------FIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYDLVQTSTSPGSVVARVYAIDNDTGINADLRYSIIGGN--SRGLFAIGERSGNITLKEKLLAGDHGVLY--KLVIKVNDSGKP 778          

HSP 2 Score: 78.5666 bits (192), Expect = 2.385e-45
Identity = 87/331 (26.28%), Postives = 144/331 (43.50%), Query Frame = 3
Query:  303 ILKQRNNIDRETMCKH---ADVCQKIILISING----QVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCT--ITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLV-ELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAPNI----AIYKSTASIRENDRTPL--VLTSVMVNDDDKGINSQFNC 1247
            I    N IDRE +C      + C   + +++      +++++   I D NDN P F      +SI EN+ + S  S+P+A D D   N I  Y +       ++  N F         I+T    K P L + + +DRE+ D + + +  ED G    S T  + V++ DVNDN P +   +I   + E    G  V +L A D D  S  N +I +   +      L  R F I  ++  ++ +     +   Y    + A DG    +   VTI I D ND+ P+I     I     +++ +++ PL   +  + V D D  +N +  C
Sbjct:  102 IFTTSNRIDREKLCSGIFTENKCFYEVEVAVLPDEVFRLVKIRFLIEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYEL-------LKGQNVFGLD-----VIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGS--NAKIHFYFGNQI--TNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASDGSSTPSRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTC 416          

HSP 3 Score: 57.3806 bits (137), Expect = 2.385e-45
Identity = 31/82 (37.80%), Postives = 41/82 (50.00%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
             D ES   Y++ I   D G+PPL    +  + I DENDNAP F    I  +  ENN  G  +  + A D DS  N  +SY +
Sbjct:  442 LDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYML 523          

HSP 4 Score: 52.373 bits (124), Expect = 6.162e-14
Identity = 27/89 (30.34%), Postives = 46/89 (51.69%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENY 1620
             DRE    Y+  +   D G P L      T++++D+NDN+P F  ++  F + EN  +   +G +   D DS EN  V+  ++N  +N+
Sbjct:  546 LDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLITVTDADSGENAVVTLSLVNARDNF 634          

HSP 5 Score: 46.595 bits (109), Expect = 6.162e-14
Identity = 29/92 (31.52%), Postives = 45/92 (48.91%), Query Frame = 3
Query: 1650 RSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF---KQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAI 1916
            R  +  DRE +  Y+  + A D G P  + T  V I + DVND  PVF      Y Y + + +   +  +++ +V A D D G N  + Y+I
Sbjct:  644 RPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYDLVQTS--TSPGSVVARVYAIDNDTGINADLRYSI 733          

HSP 6 Score: 71.633 bits (174), Expect = 8.250e-12
Identity = 80/292 (27.40%), Postives = 132/292 (45.21%), Query Frame = 3
Query:  393 QVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQ--QGSCTITVSIIDVNDNSPQWPTVNISKTVKE-CDRQGPLVELQAFDRDDSSTPNGQIKYKI---SDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTA--VTIEIEDCNDHAPNIAIYKSTAS---IRENDRTPLVLTSVMVNDDDKGINS 1235
            Q   +++ I DENDN P F++    LS  EN+  G+EL+  +A D DS  N+ + Y +                    TIF   ++R +   L  ++++DRE+ DR+   +IA+D+G    Q + T+T+S++D NDNSP +     +  V E     G +  +   D D  S  N  +   +    DN          F I   +  +        + +   TF + A+D G  + S+   VTI +ED ND+ P   I  +  S   ++ +     V+  V   D+D GIN+
Sbjct:  466 QSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYML---------------GPNAPTIF--NLDR-RTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLITVTDAD--SGENAVVTLSLVNARDN----------FIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYDLVQTSTSPGSVVARVYAIDNDTGINA 727          

HSP 7 Score: 52.7582 bits (125), Expect = 6.258e-10
Identity = 29/86 (33.72%), Postives = 46/86 (53.49%), Query Frame = 3
Query: 1656 QMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYF-YQITEGNGLATIHAILGKVTADDKDLGENGTVYY 1910
            Q  +DRE KD Y + I  +D G P+ + T  + + + DVND  PVFK++     I E    A +   + ++ A D DLG N  +++
Sbjct:  222 QQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPED---AAVGTSVTQLHATDADLGSNAKIHF 304          

HSP 8 Score: 32.7278 bits (73), Expect = 6.258e-10
Identity = 19/51 (37.25%), Postives = 26/51 (50.98%), Query Frame = 1
Query: 1450 IIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQIL 1602
            I D NDN+P F S  I  ++ EN  + +      A DPD   NG   Y++L
Sbjct:  147 IEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELL 197          

HSP 9 Score: 63.929 bits (154), Expect = 1.788e-9
Identity = 81/285 (28.42%), Postives = 124/285 (43.51%), Query Frame = 3
Query: 1608 RRKLLFYNHYFRENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYF-YQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQK----YDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFI---NISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNI 2438
            R K +F N +  E  + +  D E   +Y++ I+A D+G+P LN +  + I+I D ND  PVF          E N   T    L K++A D D G N  + Y +       ++   R   +                  +DRE+       +IA DNG P L     V + VLD NDN P F +  N+ NF    N+     VG +       D D GEN  +T S+++ +  +  +   L    R  +T + RE++G        ++A D G+P K+  V V I
Sbjct:  425 RLKPVFDNQFLLETAAPL--DYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGT---ELTKISATDADSGRNAELSYMLGPNAPTIFNLDRRTGILTAVRK-------------LDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTH--NEYNFYVPENLPMYGTVGLITVT----DADSGENAVVTLSLVNAR--DNFIIDPLTGVIRPNITFD-REQQGSY---TFQVKALDKGSPQKSSTVKVTI 679          

HSP 10 Score: 54.6842 bits (130), Expect = 1.068e-6
Identity = 80/332 (24.10%), Postives = 139/332 (41.87%), Query Frame = 3
Query:  405 VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQ--ASRYFTIFIKTINRMKIPYLKLIKE-IDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPT---VNISKTVKECDRQGPL----VELQAFDRDDSSTPNGQIKYKISDNSP--KKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTA-VTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDL--NDTTYFTMVKECLQSIKWTAALYVQYQKNPRHLF 1355
            + V + D NDN P F  +   ++I E++ +G+ ++   A D D   N+ I ++            NQ    A R+F I   T        L  +KE +DREE    +L ++A D        T+T++I D+NDN P   T   +N      +   + PL      +   D+D  +  NG++      + P   K + +  F +  ++             + Y    + +  G    N +A + I+I+D ND+AP   +     S  EN+     LT +   D D G N++ +  L  N  T F + +   ++   TA   +  +K  R+ F
Sbjct:  253 LQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFG----------NQITNLAKRHFAIDNNT-------GLITVKEPLDREESPYHKLTVLASDGSSTPSRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKD--ADLNGKVTCFTDHDVPFRLKPVFDNQFLLETAAPLDYEST------REYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPTIFNLDR---RTGILTAVRKLDREKQDRYTF 556          
BLAST of Protocadherin-1 vs. Ensembl Xenopus
Match: ENSXETT00000047801.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 89.7373 bits (221), Expect = 2.928e-45
Identity = 82/257 (31.91%), Postives = 124/257 (48.25%), Query Frame = 3
Query: 1662 EIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQ-QYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVV------DREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLRERE-GIRLPDRLIIRASDNGTP 2408
            ++DRE +D+Y+ T++AKDNG PSL    TV + +LD ND  P F   +Y + + E      ++  +G +T  D D GEN  V  ++    D+                  I  + GV+      DREQ  S   ++ A D G PQ S+   V + V DVNDNKP F  P N  ++  + T +  G V+A   A D D G N  + YSII      + L    +  G + L + L   + G+    +L+I+ +D+G P
Sbjct:  545 KLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPEN---LPMYGTVGLITVTDADSGENAVVTLSLVNARDN----------------FIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYDLVQTSTSPGSVVARVYAIDNDTGINADLRYSIIGGN--SRGLFAIGERSGNITLKEKLLAGDHGVLY--KLVIKVNDSGKP 778          

HSP 2 Score: 78.1814 bits (191), Expect = 2.928e-45
Identity = 87/331 (26.28%), Postives = 144/331 (43.50%), Query Frame = 3
Query:  303 ILKQRNNIDRETMCKH---ADVCQKIILISING----QVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCT--ITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLV-ELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAPNI----AIYKSTASIRENDRTPL--VLTSVMVNDDDKGINSQFNC 1247
            I    N IDRE +C      + C   + +++      +++++   I D NDN P F      +SI EN+ + S  S+P+A D D   N I  Y +       ++  N F         I+T    K P L + + +DRE+ D + + +  ED G    S T  + V++ DVNDN P +   +I   + E    G  V +L A D D  S  N +I +   +      L  R F I  ++  ++ +     +   Y    + A DG    +   VTI I D ND+ P+I     I     +++ +++ PL   +  + V D D  +N +  C
Sbjct:  102 IFTTSNRIDREKLCSGIFTENKCFYEVEVAVLPDEVFRLVKIRFLIEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYEL-------LKGQNVFGLD-----VIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGS--NAKIHFYFGNQI--TNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASDGSSTPSRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTC 416          

HSP 3 Score: 57.3806 bits (137), Expect = 2.928e-45
Identity = 31/82 (37.80%), Postives = 41/82 (50.00%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
             D ES   Y++ I   D G+PPL    +  + I DENDNAP F    I  +  ENN  G  +  + A D DS  N  +SY +
Sbjct:  442 LDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYML 523          

HSP 4 Score: 52.373 bits (124), Expect = 6.312e-14
Identity = 27/89 (30.34%), Postives = 46/89 (51.69%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENY 1620
             DRE    Y+  +   D G P L      T++++D+NDN+P F  ++  F + EN  +   +G +   D DS EN  V+  ++N  +N+
Sbjct:  546 LDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLITVTDADSGENAVVTLSLVNARDNF 634          

HSP 5 Score: 46.595 bits (109), Expect = 6.312e-14
Identity = 29/92 (31.52%), Postives = 45/92 (48.91%), Query Frame = 3
Query: 1650 RSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF---KQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAI 1916
            R  +  DRE +  Y+  + A D G P  + T  V I + DVND  PVF      Y Y + + +   +  +++ +V A D D G N  + Y+I
Sbjct:  644 RPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYDLVQTS--TSPGSVVARVYAIDNDTGINADLRYSI 733          

HSP 6 Score: 71.2478 bits (173), Expect = 9.942e-12
Identity = 80/291 (27.49%), Postives = 132/291 (45.36%), Query Frame = 3
Query:  393 QVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQ--QGSCTITVSIIDVNDNSPQWPTVNISKTVKE-CDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRL--FYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTA--VTIEIEDCNDHAPNIAIYKSTAS---IRENDRTPLVLTSVMVNDDDKGINS 1235
            Q   +++ I DENDN P F++    LS  EN+  G+EL+  +A D DS  N+ + Y +                    TIF   ++R +   L  ++++DRE+ DR+   +IA+D+G    Q + T+T+S++D NDNSP +     +  V E     G +  +   D D  S  N  +            L+N    F I   +  +        + +   TF + A+D G  + S+   VTI +ED ND+ P   I  +  S   ++ +     V+  V   D+D GIN+
Sbjct:  466 QSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYML---------------GPNAPTIF--NLDR-RTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLITVTDAD--SGENAVVTLS---------LVNARDNFIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYDLVQTSTSPGSVVARVYAIDNDTGINA 727          

HSP 7 Score: 52.7582 bits (125), Expect = 6.357e-10
Identity = 29/86 (33.72%), Postives = 46/86 (53.49%), Query Frame = 3
Query: 1656 QMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYF-YQITEGNGLATIHAILGKVTADDKDLGENGTVYY 1910
            Q  +DRE KD Y + I  +D G P+ + T  + + + DVND  PVFK++     I E    A +   + ++ A D DLG N  +++
Sbjct:  222 QQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPED---AAVGTSVTQLHATDADLGSNAKIHF 304          

HSP 8 Score: 32.7278 bits (73), Expect = 6.357e-10
Identity = 19/51 (37.25%), Postives = 26/51 (50.98%), Query Frame = 1
Query: 1450 IIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQIL 1602
            I D NDN+P F S  I  ++ EN  + +      A DPD   NG   Y++L
Sbjct:  147 IEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELL 197          

HSP 9 Score: 63.929 bits (154), Expect = 1.832e-9
Identity = 81/285 (28.42%), Postives = 124/285 (43.51%), Query Frame = 3
Query: 1608 RRKLLFYNHYFRENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYF-YQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQK----YDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFI---NISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNI 2438
            R K +F N +  E  + +  D E   +Y++ I+A D+G+P LN +  + I+I D ND  PVF          E N   T    L K++A D D G N  + Y +       ++   R   +                  +DRE+       +IA DNG P L     V + VLD NDN P F +  N+ NF    N+     VG +       D D GEN  +T S+++ +  +  +   L    R  +T + RE++G        ++A D G+P K+  V V I
Sbjct:  425 RLKPVFDNQFLLETAAPL--DYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGT---ELTKISATDADSGRNAELSYMLGPNAPTIFNLDRRTGILTAVRK-------------LDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTH--NEYNFYVPENLPMYGTVGLITVT----DADSGENAVVTLSLVNAR--DNFIIDPLTGVIRPNITFD-REQQGSY---TFQVKALDKGSPQKSSTVKVTI 679          

HSP 10 Score: 54.6842 bits (130), Expect = 1.240e-6
Identity = 80/332 (24.10%), Postives = 139/332 (41.87%), Query Frame = 3
Query:  405 VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQ--ASRYFTIFIKTINRMKIPYLKLIKE-IDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPT---VNISKTVKECDRQGPL----VELQAFDRDDSSTPNGQIKYKISDNSP--KKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTA-VTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDL--NDTTYFTMVKECLQSIKWTAALYVQYQKNPRHLF 1355
            + V + D NDN P F  +   ++I E++ +G+ ++   A D D   N+ I ++            NQ    A R+F I   T        L  +KE +DREE    +L ++A D        T+T++I D+NDN P   T   +N      +   + PL      +   D+D  +  NG++      + P   K + +  F +  ++             + Y    + +  G    N +A + I+I+D ND+AP   +     S  EN+     LT +   D D G N++ +  L  N  T F + +   ++   TA   +  +K  R+ F
Sbjct:  253 LQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFG----------NQITNLAKRHFAIDNNT-------GLITVKEPLDREESPYHKLTVLASDGSSTPSRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKD--ADLNGKVTCFTDHDVPFRLKPVFDNQFLLETAAPLDYEST------REYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPTIFNLDR---RTGILTAVRKLDREKQDRYTF 556          
BLAST of Protocadherin-1 vs. Ensembl Xenopus
Match: ENSXETT00000047798.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 89.3521 bits (220), Expect = 3.777e-45
Identity = 82/257 (31.91%), Postives = 124/257 (48.25%), Query Frame = 3
Query: 1662 EIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQ-QYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVV------DREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLRERE-GIRLPDRLIIRASDNGTP 2408
            ++DRE +D+Y+ T++AKDNG PSL    TV + +LD ND  P F   +Y + + E      ++  +G +T  D D GEN  V  ++    D+                  I  + GV+      DREQ  S   ++ A D G PQ S+   V + V DVNDNKP F  P N  ++  + T +  G V+A   A D D G N  + YSII      + L    +  G + L + L   + G+    +L+I+ +D+G P
Sbjct:  525 KLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPEN---LPMYGTVGLITVTDADSGENAVVTLSLVNARDN----------------FIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYDLVQTSTSPGSVVARVYAIDNDTGINADLRYSIIGGN--SRGLFAIGERSGNITLKEKLLAGDHGVLY--KLVIKVNDSGKP 758          

HSP 2 Score: 78.1814 bits (191), Expect = 3.777e-45
Identity = 87/331 (26.28%), Postives = 144/331 (43.50%), Query Frame = 3
Query:  303 ILKQRNNIDRETMCKH---ADVCQKIILISING----QVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCT--ITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLV-ELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAPNI----AIYKSTASIRENDRTPL--VLTSVMVNDDDKGINSQFNC 1247
            I    N IDRE +C      + C   + +++      +++++   I D NDN P F      +SI EN+ + S  S+P+A D D   N I  Y +       ++  N F         I+T    K P L + + +DRE+ D + + +  ED G    S T  + V++ DVNDN P +   +I   + E    G  V +L A D D  S  N +I +   +      L  R F I  ++  ++ +     +   Y    + A DG    +   VTI I D ND+ P+I     I     +++ +++ PL   +  + V D D  +N +  C
Sbjct:   82 IFTTSNRIDREKLCSGIFTENKCFYEVEVAVLPDEVFRLVKIRFLIEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYEL-------LKGQNVFGLD-----VIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGS--NAKIHFYFGNQI--TNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASDGSSTPSRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTC 396          

HSP 3 Score: 56.9954 bits (136), Expect = 3.777e-45
Identity = 31/82 (37.80%), Postives = 41/82 (50.00%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
             D ES   Y++ I   D G+PPL    +  + I DENDNAP F    I  +  ENN  G  +  + A D DS  N  +SY +
Sbjct:  422 LDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYML 503          

HSP 4 Score: 54.6842 bits (130), Expect = 3.834e-24
Identity = 75/306 (24.51%), Postives = 128/306 (41.83%), Query Frame = 3
Query:  405 VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQ--ASRYFTIFIKTINRMKIPYLKLIKE-IDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPT---VNISKTVKECDRQGPL----VELQAFDRDDSSTPNGQIKYKISDNSP--KKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTA-VTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDL--NDTTYFTM 1277
            + V + D NDN P F  +   ++I E++ +G+ ++   A D D   N+ I ++            NQ    A R+F I   T        L  +KE +DREE    +L ++A D        T+T++I D+NDN P   T   +N      +   + PL      +   D+D  +  NG++      + P   K + +  F +  ++             + Y    + +  G    N +A + I+I+D ND+AP   +     S  EN+     LT +   D D G N++ +  L  N  T F +
Sbjct:  233 LQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFG----------NQITNLAKRHFAIDNNT-------GLITVKEPLDREESPYHKLTVLASDGSSTPSRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKD--ADLNGKVTCFTDHDVPFRLKPVFDNQFLLETAAPLDYEST------REYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPTIFNL 513          

HSP 5 Score: 52.373 bits (124), Expect = 3.834e-24
Identity = 27/89 (30.34%), Postives = 46/89 (51.69%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENY 1620
             DRE    Y+  +   D G P L      T++++D+NDN+P F  ++  F + EN  +   +G +   D DS EN  V+  ++N  +N+
Sbjct:  526 LDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLITVTDADSGENAVVTLSLVNARDNF 614          

HSP 6 Score: 46.595 bits (109), Expect = 3.834e-24
Identity = 29/92 (31.52%), Postives = 45/92 (48.91%), Query Frame = 3
Query: 1650 RSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF---KQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAI 1916
            R  +  DRE +  Y+  + A D G P  + T  V I + DVND  PVF      Y Y + + +   +  +++ +V A D D G N  + Y+I
Sbjct:  624 RPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYDLVQTS--TSPGSVVARVYAIDNDTGINADLRYSI 713          

HSP 7 Score: 71.2478 bits (173), Expect = 1.004e-11
Identity = 80/291 (27.49%), Postives = 132/291 (45.36%), Query Frame = 3
Query:  393 QVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQ--QGSCTITVSIIDVNDNSPQWPTVNISKTVKE-CDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRL--FYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTA--VTIEIEDCNDHAPNIAIYKSTAS---IRENDRTPLVLTSVMVNDDDKGINS 1235
            Q   +++ I DENDN P F++    LS  EN+  G+EL+  +A D DS  N+ + Y +                    TIF   ++R +   L  ++++DRE+ DR+   +IA+D+G    Q + T+T+S++D NDNSP +     +  V E     G +  +   D D  S  N  +            L+N    F I   +  +        + +   TF + A+D G  + S+   VTI +ED ND+ P   I  +  S   ++ +     V+  V   D+D GIN+
Sbjct:  446 QSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYML---------------GPNAPTIF--NLDR-RTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLITVTDAD--SGENAVVTLS---------LVNARDNFIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYDLVQTSTSPGSVVARVYAIDNDTGINA 707          

HSP 8 Score: 52.7582 bits (125), Expect = 6.517e-10
Identity = 29/86 (33.72%), Postives = 46/86 (53.49%), Query Frame = 3
Query: 1656 QMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYF-YQITEGNGLATIHAILGKVTADDKDLGENGTVYY 1910
            Q  +DRE KD Y + I  +D G P+ + T  + + + DVND  PVFK++     I E    A +   + ++ A D DLG N  +++
Sbjct:  202 QQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPED---AAVGTSVTQLHATDADLGSNAKIHF 284          

HSP 9 Score: 32.7278 bits (73), Expect = 6.517e-10
Identity = 19/51 (37.25%), Postives = 26/51 (50.98%), Query Frame = 1
Query: 1450 IIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQIL 1602
            I D NDN+P F S  I  ++ EN  + +      A DPD   NG   Y++L
Sbjct:  127 IEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELL 177          

HSP 10 Score: 63.5438 bits (153), Expect = 2.175e-9
Identity = 81/285 (28.42%), Postives = 124/285 (43.51%), Query Frame = 3
Query: 1608 RRKLLFYNHYFRENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYF-YQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQK----YDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFI---NISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNI 2438
            R K +F N +  E  + +  D E   +Y++ I+A D+G+P LN +  + I+I D ND  PVF          E N   T    L K++A D D G N  + Y +       ++   R   +                  +DRE+       +IA DNG P L     V + VLD NDN P F +  N+ NF    N+     VG +       D D GEN  +T S+++ +  +  +   L    R  +T + RE++G        ++A D G+P K+  V V I
Sbjct:  405 RLKPVFDNQFLLETAAPL--DYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGT---ELTKISATDADSGRNAELSYMLGPNAPTIFNLDRRTGILTAVRK-------------LDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTH--NEYNFYVPENLPMYGTVGLITVT----DADSGENAVVTLSLVNAR--DNFIIDPLTGVIRPNITFD-REQQGSY---TFQVKALDKGSPQKSSTVKVTI 659          
BLAST of Protocadherin-1 vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 94.3597 bits (233), Expect = 2.966e-47
Identity = 92/350 (26.29%), Postives = 159/350 (45.43%), Query Frame = 3
Query:  276 YFILQSHSG-ILKQRNNIDRETM--CKHADVCQKIIL---ISI-----NG--QVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQG-PLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENS--TAVTIEIEDCNDHAPNIAIYK--------STASIRENDRTPLVLTSVMVNDDDKGINSQFNC 1247
            Y  +   +G I     +IDRE +  C++       IL   +SI     NG  ++LE  + + D NDN P F+    TL+I EN++IGS   +P A D D+ PN +  Y ++             +A   F + +      K P L ++  +DRE  D ++L +  +D G   +  S  + V+++D NDN+P++        + E    G  +++++A D D  +  N +I Y         E++ RL  +  ++  ++ QG    +  + + F + A D G    S    V + ++D ND+AP I I            A+I E+      +  V V+D D+G N+   C
Sbjct:   76 YLRVDGKTGDIFTTETSIDREGLRECQNQIPGNPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQ----------AGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGA--NAEIDYTFHQ---APEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTC 410          

HSP 2 Score: 83.5741 bits (205), Expect = 2.966e-47
Identity = 86/271 (31.73%), Postives = 128/271 (47.23%), Query Frame = 3
Query: 1644 ENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFK-QQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQL----QNDGRLILTKNL-REREGIRLPDRLIIRASDNGTPPKAELVTVNI 2438
            E R +  +DRE +D Y L ++A D G PSL  T TV + +LD ND  P F    Y + + E   +  +  + G VT  D D GEN  V  ++ Q       QN  G  L  ++           DREQ  +   ++ A D G P  SA   V ++VLD NDN P    P N  + + ++  +++G+ ++   AED D G N  +TYSI          PY L     + G + L K + R   G+    RL+++ SD G PP+     V++
Sbjct:  541 EIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVME--NMPALSPV-GMVTVIDGDKGENARVQLSVEQDNGDFVIQNGTGTILSSLS----------FDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRL-LTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGN------PYGLFQIGSHSGAITLEKEIERRHHGLH---RLVVKVSDRGKPPRYGTALVHL 788          

HSP 3 Score: 53.5286 bits (127), Expect = 2.966e-47
Identity = 29/84 (34.52%), Postives = 38/84 (45.24%), Query Frame = 1
Query: 1348 TFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
            T  D E +  Y++ I  +D G PPL       V ++D NDNAP F          ENN  G  +  V A D DS  N  + Y +
Sbjct:  440 TPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSL 523          

HSP 4 Score: 60.077 bits (144), Expect = 1.966e-22
Identity = 31/80 (38.75%), Postives = 40/80 (50.00%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSY 1593
             DRE    Y + I+  D G PP     L  VT++D NDNAPKF        L+EN+ IG  +  V+A D D   N  + Y
Sbjct:  216 LDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDY 295          

HSP 5 Score: 58.5362 bits (140), Expect = 1.966e-22
Identity = 71/257 (27.63%), Postives = 116/257 (45.14%), Query Frame = 3
Query: 1656 QMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTA------DDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTP 2408
            Q  +DRE       +++AKD G    +    V + + D+ND  P  + +    +T  +G+A I   + + TA       D+D GEN  V   +        RQ +   +  K            +D E++     EI+A D+G P LS+  ++ V V+DVNDN P F   I ++ F     +++ G+V+A   A D D G N  + YS +  +   Q L + +  +   I  K   +RE  R    L + A+D G+P
Sbjct:  320 QGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTT--PLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAF---PENNKPGEVVAEVTASDADSGSNAELVYS-LEPEPAAQGL-FTISPENGEIRVKTSLDRE-QRDSYELKVVAADRGSP 568          

HSP 6 Score: 28.4906 bits (62), Expect = 1.966e-22
Identity = 17/52 (32.69%), Postives = 25/52 (48.08%), Query Frame = 3
Query: 1098 IEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDL 1253
            IE++D ND+ PN A    T +I EN     +    +  D D G N   + +L
Sbjct:  134 IEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYEL 185          

HSP 7 Score: 55.4546 bits (132), Expect = 1.473e-16
Identity = 34/104 (32.69%), Postives = 48/104 (46.15%), Query Frame = 1
Query: 1348 TFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYF---TITILGKI 1650
            T  DRE    Y + +   D G P L G     V ++D NDN PKF      F++ EN    +P+G V   D D  EN RV   +  ++ ++     T TIL  +
Sbjct:  546 TSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGDFVIQNGTGTILSSL 649          

HSP 8 Score: 51.9878 bits (123), Expect = 1.473e-16
Identity = 66/299 (22.07%), Postives = 122/299 (40.80%), Query Frame = 3
Query:  411 VYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSP------------QWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPN------GQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENST--AVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQF 1241
            V + D NDN P+F        + ENS IG  +    A+D D   N+ I Y         +RR+ +   +                 + +   +DRE++      ++A+D G   +     + V++ D+NDN+P            Q    NIS+ V E   +  +  +Q  DRD+           G + +++   S       + +++  ++     +      +K Y T  I AVD G    S+  ++ +++ D ND+AP      +  +  EN++   V+  V  +D D G N++ 
Sbjct:  246 VTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQA-PEVVRRLLRLDRNTGL--------------ITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAE---ETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEK------VKDY-TIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAEL 519          

HSP 9 Score: 61.2326 bits (147), Expect = 7.283e-14
Identity = 65/223 (29.15%), Postives = 108/223 (48.43%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQ-YFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFI-------NISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQ 2309
            +DRE  D Y LTI  +D G P    +  + + +LD ND  P F++  Y  +++E + +   H+++ +V A+D D G N  + Y   Q  +   R       L      G++ + G VDRE + +++  ++A D G    SA A V+V V D+NDN P  +  I  +  +       NIS D      +A  +  D D+GEN  +T  +        ++P+QL+
Sbjct:  216 LDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIG--HSVI-QVKANDSDQGANAEIDYTFHQAPEVVRR------LLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIE--IRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAG------DVPFQLR 421          

HSP 10 Score: 37.3502 bits (85), Expect = 7.283e-14
Identity = 26/82 (31.71%), Postives = 37/82 (45.12%), Query Frame = 1
Query: 1369 LSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDE 1614
            L F   +   +  G P L+  +   + + D NDN P F S  I   + EN NIG+      A D D+  NG  SY++    E
Sbjct:  112 LEFEVSITDLVQNGSPRLLEGQ---IEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPE 190          

HSP 11 Score: 70.0922 bits (170), Expect = 1.664e-11
Identity = 75/284 (26.41%), Postives = 126/284 (44.37%), Query Frame = 3
Query:  411 VYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQ--QGSCTITVSIIDVNDNSPQWPTVNISKTVKE-CDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTAS--IRENDRTPLVLTSVMVNDDDKGINSQF 1241
            V + D NDN P F+     ++  EN+  G  ++  TA D DS  N+ + Y ++           +  A   FTI  +         +++   +DRE+ D +EL ++A D G    QG+ T+ V+++D NDN P++     + +V E      P+  +   D D     N +++  +       E  N  F I   +  + S      + ++  TF + AVDGG   R     VTI + D ND+AP I    +T+   +    R    ++ V   D D GIN++ 
Sbjct:  472 VQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEP----------EPAAQGLFTISPENGE------IRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGE--NARVQLSV-------EQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRLLTPQTRLGETVSQVTAEDIDSGINAEL 730          

HSP 12 Score: 70.0922 bits (170), Expect = 1.922e-11
Identity = 91/300 (30.33%), Postives = 142/300 (47.33%), Query Frame = 3
Query: 1635 YFRENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYF-YQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFI---NISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYIPNNLTPRNNALPPGINKKSNDKNRF 2522
            YF +  + ++ ++ +KD Y++ I+A D+G P L+ T ++ ++++DVND  PVF Q        E N    + A   +VTA D D G N  + Y++         +             G + +   +DREQ  S + +++A D G P L   A V+V+VLD NDN PKF   ++  NF    N+   S VG V       D DKGEN  +  S+      + N  + +QN    IL+    +RE  +      ++A D G PP++  V V I  +  N    +NA  P I   SN  +R 
Sbjct:  434 YFLQTTTPLDYEK-VKD-YTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVA---EVTASDADSGSNAELVYSLEP-------EPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFM--LSGYNFSVMENMPALSPVGMVTVI----DGDKGENARVQLSV-----EQDNGDFVIQNGTGTILSSLSFDRE-QQSTYTFQLKAVDGGVPPRSAYVGVTINVLDEN----DNA--PFITAPSNTSHRL 703          

HSP 13 Score: 51.6026 bits (122), Expect = 5.127e-7
Identity = 32/95 (33.68%), Postives = 45/95 (47.37%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAP--KFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
            FDRE  S Y+  ++ +D G PP       T+ ++DENDNAP     S+     LT    +G  +  V A D DS  N  ++Y I   +    F I
Sbjct:  651 FDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRLLTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNPYGLFQI 745          

HSP 14 Score: 23.483 bits (49), Expect = 5.127e-7
Identity = 10/36 (27.78%), Postives = 17/36 (47.22%), Query Frame = 3
Query: 1656 QMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRI 1763
            + EI+R     + L +   D G+P    T  VH+ +
Sbjct:  755 EKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYV 790          
BLAST of Protocadherin-1 vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 94.3597 bits (233), Expect = 2.966e-47
Identity = 92/350 (26.29%), Postives = 159/350 (45.43%), Query Frame = 3
Query:  276 YFILQSHSG-ILKQRNNIDRETM--CKHADVCQKIIL---ISI-----NG--QVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQG-PLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENS--TAVTIEIEDCNDHAPNIAIYK--------STASIRENDRTPLVLTSVMVNDDDKGINSQFNC 1247
            Y  +   +G I     +IDRE +  C++       IL   +SI     NG  ++LE  + + D NDN P F+    TL+I EN++IGS   +P A D D+ PN +  Y ++             +A   F + +      K P L ++  +DRE  D ++L +  +D G   +  S  + V+++D NDN+P++        + E    G  +++++A D D  +  N +I Y         E++ RL  +  ++  ++ QG    +  + + F + A D G    S    V + ++D ND+AP I I            A+I E+      +  V V+D D+G N+   C
Sbjct:   76 YLRVDGKTGDIFTTETSIDREGLRECQNQIPGNPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQ----------AGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGA--NAEIDYTFHQ---APEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTC 410          

HSP 2 Score: 83.5741 bits (205), Expect = 2.966e-47
Identity = 86/271 (31.73%), Postives = 128/271 (47.23%), Query Frame = 3
Query: 1644 ENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFK-QQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQL----QNDGRLILTKNL-REREGIRLPDRLIIRASDNGTPPKAELVTVNI 2438
            E R +  +DRE +D Y L ++A D G PSL  T TV + +LD ND  P F    Y + + E   +  +  + G VT  D D GEN  V  ++ Q       QN  G  L  ++           DREQ  +   ++ A D G P  SA   V ++VLD NDN P    P N  + + ++  +++G+ ++   AED D G N  +TYSI          PY L     + G + L K + R   G+    RL+++ SD G PP+     V++
Sbjct:  541 EIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVME--NMPALSPV-GMVTVIDGDKGENARVQLSVEQDNGDFVIQNGTGTILSSLS----------FDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRL-LTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGN------PYGLFQIGSHSGAITLEKEIERRHHGLH---RLVVKVSDRGKPPRYGTALVHL 788          

HSP 3 Score: 53.5286 bits (127), Expect = 2.966e-47
Identity = 29/84 (34.52%), Postives = 38/84 (45.24%), Query Frame = 1
Query: 1348 TFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
            T  D E +  Y++ I  +D G PPL       V ++D NDNAP F          ENN  G  +  V A D DS  N  + Y +
Sbjct:  440 TPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSL 523          

HSP 4 Score: 60.077 bits (144), Expect = 1.966e-22
Identity = 31/80 (38.75%), Postives = 40/80 (50.00%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSY 1593
             DRE    Y + I+  D G PP     L  VT++D NDNAPKF        L+EN+ IG  +  V+A D D   N  + Y
Sbjct:  216 LDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDY 295          

HSP 5 Score: 58.5362 bits (140), Expect = 1.966e-22
Identity = 71/257 (27.63%), Postives = 116/257 (45.14%), Query Frame = 3
Query: 1656 QMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTA------DDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTP 2408
            Q  +DRE       +++AKD G    +    V + + D+ND  P  + +    +T  +G+A I   + + TA       D+D GEN  V   +        RQ +   +  K            +D E++     EI+A D+G P LS+  ++ V V+DVNDN P F   I ++ F     +++ G+V+A   A D D G N  + YS +  +   Q L + +  +   I  K   +RE  R    L + A+D G+P
Sbjct:  320 QGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTT--PLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAF---PENNKPGEVVAEVTASDADSGSNAELVYS-LEPEPAAQGL-FTISPENGEIRVKTSLDRE-QRDSYELKVVAADRGSP 568          

HSP 6 Score: 28.4906 bits (62), Expect = 1.966e-22
Identity = 17/52 (32.69%), Postives = 25/52 (48.08%), Query Frame = 3
Query: 1098 IEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDL 1253
            IE++D ND+ PN A    T +I EN     +    +  D D G N   + +L
Sbjct:  134 IEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYEL 185          

HSP 7 Score: 55.4546 bits (132), Expect = 1.473e-16
Identity = 34/104 (32.69%), Postives = 48/104 (46.15%), Query Frame = 1
Query: 1348 TFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYF---TITILGKI 1650
            T  DRE    Y + +   D G P L G     V ++D NDN PKF      F++ EN    +P+G V   D D  EN RV   +  ++ ++     T TIL  +
Sbjct:  546 TSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGDFVIQNGTGTILSSL 649          

HSP 8 Score: 51.9878 bits (123), Expect = 1.473e-16
Identity = 66/299 (22.07%), Postives = 122/299 (40.80%), Query Frame = 3
Query:  411 VYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSP------------QWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPN------GQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENST--AVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQF 1241
            V + D NDN P+F        + ENS IG  +    A+D D   N+ I Y         +RR+ +   +                 + +   +DRE++      ++A+D G   +     + V++ D+NDN+P            Q    NIS+ V E   +  +  +Q  DRD+           G + +++   S       + +++  ++     +      +K Y T  I AVD G    S+  ++ +++ D ND+AP      +  +  EN++   V+  V  +D D G N++ 
Sbjct:  246 VTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQA-PEVVRRLLRLDRNTGL--------------ITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAE---ETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEK------VKDY-TIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAEL 519          

HSP 9 Score: 61.2326 bits (147), Expect = 7.283e-14
Identity = 65/223 (29.15%), Postives = 108/223 (48.43%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQ-YFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFI-------NISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQ 2309
            +DRE  D Y LTI  +D G P    +  + + +LD ND  P F++  Y  +++E + +   H+++ +V A+D D G N  + Y   Q  +   R       L      G++ + G VDRE + +++  ++A D G    SA A V+V V D+NDN P  +  I  +  +       NIS D      +A  +  D D+GEN  +T  +        ++P+QL+
Sbjct:  216 LDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIG--HSVI-QVKANDSDQGANAEIDYTFHQAPEVVRR------LLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIE--IRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAG------DVPFQLR 421          

HSP 10 Score: 37.3502 bits (85), Expect = 7.283e-14
Identity = 26/82 (31.71%), Postives = 37/82 (45.12%), Query Frame = 1
Query: 1369 LSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDE 1614
            L F   +   +  G P L+  +   + + D NDN P F S  I   + EN NIG+      A D D+  NG  SY++    E
Sbjct:  112 LEFEVSITDLVQNGSPRLLEGQ---IEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPE 190          

HSP 11 Score: 70.0922 bits (170), Expect = 1.664e-11
Identity = 75/284 (26.41%), Postives = 126/284 (44.37%), Query Frame = 3
Query:  411 VYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQ--QGSCTITVSIIDVNDNSPQWPTVNISKTVKE-CDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTAS--IRENDRTPLVLTSVMVNDDDKGINSQF 1241
            V + D NDN P F+     ++  EN+  G  ++  TA D DS  N+ + Y ++           +  A   FTI  +         +++   +DRE+ D +EL ++A D G    QG+ T+ V+++D NDN P++     + +V E      P+  +   D D     N +++  +       E  N  F I   +  + S      + ++  TF + AVDGG   R     VTI + D ND+AP I    +T+   +    R    ++ V   D D GIN++ 
Sbjct:  472 VQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEP----------EPAAQGLFTISPENGE------IRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGE--NARVQLSV-------EQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRLLTPQTRLGETVSQVTAEDIDSGINAEL 730          

HSP 12 Score: 70.0922 bits (170), Expect = 1.922e-11
Identity = 91/300 (30.33%), Postives = 142/300 (47.33%), Query Frame = 3
Query: 1635 YFRENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYF-YQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFI---NISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYIPNNLTPRNNALPPGINKKSNDKNRF 2522
            YF +  + ++ ++ +KD Y++ I+A D+G P L+ T ++ ++++DVND  PVF Q        E N    + A   +VTA D D G N  + Y++         +             G + +   +DREQ  S + +++A D G P L   A V+V+VLD NDN PKF   ++  NF    N+   S VG V       D DKGEN  +  S+      + N  + +QN    IL+    +RE  +      ++A D G PP++  V V I  +  N    +NA  P I   SN  +R 
Sbjct:  434 YFLQTTTPLDYEK-VKD-YTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVA---EVTASDADSGSNAELVYSLEP-------EPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFM--LSGYNFSVMENMPALSPVGMVTVI----DGDKGENARVQLSV-----EQDNGDFVIQNGTGTILSSLSFDRE-QQSTYTFQLKAVDGGVPPRSAYVGVTINVLDEN----DNA--PFITAPSNTSHRL 703          

HSP 13 Score: 51.6026 bits (122), Expect = 5.127e-7
Identity = 32/95 (33.68%), Postives = 45/95 (47.37%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAP--KFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
            FDRE  S Y+  ++ +D G PP       T+ ++DENDNAP     S+     LT    +G  +  V A D DS  N  ++Y I   +    F I
Sbjct:  651 FDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRLLTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNPYGLFQI 745          

HSP 14 Score: 23.483 bits (49), Expect = 5.127e-7
Identity = 10/36 (27.78%), Postives = 17/36 (47.22%), Query Frame = 3
Query: 1656 QMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRI 1763
            + EI+R     + L +   D G+P    T  VH+ +
Sbjct:  755 EKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYV 790          
BLAST of Protocadherin-1 vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 87.0409 bits (214), Expect = 6.115e-45
Identity = 75/286 (26.22%), Postives = 131/286 (45.80%), Query Frame = 3
Query:  429 NDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQG-PLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENS--TAVTIEIEDCNDHAPNIAIYK--------STASIRENDRTPLVLTSVMVNDDDKGINSQFNC 1247
            NDN P F+    TL+I EN++IGS   +P A D D+ PN +  Y ++             +A   F + +      K P L ++  +DRE  D ++L +  +D G   +  S  + V+++D NDN+P++        + E    G  +++++A D D  +  N +I Y         E++ RL  +  ++  ++ QG    +  + + F + A D G    S    V + ++D ND+AP I I            A+I E+      +  V V+D D+G N+   C
Sbjct:    1 NDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQ----------AGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGA--NAEIDYTFHQ---APEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTC 271          

HSP 2 Score: 83.5741 bits (205), Expect = 6.115e-45
Identity = 86/271 (31.73%), Postives = 128/271 (47.23%), Query Frame = 3
Query: 1644 ENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFK-QQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQL----QNDGRLILTKNL-REREGIRLPDRLIIRASDNGTPPKAELVTVNI 2438
            E R +  +DRE +D Y L ++A D G PSL  T TV + +LD ND  P F    Y + + E   +  +  + G VT  D D GEN  V  ++ Q       QN  G  L  ++           DREQ  +   ++ A D G P  SA   V ++VLD NDN P    P N  + + ++  +++G+ ++   AED D G N  +TYSI          PY L     + G + L K + R   G+    RL+++ SD G PP+     V++
Sbjct:  402 EIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVME--NMPALSPV-GMVTVIDGDKGENARVQLSVEQDNGDFVIQNGTGTILSSLS----------FDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRL-LTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGN------PYGLFQIGSHSGAITLEKEIERRHHGLH---RLVVKVSDRGKPPRYGTALVHL 649          

HSP 3 Score: 53.1434 bits (126), Expect = 6.115e-45
Identity = 29/84 (34.52%), Postives = 38/84 (45.24%), Query Frame = 1
Query: 1348 TFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
            T  D E +  Y++ I  +D G PPL       V ++D NDNAP F          ENN  G  +  V A D DS  N  + Y +
Sbjct:  301 TPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSL 384          

HSP 4 Score: 60.077 bits (144), Expect = 3.983e-20
Identity = 31/80 (38.75%), Postives = 40/80 (50.00%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSY 1593
             DRE    Y + I+  D G PP     L  VT++D NDNAPKF        L+EN+ IG  +  V+A D D   N  + Y
Sbjct:   77 LDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDY 156          

HSP 5 Score: 58.151 bits (139), Expect = 3.983e-20
Identity = 71/257 (27.63%), Postives = 116/257 (45.14%), Query Frame = 3
Query: 1656 QMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTA------DDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTP 2408
            Q  +DRE       +++AKD G    +    V + + D+ND  P  + +    +T  +G+A I   + + TA       D+D GEN  V   +        RQ +   +  K            +D E++     EI+A D+G P LS+  ++ V V+DVNDN P F   I ++ F     +++ G+V+A   A D D G N  + YS +  +   Q L + +  +   I  K   +RE  R    L + A+D G+P
Sbjct:  181 QGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTT--PLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAF---PENNKPGEVVAEVTASDADSGSNAELVYS-LEPEPAAQGL-FTISPENGEIRVKTSLDRE-QRDSYELKVVAADRGSP 429          

HSP 6 Score: 20.7866 bits (42), Expect = 3.983e-20
Identity = 14/46 (30.43%), Postives = 20/46 (43.48%), Query Frame = 3
Query: 1116 NDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDL 1253
            ND+ PN A    T +I EN     +    +  D D G N   + +L
Sbjct:    1 NDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYEL 46          

HSP 7 Score: 55.4546 bits (132), Expect = 2.346e-16
Identity = 34/104 (32.69%), Postives = 48/104 (46.15%), Query Frame = 1
Query: 1348 TFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYF---TITILGKI 1650
            T  DRE    Y + +   D G P L G     V ++D NDN PKF      F++ EN    +P+G V   D D  EN RV   +  ++ ++     T TIL  +
Sbjct:  407 TSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGDFVIQNGTGTILSSL 510          

HSP 8 Score: 51.6026 bits (122), Expect = 2.346e-16
Identity = 66/301 (21.93%), Postives = 122/301 (40.53%), Query Frame = 3
Query:  405 VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSP------------QWPTVNISKTVKECDRQGPLVELQAFDRDDSSTP------NGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENST--AVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQF 1241
            + V + D NDN P+F        + ENS IG  +    A+D D   N+ I Y                QA       ++      +  + +   +DRE++      ++A+D G   +     + V++ D+NDN+P            Q    NIS+ V E   +  +  +Q  DRD+           G + +++   S       + +++  ++     +      +K Y T  I AVD G    S+  ++ +++ D ND+AP      +  +  EN++   V+  V  +D D G N++ 
Sbjct:  105 LRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTF-------------HQAPEVVRRLLRLDRNTGL--ITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAE---ETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEK------VKDY-TIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAEL 380          

HSP 9 Score: 60.8474 bits (146), Expect = 2.751e-13
Identity = 65/223 (29.15%), Postives = 108/223 (48.43%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQ-YFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFI-------NISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQ 2309
            +DRE  D Y LTI  +D G P    +  + + +LD ND  P F++  Y  +++E + +   H+++ +V A+D D G N  + Y   Q  +   R       L      G++ + G VDRE + +++  ++A D G    SA A V+V V D+NDN P  +  I  +  +       NIS D      +A  +  D D+GEN  +T  +        ++P+QL+
Sbjct:   77 LDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIG--HSVI-QVKANDSDQGANAEIDYTFHQAPEVVRR------LLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIE--IRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAG------DVPFQLR 282          

HSP 10 Score: 35.4242 bits (80), Expect = 2.751e-13
Identity = 20/51 (39.22%), Postives = 25/51 (49.02%), Query Frame = 1
Query: 1462 NDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDE 1614
            NDN P F S  I   + EN NIG+      A D D+  NG  SY++    E
Sbjct:    1 NDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPE 51          

HSP 11 Score: 70.0922 bits (170), Expect = 1.852e-11
Identity = 90/300 (30.00%), Postives = 141/300 (47.00%), Query Frame = 3
Query: 1635 YFRENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYF-YQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFI---NISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYIPNNLTPRNNALPPGINKKSNDKNRF 2522
            YF +  + ++ ++ +KD Y++ I+A D+G P L+ T ++ ++++DVND  PVF Q        E N       ++ +VTA D D G N  + Y++         +             G + +   +DREQ  S + +++A D G P L   A V+V+VLD NDN PKF   ++  NF    N+   S VG V       D DKGEN  +  S+      + N  + +QN    IL+    +RE         ++A D G PP++  V V I  +  N    +NA  P I   SN  +R 
Sbjct:  295 YFLQTTTPLDYEK-VKD-YTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPG---EVVAEVTASDADSGSNAELVYSLEP-------EPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFM--LSGYNFSVMENMPALSPVGMVTVI----DGDKGENARVQLSV-----EQDNGDFVIQNGTGTILSSLSFDREQQST-YTFQLKAVDGGVPPRSAYVGVTINVLDEN----DNA--PFITAPSNTSHRL 564          

HSP 12 Score: 69.707 bits (169), Expect = 2.213e-11
Identity = 75/284 (26.41%), Postives = 126/284 (44.37%), Query Frame = 3
Query:  411 VYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQ--QGSCTITVSIIDVNDNSPQWPTVNISKTVKE-CDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTAS--IRENDRTPLVLTSVMVNDDDKGINSQF 1241
            V + D NDN P F+     ++  EN+  G  ++  TA D DS  N+ + Y ++           +  A   FTI  +         +++   +DRE+ D +EL ++A D G    QG+ T+ V+++D NDN P++     + +V E      P+  +   D D     N +++  +       E  N  F I   +  + S      + ++  TF + AVDGG   R     VTI + D ND+AP I    +T+   +    R    ++ V   D D GIN++ 
Sbjct:  333 VQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEP----------EPAAQGLFTISPENGE------IRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGE--NARVQLSV-------EQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRLLTPQTRLGETVSQVTAEDIDSGINAEL 591          

HSP 13 Score: 51.2174 bits (121), Expect = 6.734e-7
Identity = 32/95 (33.68%), Postives = 45/95 (47.37%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAP--KFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
            FDRE  S Y+  ++ +D G PP       T+ ++DENDNAP     S+     LT    +G  +  V A D DS  N  ++Y I   +    F I
Sbjct:  512 FDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRLLTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNPYGLFQI 606          

HSP 14 Score: 23.483 bits (49), Expect = 6.734e-7
Identity = 10/36 (27.78%), Postives = 17/36 (47.22%), Query Frame = 3
Query: 1656 QMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRI 1763
            + EI+R     + L +   D G+P    T  VH+ +
Sbjct:  616 EKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYV 651          
BLAST of Protocadherin-1 vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 85.5001 bits (210), Expect = 1.220e-44
Identity = 108/414 (26.09%), Postives = 179/414 (43.24%), Query Frame = 3
Query:   78 LSISIIFGILIEMLIC------KTFYIKLKISENKGSGEDLINLKNYIIIHKLPINSSGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHADV---CQKIILISING----QVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCT--ITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLV-ELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAPNIAI------YKSTASIREND--RTPLVLTSVMVNDDDKGINSQFNC 1247
            LS + IF +L+  ++       K + ++ ++ EN   G DL+   N  +I    + +   + ++    D+    I +    I      IDRE +C    +   C   + +++      +++++   I D NDN P F      +SI ENS I S  SLP A D D   N +  Y +  I S++I  ++           I+T    K+P L + KE+DREE D + + +  ED G  Q S T  + VS+ D NDN P +    I  ++ E    G  V +L A D D     N +I +  S+      +  RLF++  ++  ++ +     +        + A DGG       V + + D ND+ P+I I         T  + EN    T + L +VM  D D   N +  C
Sbjct:    4 LSGTYIFAVLLACVVFQSGAQEKNYTVREEMPENVLIG-DLLKDLNLSLIPDKSLTTPMQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDREKLCAGIVLDARCFYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQL--IKSQNIFGLD----------VIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGE--NARIHFYFSNLV--SNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVLATDGGSTPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVM--DKDSEHNGRVTC 398          

HSP 2 Score: 71.633 bits (174), Expect = 1.220e-44
Identity = 82/276 (29.71%), Postives = 125/276 (45.29%), Query Frame = 3
Query: 1662 EIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQ-QYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVV------DREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILT-KNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYIPNNLTP 2465
            ++DRE +++Y  T++A+DNG P L    TV + +LD ND  P+F   +Y + + E       H  +G +T  D D GEN  V  +I    D                   I    GV+      DRE+  S    + A D G+   S+ A V ++V+DVNDNKP F  P +  +F  +   +  G V+    A D D G N  + YSI+      + L    Q  G + L  K +    G+    R+I++A+D G  P +    VN+ +  N   P
Sbjct:  527 KLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPES---LPKHGTVGLITVTDPDYGENSAVTLSILDVNDQ----------------FTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFEWVLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGGN--TKGLFMIEQTSGNITLKEKCMVSDLGLH---RVIVKANDLGQ-PDSLFNVVNVNFFINESVP 777          

HSP 3 Score: 65.4698 bits (158), Expect = 1.220e-44
Identity = 31/84 (36.90%), Postives = 46/84 (54.76%), Query Frame = 1
Query: 1348 TFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
             F D ES   Y++ +   D G+PPL    +  + + DENDNAP F    I  ++ ENN+ GA +  + A D DS +N  +SY +
Sbjct:  422 AFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYML 505          

HSP 4 Score: 62.003 bits (149), Expect = 4.693e-27
Identity = 72/288 (25.00%), Postives = 122/288 (42.36%), Query Frame = 3
Query:  405 VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKE-IDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPT---VNISKTVKECDRQGPL----VELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRE--NSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQ 1238
            + V + D NDN P F  +   +SI EN+ IGS ++   A D D   N+ I ++  ++ S   +R+     +                 L  +KE +DREE    +L+++A D G      T+ V++ D+NDN P       VN +          PL      +   D+D  S  NG++    +D+    E+  RL  +  +   L +      +        + A D G      S+ + I+++D ND+AP       + S+ EN+     LT +   D D G N++
Sbjct:  235 LQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTG---------------LITVKEPLDREESPSHKLLVLATDGGSTPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKD--SEHNGRVTC-FTDH----EVPFRLRPVFSNQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAE 500          

HSP 5 Score: 53.1434 bits (126), Expect = 4.693e-27
Identity = 33/93 (35.48%), Postives = 46/93 (49.46%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
             DRE    Y   +   D G PPL+      VT++D+NDN+P F  ++  F + E+      +G +   DPD  EN  V+  IL  D N  FTI
Sbjct:  528 LDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSIL--DVNDQFTI 618          

HSP 6 Score: 47.7506 bits (112), Expect = 4.693e-27
Identity = 30/93 (32.26%), Postives = 45/93 (48.39%), Query Frame = 3
Query: 1650 RSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF----KQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAI 1916
            R  +  DRE ++ Y+  + A+D G  S + T  V I ++DVND  P+F        F  +       T   ++ KV A D D+G N  V Y+I
Sbjct:  626 RPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFEWVLPSTNPGT---VVFKVVAIDDDIGMNAEVLYSI 715          

HSP 7 Score: 68.5514 bits (166), Expect = 1.346e-16
Identity = 67/225 (29.78%), Postives = 104/225 (46.22%), Query Frame = 3
Query: 1608 RRKLLFYNHYFRENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYF-YQITEGNGLATIHAILGKVTADDKDLGENGTVYYAI----RQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSII 2267
            R + +F N +  E  + +  D E   +Y++ ++A D G+P LN +  + I++ D ND  PVF Q +    + E N      A L K++A D D G+N  + Y +      +++   R   +                  +DRE+       ++A DNG P L + A V V VLD NDN P F +  N+ NF    +  + G V       DPD GEN  +T SI+
Sbjct:  407 RLRPVFSNQFLLETAAFL--DFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPG---AQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAVKK-------------LDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTH--NEYNFYVPESLPKHGTV-GLITVTDPDYGENSAVTLSIL 610          

HSP 8 Score: 38.891 bits (89), Expect = 1.346e-16
Identity = 30/88 (34.09%), Postives = 38/88 (43.18%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFT---------LTENNNIGAPIGYVRAYDPDSNENGRVS 1590
             DRE    + +L+   D G  P     L  VT  D NDN P   S DIR+          L+EN  +   I  +   D DS  NGRV+
Sbjct:  315 LDREESPSHKLLVLATDGGSTPARATVLVNVT--DINDNVP---SIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVT 397          

HSP 9 Score: 73.559 bits (179), Expect = 1.298e-12
Identity = 75/286 (26.22%), Postives = 130/286 (45.45%), Query Frame = 3
Query:  405 VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKEC-DRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTAS---IRENDRTPLVLTSVMVNDDDKGINSQ 1238
            +++ + DENDN P F+    +LS+ EN+  G++L+  +A D DS  N+ I Y +             F A   F +  +T        L  +K++DRE+ +++   ++A+D+G      + T+ V+++D NDNSP +     +  V E   + G +  +   D D     N  +   I D       +N  F I   S  +        + +   TF++ A DGG   R ++  VTI + D ND+ P      S  S   +  +     V+  V+  DDD G+N++
Sbjct:  452 LLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLG------------FDAPPEFNLDQRT------GILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGE--NSAVTLSILD-------VNDQFTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFEWVLPSTNPGTVVFKVVAIDDDIGMNAE 710          

HSP 10 Score: 50.8322 bits (120), Expect = 1.795e-10
Identity = 62/264 (23.48%), Postives = 113/264 (42.80%), Query Frame = 3
Query: 1656 QMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF-KQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYA-------IRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMN-FINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQ---NDGRLILTKNLREREGIRLPDRLIIRASDNGTPP 2411
            Q E+DRE KD Y + +  +D G P  + T  + + + D ND  P+F +++    I E    A I + + ++ A D D+GEN  +++        I ++  H N    +                  +DRE+  S +  ++A D G     A   V V  ++ N      +Y +N  N  + +S ++ +   +A     D D   NG +T         +  +P++L+   ++  L+ T    + E  R    + + A+D G PP
Sbjct:  204 QKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPEN---APIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEP------------LDREESPSHKLLVLATDGGSTPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTC------FTDHEVPFRLRPVFSNQFLLETAAFLDFESTR-EYAIKLLAADAGKPP 445          

HSP 11 Score: 36.1946 bits (82), Expect = 1.795e-10
Identity = 29/91 (31.87%), Postives = 44/91 (48.35%), Query Frame = 1
Query: 1354 FDRESLSFYSVL-IRCIDLGRPPLVGEKLFTVTII-----DENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNN 1608
             DRE L    VL  RC       ++ +++F +  I     D NDNAP F +  I  ++ EN+ I +      A DPD   NG  +YQ++ +
Sbjct:   91 IDREKLCAGIVLDARCFYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKS 181          

HSP 12 Score: 59.6918 bits (143), Expect = 2.746e-8
Identity = 60/239 (25.10%), Postives = 108/239 (45.19%), Query Frame = 3
Query:  279 FILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQVLE----VMVYINDENDNIPQFSMRH------KTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRM--NQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQ--QGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGP-LVELQAFDRDDSSTPNGQIKYKISDNSPKK 950
            F L + +G++  +  +DRE    H     K+++++ +G        V+V + D NDN+P   +R+       T+ + EN+ + ++++L T  D DSE N  +  F        +R +  NQF                    L+    +D E    + + L+A D+GK     S  + + + D NDN+P +    IS +V E +  G  L ++ A D D  S  N +I Y +  ++P +
Sbjct:  300 FHLNTTTGLITVKEPLDREESPSH-----KLLVLATDGGSTPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVPFRLRPVFSNQF-------------------LLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDAD--SGQNAEISYMLGFDAPPE 512          
BLAST of Protocadherin-1 vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 84.7297 bits (208), Expect = 3.905e-44
Identity = 108/414 (26.09%), Postives = 179/414 (43.24%), Query Frame = 3
Query:   78 LSISIIFGILIEMLIC------KTFYIKLKISENKGSGEDLINLKNYIIIHKLPINSSGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHADV---CQKIILISING----QVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCT--ITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLV-ELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAPNIAI------YKSTASIREND--RTPLVLTSVMVNDDDKGINSQFNC 1247
            LS + IF +L+  ++       K + ++ ++ EN   G DL+   N  +I    + +   + ++    D+    I +    I      IDRE +C    +   C   + +++      +++++   I D NDN P F      +SI ENS I S  SLP A D D   N +  Y +  I S++I  ++           I+T    K+P L + KE+DREE D + + +  ED G  Q S T  + VS+ D NDN P +    I  ++ E    G  V +L A D D     N +I +  S+      +  RLF++  ++  ++ +     +        + A DGG       V + + D ND+ P+I I         T  + EN    T + L +VM  D D   N +  C
Sbjct:    4 LSGTYIFAVLLACVVFQSGAQEKNYTVREEMPENVLIG-DLLKDLNLSLIPDKSLTTPMQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDREKLCAGIVLDARCFYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQL--IKSQNIFGLD----------VIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGE--NARIHFYFSNLV--SNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVLATDGGSTPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVM--DKDSEHNGRVTC 398          

HSP 2 Score: 70.4774 bits (171), Expect = 3.905e-44
Identity = 82/276 (29.71%), Postives = 125/276 (45.29%), Query Frame = 3
Query: 1662 EIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQ-QYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVV------DREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILT-KNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYIPNNLTP 2465
            ++DRE +++Y  T++A+DNG P L    TV + +LD ND  P+F   +Y + + E       H  +G +T  D D GEN  V  +I    D                   I    GV+      DRE+  S    + A D G+   S+ A V ++V+DVNDNKP F  P +  +F  +   +  G V+    A D D G N  + YSI+      + L    Q  G + L  K +    G+    R+I++A+D G  P +    VN+ +  N   P
Sbjct:  527 KLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPES---LPKHGTVGLITVTDPDYGENSAVTLSILDVNDQ----------------FTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFEWVLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGGN--TKGLFMIEQTSGNITLKEKCMVSDLGLH---RVIVKANDLGQ-PDSLFNVVNVNFFINESVP 777          

HSP 3 Score: 65.4698 bits (158), Expect = 3.905e-44
Identity = 31/84 (36.90%), Postives = 46/84 (54.76%), Query Frame = 1
Query: 1348 TFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
             F D ES   Y++ +   D G+PPL    +  + + DENDNAP F    I  ++ ENN+ GA +  + A D DS +N  +SY +
Sbjct:  422 AFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYML 505          

HSP 4 Score: 61.2326 bits (147), Expect = 7.089e-27
Identity = 72/288 (25.00%), Postives = 122/288 (42.36%), Query Frame = 3
Query:  405 VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKE-IDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPT---VNISKTVKECDRQGPL----VELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRE--NSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQ 1238
            + V + D NDN P F  +   +SI EN+ IGS ++   A D D   N+ I ++  ++ S   +R+     +                 L  +KE +DREE    +L+++A D G      T+ V++ D+NDN P       VN +          PL      +   D+D  S  NG++    +D+    E+  RL  +  +   L +      +        + A D G      S+ + I+++D ND+AP       + S+ EN+     LT +   D D G N++
Sbjct:  235 LQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTG---------------LITVKEPLDREESPSHKLLVLATDGGSTPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKD--SEHNGRVTC-FTDH----EVPFRLRPVFSNQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAE 500          

HSP 5 Score: 53.1434 bits (126), Expect = 7.089e-27
Identity = 33/93 (35.48%), Postives = 46/93 (49.46%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
             DRE    Y   +   D G PPL+      VT++D+NDN+P F  ++  F + E+      +G +   DPD  EN  V+  IL  D N  FTI
Sbjct:  528 LDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSIL--DVNDQFTI 618          

HSP 6 Score: 47.7506 bits (112), Expect = 7.089e-27
Identity = 30/93 (32.26%), Postives = 45/93 (48.39%), Query Frame = 3
Query: 1650 RSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF----KQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAI 1916
            R  +  DRE ++ Y+  + A+D G  S + T  V I ++DVND  P+F        F  +       T   ++ KV A D D+G N  V Y+I
Sbjct:  626 RPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFEWVLPSTNPGT---VVFKVVAIDDDIGMNAEVLYSI 715          

HSP 7 Score: 67.781 bits (164), Expect = 2.268e-16
Identity = 67/225 (29.78%), Postives = 104/225 (46.22%), Query Frame = 3
Query: 1608 RRKLLFYNHYFRENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYF-YQITEGNGLATIHAILGKVTADDKDLGENGTVYYAI----RQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSII 2267
            R + +F N +  E  + +  D E   +Y++ ++A D G+P LN +  + I++ D ND  PVF Q +    + E N      A L K++A D D G+N  + Y +      +++   R   +                  +DRE+       ++A DNG P L + A V V VLD NDN P F +  N+ NF    +  + G V       DPD GEN  +T SI+
Sbjct:  407 RLRPVFSNQFLLETAAFL--DFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPG---AQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAVKK-------------LDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTH--NEYNFYVPESLPKHGTV-GLITVTDPDYGENSAVTLSIL 610          

HSP 8 Score: 38.891 bits (89), Expect = 2.268e-16
Identity = 30/88 (34.09%), Postives = 38/88 (43.18%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFT---------LTENNNIGAPIGYVRAYDPDSNENGRVS 1590
             DRE    + +L+   D G  P     L  VT  D NDN P   S DIR+          L+EN  +   I  +   D DS  NGRV+
Sbjct:  315 LDREESPSHKLLVLATDGGSTPARATVLVNVT--DINDNVP---SIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVT 397          

HSP 9 Score: 73.559 bits (179), Expect = 1.680e-12
Identity = 75/286 (26.22%), Postives = 130/286 (45.45%), Query Frame = 3
Query:  405 VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKEC-DRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTAS---IRENDRTPLVLTSVMVNDDDKGINSQ 1238
            +++ + DENDN P F+    +LS+ EN+  G++L+  +A D DS  N+ I Y +             F A   F +  +T        L  +K++DRE+ +++   ++A+D+G      + T+ V+++D NDNSP +     +  V E   + G +  +   D D     N  +   I D       +N  F I   S  +        + +   TF++ A DGG   R ++  VTI + D ND+ P      S  S   +  +     V+  V+  DDD G+N++
Sbjct:  452 LLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLG------------FDAPPEFNLDQRTG------ILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGE--NSAVTLSILD-------VNDQFTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFEWVLPSTNPGTVVFKVVAIDDDIGMNAE 710          

HSP 10 Score: 50.0618 bits (118), Expect = 3.265e-10
Identity = 27/86 (31.40%), Postives = 47/86 (54.65%), Query Frame = 3
Query: 1656 QMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF-KQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYY 1910
            Q E+DRE KD Y + +  +D G P  + T  + + + D ND  P+F +++    I E    A I + + ++ A D D+GEN  +++
Sbjct:  204 QKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPEN---APIGSSVTQLHATDADIGENARIHF 286          

HSP 11 Score: 35.8094 bits (81), Expect = 3.265e-10
Identity = 29/91 (31.87%), Postives = 44/91 (48.35%), Query Frame = 1
Query: 1354 FDRESLSFYSVL-IRCIDLGRPPLVGEKLFTVTII-----DENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNN 1608
             DRE L    VL  RC       ++ +++F +  I     D NDNAP F +  I  ++ EN+ I +      A DPD   NG  +YQ++ +
Sbjct:   91 IDREKLCAGIVLDARCFYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKS 181          

HSP 12 Score: 58.9214 bits (141), Expect = 4.237e-8
Identity = 60/239 (25.10%), Postives = 108/239 (45.19%), Query Frame = 3
Query:  279 FILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQVLE----VMVYINDENDNIPQFSMRH------KTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRM--NQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQ--QGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGP-LVELQAFDRDDSSTPNGQIKYKISDNSPKK 950
            F L + +G++  +  +DRE    H     K+++++ +G        V+V + D NDN+P   +R+       T+ + EN+ + ++++L T  D DSE N  +  F        +R +  NQF                    L+    +D E    + + L+A D+GK     S  + + + D NDN+P +    IS +V E +  G  L ++ A D D  S  N +I Y +  ++P +
Sbjct:  300 FHLNTTTGLITVKEPLDREESPSH-----KLLVLATDGGSTPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVPFRLRPVFSNQF-------------------LLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDAD--SGQNAEISYMLGFDAPPE 512          
BLAST of Protocadherin-1 vs. UniProt/SwissProt
Match: sp|Q08174|PCDH1_HUMAN (Protocadherin-1 OS=Homo sapiens OX=9606 GN=PCDH1 PE=1 SV=2)

HSP 1 Score: 96.2857 bits (238), Expect = 9.405e-46
Identity = 92/350 (26.29%), Postives = 161/350 (46.00%), Query Frame = 3
Query:  276 YFILQSHSG-ILKQRNNIDRETM--CKH---ADVCQKIILISI-----NG--QVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQG-PLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENS--TAVTIEIEDCNDHAPNIAIYK--------STASIRENDRTPLVLTSVMVNDDDKGINSQFNC 1247
            Y  +   +G I     +IDRE +  C++    D C     +SI     NG  ++LE  + + D NDN P F+    TL+I EN++IGS   +P A D D+ PN +  Y ++             +A   F + +      K P L ++  +DRE  D ++L +  +D G   +  S  + V+++D NDN+P++   +    + E    G  +++++A D D  +  N +I+Y         E++ RL  +  ++  ++ QG    +  + + F + A D G    S    V + ++D ND+AP I I            A+I E+      +  V V+D D+G N+   C
Sbjct:   98 YLRVDGKTGDIFTTETSIDREGLRECQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQ----------AGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGA--NAEIEYTFHQ---APEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTC 432          

HSP 2 Score: 78.9518 bits (193), Expect = 9.405e-46
Identity = 82/264 (31.06%), Postives = 124/264 (46.97%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFK-QQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQL----QNDGRLILTKNL-REREGIRLPDRLIIRASDNGTPPKAELVTVNI 2438
            +DRE ++ Y L ++A D G PSL  T TV + +LD ND  P F    Y + + E   +  +  + G VT  D D GEN  V  ++ Q       QN  G  L  ++           DREQ  +   ++ A D G P  SA   V ++VLD NDN P    P N  + + ++  +++G+ ++   AED D G N  + YSI          PY L     + G + L K + R   G+    RL+++ SD G PP+     V++
Sbjct:  570 LDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVME--NMPALSPV-GMVTVIDGDKGENAQVQLSVEQDNGDFVIQNGTGTILSSLS----------FDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKL-LTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGN------PYGLFQIGSHSGAITLEKEIERRHHGLH---RLVVKVSDRGKPPRYGTALVHL 810          

HSP 3 Score: 53.5286 bits (127), Expect = 9.405e-46
Identity = 36/109 (33.03%), Postives = 48/109 (44.04%), Query Frame = 1
Query: 1348 TFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI-LNNDENYYFTITI-LGKIEAKWKL 1668
            T  D E +  Y++ I  +D G PPL       V ++D NDNAP F          ENN  G  I  + A D DS  N  + Y +         FTI+   G+I+ K  L
Sbjct:  462 TPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSL 570          

HSP 4 Score: 61.2326 bits (147), Expect = 2.042e-21
Identity = 31/80 (38.75%), Postives = 40/80 (50.00%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSY 1593
             DRE    Y + I+  D G PP     L  VT++D NDNAPKF        L+EN+ IG  +  V+A D D   N  + Y
Sbjct:  238 LDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEY 317          

HSP 5 Score: 56.6102 bits (135), Expect = 2.042e-21
Identity = 58/209 (27.75%), Postives = 96/209 (45.93%), Query Frame = 3
Query: 1656 QMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTA------DDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSI 2264
            Q  +DRE       +++AKD G    +    V + + D+ND  P  + +    +T  +G+A I   + + TA       D+D GEN  V   +        RQ +   +  K            +D E++     EI+A D+G P LS+  ++ V V+DVNDN P F   + ++ F     +++ G+V+A   A D D G N  + YS+
Sbjct:  342 QGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTT--PLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAF---PENNKPGEVIAEITASDADSGSNAELVYSL 545          

HSP 6 Score: 28.8758 bits (63), Expect = 2.042e-21
Identity = 17/52 (32.69%), Postives = 26/52 (50.00%), Query Frame = 3
Query: 1098 IEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDL 1253
            IE++D ND+ PN A    T +I EN     +    + +D D G N   + +L
Sbjct:  156 IEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYEL 207          

HSP 7 Score: 58.5362 bits (140), Expect = 4.370e-17
Identity = 73/332 (21.99%), Postives = 136/332 (40.96%), Query Frame = 3
Query:  285 LQSHSGILKQRNNIDRETMCK-HADVCQKIILISINGQVLEVMVYINDENDNIPQFSMRHKTLSIQENS------DIGSE--LSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCT--ITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLV-ELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGR--ENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQ 1238
            L  ++G++  +  +DRE +      V  K    +      +V+V + D NDN P   +R   L   ++       D+  E  ++L    D D   N+ +   +       +R+ ++  +      F++T              +D E++  + + ++A DSG    S T  + V ++DVNDN+P +          E ++ G ++ E+ A D D  S  N ++ Y +      K     LF I+  +  +  +     + +      + A D G    + +  V + + DCND+ P   +     S+ EN      +  V V D DKG N+Q
Sbjct:  332 LDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTT-----------PLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGS--NAELVYSLEPEPAAK----GLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQ 646          

HSP 8 Score: 49.6766 bits (117), Expect = 4.370e-17
Identity = 32/95 (33.68%), Postives = 44/95 (46.32%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAP--KFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
            FDRE  S Y+  ++ +D G PP       T+ ++DENDNAP     S+     LT    +G  +  V A D DS  N  + Y I   +    F I
Sbjct:  673 FDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKLLTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPYGLFQI 767          

HSP 9 Score: 23.483 bits (49), Expect = 4.370e-17
Identity = 10/36 (27.78%), Postives = 17/36 (47.22%), Query Frame = 3
Query: 1656 QMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRI 1763
            + EI+R     + L +   D G+P    T  VH+ +
Sbjct:  777 EKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYV 812          

HSP 10 Score: 60.8474 bits (146), Expect = 5.259e-13
Identity = 65/223 (29.15%), Postives = 108/223 (48.43%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQ-QYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFI-------NISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQ 2309
            +DRE  D Y LTI  +D G P    +  + + +LD ND  P F++  Y  +++E + +   H+++ +V A+D D G N  + Y   Q  +   R       L      G++ + G VDRE + +++  ++A D G    SA A V+V V D+NDN P  +  I  +  +       NIS D      +A  +  D D+GEN  +T  +        ++P+QL+
Sbjct:  238 LDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIG--HSVI-QVKANDSDQGANAEIEYTFHQAPEVVRR------LLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIE--IRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAG------DVPFQLR 443          

HSP 11 Score: 37.3502 bits (85), Expect = 5.259e-13
Identity = 26/82 (31.71%), Postives = 37/82 (45.12%), Query Frame = 1
Query: 1369 LSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDE 1614
            L F   +   +  G P L+  +   + + D NDN P F S  I   + EN NIG+      A D D+  NG  SY++    E
Sbjct:  134 LEFEVSITDLVQNGSPRLLEGQ---IEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPE 212          

HSP 12 Score: 72.4034 bits (176), Expect = 2.463e-11
Identity = 75/284 (26.41%), Postives = 127/284 (44.72%), Query Frame = 3
Query:  411 VYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQ--QGSCTITVSIIDVNDNSPQWPTVNISKTVKE-CDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTAS--IRENDRTPLVLTSVMVNDDDKGINSQF 1241
            V + D NDN P F+     ++  EN+  G  ++  TA D DS  N+ + Y ++           +  A   FTI  +T        +++   +DRE+ + +EL ++A D G    QG+ T+ V+++D NDN P++     + +V E      P+  +   D D     N Q++  +       E  N  F I   +  + S      + ++  TF + AVDGG   R     VTI + D ND+AP I    +T+   +    R    ++ V   D D G+N++ 
Sbjct:  494 VQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEP----------EPAAKGLFTISPETGE------IQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGE--NAQVQLSV-------EQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKLLTPQTRLGETVSQVAAEDFDSGVNAEL 752          

HSP 13 Score: 54.299 bits (129), Expect = 1.256e-10
Identity = 33/104 (31.73%), Postives = 48/104 (46.15%), Query Frame = 1
Query: 1348 TFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYF---TITILGKI 1650
            T  DRE    Y + +   D G P L G     V ++D NDN PKF      F++ EN    +P+G V   D D  EN +V   +  ++ ++     T TIL  +
Sbjct:  568 TSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQDNGDFVIQNGTGTILSSL 671          

HSP 14 Score: 35.8094 bits (81), Expect = 1.256e-10
Identity = 28/92 (30.43%), Postives = 39/92 (42.39%), Query Frame = 3
Query: 1653 SQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILG----KVTADDKDLGENGTVYYAI 1916
            S +  DRE +  Y+  + A D G P  +    V I +LD ND  P             + L T    LG    +V A+D D G N  + Y+I
Sbjct:  669 SSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPS----NTSHKLLTPQTRLGETVSQVAAEDFDSGVNAELIYSI 756          

HSP 15 Score: 68.9366 bits (167), Expect = 2.694e-10
Identity = 88/300 (29.33%), Postives = 142/300 (47.33%), Query Frame = 3
Query: 1635 YFRENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYF-YQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFI---NISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYIPNNLTPRNNALPPGINKKSNDKNRF 2522
            YF +  + ++ ++ +KD Y++ I+A D+G P L+ T ++ ++++DVND  PVF Q        E N       ++ ++TA D D G N  + Y++         +             G + +   +DREQ  S + +++A D G P L   A V+V+VLD NDN PKF   ++  NF    N+   S VG V       D DKGEN  +  S+      + N  + +QN    IL+    +RE  +      ++A D G PP++  V V I  +  N    +NA  P I   SN  ++ 
Sbjct:  456 YFLQTTTPLDYEK-VKD-YTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGE---VIAEITASDADSGSNAELVYSLEP-------EPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFM--LSGYNFSVMENMPALSPVGMVTVI----DGDKGENAQVQLSV-----EQDNGDFVIQNGTGTILSSLSFDRE-QQSTYTFQLKAVDGGVPPRSAYVGVTINVLDEN----DNA--PYITAPSNTSHKL 725          
BLAST of Protocadherin-1 vs. UniProt/SwissProt
Match: sp|Q9BZA7|PC11X_HUMAN (Protocadherin-11 X-linked OS=Homo sapiens OX=9606 GN=PCDH11X PE=2 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 6.087e-43
Identity = 110/441 (24.94%), Postives = 186/441 (42.18%), Query Frame = 3
Query:   78 LSISIIFGILIEMLIC------KTFYIKLKISENKGSGEDLINLKNYIIIHKLPINSSGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMC---KHADVCQKIILISING----QVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCT--ITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLV-ELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAPNIAI------YKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYFTMVKECLQSIKWTAALYVQYQ 1334
            LS + IF +L+  ++       K + I+ ++ EN   G DL+   N  +I    + ++  + ++    D+    I +    I      IDRE +C      + C   + ++I      +++++   I D NDN P F      +SI ENS I S+ +LP A D D   N +  Y +  I S++I  ++           I+T    K+P L + KE+DREE D + + +  ED G  Q S T  + VS+ D NDN P +    I  ++ E    G  V +L A D D     N +I +  S+      +  RLF++  ++  ++ +     +        + A DGG       V + + D ND+ P+I I         T  + EN      +  + V D D   N +  C  +    F +            A Y+ Y+
Sbjct:    4 LSGTYIFAVLLACVVFHSGAQEKNYTIREEMPENVLIG-DLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYEL--IKSQNIFGLD----------VIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGE--NAKIHFSFSNLV--SNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLETAAYLDYE 427          

HSP 2 Score: 71.633 bits (174), Expect = 6.087e-43
Identity = 78/257 (30.35%), Postives = 121/257 (47.08%), Query Frame = 3
Query: 1662 EIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQ-QYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVV------DREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLRERE-GIRLPDRLIIRASDNGTP 2408
            ++DRE +D+Y  TI+AKDNG P L    TV + I+D ND  PVF   +Y + + E       H  +G +T  D D G+N  V  +I  + D                   I +  GV+      DRE+  S    + A D G+   S+ A V ++V+DVNDNKP F  P +  ++  +   +  G V+    A D D G N  + YSI+      ++L    Q  G + L +     + G+    R++++A+D G P
Sbjct:  527 KLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPEN---LPRHGTVGLITVTDPDYGDNSAVTLSILDEND----------------DFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGN--TRDLFAIDQETGNITLMEKCDVTDLGLH---RVLVKANDLGQP 759          

HSP 3 Score: 59.3066 bits (142), Expect = 6.087e-43
Identity = 31/95 (32.63%), Postives = 50/95 (52.63%), Query Frame = 1
Query: 1348 TFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
             + D ES   Y++ +   D G+PPL    +  + + DENDNAP F    +  ++ ENN+ G  +  V A D DS  N +++Y +L  D    F++
Sbjct:  422 AYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINY-LLGPDAPPEFSL 515          

HSP 4 Score: 63.1586 bits (152), Expect = 3.177e-25
Identity = 74/293 (25.26%), Postives = 122/293 (41.64%), Query Frame = 3
Query:  405 VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVE----------LQAFDRDDSSTPNGQIKYKISDNSP--KKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVT-IEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFN 1244
            + V + D NDN P F      +SI EN+ +G+ ++   A D D   N+ I +   ++ S   RR+    A+    I IK             + +DREE    +L+++A D G       + V++ DVNDN    P+++I   V   +    L E          +   D+D     NG++        P   + + +  F +  ++             K Y    + A  G    N +A+  I+++D ND+AP       T SI EN+   + LT V   D D G N++ N
Sbjct:  235 LQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGL-ITIK-------------EPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDN---VPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADH--NGRVTCFTDHEIPFRLRPVFSNQFLLETAAYLDYEST------KEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKIN 502          

HSP 5 Score: 53.9138 bits (128), Expect = 3.177e-25
Identity = 36/93 (38.71%), Postives = 46/93 (49.46%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
             DRE    Y   I   D G PPL       V+IID+NDN+P F  ++  F + EN      +G +   DPD  +N  V+  IL  DEN  FTI
Sbjct:  528 LDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSIL--DENDDFTI 618          

HSP 6 Score: 42.3578 bits (98), Expect = 3.177e-25
Identity = 28/92 (30.43%), Postives = 45/92 (48.91%), Query Frame = 3
Query: 1650 RSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF---KQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAI 1916
            R  +  DRE ++ Y+  + A+D G  S + +  V I ++DVND  PVF        Y++   +       ++ +V A D D G N  V Y+I
Sbjct:  626 RPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPS--TNPGTVVFQVIAVDNDTGMNAEVRYSI 715          

HSP 7 Score: 81.6481 bits (200), Expect = 4.038e-14
Identity = 81/290 (27.93%), Postives = 131/290 (45.17%), Query Frame = 3
Query:  393 QVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKE-CDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTAS---IRENDRTPLVLTSVMVNDDDKGINSQ 1238
            Q   + + + DENDN P F+    T+SI EN+  G +L+  +A D DS PN+ I Y +               A   F++  +T        L ++K++DRE+ D++   ++A+D+G      + T+ VSIID NDNSP +     +  V E   R G +  +   D D     N  +   I D        N  F I   +  +        + +   TF++ A DGG   R +S  VTI + D ND+ P   +  S  S   +  +     V+  V+  D+D G+N++
Sbjct:  448 QSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGP------------DAPPEFSLDCRTG------MLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGD--NSAVTLSILDE-------NDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAE 710          

HSP 8 Score: 65.855 bits (159), Expect = 4.551e-14
Identity = 66/223 (29.60%), Postives = 101/223 (45.29%), Query Frame = 3
Query: 1608 RRKLLFYNHYFRENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFI---NISTDSQVGKVLANFEAEDPDKGENGTITYSII 2267
            R + +F N +  E  + +  D E   +Y++ ++A D G+P LN +  + I++ D ND  PVF Q +       N    I   L KV+A D D G N  + Y +                       G+L +   +DRE+       I+A DNG P L++   V V ++D NDN P F +  N+ NF    N+     VG +       DPD G+N  +T SI+
Sbjct:  407 RLRPVFSNQFLLETAAYL--DYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQ--LTKVSAMDADSGPNAKINYLLGPD---------APPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTH--NEYNFYVPENLPRHGTVGLITVT----DPDYGDNSAVTLSIL 610          

HSP 9 Score: 36.1946 bits (82), Expect = 4.551e-14
Identity = 26/88 (29.55%), Postives = 38/88 (43.18%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRF---------TLTENNNIGAPIGYVRAYDPDSNENGRVS 1590
             DRE    + +L+   D G  P     +  V + D NDN P     DIR+          L+EN  +   I  +   D D++ NGRV+
Sbjct:  315 LDREETPNHKLLVLASDGGLMP--ARAMVLVNVTDVNDNVPSI---DIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVT 397          

HSP 10 Score: 51.9878 bits (123), Expect = 3.218e-9
Identity = 27/86 (31.40%), Postives = 45/86 (52.33%), Query Frame = 3
Query: 1656 QMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYA 1913
            Q E+DRE KD Y + +  +D G P  + T  + + + D ND  PVFK+         N  A +   + ++ A D D+GEN  ++++
Sbjct:  204 QKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPEN--APVGTSVTQLHATDADIGENAKIHFS 287          

HSP 11 Score: 33.113 bits (74), Expect = 3.218e-9
Identity = 19/53 (35.85%), Postives = 29/53 (54.72%), Query Frame = 1
Query: 1450 IIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNN 1608
            I D NDNAP F +  I  ++ EN+ I +      A DPD   NG  +Y+++ +
Sbjct:  129 IEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKS 181          
BLAST of Protocadherin-1 vs. UniProt/SwissProt
Match: sp|Q71M42|PC11X_PANTR (Protocadherin-11 X-linked OS=Pan troglodytes OX=9598 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 7.056e-43
Identity = 110/441 (24.94%), Postives = 186/441 (42.18%), Query Frame = 3
Query:   78 LSISIIFGILIEMLIC------KTFYIKLKISENKGSGEDLINLKNYIIIHKLPINSSGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMC---KHADVCQKIILISING----QVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCT--ITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLV-ELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAPNIAI------YKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYFTMVKECLQSIKWTAALYVQYQ 1334
            LS + IF +L+  ++       K + I+ ++ EN   G DL+   N  +I    + ++  + ++    D+    I +    I      IDRE +C      + C   + ++I      +++++   I D NDN P F      +SI ENS I S+ +LP A D D   N +  Y +  I S++I  ++           I+T    K+P L + KE+DREE D + + +  ED G  Q S T  + VS+ D NDN P +    I  ++ E    G  V +L A D D     N +I +  S+      +  RLF++  ++  ++ +     +        + A DGG       V + + D ND+ P+I I         T  + EN      +  + V D D   N +  C  +    F +            A Y+ Y+
Sbjct:    4 LSGTYIFAVLLACVVFHSGAQEKNYTIREEMPENVLIG-DLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGTNGVQNYEL--IKSQNIFGLD----------VIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGE--NAKIHFSFSNLV--SNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLETAAYLDYE 427          

HSP 2 Score: 72.0182 bits (175), Expect = 7.056e-43
Identity = 78/257 (30.35%), Postives = 121/257 (47.08%), Query Frame = 3
Query: 1662 EIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQ-QYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVV------DREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLRERE-GIRLPDRLIIRASDNGTP 2408
            ++DRE +D+Y  TI+AKDNG P L    TV + I+D ND  PVF   +Y + + E       H  +G +T  D D G+N  V  +I  + D                   I +  GV+      DRE+  S    + A D G+   S+ A V ++V+DVNDNKP F  P +  ++  +   +  G V+    A D D G N  + YSI+      ++L    Q  G + L +     + G+    R++++A+D G P
Sbjct:  527 KLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPEN---LPRHGTVGLITVTDPDYGDNSAVTLSILDEND----------------DFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTNPGTVVFQVMAVDNDTGMNAEVRYSIVGGN--TRDLFAIDQETGNITLMEKCDVTDLGLH---RVLVKANDLGQP 759          

HSP 3 Score: 57.7658 bits (138), Expect = 7.056e-43
Identity = 31/95 (32.63%), Postives = 49/95 (51.58%), Query Frame = 1
Query: 1348 TFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
             + D ES   Y++ +   D G+PPL    +  + + DENDNAP F    +  ++ ENN+ G  +  V A D DS  N  ++Y +L  D    F++
Sbjct:  422 AYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINY-LLGPDAPPEFSL 515          

HSP 4 Score: 63.929 bits (154), Expect = 1.187e-26
Identity = 74/293 (25.26%), Postives = 122/293 (41.64%), Query Frame = 3
Query:  405 VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVE----------LQAFDRDDSSTPNGQIKYKISDNSP--KKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVT-IEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFN 1244
            + V + D NDN P F      +SI EN+ +G+ ++   A D D   N+ I +   ++ S   RR+    A+    I IK             + +DREE    +L+++A D G       + V++ DVNDN    P+++I   V   +    L E          +   D+D     NG++        P   + + +  F +  ++             K Y    + A  G    N +A+  I+++D ND+AP       T SI EN+   + LT V   D D G N++ N
Sbjct:  235 LQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGL-ITIK-------------EPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDN---VPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADH--NGRVTCFTDHEIPFRLRPVFSNQFLLETAAYLDYEST------KEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEIN 502          

HSP 5 Score: 53.9138 bits (128), Expect = 1.187e-26
Identity = 36/93 (38.71%), Postives = 46/93 (49.46%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
             DRE    Y   I   D G PPL       V+IID+NDN+P F  ++  F + EN      +G +   DPD  +N  V+  IL  DEN  FTI
Sbjct:  528 LDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSIL--DENDDFTI 618          

HSP 6 Score: 46.2098 bits (108), Expect = 1.187e-26
Identity = 29/92 (31.52%), Postives = 46/92 (50.00%), Query Frame = 3
Query: 1650 RSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF---KQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAI 1916
            R  +  DRE ++ Y+  + A+D G  S + +  V I ++DVND  PVF      Y Y++   +       ++ +V A D D G N  V Y+I
Sbjct:  626 RPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPS--TNPGTVVFQVMAVDNDTGMNAEVRYSI 715          

HSP 7 Score: 82.4185 bits (202), Expect = 1.949e-14
Identity = 82/290 (28.28%), Postives = 131/290 (45.17%), Query Frame = 3
Query:  393 QVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKE-CDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTAS---IRENDRTPLVLTSVMVNDDDKGINSQ 1238
            Q   + + + DENDN P F+    T+SI EN+  G +L+  +A D DS PN+ I Y +               A   F++  +T        L ++K++DRE+ D++   ++A+D+G      + T+ VSIID NDNSP +     +  V E   R G +  +   D D     N  +   I D        N  F I   +  +        + +   TF++ A DGG   R +S  VTI + D ND+ P   +  S  S   +  +     V+  VM  D+D G+N++
Sbjct:  448 QSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGP------------DAPPEFSLDRRTG------MLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGD--NSAVTLSILDE-------NDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTNPGTVVFQVMAVDNDTGMNAE 710          

HSP 8 Score: 67.0106 bits (162), Expect = 2.111e-14
Identity = 65/227 (28.63%), Postives = 102/227 (44.93%), Query Frame = 3
Query: 1608 RRKLLFYNHYFRENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAI----RQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFI---NISTDSQVGKVLANFEAEDPDKGENGTITYSII 2267
            R + +F N +  E  + +  D E   +Y++ ++A D G+P LN +  + I++ D ND  PVF Q +       N    I   L KV+A D D G N  + Y +      ++    R   + +                +DRE+       I+A DNG P L++   V V ++D NDN P F +  N+ NF    N+     VG +       DPD G+N  +T SI+
Sbjct:  407 RLRPVFSNQFLLETAAYL--DYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQ--LTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKK-------------LDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTH--NEYNFYVPENLPRHGTVGLITVT----DPDYGDNSAVTLSIL 610          

HSP 9 Score: 36.1946 bits (82), Expect = 2.111e-14
Identity = 26/88 (29.55%), Postives = 38/88 (43.18%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRF---------TLTENNNIGAPIGYVRAYDPDSNENGRVS 1590
             DRE    + +L+   D G  P     +  V + D NDN P     DIR+          L+EN  +   I  +   D D++ NGRV+
Sbjct:  315 LDREETPNHKLLVLASDGGLMP--ARAMVLVNVTDVNDNVPSI---DIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVT 397          

HSP 10 Score: 51.9878 bits (123), Expect = 1.513e-9
Identity = 27/86 (31.40%), Postives = 45/86 (52.33%), Query Frame = 3
Query: 1656 QMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYA 1913
            Q E+DRE KD Y + +  +D G P  + T  + + + D ND  PVFK+         N  A +   + ++ A D D+GEN  ++++
Sbjct:  204 QKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPEN--APVGTSVTQLHATDADIGENAKIHFS 287          

HSP 11 Score: 34.2686 bits (77), Expect = 1.513e-9
Identity = 19/53 (35.85%), Postives = 29/53 (54.72%), Query Frame = 1
Query: 1450 IIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNN 1608
            I D NDNAP F +  I  ++ EN+ I +      A DPD   NG  +Y+++ +
Sbjct:  129 IEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGTNGVQNYELIKS 181          
BLAST of Protocadherin-1 vs. UniProt/SwissProt
Match: sp|Q6WYY1|PC11X_PANPA (Protocadherin-11 X-linked OS=Pan paniscus OX=9597 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 7.659e-43
Identity = 110/441 (24.94%), Postives = 186/441 (42.18%), Query Frame = 3
Query:   78 LSISIIFGILIEMLIC------KTFYIKLKISENKGSGEDLINLKNYIIIHKLPINSSGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMC---KHADVCQKIILISING----QVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCT--ITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLV-ELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAPNIAI------YKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYFTMVKECLQSIKWTAALYVQYQ 1334
            LS + IF +L+  ++       K + I+ ++ EN   G DL+   N  +I    + ++  + ++    D+    I +    I      IDRE +C      + C   + ++I      +++++   I D NDN P F      +SI ENS I S+ +LP A D D   N +  Y +  I S++I  ++           I+T    K+P L + KE+DREE D + + +  ED G  Q S T  + VS+ D NDN P +    I  ++ E    G  V +L A D D     N +I +  S+      +  RLF++  ++  ++ +     +        + A DGG       V + + D ND+ P+I I         T  + EN      +  + V D D   N +  C  +    F +            A Y+ Y+
Sbjct:    4 LSGTYIFAVLLACVVFHSGAQEKNYTIREEMPENVLIG-DLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGTNGVQNYEL--IKSQNIFGLD----------VIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGE--NAKIHFSFSNLV--SNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLETAAYLDYE 427          

HSP 2 Score: 72.0182 bits (175), Expect = 7.659e-43
Identity = 78/257 (30.35%), Postives = 121/257 (47.08%), Query Frame = 3
Query: 1662 EIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQ-QYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVV------DREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLRERE-GIRLPDRLIIRASDNGTP 2408
            ++DRE +D+Y  TI+AKDNG P L    TV + I+D ND  PVF   +Y + + E       H  +G +T  D D G+N  V  +I  + D                   I +  GV+      DRE+  S    + A D G+   S+ A V ++V+DVNDNKP F  P +  ++  +   +  G V+    A D D G N  + YSI+      ++L    Q  G + L +     + G+    R++++A+D G P
Sbjct:  527 KLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPEN---LPRHGTVGLITVTDPDYGDNSAVTLSILDEND----------------DFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTNPGTVVFQVMAVDNDTGMNAEVRYSIVGGN--TRDLFAIDQETGNITLMEKCDVTDLGLH---RVLVKANDLGQP 759          

HSP 3 Score: 57.7658 bits (138), Expect = 7.659e-43
Identity = 31/95 (32.63%), Postives = 49/95 (51.58%), Query Frame = 1
Query: 1348 TFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
             + D ES   Y++ +   D G+PPL    +  + + DENDNAP F    +  ++ ENN+ G  +  V A D DS  N  ++Y +L  D    F++
Sbjct:  422 AYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINY-LLGPDAPPEFSL 515          

HSP 4 Score: 63.929 bits (154), Expect = 1.246e-26
Identity = 74/293 (25.26%), Postives = 122/293 (41.64%), Query Frame = 3
Query:  405 VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVE----------LQAFDRDDSSTPNGQIKYKISDNSP--KKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVT-IEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFN 1244
            + V + D NDN P F      +SI EN+ +G+ ++   A D D   N+ I +   ++ S   RR+    A+    I IK             + +DREE    +L+++A D G       + V++ DVNDN    P+++I   V   +    L E          +   D+D     NG++        P   + + +  F +  ++             K Y    + A  G    N +A+  I+++D ND+AP       T SI EN+   + LT V   D D G N++ N
Sbjct:  235 LQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGL-ITIK-------------EPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDN---VPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADH--NGRVTCFTDHEIPFRLRPVFSNQFLLETAAYLDYEST------KEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEIN 502          

HSP 5 Score: 53.9138 bits (128), Expect = 1.246e-26
Identity = 36/93 (38.71%), Postives = 46/93 (49.46%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
             DRE    Y   I   D G PPL       V+IID+NDN+P F  ++  F + EN      +G +   DPD  +N  V+  IL  DEN  FTI
Sbjct:  528 LDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSIL--DENDDFTI 618          

HSP 6 Score: 46.2098 bits (108), Expect = 1.246e-26
Identity = 29/92 (31.52%), Postives = 46/92 (50.00%), Query Frame = 3
Query: 1650 RSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF---KQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAI 1916
            R  +  DRE ++ Y+  + A+D G  S + +  V I ++DVND  PVF      Y Y++   +       ++ +V A D D G N  V Y+I
Sbjct:  626 RPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPS--TNPGTVVFQVMAVDNDTGMNAEVRYSI 715          

HSP 7 Score: 82.4185 bits (202), Expect = 2.051e-14
Identity = 82/290 (28.28%), Postives = 131/290 (45.17%), Query Frame = 3
Query:  393 QVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKE-CDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTAS---IRENDRTPLVLTSVMVNDDDKGINSQ 1238
            Q   + + + DENDN P F+    T+SI EN+  G +L+  +A D DS PN+ I Y +               A   F++  +T        L ++K++DRE+ D++   ++A+D+G      + T+ VSIID NDNSP +     +  V E   R G +  +   D D     N  +   I D        N  F I   +  +        + +   TF++ A DGG   R +S  VTI + D ND+ P   +  S  S   +  +     V+  VM  D+D G+N++
Sbjct:  448 QSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGP------------DAPPEFSLDRRTG------MLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGD--NSAVTLSILDE-------NDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTNPGTVVFQVMAVDNDTGMNAE 710          

HSP 8 Score: 67.0106 bits (162), Expect = 2.094e-14
Identity = 65/227 (28.63%), Postives = 102/227 (44.93%), Query Frame = 3
Query: 1608 RRKLLFYNHYFRENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAI----RQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFI---NISTDSQVGKVLANFEAEDPDKGENGTITYSII 2267
            R + +F N +  E  + +  D E   +Y++ ++A D G+P LN +  + I++ D ND  PVF Q +       N    I   L KV+A D D G N  + Y +      ++    R   + +                +DRE+       I+A DNG P L++   V V ++D NDN P F +  N+ NF    N+     VG +       DPD G+N  +T SI+
Sbjct:  407 RLRPVFSNQFLLETAAYL--DYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQ--LTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKK-------------LDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTH--NEYNFYVPENLPRHGTVGLITVT----DPDYGDNSAVTLSIL 610          

HSP 9 Score: 36.1946 bits (82), Expect = 2.094e-14
Identity = 26/88 (29.55%), Postives = 38/88 (43.18%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRF---------TLTENNNIGAPIGYVRAYDPDSNENGRVS 1590
             DRE    + +L+   D G  P     +  V + D NDN P     DIR+          L+EN  +   I  +   D D++ NGRV+
Sbjct:  315 LDREETPNHKLLVLASDGGLMP--ARAMVLVNVTDVNDNVPSI---DIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVT 397          

HSP 10 Score: 51.9878 bits (123), Expect = 1.563e-9
Identity = 27/86 (31.40%), Postives = 45/86 (52.33%), Query Frame = 3
Query: 1656 QMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYA 1913
            Q E+DRE KD Y + +  +D G P  + T  + + + D ND  PVFK+         N  A +   + ++ A D D+GEN  ++++
Sbjct:  204 QKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPEN--APVGTSVTQLHATDADIGENAKIHFS 287          

HSP 11 Score: 34.2686 bits (77), Expect = 1.563e-9
Identity = 19/53 (35.85%), Postives = 29/53 (54.72%), Query Frame = 1
Query: 1450 IIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNN 1608
            I D NDNAP F +  I  ++ EN+ I +      A DPD   NG  +Y+++ +
Sbjct:  129 IEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGTNGVQNYELIKS 181          
BLAST of Protocadherin-1 vs. UniProt/SwissProt
Match: sp|Q6WXV7|PC11X_PONPY (Protocadherin-11 X-linked OS=Pongo pygmaeus OX=9600 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 2.710e-42
Identity = 110/441 (24.94%), Postives = 186/441 (42.18%), Query Frame = 3
Query:   78 LSISIIFGILIEMLIC------KTFYIKLKISENKGSGEDLINLKNYIIIHKLPINSSGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMC---KHADVCQKIILISING----QVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCT--ITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLV-ELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAPNIAIY------KSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYFTMVKECLQSIKWTAALYVQYQ 1334
            LS + IF +L+  ++       K + I+ ++ EN   G DL+   N  +I    + ++  + ++    D+    I +    I      IDRE +C      + C   + ++I      +++++   I D NDN P F      +SI ENS I S+ +LP A D D   N +  Y +  I S++I  ++           I+T    K+P L + KE+DREE D + + +  ED G  Q S T  + VS+ D NDN P +    I  ++ E    G  V +L A D D     N +I +  S+      +  RLF++  ++  ++ +     +        + A DGG       V + + D ND+ P+I I         T  + EN      +  + V D D   N +  C  +    F +            A Y+ Y+
Sbjct:    4 LSGTYIFAVLLACVVFHSGAQEKNYTIREEMPENVLIG-DLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLTRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYEL--IKSQNIFGLD----------VIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGE--NAKIHFSFSNLV--SNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPINDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLETAAYLDYE 427          

HSP 2 Score: 71.2478 bits (173), Expect = 2.710e-42
Identity = 78/257 (30.35%), Postives = 121/257 (47.08%), Query Frame = 3
Query: 1662 EIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQ-QYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVV------DREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLRERE-GIRLPDRLIIRASDNGTP 2408
            ++DRE +D+Y  TI+AKDNG P L    TV + I+D ND  PVF   +Y + + E       H  +G +T  D D G+N  V  +I  + D                   I +  GV+      DRE+  S    + A D G+   S+ A V ++V+DVNDNKP F  P +  ++  +   +  G V+    A D D G N  + YSI+      ++L    Q  G + L +     + G+    R++++A+D G P
Sbjct:  527 KLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPEN---LPRHGTVGLITVTDPDYGDNSAVTLSILDEND----------------DFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGN--TRDLFAIDQETGNITLMEKCDVTDLGLH---RVLVKANDLGQP 759          

HSP 3 Score: 57.7658 bits (138), Expect = 2.710e-42
Identity = 31/95 (32.63%), Postives = 49/95 (51.58%), Query Frame = 1
Query: 1348 TFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
             + D ES   Y++ +   D G+PPL    +  + + DENDNAP F    +  ++ ENN+ G  +  V A D DS  N  ++Y +L  D    F++
Sbjct:  422 AYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINY-LLGPDAPPEFSL 515          

HSP 4 Score: 63.5438 bits (153), Expect = 1.950e-26
Identity = 74/293 (25.26%), Postives = 122/293 (41.64%), Query Frame = 3
Query:  405 VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVE----------LQAFDRDDSSTPNGQIKYKISDNSP--KKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVT-IEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFN 1244
            + V + D NDN P F      +SI EN+ +G+ ++   A D D   N+ I +   ++ S   RR+    A+    I IK             + +DREE    +L+++A D G       + V++ DVNDN    P+++I   V   +    L E          +   D+D     NG++        P   + + +  F +  ++             K Y    + A  G    N +A+  I+++D ND+AP       T SI EN+   + LT V   D D G N++ N
Sbjct:  235 LQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGL-ITIK-------------EPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDN---VPSIDIRYIVNPINDTVVLSENIPLNTKIALITVTDKDADH--NGRVTCFTDHEIPFRLRPVFSNQFLLETAAYLDYEST------KEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEIN 502          

HSP 5 Score: 53.9138 bits (128), Expect = 1.950e-26
Identity = 36/93 (38.71%), Postives = 46/93 (49.46%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
             DRE    Y   I   D G PPL       V+IID+NDN+P F  ++  F + EN      +G +   DPD  +N  V+  IL  DEN  FTI
Sbjct:  528 LDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSIL--DENDDFTI 618          

HSP 6 Score: 45.8246 bits (107), Expect = 1.950e-26
Identity = 29/92 (31.52%), Postives = 46/92 (50.00%), Query Frame = 3
Query: 1650 RSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF---KQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAI 1916
            R  +  DRE ++ Y+  + A+D G  S + +  V I ++DVND  PVF      Y Y++   +       ++ +V A D D G N  V Y+I
Sbjct:  626 RPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPS--TNPGTVVFQVIAVDNDTGMNAEVRYSI 715          

HSP 7 Score: 66.6254 bits (161), Expect = 2.486e-14
Identity = 65/227 (28.63%), Postives = 102/227 (44.93%), Query Frame = 3
Query: 1608 RRKLLFYNHYFRENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAI----RQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFI---NISTDSQVGKVLANFEAEDPDKGENGTITYSII 2267
            R + +F N +  E  + +  D E   +Y++ ++A D G+P LN +  + I++ D ND  PVF Q +       N    I   L KV+A D D G N  + Y +      ++    R   + +                +DRE+       I+A DNG P L++   V V ++D NDN P F +  N+ NF    N+     VG +       DPD G+N  +T SI+
Sbjct:  407 RLRPVFSNQFLLETAAYL--DYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQ--LTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKK-------------LDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTH--NEYNFYVPENLPRHGTVGLITVT----DPDYGDNSAVTLSIL 610          

HSP 8 Score: 35.8094 bits (81), Expect = 2.486e-14
Identity = 26/88 (29.55%), Postives = 38/88 (43.18%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRF---------TLTENNNIGAPIGYVRAYDPDSNENGRVS 1590
             DRE    + +L+   D G  P     +  V + D NDN P     DIR+          L+EN  +   I  +   D D++ NGRV+
Sbjct:  315 LDREETPNHKLLVLASDGGLMP--ARAMVLVNVTDVNDNVPSI---DIRYIVNPINDTVVLSENIPLNTKIALITVTDKDADHNGRVT 397          

HSP 9 Score: 80.4925 bits (197), Expect = 8.436e-14
Identity = 81/290 (27.93%), Postives = 131/290 (45.17%), Query Frame = 3
Query:  393 QVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKE-CDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTAS---IRENDRTPLVLTSVMVNDDDKGINSQ 1238
            Q   + + + DENDN P F+    T+SI EN+  G +L+  +A D DS PN+ I Y +               A   F++  +T        L ++K++DRE+ D++   ++A+D+G      + T+ VSIID NDNSP +     +  V E   R G +  +   D D     N  +   I D        N  F I   +  +        + +   TF++ A DGG   R +S  VTI + D ND+ P   +  S  S   +  +     V+  V+  D+D G+N++
Sbjct:  448 QSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGP------------DAPPEFSLDRRTG------MLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGD--NSAVTLSILDE-------NDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAE 710          

HSP 10 Score: 51.9878 bits (123), Expect = 3.218e-9
Identity = 27/87 (31.03%), Postives = 45/87 (51.72%), Query Frame = 3
Query: 1656 QMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAI 1916
            Q E+DRE KD Y + +  +D G P  + T  + + + D ND  PVFK+         N  A +   + ++ A D D+GEN  ++++ 
Sbjct:  204 QKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPEN--APVGTSVTQLHATDADIGENAKIHFSF 288          

HSP 11 Score: 33.113 bits (74), Expect = 3.218e-9
Identity = 19/53 (35.85%), Postives = 29/53 (54.72%), Query Frame = 1
Query: 1450 IIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNN 1608
            I D NDNAP F +  I  ++ EN+ I +      A DPD   NG  +Y+++ +
Sbjct:  129 IEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKS 181          
BLAST of Protocadherin-1 vs. TrEMBL
Match: A0A267DHT6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017053g3 PE=4 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 1.147e-66
Identity = 126/385 (32.73%), Postives = 189/385 (49.09%), Query Frame = 3
Query:  129 TFYIKLKISENKGSGEDLINLKNYIIIHKLPINSSGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHADV-CQKIILISIN----GQ--VLEVMVYINDENDNIPQFSMRHKT--LSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDS--GKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDR-QGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNC 1247
            TFY K +I      G ++ NLK      +        +N++  +P+I   F L+S +G L     +DRE +C +  + C +   + +     GQ  V+ + + IND ND  P+F  +HK   +SI E+ +  S  SLPTA+D DS+    ++Y +K I            A  YF +F++     ++P L+LIK +DRE  D +EL L+  D    + Q S  I + ++D NDN PQW     S T+ ECDR   PL++L A D D     N +I Y I   + K   + + FYI+G  L  +         K  +   + A D GG    T V + + DCNDH PNI +      I END T  VL  ++V D+D+G N   +C
Sbjct:   28 TFYTKEEIP----IGNEIGNLKT-----RFSYPDGSQFNMLFPDPEIRRLFRLESRTGALSTIARLDREVLCPNKPLECLRTFNVEVKRGGTGQEEVIVIRLIINDVNDQRPKFEAKHKKFRISIPESDNPPSYYSLPTAEDGDSDRYDNVKYDLKMIGD----------AGMYFKLFLEERGSKRVPKLELIKALDRETKDNYELQLLVSDEQHPQDQDSADIQIEVLDANDNKPQWRLAKQSITISECDRLHRPLLKLNATDED----LNERITYSIGKAAGKD--VAKSFYISGDKLKQNQSLDYEKIRKKVLYIPLVAEDRGGSTVETYVELRVTDCNDHYPNITVEMIEDKILENDETEKVLARILVVDEDEGNNGTVDC 387          

HSP 2 Score: 73.559 bits (179), Expect = 1.147e-66
Identity = 77/265 (29.06%), Postives = 117/265 (44.15%), Query Frame = 3
Query: 1653 SQMEIDREIKDQYSLTIMAKDNG-EPSLNDTCTVHIRILDVNDCVPVFK-QQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSI---------ISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPD-RLIIRASDNGTPP 2411
            S +  DRE  D Y  T+   D+G +     T TV + I+D +D VP F+ ++Y ++I E  G       +G+V A D D+G N  ++Y + ++Y  ++  +     +        L   G  DRE+   I  EI A + G  +    A V + + DVNDN P  +         N+S +S  G  +      D D GENGT+TY +         I  KH    L   L+N+         +  +G +    RL I   DNG PP
Sbjct:  527 SAVSFDREQIDHYRFTVTVADSGLKEQRTSTATVEVTIVDEDDSVPTFQFREYMFRIEEDYGRNLSKRYIGEVKATDADIGANQMIWYEVNRQY-QASLADVGISGMYFYFNGSHLYGEGNFDREKQEIINLEIFARNRGPAKHKGSARVTITLNDVNDNAPSIQ---GLQKVYNLSENSPAGTPVLQVSGTDLDAGENGTLTYILDETEANRFTIDGKHGIVTLSGSLKNN---------QPEDGFQSQTYRLGIGVRDNGNPP 778          

HSP 3 Score: 66.2402 bits (160), Expect = 1.147e-66
Identity = 41/113 (36.28%), Postives = 61/113 (53.98%), Query Frame = 1
Query: 1300 SNGRQLFMYNIKKIPDTFFDRESLSFYSVLIR--CIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
            ++G+   +Y +KK+    FDRE+ S   V +   C D G  P VG K   + I+DENDNAP+  S    F + EN+     +G V A D D +EN R+ +  L++D +  F I
Sbjct:  404 TDGQYKTIYKLKKLAHVSFDREATSGGEVRVDIICTDKGDSPRVGRKEVKIMILDENDNAPRIESKLYTFRIHENSPPNTLVGRVTARDDDIDENARLKFS-LHSDGSRNFVI 515          
BLAST of Protocadherin-1 vs. TrEMBL
Match: A0A1I8H4K2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 6.020e-65
Identity = 124/385 (32.21%), Postives = 186/385 (48.31%), Query Frame = 3
Query:  129 TFYIKLKISENKGSGEDLINLKNYIIIHKLPINSSGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHADV-CQKIILISIN----GQ--VLEVMVYINDENDNIPQFSMRHKT--LSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDS--GKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDR-QGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNC 1247
            TFY K +I      G ++ NLK      +        +N++  + +I   F L S +G L     +DRE +C +  + C +   + +     GQ  V+ + + IND ND  P+F  +HK   +SI E+ +  S  SLPTA+D DS+    ++Y +K I            A  YF +F++     ++P L+L K +DRE  D +EL L+  D    + Q S  I + ++D NDN PQW     S T+ ECDR   PL++L A D D     N +I Y I   + K   + + FYI+G  L  +         K  +   + A D GG    T V + + DCNDH PNI +      I END T  VL  ++V D+D+G N   +C
Sbjct:   28 TFYTKEEIP----IGNEIGNLKT-----RFSYPDGSQFNMLFPDSEIRRLFRLDSRTGALSTIARLDREVLCPNKPLECLRTFNVEVKRGGTGQEEVIVIRLIINDVNDQRPKFEAKHKKFRISIPESDNPPSYYSLPTAEDGDSDRYDHVKYDLKMIGD----------AGMYFKLFLEERGSKRVPKLELTKALDRETKDNYELQLLVSDEQHPQDQDSADIQIEVLDANDNKPQWRLAKQSITISECDRLHRPLLKLNATDED----LNERITYSIGKAAGKD--VAKSFYISGDKLKQNQSLDYEKIRKKVLYIPLVAEDRGGSTVETYVELRVTDCNDHYPNITVEMIEDKILENDETEKVLARILVVDEDEGNNGTVDC 387          

HSP 2 Score: 73.559 bits (179), Expect = 6.020e-65
Identity = 77/265 (29.06%), Postives = 117/265 (44.15%), Query Frame = 3
Query: 1653 SQMEIDREIKDQYSLTIMAKDNG-EPSLNDTCTVHIRILDVNDCVPVFK-QQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSI---------ISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPD-RLIIRASDNGTPP 2411
            S +  DRE  D Y  T+   D+G +     T TV + I+D +D VP F+ ++Y ++I E  G       +G+V A D D+G N  ++Y + ++Y  ++  +     +        L   G  DRE+   I  EI A + G  +    A V + + DVNDN P  +         N+S +S  G  +      D D GENGT+TY +         I  KH    L   L+N+         +  +G +    RL I   DNG PP
Sbjct:  527 SAVSFDREQIDHYRFTVTVADSGLKEQRTSTATVEVTIVDEDDSVPTFQFREYMFRIEEDYGRNLSKRYIGEVKATDADIGANQMIWYEVNRQY-QASLADVGISGMYFYFNGSHLYGEGNFDREKQEIINLEIFARNRGPAKHKGSARVTITLNDVNDNAPSIQ---GLQKVYNLSENSPAGTPVLQVSGTDLDAGENGTLTYILDETEANRFTIDGKHGIVTLSGSLKNN---------QPEDGFQSQTYRLGIGVRDNGNPP 778          

HSP 3 Score: 66.6254 bits (161), Expect = 6.020e-65
Identity = 42/113 (37.17%), Postives = 61/113 (53.98%), Query Frame = 1
Query: 1300 SNGRQLFMYNIKKIPDTFFDRESLSFYSVL--IRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
            ++G+   +Y +KK+    FDRE+ S   V   I C D G  P VG K   + I+DENDNAP+  S    F + EN+     +G V A D D +EN R+ +  L++D +  F I
Sbjct:  404 TDGQYKTIYKLKKLAHVSFDREATSGGEVRVDIICTDKGDSPRVGRKEVKIMILDENDNAPRIESKLYTFRIHENSPPNTLVGRVTARDDDIDENARLKFS-LHSDGSRNFVI 515          
BLAST of Protocadherin-1 vs. TrEMBL
Match: A0A267GS00 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017053g1 PE=4 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 7.157e-65
Identity = 124/385 (32.21%), Postives = 186/385 (48.31%), Query Frame = 3
Query:  129 TFYIKLKISENKGSGEDLINLKNYIIIHKLPINSSGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHADV-CQKIILISI----NGQ--VLEVMVYINDENDNIPQFSMRHKT--LSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDS--GKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDR-QGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNC 1247
            TFY K +I      G ++ NLK      +        +N++  + +I   F L S +G L     +DRE +C +  + C +   + +     GQ  V+ + + IND ND  P+F  +HK   +SI E+ +  S  SLPTA+D DS+    ++Y +K I            A  YF +F++     ++P L+L K +DRE  D +EL L+  D    + Q S  I + ++D NDN PQW     S T+ ECDR   PL++L A D D     N +I Y I   + K   + + FYI+G  L  +         K  +   + A D GG    T V + + DCNDH PNI +      I END T  VL  ++V D+D+G N   +C
Sbjct:   28 TFYTKEEIP----IGNEIGNLKT-----RFSYPDGSQFNMLFPDSEIRRLFRLDSRTGALSTIARLDREVLCPNKPLECLRTFNVEVKRGGTGQEEVIVIRLIINDVNDQRPKFEAKHKKFRISIPESDNPPSYYSLPTAEDGDSDRYDHVKYDLKMIGD----------AGMYFKLFLEERGSKRVPKLELTKALDRETKDNYELQLLVSDEQHPEDQDSADIQIEVLDANDNKPQWRLAKQSITISECDRLHRPLLKLNATDED----LNERITYSIGKAAGKD--VAKSFYISGDKLKQNQSLDYEKIRKKVLYIPLVAEDRGGSTVETYVELRVTDCNDHYPNITVEMIEDKILENDETEKVLARILVVDEDEGNNGTVDC 387          

HSP 2 Score: 73.559 bits (179), Expect = 7.157e-65
Identity = 77/265 (29.06%), Postives = 117/265 (44.15%), Query Frame = 3
Query: 1653 SQMEIDREIKDQYSLTIMAKDNG-EPSLNDTCTVHIRILDVNDCVPVFK-QQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSI---------ISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPD-RLIIRASDNGTPP 2411
            S +  DRE  D Y  T+   D+G +     T TV + I+D +D VP F+ ++Y ++I E  G       +G+V A D D+G N  ++Y + ++Y  ++  +     +        L   G  DRE+   I  EI A + G  +    A V + + DVNDN P  +         N+S +S  G  +      D D GENGT+TY +         I  KH    L   L+N+         +  +G +    RL I   DNG PP
Sbjct:  527 SAVSFDREQIDHYRFTVTVADSGLKEQRTSTATVEVTIVDEDDSVPTFQFREYMFRIEEDYGRNLSKRYIGEVKATDADIGANQMIWYEVNRQY-QASLADVGISGMYFYFNGSHLYGEGNFDREKQEIINLEIFARNRGPAKHKGSARVTITLNDVNDNAPSIQ---GLQKVYNLSENSPAGTPVLQVSGTDLDAGENGTLTYILDETEANRFTIDGKHGIVTLSGSLKNN---------QPEDGFQSQTYRLGIGVRDNGNPP 778          

HSP 3 Score: 66.2402 bits (160), Expect = 7.157e-65
Identity = 42/113 (37.17%), Postives = 61/113 (53.98%), Query Frame = 1
Query: 1300 SNGRQLFMYNIKKIPDTFFDRESLSFYSVL--IRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
            ++G+   +Y +KK+    FDRE+ S   V   I C D G  P VG K   + I+DENDNAP+  S    F + EN+     +G V A D D +EN R+ +  L++D +  F I
Sbjct:  404 TDGQYKTIYKLKKLAHVSFDREATSGGEVRVDIICTDKGDSPRVGRKEVKIMILDENDNAPRIESKLYTFRIHENSPPNTLVGRVTARDDDIDENARLKFS-LHSDGSRNFVI 515          
BLAST of Protocadherin-1 vs. TrEMBL
Match: A0A267GLZ2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017053g2 PE=4 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 1.803e-64
Identity = 124/385 (32.21%), Postives = 186/385 (48.31%), Query Frame = 3
Query:  129 TFYIKLKISENKGSGEDLINLKNYIIIHKLPINSSGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHADV-CQKIILISIN----GQ--VLEVMVYINDENDNIPQFSMRHKT--LSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQG--SCTITVSIIDVNDNSPQWPTVNISKTVKECDR-QGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNC 1247
            TFY K +I      G ++ NLK      +        +N++  + +I   F L S +G L     +DRE +C +  + C +   + +     GQ  V+ + + IND ND  P+F  +HK   +SI E+ +  S  SLPTA+D DS+    ++Y +K I            A  +F +F++     ++P L+L K +DRE  D +EL L+  D   QQ   S  I + ++D NDN PQW     S T+ ECDR   PL++L A D D     N +I Y I   + K   + + FYI+G  L  +         K  +   + A D GG    T V + + DCNDH PNI +      I END T  VL  ++V D+D+G N   +C
Sbjct:   28 TFYTKEEIP----IGNEIGNLKT-----RFSYPDGSQFNMLFPDSEIRRLFRLDSRTGALSTIARLDREVLCPNKPLECLRTFNVEVKRGGTGQEEVIVIRLIINDVNDQRPKFEAKHKKFRISIPESDNPPSYYSLPTAEDGDSDRYDHVKYDLKMIGD----------AGMHFKLFLEERGSKRVPKLELTKALDRETKDNYELQLLVSDEQHQQDQDSADIQIEVLDANDNKPQWRLAKQSITISECDRLHRPLLKLNATDED----LNERITYSIGKAAGKD--VAKSFYISGDKLKQNQSLDYEKIRKKVLYIPLVAEDRGGSTVETYVELRVTDCNDHYPNITVEMIEDKILENDETEKVLARILVVDEDEGNNGTVDC 387          

HSP 2 Score: 73.1738 bits (178), Expect = 1.803e-64
Identity = 77/265 (29.06%), Postives = 117/265 (44.15%), Query Frame = 3
Query: 1653 SQMEIDREIKDQYSLTIMAKDNG-EPSLNDTCTVHIRILDVNDCVPVFK-QQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSI---------ISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPD-RLIIRASDNGTPP 2411
            S +  DRE  D Y  T+   D+G +     T TV + I+D +D VP F+ ++Y ++I E  G       +G+V A D D+G N  ++Y + ++Y  ++  +     +        L   G  DRE+   I  EI A + G  +    A V + + DVNDN P  +         N+S +S  G  +      D D GENGT+TY +         I  KH    L   L+N+         +  +G +    RL I   DNG PP
Sbjct:  527 SAVSFDREQIDHYRFTVTVADSGLKEQRTSTATVEVTIVDEDDSVPTFQFREYMFRIEEDYGRNLSKRYIGEVKATDADIGANQMIWYEVNRQY-QASLADVGISGMYFYFNGSHLYGEGNFDREKQEIINLEIFARNRGPAKHKGSARVTITLNDVNDNAPSIQ---GLQKVYNLSENSPAGTPVLQVSGTDLDAGENGTLTYILDETEANRFTIDGKHGIVTLSGSLKNN---------QPEDGFQSQTYRLGIGVCDNGNPP 778          

HSP 3 Score: 65.855 bits (159), Expect = 1.803e-64
Identity = 41/113 (36.28%), Postives = 60/113 (53.10%), Query Frame = 1
Query: 1300 SNGRQLFMYNIKKIPDTFFDRESLSFYSVLIR--CIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
            ++G+   +Y +KK+    FDRE+ S   V +   C D G  P VG K   + I+DENDNAP+  S    F + EN+     +G V A D D +EN R+ +  L+ D +  F I
Sbjct:  404 TDGQYKTIYKLKKLAHVSFDREATSGGDVRVDIICTDKGDSPRVGRKEVKIMILDENDNAPRIESKLYTFRIHENSPPNTLVGRVTARDDDIDENARLKFS-LHGDGSRNFVI 515          
BLAST of Protocadherin-1 vs. TrEMBL
Match: K1P7M1 (Protocadherin-11 Y-linked OS=Crassostrea gigas OX=29159 GN=CGI_10008007 PE=4 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 8.922e-57
Identity = 102/387 (26.36%), Postives = 180/387 (46.51%), Query Frame = 3
Query:  237 TYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQV------LEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTI-FIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGS--CTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLV-ELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENS--TAVTIEIEDCNDHAPNIAI----YKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYFTMVKECLQSIKWTAALYVQYQKNPRH 1349
            T++++S E  ++  F +   SG L     +DRE +C    VC+     S    +      +++++YI D ND+ P F     +L I E++ IG+  ++  A D D+ PN  +  +  +            Q+   F++ F++ ++   +  L + KE+DRE  D + L++IA D G    S    + V I DVNDN+P   +   + +VKE +  G ++  L+A D D  S  N +I+Y++S++  + E I +LF I   +  L        +        + A D G +  +   +V + +ED  ++ P I +        A I E+     V+  V+V D D G+N    C L D  YF + +  +   K T A  +  ++ P H
Sbjct:   60 TFSLLSGESYVS-MFTIDETSGNLYTARVVDREKLCPFTAVCKISFEASAKSTIRSFFTKIKLVIYIQDINDHSPVFPRSSMSLEIPESTLIGNSFTIDGAKDADTSPNYTLNSYTLE------------QSDSPFSLSFVQNLDGTSVVKLVVDKELDREVQDSYNLVVIAADGGNPPRSERLLVNVRITDVNDNAPMLSSTIYNVSVKEDEPVGSIILTLKATDLD--SGKNAEIRYRLSNH--QSENIKQLFEIDEITGQLRIAKPLPYNDGNPYRVIVEASDLGDQPLTVQASVKVLVEDSANNPPEIHVTLLPTSDIARISEDASVGAVIAHVVVIDRDSGMNGYVTCML-DYPYFKIDRLEVNEYKVTVAQPLDREQLPNH 428          

HSP 2 Score: 92.0485 bits (227), Expect = 8.922e-57
Identity = 76/260 (29.23%), Postives = 121/260 (46.54%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYF-YQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIR 2441
             DRE    +   ++A D G  +L+ T TV ++++D ND  P F ++ F ++++E     T+   +G++ A D D G NG   +     Y  S  Q         +           +DRE+       +   D G+P  S+ A V + + D NDN PKF +P +  N + +S +++ G ++A   A DPDK +NG ITYSI      E  + Y   + G +I  K L E  G      L+  A D G+  +A  V   +R
Sbjct:  527 FDRETTPTFVFKVIASDKGPTTLSSTATVMVKVIDENDVAPAFLEKVFLFKVSEQKAAGTV---VGRLIARDFDEGVNGEFEF-----YAESGTQPFEVAKDGVVKTTMS------LDREKQEVYDFTVFVTDKGQPPKSSSARVKITIDDENDNSPKFVFPSSTNNTVMVSQNTKPGAIIARIRAVDPDKEQNGEITYSIEGANFSE--VFYSNNHTGDIIAKKGLEEYSGQTF--SLVAVARDLGSAFQATRVEFFVR 768          

HSP 3 Score: 77.0258 bits (188), Expect = 8.922e-57
Identity = 38/95 (40.00%), Postives = 53/95 (55.79%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITI 1638
             DRE L  +++ I C D G P L     FT  I+D NDNAPKF S+  + ++ ENN  G  +  V+A D D  +NG V YQ+L N+    + + I
Sbjct:  420 LDREQLPNHTITIVCRDAGTPSLTSTHTFTAIILDSNDNAPKFSSNIYQGSIPENNRKGTQVIQVQATDVDQGQNGEVQYQLLQNNVTQQYELAI 514          

HSP 4 Score: 62.7734 bits (151), Expect = 2.896e-17
Identity = 40/113 (35.40%), Postives = 55/113 (48.67%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKF---GSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILN-NDENYYFTITILGKIEAKWKLIEKS 1680
             DRE    Y   +   D G+PP        +TI DENDN+PKF    S +    +++N   GA I  +RA DPD  +NG ++Y I   N    +++    G I AK  L E S
Sbjct:  629 LDREKQEVYDFTVFVTDKGQPPKSSSARVKITIDDENDNSPKFVFPSSTNNTVMVSQNTKPGAIIARIRAVDPDKEQNGEITYSIEGANFSEVFYSNNHTGDIIAKKGLEEYS 741          

HSP 5 Score: 57.7658 bits (138), Expect = 2.896e-17
Identity = 52/214 (24.30%), Postives = 100/214 (46.73%), Query Frame = 3
Query:  621 YFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQ--GSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGP-LVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFF--ITAVDGGGRENSTAVTIEIE--DCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQF 1241
            YF I    +N  K+    + + +DRE++    + ++  D+G      + T T  I+D NDN+P++ +     ++ E +R+G  ++++QA D D     NG+++Y++  N+     + + + +A  S           D +T  TF   + A D G    S+  T+ ++  D ND AP          + E      V+  ++  D D+G+N +F
Sbjct:  401 YFKIDRLEVNEYKV---TVAQPLDREQLPNHTITIVCRDAGTPSLTSTHTFTAIILDSNDNAPKFSSNIYQGSIPENNRKGTQVIQVQATDVDQGQ--NGEVQYQLLQNN-----VTQQYELAIDSSTGKVTTGITFDRETTPTFVFKVIASDKGPTTLSSTATVMVKVIDENDVAPAFLEKVFLFKVSEQKAAGTVVGRLIARDFDEGVNGEF 604          

HSP 6 Score: 51.2174 bits (121), Expect = 9.138e-16
Identity = 81/327 (24.77%), Postives = 137/327 (41.90%), Query Frame = 3
Query:  324 IDRETMCKHADVCQKIILISING------QVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSII--DVNDNSPQ-----WPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAV--DGGGRENSTAVTIE--IEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDL 1253
            +DRE    +      +++I+ +G      + L V V I D NDN P  S     +S++E+  +GS +    A DLDS  N+ IRY + +  S +I+++ +          I  I       L++ K +   + + + +I+ A D G Q  +   +V ++  D  +N P+      PT +I++  ++      +  +   DRD  S  NG +   +     K   I+RL               Q +D +      IT V  D G    ++  T    I D ND+AP  +      SI EN+R    +  V   D D+G N +    L
Sbjct:  204 LDREVQDSY-----NLVVIAADGGNPPRSERLLVNVRITDVNDNAPMLSSTIYNVSVKEDEPVGSIILTLKATDLDSGKNAEIRYRLSNHQSENIKQLFE----------IDEITGQ----LRIAKPLPYNDGNPYRVIVEASDLGDQPLTVQASVKVLVEDSANNPPEIHVTLLPTSDIARISEDASVGAVIAHVVVIDRD--SGMNGYVTCMLDYPYFK---IDRL-----EVNEYKVTVAQPLDREQLPNHTITIVCRDAGTPSLTSTHTFTAIILDSNDNAPKFSSNIYQGSIPENNRKGTQVIQVQATDVDQGQNGEVQYQL 501          

HSP 7 Score: 44.2838 bits (103), Expect = 9.138e-16
Identity = 28/93 (30.11%), Postives = 46/93 (49.46%), Query Frame = 3
Query: 1650 RSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIH----AILGKVTADDKDLGENGTVYYAI 1916
            ++ M +DRE ++ Y  T+   D G+P  + +  V I I D ND  P F    F   T    + + +    AI+ ++ A D D  +NG + Y+I
Sbjct:  624 KTTMSLDREKQEVYDFTVFVTDKGQPPKSSSARVKITIDDENDNSPKF---VFPSSTNNTVMVSQNTKPGAIIARIRAVDPDKEQNGEITYSI 713          

HSP 8 Score: 39.6614 bits (91), Expect = 9.138e-16
Identity = 25/80 (31.25%), Postives = 34/80 (42.50%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSY 1593
            FDRE+   +   +   D G   L       V +IDEND AP F      F ++E    G  +G + A D D   NG   +
Sbjct:  527 FDRETTPTFVFKVIASDKGPTTLSSTATVMVKVIDENDVAPAFLEKVFLFKVSEQKAAGTVVGRLIARDFDEGVNGEFEF 606          

HSP 9 Score: 72.0182 bits (175), Expect = 6.278e-14
Identity = 76/258 (29.46%), Postives = 116/258 (44.96%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNI 2438
            +DRE    +++TI+ +D G PSL  T T    ILD ND  P F    +      N       I  +V A D D G+NG V Y + Q  ++  +Q  + ++     +   +      DRE   +   ++IA D G   LS+ A V+V V+D ND  P F   + K+    +S     G V+    A D D+G NG   +   S        P+++  DG +  T +L +RE   + D   +  +D G PPK+    V I
Sbjct:  420 LDREQLPNHTITIVCRDAGTPSLTSTHTFTAIILDSNDNAPKFSSNIYQGSIPENNRKGTQVI--QVQATDVDQGQNGEVQYQLLQ--NNVTQQYELAIDSSTGKVTTGI----TFDRETTPTFVFKVIASDKGPTTLSSTATVMVKVIDENDVAPAF---LEKVFLFKVSEQKAAGTVVGRLIARDFDEGVNGEFEFYAESGTQ-----PFEVAKDGVVKTTMSL-DREKQEVYD-FTVFVTDKGQPPKSSSARVKI 659          

HSP 10 Score: 36.965 bits (84), Expect = 6.278e-14
Identity = 33/118 (27.97%), Postives = 54/118 (45.76%), Query Frame = 1
Query: 1270 LRWSKNVYNQSNGRQLFMYNIKKIPDTFFDRESLSF-----YSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFG------SDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVS 1590
            +R+  + +   N +QLF   I +I       + L +     Y V++   DLG  PL  +    V + D  +N P+        SD  R  ++E+ ++GA I +V   D DS  NG V+
Sbjct:  281 IRYRLSNHQSENIKQLF--EIDEITGQLRIAKPLPYNDGNPYRVIVEASDLGDQPLTVQASVKVLVEDSANNPPEIHVTLLPTSDIAR--ISEDASVGAVIAHVVVIDRDSGMNGYVT 394          
BLAST of Protocadherin-1 vs. Ensembl Cavefish
Match: ENSAMXT00000053628.1 (pep primary_assembly:Astyanax_mexicanus-2.0:8:8891722:8898216:1 gene:ENSAMXG00000040436.1 transcript:ENSAMXT00000053628.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 108.612 bits (270), Expect = 6.447e-47
Identity = 101/357 (28.29%), Postives = 160/357 (44.82%), Query Frame = 3
Query:  279 FILQSHSGILKQRNNIDRETMCKHADVCQKIILISING--QVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGK--QQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVE-LQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYFTM---VKECLQSIKWTAAL 1319
            F +  ++G+L  +  IDR+ +C     C   I   +    ++  + V + D NDN P F+     L I EN+  G+   LP A DLD+  NS        IH+  + +   FQ            +  KI +L L K++DRE+ +   L+L A D G   + G+  ITV + D+NDN P +     +  +KE    G ++  + A D DD    NG+++Y  S +S  K  IN  FY+   +  +S +G    +        + A D G         V I++ D ND+ P I I   +    E  +   V+  + V D D G+N +  C L D   F +   VK  + S++   AL
Sbjct:   77 FQVNQNNGVLSVKEKIDRDELCGKNRACTVNIKTVVENPLEIHYIEVEVTDVNDNYPVFAETKMYLEIPENTLPGARFELPAARDLDAGINS--------IHTYKLGQNEHFQLQ-----LRDGDDEDKIVFLVLHKQLDREQYNSQSLLLTAYDGGSPPKSGTLNITVCVSDINDNRPVFTQETYTVMLKENTPTGSIIATVNASDADDGL--NGEVEYAFSRSS--KSQINDKFYLDSVTGEISIKGKIDFEENEAYRLNVQATDKGQPPMTGDCRVLIKVTDVNDNKPEIDITSLSNMTPEGSKRGTVIALISVTDKDSGLNGKVVCSLPDKVPFELKSSVKGNMYSLETKDAL 416          

HSP 2 Score: 70.4774 bits (171), Expect = 6.447e-47
Identity = 36/83 (43.37%), Postives = 49/83 (59.04%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQIL 1602
             DRE +S+Y + I   DLG+PP +  K   V + D NDN P+F  + I   L ENN+ GAPI  V A D D NEN  ++Y ++
Sbjct:  416 LDRELVSYYDITIIATDLGQPPQLSHKTIRVHVADVNDNNPEFPYNPINLYLLENNSPGAPIFSVSARDKDLNENAVITYSVI 498          

HSP 3 Score: 50.8322 bits (120), Expect = 6.447e-47
Identity = 31/101 (30.69%), Postives = 49/101 (48.51%), Query Frame = 3
Query: 1662 EIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAI---------LGKVTADDKDLGENGTVYYAIRQKYDHS 1937
            + D E    +   + A D+G P+L+   TV++ ILD ND VPV      Y +T       +  I         + KV A D D+G NG + +++++  DHS
Sbjct:  524 QFDFETVKSFQFHVSASDSGTPALSSNVTVNVFILDKNDNVPVI----LYPVTSNGSAEGVEEIPRNVNAGHLVTKVRAYDADIGYNGWLLFSLQEVSDHS 620          

HSP 4 Score: 67.3958 bits (163), Expect = 1.903e-20
Identity = 78/263 (29.66%), Postives = 123/263 (46.77%), Query Frame = 3
Query: 1662 EIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQIT-EGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQL---QNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNI 2438
            +ID E  + Y L + A D G+P +   C V I++ DVND  P         +T EG+   T+ A+   ++  DKD G NG V  ++  K     + +  G        +        +DRE +      IIA D G+P   +   + V V DVNDN P+F  P N +N   +  +S  G  + +  A D D  EN  ITYS+I    M+ ++   +     +G++   K   + E ++   +  + ASD+GTP  +  VTVN+
Sbjct:  309 KIDFEENEAYRLNVQATDKGQPPMTGDCRVLIKVTDVNDNKPEIDITSLSNMTPEGSKRGTVIAL---ISVTDKDSGLNGKVVCSLPDKVPFELKSSVKGNMYSLETKD-------ALDRELVSYYDITIIATDLGQPPQLSHKTIRVHVADVNDNNPEF--PYNPINLYLLENNSP-GAPIFSVSARDKDLNENAVITYSVIK-GGMQNDMASFINIHSENGQIYALKQF-DFETVK-SFQFHVSASDSGTPALSSNVTVNV 555          

HSP 5 Score: 53.1434 bits (126), Expect = 1.903e-20
Identity = 35/109 (32.11%), Postives = 50/109 (45.87%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENY----YFTITILGKIEAKWKL 1668
             DRE  +  S+L+   D G PP  G    TV + D NDN P F  +     L EN   G+ I  V A D D   NG V Y    + ++     ++  ++ G+I  K K+
Sbjct:  202 LDREQYNSQSLLLTAYDGGSPPKSGTLNITVCVSDINDNRPVFTQETYTVMLKENTPTGSIIATVNASDADDGLNGEVEYAFSRSSKSQINDKFYLDSVTGEISIKGKI 310          

HSP 6 Score: 67.0106 bits (162), Expect = 1.160e-10
Identity = 76/265 (28.68%), Postives = 133/265 (50.19%), Query Frame = 3
Query: 1662 EIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTD-SQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQND--GRL--ILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIR 2441
            ++DRE  +  SL + A D G P  + T  + + + D+ND  PVF Q+ +  + + N      +I+  V A D D G NG V YA  +     + ++ I       ++ G ++I G +D E+  + +  + A D G+P ++    V++ V DVNDNKP+    I+  +  N++ + S+ G V+A     D D G NG +  S      +   +P++L++   G +  + TK+  +RE +   D  II A+D G PP+    T+ + 
Sbjct:  201 QLDREQYNSQSLLLTAYDGGSPPKSGTLNITVCVSDINDNRPVFTQETYTVMLKEN--TPTGSIIATVNASDADDGLNGEVEYAFSR-----SSKSQINDKFYLDSVTGEISIKGKIDFEENEAYRLNVQATDKGQPPMTGDCRVLIKVTDVNDNKPE----IDITSLSNMTPEGSKRGTVIALISVTDKDSGLNGKVVCS------LPDKVPFELKSSVKGNMYSLETKDALDRELVSYYDITII-ATDLGQPPQLSHKTIRVH 447          

HSP 7 Score: 64.6994 bits (156), Expect = 6.144e-10
Identity = 82/353 (23.23%), Postives = 143/353 (40.51%), Query Frame = 3
Query:  222 INSSGTYNIISNEPDINNYFILQSHSG-------ILKQRNNIDRETMCKHADVCQKIILISINGQ------VLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGK--QQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSP---KKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDD 1220
            INS  TY +  NE     +F LQ   G        L     +DRE         Q ++L + +G        L + V ++D NDN P F+    T+ ++EN+  GS ++   A D D   N  + Y           R ++ Q +  F  ++ ++       + +  +ID EE + + L + A D G+    G C + + + DVNDN P+    ++S    E  ++G ++ L +    DS   NG++   + D  P   K  +   ++ +               +L +Y    I A D G   + +   + + + D ND+ P          + EN+     + SV   D D
Sbjct:  166 INSIHTYKLGQNE-----HFQLQLRDGDDEDKIVFLVLHKQLDREQYNS-----QSLLLTAYDGGSPPKSGTLNITVCVSDINDNRPVFTQETYTVMLKENTPTGSIIATVNASDADDGLNGEVEYAFS--------RSSKSQINDKF--YLDSVTGE----ISIKGKIDFEENEAYRLNVQATDKGQPPMTGDCRVLIKVTDVNDNKPEIDITSLSNMTPEGSKRGTVIALISVTDKDSGL-NGKVVCSLPDKVPFELKSSVKGNMYSLETKDALDR-------ELVSYYDITIIATDLGQPPQLSHKTIRVHVADVNDNNPEFPYNPINLYLLENNSPGAPIFSVSARDKD 486          

HSP 8 Score: 53.1434 bits (126), Expect = 1.841e-6
Identity = 85/358 (23.74%), Postives = 153/358 (42.74%), Query Frame = 3
Query:  252 SNEPDINNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQV-----LEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGK--QQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQG-PLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTY--ITFFITAVDGGGRENSTAVTIE--IEDCNDHAPNIAIYKSTAS--------IRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTT 1265
            S++  IN+ F L S +G +  +  ID E      +  +  +  +  GQ        V++ + D NDN P+  +   +    E S  G+ ++L +  D DS  N  +   + D    +++  +  + + Y               L+    +DRE +  +++ +IA D G+  Q    TI V + DVNDN+P++P   I+  + E +  G P+  + A D+D +   N  I Y +     + ++ +   +I   S       L+  D +T     F ++A D G    S+ VT+   I D ND+ P + +Y  T++        I  N     ++T V   D D G N      L + +
Sbjct:  286 SSKSQINDKFYLDSVTGEISIKGKIDFE----ENEAYRLNVQATDKGQPPMTGDCRVLIKVTDVNDNKPEIDITSLSNMTPEGSKRGTVIALISVTDKDSGLNGKVVCSLPDKVPFELK--SSVKGNMY--------------SLETKDALDRELVSYYDITIIATDLGQPPQLSHKTIRVHVADVNDNNPEFPYNPINLYLLENNSPGAPIFSVSARDKDLNE--NAVITYSVIKGGMQNDMAS---FINIHSENGQIYALKQFDFETVKSFQFHVSASDSGTPALSSNVTVNVFILDKNDNVP-VILYPVTSNGSAEGVEEIPRNVNAGHLVTKVRAYDADIGYNGWLLFSLQEVS 617          
BLAST of Protocadherin-1 vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 105.145 bits (261), Expect = 1.018e-46
Identity = 96/330 (29.09%), Postives = 159/330 (48.18%), Query Frame = 3
Query:  324 IDRETM--CK-HADVCQKIILISI-------NGQVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYK--------STASIRENDRTPLVLTSVMVNDDDKGINSQFNC 1247
            IDRET+  C+     C     +S+       + +++E  + + D NDN PQF     TLS+QEN+ +G+  ++P A D D+E N +++Y   D+ +         +AS  F++ +      K+P L ++  +DRE  D ++L + A D G   +  S  + V I D NDN+PQ+   +    V E    G  V LQ    D    PNG+I+Y I   S   + + ++  I  S+  +S +G    +  +   F + A D G   + ++T V+IE+ D ND+AP + I            A+I E+      +  V V+D D+G N+   C
Sbjct:   80 IDRETLKDCRIKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKY---DLSAGP-------EASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSV-LQVKANDSDLGPNGEIEYTIHQAS---DPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTC 395          

HSP 2 Score: 80.8777 bits (198), Expect = 1.018e-46
Identity = 94/287 (32.75%), Postives = 135/287 (47.04%), Query Frame = 3
Query: 1584 SVISDFE*RRKLLFYNHYFRENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFK-QQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNL-REREGIRLPDRLIIRASDNGTPPKAELVTVNI 2438
            S+I+D    R L   +    E R++  +DRE K++Y   + A D G PS   T TV I++LD ND  P F    Y + + E   +  +  + G VT  D D GEN  V  ++     +   QN  G  L  I+           DRE+  S    + A D G+P  S+   V ++VLD NDN P    P N  +F  +S  +    V+   EAED D G N  + YSI      E  L Y   +DG + LTK L R+  G+    RL+++ SD G P +  +  V+I
Sbjct:  507 SIIADSS-TRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLEN--MPPLSPV-GMVTVLDMDKGENAQVQLSVEPDVGNFVVQNGTGTILSSIS----------FDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKPSNS-SFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHE--LFYISPSDGEIKLTKELTRKHGGLH---RLVVKVSDRGKPSRHAIALVHI 773          

HSP 3 Score: 43.1282 bits (100), Expect = 1.018e-46
Identity = 28/85 (32.94%), Postives = 35/85 (41.18%), Query Frame = 1
Query: 1348 TFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQIL 1602
            T  D E +  Y V I  +D G P L       V + D NDN+P F          E N  G  +  V A D DS  N  + Y I+
Sbjct:  425 TPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSII 509          

HSP 4 Score: 80.8777 bits (198), Expect = 2.514e-19
Identity = 72/224 (32.14%), Postives = 112/224 (50.00%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF-KQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFK-----YPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDG 2318
            +DRE+KD Y LTI A D G PS   +  + + I D ND  P F K  Y  +++E + +   +++L +V A+D DLG NG + Y I Q  D   +   I  +   I+++      G +DRE++ S +  +IA D G    S+   V ++V D NDN P  +        +     NIS D  VG  +A  +  D D+GEN  +T  +        ++P+QL+  G
Sbjct:  201 LDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVG--YSVL-QVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVK------GPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAG------DVPFQLRPAG 409          

HSP 5 Score: 35.8094 bits (81), Expect = 2.514e-19
Identity = 17/52 (32.69%), Postives = 29/52 (55.77%), Query Frame = 1
Query: 1444 VTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
            + + D NDN P+F S  +  ++ EN ++GA     +A D D+  NG + Y +
Sbjct:  119 IEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDL 170          

HSP 6 Score: 59.3066 bits (142), Expect = 4.294e-16
Identity = 79/335 (23.58%), Postives = 145/335 (43.28%), Query Frame = 3
Query:  285 LQSHSGILKQRNNIDRETMCKHA-DVCQKIILISINGQVLEVMVYINDENDNIPQFSMRHKTL--------SIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCT--ITVSIIDVNDNSPQWPTVNISKTVKECDRQG-PLVELQAFDRDDSSTPNGQIKYKI-SDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIREN--DRTPLVLTSVMVNDDDKGINSQ 1238
            ++  +GI+  +  +DRE +      V  +    S       V + + D+NDN P   +R   L        +I E+  +G+ ++L    D D   N+++   +       +R                +++  K  +L+    +D E I  + + ++A DSG    S T  + V + D NDNSP +          E ++ G  ++++ A D D  +  N ++ Y I +D+S +      LF I  SS  + ++     + K    F +TA D G      +  V I++ D ND+ P   +   + S+ EN    +P+ + +V+  D DKG N+Q
Sbjct:  295 IERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGD-----------SSVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGT--NAELVYSIIADSSTRG-----LFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVL--DMDKGENAQ 609          

HSP 7 Score: 43.1282 bits (100), Expect = 4.294e-16
Identity = 33/112 (29.46%), Postives = 52/112 (46.43%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAP---IGYVRAYDPDSNENGRVSYQILNNDENYYFTITIL-GKIEAKWKLIEK 1677
            FDRE  S Y+  ++ +D G PP       T+ ++DENDNAP   +     +    + + AP   +  V A D D   N  + Y I   + +  F I+   G+I+   +L  K
Sbjct:  636 FDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVV-TKPSNSSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHELFYISPSDGEIKLTKELTRK 746          

HSP 8 Score: 22.7126 bits (47), Expect = 4.294e-16
Identity = 10/34 (29.41%), Postives = 17/34 (50.00%), Query Frame = 3
Query: 1662 EIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRI 1763
            E+ R+    + L +   D G+PS +    VHI +
Sbjct:  742 ELTRKHGGLHRLVVKVSDRGKPSRHAIALVHIYV 775          

HSP 9 Score: 52.373 bits (124), Expect = 5.801e-11
Identity = 87/300 (29.00%), Postives = 131/300 (43.67%), Query Frame = 3
Query: 1635 YFRENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYF-YQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFI-NISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLP-YQLQNDGRLILTKNL--REREGIRLPDRLIIRASDNGTPPKAELVTVNIRYIPNNLTPRNNALPPGINKKSNDKNR 2519
            YF +  + ++ +R I+D Y + I+A D+G P+L+ T ++ +++ D ND  P+F    F  +  E N       +L  V A D D G N  + Y+I    D S R                      +DRE     +  + A D G P     A V++ VLD NDN PKF       + + N+   S VG V       D DKGEN  +  S+      E ++  + +QN    IL+     RE+E         ++A D G PP++  V V I  +  N    +NA  P + K SN   R
Sbjct:  419 YFLQTTTPLDYER-IRD-YRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPG--EKVL-DVIALDADSGTNAELVYSIIA--DSSTRGLFEIDPSSGEVRARSP-----LDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVT----VLDMDKGENAQVQLSV------EPDVGNFVVQNGTGTILSSISFDREKESSYT---FRLKAVDGGEPPRSSYVGVTINVLDEN----DNA--PVVTKPSNSSFR 687          

HSP 10 Score: 35.8094 bits (81), Expect = 5.801e-11
Identity = 23/88 (26.14%), Postives = 39/88 (44.32%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAP---------KFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVS 1590
             DRE +S +   +   D G  P       ++ + D+NDNAP         +  SD +   ++E+  +G  +  V+  D D  EN  V+
Sbjct:  308 LDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGV-ANISEDMPVGTAVALVQVSDKDEGENAVVT 394          

HSP 11 Score: 55.4546 bits (132), Expect = 4.385e-7
Identity = 74/288 (25.69%), Postives = 124/288 (43.06%), Query Frame = 3
Query:  411 VYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRY-FIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKE-CDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPL-----VLTSVMVNDDDKGINSQF 1241
            V + D NDN P FS     +   E +  G ++    A D DS  N+ + Y  I D  +R +  ++                R + P       +DRE  +R+E  + A D G    +G+ T+ + ++D NDN P++   + S +V E      P+  +   D D     N Q++  +     + ++ N  F +   +  + S      + ++  TF + AVDGG   R +   VTI + D ND+AP +    S +S R    +PL     V+  V   D D G N++ 
Sbjct:  457 VQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEV----------RARSP-------LDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGE--NAQVQLSV-----EPDVGN--FVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAP-VVTKPSNSSFRR--LSPLAAPDSVVEVVEAEDIDYGSNAEL 715          

HSP 12 Score: 53.5286 bits (127), Expect = 1.761e-6
Identity = 29/82 (35.37%), Postives = 39/82 (47.56%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
             DRE    Y + I  +D G P      L  V I D NDNAP+F        ++EN+ +G  +  V+A D D   NG + Y I
Sbjct:  201 LDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTI 282          
BLAST of Protocadherin-1 vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 104.76 bits (260), Expect = 3.421e-46
Identity = 96/330 (29.09%), Postives = 159/330 (48.18%), Query Frame = 3
Query:  324 IDRETM--CK-HADVCQKIILISI-------NGQVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYK--------STASIRENDRTPLVLTSVMVNDDDKGINSQFNC 1247
            IDRET+  C+     C     +S+       + +++E  + + D NDN PQF     TLS+QEN+ +G+  ++P A D D+E N +++Y   D+ +         +AS  F++ +      K+P L ++  +DRE  D ++L + A D G   +  S  + V I D NDN+PQ+   +    V E    G  V LQ    D    PNG+I+Y I   S   + + ++  I  S+  +S +G    +  +   F + A D G   + ++T V+IE+ D ND+AP + I            A+I E+      +  V V+D D+G N+   C
Sbjct:  116 IDRETLKDCRIKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKY---DLSAGP-------EASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSV-LQVKANDSDLGPNGEIEYTIHQAS---DPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTC 431          

HSP 2 Score: 80.1073 bits (196), Expect = 3.421e-46
Identity = 94/287 (32.75%), Postives = 135/287 (47.04%), Query Frame = 3
Query: 1584 SVISDFE*RRKLLFYNHYFRENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFK-QQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNL-REREGIRLPDRLIIRASDNGTPPKAELVTVNI 2438
            S+I+D    R L   +    E R++  +DRE K++Y   + A D G PS   T TV I++LD ND  P F    Y + + E   +  +  + G VT  D D GEN  V  ++     +   QN  G  L  I+           DRE+  S    + A D G+P  S+   V ++VLD NDN P    P N  +F  +S  +    V+   EAED D G N  + YSI      E  L Y   +DG + LTK L R+  G+    RL+++ SD G P +  +  V+I
Sbjct:  543 SIIADSS-TRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLEN--MPPLSPV-GMVTVLDMDKGENAQVQLSVEPDVGNFVVQNGTGTILSSIS----------FDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKPSNS-SFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHE--LFYISPSDGEIKLTKELTRKHGGLH---RLVVKVSDRGKPSRHAIALVHI 809          

HSP 3 Score: 42.743 bits (99), Expect = 3.421e-46
Identity = 28/85 (32.94%), Postives = 35/85 (41.18%), Query Frame = 1
Query: 1348 TFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQIL 1602
            T  D E +  Y V I  +D G P L       V + D NDN+P F          E N  G  +  V A D DS  N  + Y I+
Sbjct:  461 TPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSII 545          

HSP 4 Score: 80.4925 bits (197), Expect = 3.230e-19
Identity = 72/224 (32.14%), Postives = 112/224 (50.00%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF-KQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFK-----YPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDG 2318
            +DRE+KD Y LTI A D G PS   +  + + I D ND  P F K  Y  +++E + +   +++L +V A+D DLG NG + Y I Q  D   +   I  +   I+++      G +DRE++ S +  +IA D G    S+   V ++V D NDN P  +        +     NIS D  VG  +A  +  D D+GEN  +T  +        ++P+QL+  G
Sbjct:  237 LDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVG--YSVL-QVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVK------GPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAG------DVPFQLRPAG 445          

HSP 5 Score: 35.8094 bits (81), Expect = 3.230e-19
Identity = 18/57 (31.58%), Postives = 30/57 (52.63%), Query Frame = 1
Query: 1444 VTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDE 1614
            + + D NDN P+F S  +  ++ EN ++GA     +A D D+  NG + Y +    E
Sbjct:  155 IEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPE 211          

HSP 6 Score: 57.7658 bits (138), Expect = 1.118e-15
Identity = 79/335 (23.58%), Postives = 145/335 (43.28%), Query Frame = 3
Query:  285 LQSHSGILKQRNNIDRETMCKHA-DVCQKIILISINGQVLEVMVYINDENDNIPQFSMRHKTL--------SIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCT--ITVSIIDVNDNSPQWPTVNISKTVKECDRQG-PLVELQAFDRDDSSTPNGQIKYKI-SDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIREN--DRTPLVLTSVMVNDDDKGINSQ 1238
            ++  +GI+  +  +DRE +      V  +    S       V + + D+NDN P   +R   L        +I E+  +G+ ++L    D D   N+++   +       +R                +++  K  +L+    +D E I  + + ++A DSG    S T  + V + D NDNSP +          E ++ G  ++++ A D D  +  N ++ Y I +D+S +      LF I  SS  + ++     + K    F +TA D G      +  V I++ D ND+ P   +   + S+ EN    +P+ + +V+  D DKG N+Q
Sbjct:  331 IERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGD-----------SSVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGT--NAELVYSIIADSSTRG-----LFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVL--DMDKGENAQ 645          

HSP 7 Score: 43.1282 bits (100), Expect = 1.118e-15
Identity = 33/112 (29.46%), Postives = 52/112 (46.43%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAP---IGYVRAYDPDSNENGRVSYQILNNDENYYFTITIL-GKIEAKWKLIEK 1677
            FDRE  S Y+  ++ +D G PP       T+ ++DENDNAP   +     +    + + AP   +  V A D D   N  + Y I   + +  F I+   G+I+   +L  K
Sbjct:  672 FDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVV-TKPSNSSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHELFYISPSDGEIKLTKELTRK 782          

HSP 8 Score: 22.7126 bits (47), Expect = 1.118e-15
Identity = 10/34 (29.41%), Postives = 17/34 (50.00%), Query Frame = 3
Query: 1662 EIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRI 1763
            E+ R+    + L +   D G+PS +    VHI +
Sbjct:  778 ELTRKHGGLHRLVVKVSDRGKPSRHAIALVHIYV 811          

HSP 9 Score: 50.8322 bits (120), Expect = 2.240e-10
Identity = 87/300 (29.00%), Postives = 131/300 (43.67%), Query Frame = 3
Query: 1635 YFRENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYF-YQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFI-NISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLP-YQLQNDGRLILTKNL--REREGIRLPDRLIIRASDNGTPPKAELVTVNIRYIPNNLTPRNNALPPGINKKSNDKNR 2519
            YF +  + ++ +R I+D Y + I+A D+G P+L+ T ++ +++ D ND  P+F    F  +  E N       +L  V A D D G N  + Y+I    D S R                      +DRE     +  + A D G P     A V++ VLD NDN PKF       + + N+   S VG V       D DKGEN  +  S+      E ++  + +QN    IL+     RE+E         ++A D G PP++  V V I  +  N    +NA  P + K SN   R
Sbjct:  455 YFLQTTTPLDYER-IRD-YRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPG--EKVL-DVIALDADSGTNAELVYSIIA--DSSTRGLFEIDPSSGEVRARSP-----LDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVT----VLDMDKGENAQVQLSV------EPDVGNFVVQNGTGTILSSISFDREKESSYT---FRLKAVDGGEPPRSSYVGVTINVLDEN----DNA--PVVTKPSNSSFR 723          

HSP 10 Score: 35.4242 bits (80), Expect = 2.240e-10
Identity = 23/88 (26.14%), Postives = 39/88 (44.32%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAP---------KFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVS 1590
             DRE +S +   +   D G  P       ++ + D+NDNAP         +  SD +   ++E+  +G  +  V+  D D  EN  V+
Sbjct:  344 LDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGV-ANISEDMPVGTAVALVQVSDKDEGENAVVT 430          

HSP 11 Score: 54.299 bits (129), Expect = 1.055e-6
Identity = 74/290 (25.52%), Postives = 125/290 (43.10%), Query Frame = 3
Query:  405 VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRY-FIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKE-CDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPL-----VLTSVMVNDDDKGINSQF 1241
            + V + D NDN P FS     +   E +  G ++    A D DS  N+ + Y  I D  +R +  ++                R + P       +DRE  +R+E  + A D G    +G+ T+ + ++D NDN P++   + S +V E      P+  +   D D     N Q++  +     + ++ N  F +   +  + S      + ++  TF + AVDGG   R +   VTI + D ND+AP +    S +S R    +PL     V+  V   D D G N++ 
Sbjct:  491 LRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEV----------RARSP-------LDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGE--NAQVQLSV-----EPDVGN--FVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAP-VVTKPSNSSFRR--LSPLAAPDSVVEVVEAEDIDYGSNAEL 751          

HSP 12 Score: 52.7582 bits (125), Expect = 2.887e-6
Identity = 29/82 (35.37%), Postives = 39/82 (47.56%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
             DRE    Y + I  +D G P      L  V I D NDNAP+F        ++EN+ +G  +  V+A D D   NG + Y I
Sbjct:  237 LDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTI 318          
BLAST of Protocadherin-1 vs. Ensembl Cavefish
Match: pcdh7a (protocadherin 7a [Source:ZFIN;Acc:ZDB-GENE-120206-1])

HSP 1 Score: 92.0485 bits (227), Expect = 3.531e-43
Identity = 97/333 (29.13%), Postives = 145/333 (43.54%), Query Frame = 3
Query:  396 VLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRY-FIKDIHSRDIRR----------------------MNQFQASR--YFTIFIK-TINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQG-PLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYK--------STASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYFTM 1277
            + E  + + D NDN P F     TLS++EN  IG+   LPTA D D   N I RY  ++D  SRD RR                           A R   F + +  T +  K P L +   +DRE  D +EL+L   D G   +     + V+I DVNDNSP++        + E    G P+++++A DRD     NGQ++Y     +   E + RL  +  +S +LS       +  + + F +TA D G   R +   V + + D ND+ P + I K          A + EN      +  V V+D D+G N    C +     FT+
Sbjct:  129 LFEGRIVVTDVNDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIDRYELVQD--SRDQRRPASATMPAGINNGAGDRRRGQEAGSVPAGRSNVFELQVADTPDGQKQPQLIVKGPLDREARDSYELVLRVRDGGNPPRSSQALLRVAITDVNDNSPRFERAVYEAEMGENTPPGTPVLQVRASDRDIGV--NGQVEYVFGAAT---ESVRRLLRLDEASGWLSVLHRIDREEVSQLRFTVTARDRGQPPRTDRATVILNVRDENDNVPVVEIRKIGRILVRDGAAMVPENVLVDTPVALVQVSDRDQGENGAVTCTVVGDVPFTL 454          

HSP 2 Score: 81.6481 bits (200), Expect = 3.531e-43
Identity = 78/275 (28.36%), Postives = 125/275 (45.45%), Query Frame = 3
Query: 1650 RSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQL----QNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYIPNNLT 2462
            R+   +DRE +++Y   ++A+D G PSL  + TV +++ D ND  P F Q+ F    + N LA  ++ +G VT  D D GEN  +   + +  +               N  G +      DRE   +    + A D G+P  SA A V + V D NDN P    P N+ ++  +   S    V+    A D D G N  + Y+++         P+QL     + G + L + L  R   R   RL++R +D+G P       V++ +I  +LT
Sbjct:  573 RATGALDREQRERYEFRVIARDKGSPSLQGSATVVVQVTDRNDNAPKFVQEVFTFYVKENLLA--NSPVGMVTVTDADEGENAELCLFVEEDEEEEEAGGRRQELFSIENNTGTIFSAASFDRESRSTYTFRVRAVDGGEPPRSATATVSLFVTDENDNAPSVTAPANE-SYTLLPPASGARTVVRTVMASDGDAGSNADLRYALVGGN------PFQLFEIGPSSGVITLAEPLERRH--RGLHRLVVRVNDSGVPSLCATALVHV-FINESLT 835          

HSP 3 Score: 43.8986 bits (102), Expect = 3.531e-43
Identity = 29/99 (29.29%), Postives = 45/99 (45.45%), Query Frame = 1
Query: 1303 NGRQLFMYNIKKIPDTFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
            N ++ F++          D E+   Y+V I  +D G P L       V ++D ND+AP F    +     ENN  G  +  V A D DS +N  ++Y +
Sbjct:  462 NKKKFFLHT-----SALLDYEATRDYTVTIVAVDSGSPSLSSNSTLMVRVVDINDHAPTFAQSLVEVHFAENNAPGERVVTVVAADADSGKNAEIAYSL 555          

HSP 4 Score: 57.7658 bits (138), Expect = 7.473e-17
Identity = 31/80 (38.75%), Postives = 41/80 (51.25%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSY 1593
             DRE+   Y +++R  D G PP   + L  V I D NDN+P+F        + EN   G P+  VRA D D   NG+V Y
Sbjct:  250 LDREARDSYELVLRVRDGGNPPRSSQALLRVAITDVNDNSPRFERAVYEAEMGENTPPGTPVLQVRASDRDIGVNGQVEY 329          

HSP 5 Score: 50.447 bits (119), Expect = 7.473e-17
Identity = 57/214 (26.64%), Postives = 98/214 (45.79%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLAT------IHAILGKVTADDKDLGENGTVY--------YAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSI 2264
            IDRE   Q   T+ A+D G+P   D  TV + + D ND VPV + +   +I   +G A       +   +  V   D+D GENG V         + ++   ++ N++                    ++D E        I+A D+G P LS+ + ++V V+D+ND+ P F   + +++F   + ++  G+ +    A D D G+N  I YS+
Sbjct:  357 IDREEVSQLRFTVTARDRGQPPRTDRATVILNVRDENDNVPVVEIRKIGRILVRDGAAMVPENVLVDTPVALVQVSDRDQGENGAVTCTVVGDVPFTLKPAGENRNKKKFFLHTS------------ALLDYEATRDYTVTIVAVDSGSPSLSSNSTLMVRVVDINDHAPTFAQSLVEVHF---AENNAPGERVVTVVAADADSGKNAEIAYSL 555          

HSP 6 Score: 52.7582 bits (125), Expect = 1.673e-15
Identity = 75/304 (24.67%), Postives = 118/304 (38.82%), Query Frame = 3
Query:  411 VYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQG------------PLVELQAFDRDDSSTPNGQIKYKISDNSP---KKELINR---LFYIAXXXXXXXXXXXXXMDLKTY--ITFFITAVDGGGRENSTAVT--IEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLN 1256
            V I D NDN P+F        + EN+  G+ +    A D D   N  + Y +    +  +RR+ +   +                +L ++  IDREE+ +    + A D G+   +   TV I++V D +   P V I K  +   R G            P+  +Q  DRD     NG +   +  + P   K    NR    F++             L+D +     T  I AVD G    S+  T  + + D NDHAP  A         EN+     + +V+  D D G N++    L+
Sbjct:  280 VAITDVNDNSPRFERAVYEAEMGENTPPGTPVLQVRASDRDIGVNGQVEY-VFGAATESVRRLLRLDEASG--------------WLSVLHRIDREEVSQLRFTVTARDRGQPPRTDRATV-ILNVRDENDNVPVVEIRKIGRILVRDGAAMVPENVLVDTPVALVQVSDRDQGE--NGAVTCTVVGDVPFTLKPAGENRNKKKFFL---------HTSALLDYEATRDYTVTIVAVDSGSPSLSSNSTLMVRVVDINDHAPTFAQSLVEVHFAENNAPGERVVTVVAADADSGKNAEIAYSLD 556          

HSP 7 Score: 50.8322 bits (120), Expect = 1.673e-15
Identity = 28/78 (35.90%), Postives = 35/78 (44.87%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRV 1587
             DRE    Y   +   D G P L G     V + D NDNAPKF  +   F + EN    +P+G V   D D  EN  +
Sbjct:  578 LDREQRERYEFRVIARDKGSPSLQGSATVVVQVTDRNDNAPKFVQEVFTFYVKENLLANSPVGMVTVTDADEGENAEL 655          

HSP 8 Score: 46.9802 bits (110), Expect = 2.202e-12
Identity = 81/360 (22.50%), Postives = 143/360 (39.72%), Query Frame = 3
Query:  222 INSSGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQV-----LEVMVYINDENDNIP--------QFSMRHKTLSIQENSDIGSELSLPTADDLD-SEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPY-LKLIKEIDREEIDRFELILIAEDSGKQQGSC--TITVSIIDVNDNSPQWPTVNISKTVKECDRQGP-LVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGG--RENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQF 1241
            +N    Y   +    +     L   SG L   + IDRE + +     +  +     GQ        V++ + DENDN+P        +  +R     + EN  + + ++L    D D  E  ++    + D+                FT+     NR K  + L     +D E    + + ++A DSG    S   T+ V ++D+ND++P +    +     E +  G  +V + A D D  S  N +I Y +  +      +N  FYI   +  + + G    + +    F + A D G    + S  V +++ D ND+AP       T  ++EN      +  V V D D+G N++ 
Sbjct:  323 VNGQVEYVFGAATESVRRLLRLDEASGWLSVLHRIDREEVSQ----LRFTVTARDRGQPPRTDRATVILNVRDENDNVPVVEIRKIGRILVRDGAAMVPENVLVDTPVALVQVSDRDQGENGAVTCTVVGDVP---------------FTLKPAGENRNKKKFFLHTSALLDYEATRDYTVTIVAVDSGSPSLSSNSTLMVRVVDINDHAPTFAQSLVEVHFAENNAPGERVVTVVAADAD--SGKNAEIAYSLDPS------VNGAFYIDADNGDIRATGALDREQRERYEFRVIARDKGSPSLQGSATVVVQVTDRNDNAPKFVQEVFTFYVKENLLANSPVGMVTVTDADEGENAEL 655          

HSP 9 Score: 46.2098 bits (108), Expect = 2.202e-12
Identity = 32/118 (27.12%), Postives = 54/118 (45.76%), Query Frame = 1
Query: 1300 SNGRQLFMYNIKKIPDTFF-----DRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFG--SDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
            + GR+  +++I+    T F     DRES S Y+  +R +D G PP       ++ + DENDNAP     +++    L   +     +  V A D D+  N  + Y ++  +    F I
Sbjct:  668 AGGRRQELFSIENNTGTIFSAASFDRESRSTYTFRVRAVDGGEPPRSATATVSLFVTDENDNAPSVTAPANESYTLLPPASGARTVVRTVMASDGDAGSNADLRYALVGGNPFQLFEI 785          

HSP 10 Score: 60.4622 bits (145), Expect = 1.278e-8
Identity = 88/318 (27.67%), Postives = 136/318 (42.77%), Query Frame = 3
Query: 1602 E*RRKLLFYNHYFRENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYF-YQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFI-NISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHM------EQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYI------PNNLTPRNNA---LPPGINKKS 2504
            E R K  F+ H      +   +D E    Y++TI+A D+G PSL+   T+ +R++D+ND  P F Q        E N  A    ++  V A D D G+N  + Y++    + +                G +   G +DREQ    +  +IA D G P L   A V+V V D NDN PKF   +       N+  +S VG V       D D+GEN  +   +   +         Q L + ++N+   I +    +RE  R      +RA D G PP++   TV++         P+   P N +   LPP    ++
Sbjct:  459 ENRNKKKFFLH------TSALLDYEATRDYTVTIVAVDSGSPSLSSNSTLMVRVVDINDHAPTFAQSLVEVHFAENN--APGERVV-TVVAADADSGKNAEIAYSLDPSVNGA---------FYIDADNGDIRATGALDREQRERYEFRVIARDKGSPSLQGSATVVVQVTDRNDNAPKFVQEVFTFYVKENLLANSPVGMVTVT----DADEGENAELCLFVEEDEEEEEAGGRRQEL-FSIENNTGTIFSAASFDRES-RSTYTFRVRAVDGGEPPRSATATVSLFVTDENDNAPSVTAPANESYTLLPPASGART 752          

HSP 11 Score: 59.6918 bits (143), Expect = 1.810e-8
Identity = 62/229 (27.07%), Postives = 105/229 (45.85%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFI-----------NISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDG 2318
            +DRE +D Y L +  +D G P  +    + + I DVND  P F ++  Y+   G        +L +V A D+D+G NG V Y      +   R   +      +++         +DRE++  ++  + A D G+P  +  A VI++V D NDN P  +  I K+  I           N+  D+ V  V    +  D D+GENG +T +++       ++P+ L+  G
Sbjct:  250 LDREARDSYELVLRVRDGGNPPRSSQALLRVAITDVNDNSPRF-ERAVYEAEMGENTPPGTPVL-QVRASDRDIGVNGQVEYVFGAATESVRRLLRLDEASGWLSVLHR------IDREEVSQLRFTVTARDRGQPPRTDRATVILNVRDENDNVPVVE--IRKIGRILVRDGAAMVPENVLVDTPVALV----QVSDRDQGENGAVTCTVVG------DVPFTLKPAG 458          
BLAST of Protocadherin-1 vs. Ensembl Cavefish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 103.219 bits (256), Expect = 5.584e-43
Identity = 98/355 (27.61%), Postives = 158/355 (44.51%), Query Frame = 3
Query:  240 YNIISNEPDINNYFILQSHSG-ILKQRNNIDRETMCKHADV----C----QKIILISINGQVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCT--ITVSIIDVNDNSPQWPTVNISKTVKECDRQG-PLVELQAFDRDDSSTPNGQIKYKISDN-SPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAPNIAI------YKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNC 1247
            Y ++S   D N    + S++G I    N IDRE +C         C    + +IL +   +++++ + + D NDN P F      +SI EN+ I S  ++P+A D D  PNS+ +Y + +              S +    ++T    K P L + + +DRE+ D + + +  ED G  Q S T  + V++ DVNDN P +    I   + E    G  +V+LQA D D  +  N +IKY      SP      RLF +  ++  ++ Q     +        + A DG        VTI + D ND+APNI +         T  + E D     +  + V+D D  +N +  C
Sbjct:   64 YRLVSKAGD-NPLLRVMSNTGEIFTTSNRIDREKLCPGPSYEDSECSFEIEVVILPNDYFRLIKIKIVVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDMGPNSVYKYELVN------------GQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPESSPVGTSVVQLQATDADVGA--NAEIKYMFGTQVSPATR---RLFALNSTTGLITVQRPLDREETANHKLSVLASDGSSSSARATVTINVTDVNDNAPNIDLRYIISPTNGTVLLSEKDPVNTKIALITVSDKDTDVNGKVIC 400          

HSP 2 Score: 67.0106 bits (162), Expect = 5.584e-43
Identity = 78/274 (28.47%), Postives = 124/274 (45.26%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVV------DREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSII--SHKHMEQNLPYQLQNDGRLILTKNLRERE-GIRLPDRLIIRASDNGTPPKAELVTVNIRYIPNNL 2459
             DRE ++++  T+ A+DNG  +L     V + ILD ND  P F   +F      N     ++ +G +T  D D GEN  V  +I    D+ N                +    GV+      DREQ  S   ++ A D+G P  S+ A V ++V+DVNDN P   YP +  +F  +   +  G V+A   A D D G N  + Y+I+  ++K + +  P      G + L +   E + G+    RL++  SD G P     + +   Y+ N +
Sbjct:  529 FDREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKFTHNHFQFFVSEN--LPKYSTVGVITVTDADAGENAVVSLSILN--DNEN--------------FILDPYTGVIKSNVSFDREQQSSYTFDVRAVDSGHPPCSSAAKVTINVIDVNDNPPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVNGNNKGLFRIDPVT----GNITLEEKPTEADSGLH---RLVVNISDLGYPKSLHTLVLVFLYVNNTV 777          

HSP 3 Score: 46.595 bits (109), Expect = 5.584e-43
Identity = 29/84 (34.52%), Postives = 37/84 (44.05%), Query Frame = 1
Query: 1348 TFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
               D E    Y   I   D G+P L    L  V + DENDN P F    I  T++ENN     +  + A D DS  N  + YQ+
Sbjct:  424 ALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLTTITATDEDSGRNAEIVYQL 507          

HSP 4 Score: 65.855 bits (159), Expect = 7.010e-29
Identity = 81/302 (26.82%), Postives = 126/302 (41.72%), Query Frame = 3
Query:  405 VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQ-------WPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYI-AXXXXXXXXXXXXXMDL---KTYITFFITAVDGGGRE-NSTA-VTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYF 1271
            + V + D NDN P F      + I E+S +G+ +    A D D   N+ I+Y      S   RR+    +    T  + T+ R           +DREE    +L ++A D        T+T+++ DVNDN+P         PT N +  + E D     + L      D+   NG++   I  + P        F++ A        +   L+D    K YI F I A D G    N TA V + +ED ND+ P         ++ EN++  L LT++   D+D G N++    L     F
Sbjct:  237 LQVTVTDVNDNRPVFKESQIEVHIPESSPVGTSVVQLQATDADVGANAEIKYMFGTQVSPATRRLFALNS----TTGLITVQR----------PLDREETANHKLSVLASDGSSSSARATVTINVTDVNDNAPNIDLRYIISPT-NGTVLLSEKDPVNTKIALITVSDKDTDV-NGKVICFIEKDVP--------FHLKAVYDNQYLLETSALLDYEGTKEYI-FKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLTTITATDEDSGRNAEIVYQLGPNASF 513          

HSP 5 Score: 58.9214 bits (141), Expect = 7.010e-29
Identity = 32/91 (35.16%), Postives = 49/91 (53.85%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYF 1626
            FDRE    +   +   D G   L  +    VTI+D+NDN+PKF  +  +F ++EN    + +G +   D D+ EN  VS  ILN++EN+  
Sbjct:  529 FDREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAVVSLSILNDNENFIL 619          

HSP 6 Score: 43.8986 bits (102), Expect = 7.010e-29
Identity = 28/93 (30.11%), Postives = 42/93 (45.16%), Query Frame = 3
Query: 1650 RSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTAD----DKDLGENGTVYYAI 1916
            +S +  DRE +  Y+  + A D+G P  +    V I ++DVND  P+     +        L  + AI G V A+    D D G N  + Y I
Sbjct:  627 KSNVSFDREQQSSYTFDVRAVDSGHPPCSSAAKVTINVIDVNDNPPIV---IYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTI 716          

HSP 7 Score: 58.9214 bits (141), Expect = 4.561e-13
Identity = 66/269 (24.54%), Postives = 115/269 (42.75%), Query Frame = 3
Query: 1656 QMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQ-QYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMN-FINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQ---NDGRLILTKNLREREGIRLPDRLIIR--ASDNGTPPKAELVTVNIR 2441
            Q  +DRE KD Y + I  +D G P  + T  + + + DVND  PVFK+ Q    I E + + T    + ++ A D D+G N  + Y    +   + R+     +   +           +DRE+  + +  ++A D       A   + V  ++ N      +Y I+  N  + +S    V   +A     D D   NG +   I      E+++P+ L+   ++  L+ T  L + EG +     I +  ASD+G P   +   V +R
Sbjct:  206 QQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPESSPVGT---SVVQLQATDADVGANAEIKYMFGTQVSPATRRLFALNSTTGLITVQRP-----LDREETANHKLSVLASDGSSSSARATVTINVTDVNDNAPNIDLRYIISPTNGTVLLSEKDPVNTKIALITVSDKDTDVNGKVICFI------EKDVPFHLKAVYDNQYLLETSALLDYEGTK---EYIFKIVASDSGKPSLNQTALVRVR 457          

HSP 8 Score: 36.5798 bits (83), Expect = 4.561e-13
Identity = 23/73 (31.51%), Postives = 33/73 (45.21%), Query Frame = 1
Query: 1444 VTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITILGKIEAKW 1662
            + + D NDNAP F S  I  ++ EN  I +      A DPD   N    Y+++N    +   I    + E KW
Sbjct:  129 IVVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDMGPNSVYKYELVNGQSAFGLDIVETPEGE-KW 200          

HSP 9 Score: 67.3958 bits (163), Expect = 8.308e-11
Identity = 87/297 (29.29%), Postives = 124/297 (41.75%), Query Frame = 3
Query: 1614 KLLFYNHYFRENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFI---NISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNL---REREGIRLPDRLIIRASDNGTPPKAELVTVNIRYIPNNLTPRNNALPP 2486
            K ++ N Y  E  + +  D E   +Y   I+A D+G+PSLN T  V +R+ D ND  P+F Q         N    ++  L  +TA D+D G N  + Y +       +     G+               V DRE        + A DNG   L + A VIV +LD NDN PKF +  N   F    N+   S VG +       D D GEN  ++ SI++        PY        ++  N+   RE++     D   +RA D+G PP +    V I  I  N  P     PP
Sbjct:  411 KAVYDNQYLLETSALL--DYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLY--LTTITATDEDSGRNAEIVYQLGPNASFFDLDRKTGVLTASR----------VFDREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKFTH--NHFQFFVSENLPKYSTVGVITVT----DADAGENAVVSLSILNDNENFILDPYT------GVIKSNVSFDREQQSSYTFD---VRAVDSGHPPCSSAAKVTINVIDVNDNPPIVIYPP 678          

HSP 10 Score: 57.3806 bits (137), Expect = 9.936e-8
Identity = 80/295 (27.12%), Postives = 123/295 (41.69%), Query Frame = 3
Query:  393 QVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHS-RDI-RRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQ--QGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTA--VTIEIEDCNDHAPNIAIYKSTASIRENDRTPL------VLTSVMVNDDDKGINSQF 1241
            Q   V V + DENDN P F+     L++ EN+     L+  TA D DS  N+ I Y +    S  D+ R+     ASR F                     DRE+ +RF   + A D+G +  Q    + V+I+D NDNSP++   +    V E   +   V +      D+   N  +   I ++       N  F +   +  + S      + ++  TF + AVD G    S+A  VTI + D ND+ P +    S  S +     PL      V+  V   D D G+N++ 
Sbjct:  450 QTALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLTTITATDEDSGRNAEIVYQLGPNASFFDLDRKTGVLTASRVF---------------------DREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGE-NAVVSLSILND-------NENFILDPYTGVIKSNVSFDREQQSSYTFDVRAVDSGHPPCSSAAKVTINVIDVNDNPPIVIYPPSNTSFK---LVPLSAIPGSVVAEVFAVDGDTGMNAEL 712          

HSP 11 Score: 52.373 bits (124), Expect = 3.517e-6
Identity = 74/289 (25.61%), Postives = 119/289 (41.18%), Query Frame = 3
Query:  138 IKLKISENKG--------SGEDLINLKNYIIIHKLPINSSGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISI----NG-QVLE----VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIK---EIDREEIDRFELILIAEDSGKQ--QGSCTITVSIIDVNDNSP--QWPTVNIS-KTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKI 929
            I+L +SEN          +  D  + +N  I+++L  N+S              +F L   +G+L      DRE         Q+  L ++    NG + L+    V+V I D+NDN P+F+  H    + EN    S + + T  D D+  N+++                        +I     N +  PY  +IK     DRE+   +   + A DSG      +  +T+++IDVNDN P   +P  N S K V      G +V  + F  D  +  N ++KY I
Sbjct:  473 IELTVSENNKRDLYLTTITATDEDSGRNAEIVYQLGPNAS--------------FFDLDRKTGVLTASRVFDRED--------QERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAVVS----------------------LSILNDNENFILDPYTGVIKSNVSFDREQQSSYTFDVRAVDSGHPPCSSAAKVTINVIDVNDNPPIVIYPPSNTSFKLVPLSAIPGSVVA-EVFAVDGDTGMNAELKYTI 716          

HSP 12 Score: 50.8322 bits (120), Expect = 9.393e-6
Identity = 36/111 (32.43%), Postives = 52/111 (46.85%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAP--KFGSDDIRFTLTENNNI-GAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI-TILGKIEAKWKLIE 1674
            FDRE  S Y+  +R +D G PP       T+ +ID NDN P   +   +  F L   + I G+ +  V A D D+  N  + Y I+N +    F I  + G I  + K  E
Sbjct:  632 FDREQQSSYTFDVRAVDSGHPPCSSAAKVTINVIDVNDNPPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVNGNNKGLFRIDPVTGNITLEEKPTE 742          
BLAST of Protocadherin-1 vs. Ensembl Sea Lamprey
Match: si:ch211-199f5.1 (protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660])

HSP 1 Score: 90.1225 bits (222), Expect = 1.352e-38
Identity = 89/343 (25.95%), Postives = 147/343 (42.86%), Query Frame = 3
Query:  300 GILKQRNNIDRETMCKHADVCQ---KIILISING--QVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGP-LVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRE--NSTAVTIEIEDCNDHAPNIAI------YKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYFTMV 1280
            G +  R  IDRE  C  A  C     ++     G  Q++   V + D ND+ P F+     + I E+  +G+ + L  A DLD   N++  Y + +     +    +   ++Y  + +K+              +DRE+   + L L A D G   + G+  + ++++D NDNSP +   + + TV+E    G  L+ L A D D+   PNG++ Y  S  SP    + RLF +   +  LS +G    +L +     I A D G         V + +ED ND+AP I +         T  + E       +  V V+D D   N    C L    +F ++
Sbjct:   82 GTVSAREVIDREQQCGQAPSCVIRFDVLCTLPRGLFQLVHAEVELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHLDENERFGLALRARTDGAKYAELVVKS-------------RLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEG--PNGEVVYSFS--SPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLRGHPHFKLL 407          

HSP 2 Score: 70.8626 bits (172), Expect = 1.352e-38
Identity = 32/91 (35.16%), Postives = 55/91 (60.44%), Query Frame = 1
Query: 1339 IPDTFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNND 1611
            + ++  DRE ++ Y +++   D G PP V  + FTV ++DENDN P+F       +L ENN+ GA +  V A+D D+  NG ++Y ++ ++
Sbjct:  416 VTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESE 506          

HSP 3 Score: 38.5058 bits (88), Expect = 1.352e-38
Identity = 28/92 (30.43%), Postives = 41/92 (44.57%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGL------ATIHAILGKVTADDKDLGENGTVYYAIRQ 1922
            +D E     +  + A+D+G P L    TV +RI+D ND  PV        +  G G+      A +  ++  V A D D   NG + Y I Q
Sbjct:  531 LDYEAMTSLTFQVQARDDGVPPLVTNATVSVRIVDENDNAPVVTHP---PLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIVQ 619          

HSP 4 Score: 59.6918 bits (143), Expect = 5.028e-18
Identity = 79/318 (24.84%), Postives = 129/318 (40.57%), Query Frame = 3
Query: 1662 EIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQ-------ITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQ---NDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYIPNNLTPRNNALPP-----GINKKSNDKNRFSGGNVDNYRDSDSTDN 2570
            ++D E+  +Y ++I A+D G  S+   C V + + D+ND  P  K  +  Q       ++EG   A   + +G VT  D D  ENG V   +R    H + +     +   +           +DREQM      + A D G P   A     V +LD NDN+P+F     + + +    ++  G  +    A D D   NG I Y+++  +    ++   +    + G +   + L       L     ++A D+G PP     TV++R +  N        PP     G+ +   D        V   RDSDS  N
Sbjct:  310 QLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEG---AAYESFVGLVTVSDIDSAENGLVACHLR---GHPHFKLLPYRDDYVVVTNSS------LDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLE---NNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSL--TFQVQARDDGVPPLVTNATVSVRIVDENDNAPVVTHPPLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEAN 610          

HSP 5 Score: 50.0618 bits (118), Expect = 5.028e-18
Identity = 27/80 (33.75%), Postives = 38/80 (47.50%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSY 1593
             DRE    Y++ +   D G PP  G  L  +T++D NDN+P F       T+ E+   G  +  + A D D   NG V Y
Sbjct:  203 LDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVY 282          

HSP 6 Score: 70.4774 bits (171), Expect = 1.100e-16
Identity = 76/268 (28.36%), Postives = 118/268 (44.03%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPI---NKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDR-LIIRASDNGTPPKAELVTVNIRYIPNN 2456
            +DRE + +Y+L + A D G+P  + T  V I +LD ND  PVF Q         +  AT   +L  + A D D G NG V Y+     D   R+                   G +D E     +  I A D G   + A   V+V V D+NDN P+ K      ++ + + +S  +     +      D D  ENG +   +  H H +  LPY+   D  +++T +  +RE  ++ D  L++ ASD GTPP+       +R +  N
Sbjct:  203 LDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVRED--ATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLK-----GQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLRGHPHFKL-LPYR---DDYVVVTNSSLDRE--QMADYFLVLEASDGGTPPRVAARQFTVRLLDEN 457          

HSP 7 Score: 34.6538 bits (78), Expect = 1.100e-16
Identity = 23/82 (28.05%), Postives = 43/82 (52.44%), Query Frame = 1
Query: 1444 VTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITILGKIE-AKW-KLIEKSK 1683
            V ++D ND+AP F   ++   ++E+  +G  +    A D D   N   +Y +   DEN  F + +  + + AK+ +L+ KS+
Sbjct:  124 VELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHL---DENERFGLALRARTDGAKYAELVVKSR 202          

HSP 8 Score: 59.6918 bits (143), Expect = 2.864e-12
Identity = 36/102 (35.29%), Postives = 52/102 (50.98%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIR-----FTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITILG 1644
             D E+++  +  ++  D G PPLV     +V I+DENDNAP      +R       L  +  +G  +  VRA D DS  NG +SY+I+  +E   F I  LG
Sbjct:  531 LDYEAMTSLTFQVQARDDGVPPLVTNATVSVRIVDENDNAPVVTHPPLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIVQGNERNLFRINRLG 632          

HSP 9 Score: 30.4166 bits (67), Expect = 2.864e-12
Identity = 10/26 (38.46%), Postives = 18/26 (69.23%), Query Frame = 3
Query: 1686 QYSLTIMAKDNGEPSLNDTCTVHIRI 1763
            ++SL +M +D G P+L+ T  + IR+
Sbjct:  651 RHSLVVMVRDRGSPALSATAAIEIRV 676          

HSP 10 Score: 52.7582 bits (125), Expect = 4.865e-7
Identity = 69/288 (23.96%), Postives = 113/288 (39.24%), Query Frame = 3
Query:  405 VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQ--GSCTITVSIIDVNDNSPQ----------WPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFIT--AVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDD 1220
            V + + D NDN P F+     ++++E++  G+ L    A D+D  PN  + Y        ++RR+ Q                 K   L L  ++D E    +E+ + A D G       C + V + D+NDN+P+            TV +S+        G LV +   D    S  NG +   +  +   K L  R  Y+              +D +    +F+   A DGG   R  +   T+ + D ND+ P        AS+ EN+     +T+V   D D
Sbjct:  231 VRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDP--------------KTGKLSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVG-LVTVSDID----SAENGLVACHLRGHPHFKLLPYRDDYVV--------VTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDAD 491          

HSP 11 Score: 49.6766 bits (117), Expect = 4.496e-6
Identity = 58/230 (25.22%), Postives = 98/230 (42.61%), Query Frame = 3
Query:  318 NNIDRETMCKHADVCQKIILISING------QVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQ--GSCTITVSIIDVNDNSP--QWPTVNISKTVKECDRQGPLVELQAF--DRDDSSTPNGQIKYKISDNSPKKEL-INRL 968
            +++DRE M  +      ++L + +G         +  V + DENDN P+F       S+ EN+  G+ ++  TA D D+E N +I Y + +        +     S Y +I   +        +  ++ +D E +      + A D G      + T++V I+D NDN+P    P +     V    R   L  L      RD  S  NG++ Y+I   + +    INRL
Sbjct:  419 SSLDREQMADYF-----LVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVE------SEVAGASVSTYVSINPSS------GAIYALRPLDYEAMTSLTFQVQARDDGVPPLVTNATVSVRIVDENDNAPVVTHPPLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIVQGNERNLFRINRL 631          
BLAST of Protocadherin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010725.1 (pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 gene:ENSPMAG00000009713.1 transcript:ENSPMAT00000010725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 96.6709 bits (239), Expect = 1.563e-35
Identity = 100/367 (27.25%), Postives = 164/367 (44.69%), Query Frame = 3
Query:  282 ILQSHSGILKQRNNIDRETMC-KHADVCQKIILI-------------SINGQVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKI-------PYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQW--PTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKY----KISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYIT--FFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAI------YKSTASIR--EN--DRTPLVLTSVMVNDDDKGINSQFNCDL 1253
            I+   SG L     +DRE +C +  D C+    +             S N ++L+V + + D ND+ P F   H  +SI E+  +G  + LP A D D+  NSI  Y I    S D  ++  F               +           L+L +++DRE +  +EL+L  ED G  K  GS  +T+ ++D NDN+P +  P     +  +       +V+L+A D D  + PNG I Y    K++  + +  L     ++ G++  ++ +  + +D +T       + A DGG   R  S  VT+E+ D ND+AP   +      Y     ++  EN    TP+VL S  V+D D G +   +  L
Sbjct:   75 IVNELSGELSVALRLDREALCMEEPDACRSTGFMHTVQVAAMAKGQGSSNLRLLDVQLLVRDINDHAPAFRAPHLNVSISESEAVGRRVPLPRAIDPDAGTNSIQHYRIS-AASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPD--AGPNGAIAYSFHTKLTSLATQAAL-----HVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLIS--VSDPDLGSSGTVDVRL 431          

HSP 2 Score: 58.151 bits (139), Expect = 1.563e-35
Identity = 69/255 (27.06%), Postives = 109/255 (42.75%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQ-------QYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLA-NFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLRER-EGIRLPDRLIIRASDNG 2402
            +DRE + +Y L++ A D G P       V + +LD ND  P F          Y + + E   + T    +G V+  D D G+N  V   + ++           +        G++    V+DRE  V  +  + A D+G+P LSA   V + V D NDN P    P     + ++ T S  G ++  +  A D D G+NG   Y II      + +     + G L L + +    EG+    RL++R  D G
Sbjct:  572 LDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTY---VGTVSTSDLDEGDNARVALNLVREAGPD------WIGGAGDTPGGVVRTLVVLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTNDNAPVITSPNTNDTWKHVRTFSPAGMLVGVSVTANDIDAGDNGRPLYEIIGGN--PKGIFLLNADSGALSLARTVSSLDEGLH---RLVVRVRDRG 812          

HSP 3 Score: 33.8834 bits (76), Expect = 1.563e-35
Identity = 25/91 (27.47%), Postives = 39/91 (42.86%), Query Frame = 1
Query: 1351 FFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFG-----SDDI---RFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
              D E    Y+V +   D G P L       ++++D NDN P F        D+     +L EN   G  +  + A D DS  NG +++ +
Sbjct:  454 LLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTL 544          

HSP 4 Score: 60.8474 bits (146), Expect = 3.391e-27
Identity = 83/365 (22.74%), Postives = 154/365 (42.19%), Query Frame = 3
Query:  291 SHSGILKQRNNIDRETMCKHADVCQKIILIS-------INGQVLEVMVYINDENDNIPQF-SMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGK--QQGSCTITVSIIDVNDNSPQWPTVNIS---------KTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELI--NRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVT--IEIEDCNDHAP----------NIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYFTMVKE 1286
             H  +L+ R  +DRE +  +     +++L         ++G VL  +V + D NDN P F     + + I E+S +G+ +    A D D+ PN  I Y     H++      Q       T  + T+   +        ++DRE +    L+++A D G+  +  S T+TV + D NDN+P +  + +          K V+      P+V +   D D  S+    ++ +    +   EL   N++ ++  ++  L  +  Q  ++       + A D G  + S  +   I + D ND+ P          ++A+Y+   S+REN     V+ +++  D D G N      L++      V E
Sbjct:  219 GHRALLELREQLDREAVPSY-----ELLLWGEDGGNPKLSGSVLLTIVVV-DANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAY---SFHTKLTSLATQAALHVDGTTGLVTVRNAE--------KLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGA---ELASPNKVQFLLKTTRLLDYEEAQQYNVS------VLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYE--VSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAE 555          

HSP 5 Score: 51.6026 bits (122), Expect = 3.391e-27
Identity = 31/96 (32.29%), Postives = 48/96 (50.00%), Query Frame = 3
Query: 1650 RSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQ-------QYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAI 1916
            R+ + +DRE + QY L++ A D+G P+L+ +C V I + D ND  PV          ++    +    L  +      VTA+D D G+NG   Y I
Sbjct:  680 RTLVVLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTNDNAPVITSPNTNDTWKHVRTFSPAGMLVGV-----SVTANDIDAGDNGRPLYEI 770          

HSP 6 Score: 48.1358 bits (113), Expect = 3.391e-27
Identity = 32/106 (30.19%), Postives = 50/106 (47.17%), Query Frame = 1
Query: 1312 QLFMYNIKKIPDTF---FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKF-GSDDI-----RFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQIL 1602
            +LF  N++    T     DRE    Y + +   D G P      +  VT++DENDNAP F G  +      +F + E  ++G  +G V   D D  +N RV+  ++
Sbjct:  555 ELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLV 660          

HSP 7 Score: 63.1586 bits (152), Expect = 4.650e-21
Identity = 31/82 (37.80%), Postives = 47/82 (57.32%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIR-FTLTENNNIGAPIGYVRAYDPDSNENGRVSYQ 1596
             DRE++  Y +L+   D G P L G  L T+ ++D NDNAP F     R   +TE++ +G  +  +RA DPD+  NG ++Y 
Sbjct:  230 LDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYS 311          

HSP 8 Score: 56.9954 bits (136), Expect = 4.650e-21
Identity = 74/286 (25.87%), Postives = 130/286 (45.45%), Query Frame = 3
Query: 1650 RSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF-----KQQYF----YQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPIN-----KMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSI--ISHKHMEQNLPYQLQNDGRLILTKNL-REREGIRLPDRLIIRASDNGTPPKAELVTVNIRYIPNN 2456
            R+  ++DRE    + L ++A+D G+ S + + TV + + D ND  PVF     + +Y      +I E N  +    +L  ++  D DLG +GTV   +R ++       +       +          ++D E+       ++A D G P+LS + N+I+ V+D+NDN P F  P +      +  +++  +   G V+ N  A D D G NG IT+++  ++       L       G+L L   L RE+   R+   L + A D G+P +     V +  +  N
Sbjct:  337 RNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVE-NLPSGTPVVL--ISVSDPDLGSSGTV--DVRLEFPTGAELASPNKVQFLLKTTR------LLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREK---RMRYELSVEACDGGSPQRKARAIVRVTVLDEN 608          

HSP 9 Score: 61.6178 bits (148), Expect = 9.592e-18
Identity = 82/352 (23.30%), Postives = 150/352 (42.61%), Query Frame = 3
Query:  297 SGILKQRN--NIDRETMCKHADVCQKIILISINGQVLE------VMVYINDENDNIPQFS--------MRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGS--CTITVSIIDVNDNSPQW---PTVNISKTVKECD--RQGPL--VELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGG--RENSTAVTIEIEDCNDHAPN-IAIYKSTAS-----IRENDRTPLVLTSVMVNDDDKGINSQFNCDL 1253
            +G++  RN   +DRETM  H     ++++++ +G  L       V V +ND+NDN P F         +    + I EN   G+ + L +  D D   +  +   ++     ++   N+ Q       F+          LK  + +D EE  ++ + ++A D G  + S    + +S++D+NDN+P +    ++     V E      GP   V L     D  S PNG I + +S+ +   E +  LF +   +  L+       + +      + A DGG   R+    V + + D ND+AP  + +  ST       + E       + +V  +D D+G N++   +L
Sbjct:  331 TGLVTVRNAEKLDRETMPVH-----RLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAELASPNKVQ-------FL----------LKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELA-GGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNL 659          

HSP 10 Score: 46.9802 bits (110), Expect = 9.592e-18
Identity = 31/99 (31.31%), Postives = 45/99 (45.45%), Query Frame = 1
Query: 1351 FFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGY-----VRAYDPDSNENGRVSYQILNNDENYYFTI 1632
              DRE    Y + +R +D GRP L      ++T+ D NDNAP   S +   T        +P G      V A D D+ +NGR  Y+I+  +    F +
Sbjct:  684 VLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTNDNAPVITSPNTNDTWKHVRTF-SPAGMLVGVSVTANDIDAGDNGRPLYEIIGGNPKGIFLL 781          

HSP 11 Score: 55.4546 bits (132), Expect = 2.315e-12
Identity = 68/259 (26.25%), Postives = 116/259 (44.79%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQ-------YFYQIT-EGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFIN---ISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTP 2408
            +D E   QY+++++A D G P L+    + I ++D+ND  PVF            Y+++   NG A    ++  + A D D G NG + + + +     +      LN+    L         +DRE+ +  +  + A D G PQ  A A V V VLD NDN P F    N  N +    +  ++ VG  +      D D+G+N  +  +++     +  +       G ++ T  + +RE  R+   L +RA D+G P
Sbjct:  455 LDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPA--GTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATP----LDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVREAGPDW-IGGAGDTPGGVVRTLVVLDRED-RVQYELSVRAVDSGRP 705          

HSP 12 Score: 35.4242 bits (80), Expect = 2.315e-12
Identity = 23/90 (25.56%), Postives = 40/90 (44.44%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIR--------FTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
             DRE++  + +++   D G+         TV + D+NDNAP F    ++          + EN   G P+  +   DPD   +G V  ++
Sbjct:  342 LDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRL 431          

HSP 13 Score: 54.6842 bits (130), Expect = 1.416e-7
Identity = 69/273 (25.27%), Postives = 119/273 (43.59%), Query Frame = 3
Query: 1662 EIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF--KQQYFYQITEGNGLATIHAILG----KVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNF-----INISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYI 2447
            ++DRE    Y L +  +D G P L+ +  + I ++D ND  PVF        +ITE       H+ +G    ++ A D D G NG + Y+   K      Q  + ++     +         +DRE M   +  ++A D G+   SA   V V++ D NDN P F+    +  +     + I  +   G  +      DPD G +GT+   +      E   P ++Q    L+ T  L + E  +  +  ++ A+D GTP  ++L+ + I  +
Sbjct:  229 QLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITE-------HSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEK--LDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAELASPNKVQ---FLLKTTRLLDYEEAQQYNVSVL-AADRGTPKLSKLLNLIISVV 488          
BLAST of Protocadherin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.0846 bits (157), Expect = 1.919e-32
Identity = 60/284 (21.13%), Postives = 122/284 (42.96%), Query Frame = 3
Query:  402 EVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWP----TVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQF 1241
            +V + + D NDN P F++    L ++EN+  G  +   +A D D   N+++ Y +          ++  + +  F +   +        L+  + +DREE   + L + A D G       ++V++ D NDNSP++     + ++++      +    V       D  S P G++ Y ++  S   +  +  F +   +  L+       + +        A DGGG   +  + + + D ND+AP++      A + E+      L  +   DDD+G+N++ 
Sbjct: 1501 QVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSV----------LSGSEGA--FVVDAASG------VLRASRRLDREERASYLLTVRASD-GTHATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAP-SEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGGLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAEL 1764          

HSP 2 Score: 61.6178 bits (148), Expect = 1.919e-32
Identity = 75/254 (29.53%), Postives = 117/254 (46.06%), Query Frame = 3
Query: 1644 ENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF-KQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVL-ANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNL-REREGIRLPDRLIIRASD 2396
            E R   E+DRE +  Y+LT++A D G P L  T T+ + + D ND  P F +++Y   I E     T   +L +++A D D G NG + Y I       + + +  L  L +           +DRE+  S +  + A D G P  S  A+V V + DVND  P F+        ++   ++Q   VL     A D D G +G +TY+            + +  DG + L ++L RE +   +   LII A+D
Sbjct: 1900 EVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGT--EVL-RLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAVARP--------LDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQL---SPYTVHARENTQGPPVLILQVVARDDDLGSSGQVTYAAAGGNDGGA---FSVSPDGHVHLLRSLDREAQPQHV---LIITATD 2133          

HSP 3 Score: 52.373 bits (124), Expect = 1.919e-32
Identity = 35/86 (40.70%), Postives = 47/86 (54.65%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGR-PPLVGEKLFTVTII--DENDNAPKFGSDDIRFTLT-ENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
             DRE  SFY++++R  D  R PP        V++I  D NDNAP F S   R  L  E++ +GA +  V+A DPDS  N  V Y +
Sbjct: 1791 LDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSP--RSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYAL 1874          

HSP 4 Score: 63.5438 bits (153), Expect = 4.898e-28
Identity = 90/351 (25.64%), Postives = 153/351 (43.59%), Query Frame = 3
Query:  273 NYFILQSHS----GILKQRNNIDRETMCKHADVCQKIILISINGQ------VLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSC--TITVSIIDVNDNSPQWPTVNISKTVKECDRQGP-LVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYI-AXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRE-NSTA-VTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINS--QFNCDLNDTTYF 1271
             +F+L +       +LK  + +DRE +  +       IL S NG+         ++VY+ND ND+ P+F++     ++ E +  GS +   TA D DS  N+ +RY I  +   D+   +  +++   T   K               +DRE      L + A+D G Q  +   ++TV+++DVND  P +       T  E    G  +V + A D D     NG ++Y    + P +     +F + + +    + + L   +L+ Y    + A D G     STA VT+ + D ND+ P     +  ASI EN+     +T+V   D D+G N   ++     D   F
Sbjct:  277 GHFVLHAPGVPGLRVLKVASQLDRERIPMY----NLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSI--VSGNDLGWFSVDESTGLVTTDGK---------------VDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGE--NGTVRYNFDPDMPAQ--YREMFRLDSLTGKVTTLKSLDREELEEY-PLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARF 601          

HSP 5 Score: 50.0618 bits (118), Expect = 4.898e-28
Identity = 62/213 (29.11%), Postives = 91/213 (42.72%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF-KQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGV-----------VDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFI-NISTDSQVGKVLANFEAEDPDKGENGTITYSI 2264
            IDRE +  Y L ++A   G   +    +V + + DVN+  PVF +  Y   I E      +++    V A DKD G+NG V Y I +                          +G+           +DRE        + A D G   LS+   V V VLDVNDNKP F    N  +++ +   + +VG ++   +A D D G NG +TYS 
Sbjct:  719 IDREEQAFYQLRVVANSGG---VAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDE---PVNSRFFSVRATDKDSGKNGEVKYEIGEG--------------------NGGEKFGIFPDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLF----NSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSF 901          

HSP 6 Score: 49.6766 bits (117), Expect = 4.898e-28
Identity = 30/93 (32.26%), Postives = 44/93 (47.31%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
             DRE  + Y + +  +D G        + T+T+ D  D  P F  DD  F + EN   G  +G V A   D N N  V+Y I++ D+   F+I
Sbjct:  616 LDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDLNAN--VTYLIVSGDQRGSFSI 706          

HSP 7 Score: 92.0485 bits (227), Expect = 1.115e-25
Identity = 94/356 (26.40%), Postives = 155/356 (43.54%), Query Frame = 3
Query:  225 NSSGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHADVCQ-KIILISINGQVLE-------VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQ--QGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGP-LVELQAFDRDDSSTPNGQIKYKI-SDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFF--ITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFN 1244
            N   TY+    +P +N  F L S +G +      DRE + +          +++ +G   +       V V++ D NDN PQF+      S+ E++   ++L   TA D+D   N  +RY I           N+      FT+   T        + L+  +DREE   + L++ A DSG      SCT+ V ++D NDN P++    +S    E  R G  L+ L A D D  + P+G ++Y I + N+     I+R           S    + +D +T   +   ++A DGG   R ++T + + + D ND+ P        ASI EN      + +V   D D  +N + +
Sbjct:  894 NGGVTYSF--EKPQVN--FELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAI-----------NEGNEGGKFTVDASTGQ------ITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDED--TGPSGDVRYAIVAGNTHATFAIDR--------STGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELH 1218          

HSP 8 Score: 43.8986 bits (102), Expect = 1.115e-25
Identity = 34/112 (30.36%), Postives = 50/112 (44.64%), Query Frame = 1
Query: 1357 DRE-SLSFYSVLIRCIDLGRPPLVGE---KLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITILGKIEAKWKLIEKS 1680
            DRE +   + V +R  D   P        K  TV + DENDNAP+F +             G+ +G ++A DPD  EN  V Y +   D        IL +++ +  +IE S
Sbjct: 1247 DREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTAILVDGLRAAAGSVVGTLQASDPDEAENAAVRYAVTGGDA------AILFRLDRRTGIIETS 1352          

HSP 9 Score: 78.1814 bits (191), Expect = 2.558e-24
Identity = 97/369 (26.29%), Postives = 160/369 (43.36%), Query Frame = 3
Query:  189 LKNYIIIHKLPINSSGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQVL---EVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQ--QGSCTITVSIIDVNDNSPQWPTVNISKTVKE-CDRQ--GPLV-ELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGR---ENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLND 1259
            L   +    L +N++ TY I+S   D    F ++   G +   N IDRE    +     ++ +++ +G V     V V ++D N++ P F      +SI E+  + S      A D DS  N  ++Y I            +      F IF     ++ + Y     E+DRE  + + L + A D+G +    S T+ V+++DVNDN P +   N S  V   C+ Q  G LV  +QA D D  S  NG + Y         EL +    IA   +F     ++     ++ +F + A DGG     ++   V + ++D ND+ P  A     AS+ E+      L  V  +D D+G+N      +N+
Sbjct:  676 LVGSVSASTLDLNANVTYLIVSG--DQRGSFSIEWSGGRIFTANAIDREEQAFY-----QLRVVANSGGVAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEI-----------GEGNGGEKFGIFPD--GQLYVRY-----ELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLF---NSSSYVFHFCEEQEVGSLVGAVQATDADAGS--NGGVTYSFEKPQVNFELDSETGRIASLRVFDREALIRQGGAASF-SFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINE 1013          

HSP 10 Score: 52.7582 bits (125), Expect = 2.558e-24
Identity = 27/93 (29.03%), Postives = 45/93 (48.39%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
             DRE  + Y++++   D G  PL       V ++DENDN P+F    +     E+  +G  +  + A D D+  +G V Y I+  + +  F I
Sbjct: 1035 LDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAI 1127          

HSP 11 Score: 64.6994 bits (156), Expect = 2.046e-23
Identity = 30/86 (34.88%), Postives = 45/86 (52.33%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNND 1611
             DRE+   Y++ +  +D GRPPL       VT+ D NDNAP+F   +    + E+   G  +  + A+DPD   NG + Y I + D
Sbjct: 1907 LDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGD 1992          

HSP 12 Score: 63.1586 bits (152), Expect = 2.046e-23
Identity = 89/381 (23.36%), Postives = 152/381 (39.90%), Query Frame = 3
Query:  138 IKLKISENKGSGEDLINLKNYIIIHKLPINSSGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQVLEVMVYINDENDNIPQFSMRHKTLSIQENSD---------IGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQG-PLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG----GRENSTA-VTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINS 1235
            ++L++ EN G GE +  L           N+  TY+++S        F++ + SG+L+    +DRE    +    +           L V V   D NDN P+FS    +  + E++          IG+ L    A D DS P   + Y +      D        A   F +   T        L + + +DRE    + L   A D G    +  + V+++D NDN+P     +++  V E    G  L+ + A D D+    N ++++ IS   P+        +  G+   LS       + +++    +   D       R +S   V++ + D ND+AP     +S A   E+     V+ +V   D D G NS
Sbjct: 1521 MELEVEENTGEGEVIFTLSATDADQGQ--NALVTYSVLSGS---EGAFVVDAASGVLRASRRLDREERASYLLTVRASDGTHATDARLSVAV--RDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVL----AGDADSGPFGEVTYALAPSEDSD-------WADGAFGLHPVTG------ALNVTRPLDRESRACYVLRARATDGGGLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGV--NAELEFSISSGDPEGR------FAVGNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRS-ALAPEDSPVGAVVATVQAVDPDSGRNS 1868          

HSP 13 Score: 60.8474 bits (146), Expect = 2.544e-18
Identity = 31/89 (34.83%), Postives = 44/89 (49.44%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENY 1620
             DRE+   YS+ +  +D G  PL       VT++D NDN P F S    F   E   +G+ +G V+A D D+  NG V+Y       N+
Sbjct:  820 LDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVNF 908          

HSP 14 Score: 50.0618 bits (118), Expect = 2.544e-18
Identity = 76/330 (23.03%), Postives = 129/330 (39.09%), Query Frame = 3
Query:  279 FILQSHSGILKQRNNIDRETMCKHADVCQKIILISIN-GQVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLND 1259
            F L S +G +    ++DRE + ++  V Q     S   G   +V V + D NDN P F       SI EN   G+ ++  TA D D   N  +RY           ++    A+R+    +      ++        +DREE   ++L + A D G  + +    +T+++ D  D  P +   + S  V E    G LV   +    D    N  + Y I     +       F I  S   + +      + + +    + A + GG     +V++ + D N+HAP         SI E++       SV   D D G N +   ++ +
Sbjct:  497 FRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRY-----------QLTAGDAARFQVNAVTGAVSTRV-------SLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDL---NANVTYLIVSGDQRGS-----FSIEWSGGRIFTANAIDREEQAFYQLRVVA-NSGGVAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGE 799          

HSP 15 Score: 67.781 bits (164), Expect = 3.618e-18
Identity = 64/203 (31.53%), Postives = 93/203 (45.81%), Query Frame = 3
Query: 1662 EIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIIS 2270
            ++DRE+     L I A+D G        ++ + +LDVND  P+F Q  +      N L  +  +   V+A D DLGENGTV Y          R+     +L              +DRE++      + A D G P L + A V V V D+NDN P F YP+    F +I  +   G  +    A DPD+G NGT+ Y + +
Sbjct:  403 KVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVV--SVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKS-----LDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVF-YPVQY--FASILENEPGGTAVTTVTATDPDRGANGTVRYQLTA 595          

HSP 16 Score: 42.3578 bits (98), Expect = 3.618e-18
Identity = 27/94 (28.72%), Postives = 46/94 (48.94%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRP-PLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
             DRE +  Y++ I   D G+P          V + D ND+AP+F        L+E    G+ +  V A D DS  N ++ Y I++ ++  +F++
Sbjct:  298 LDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLGWFSV 391          

HSP 17 Score: 62.7734 bits (151), Expect = 8.326e-16
Identity = 76/269 (28.25%), Postives = 122/269 (45.35%), Query Frame = 3
Query: 1662 EIDREIKDQYSLTIMAKDNGEP-SLNDTCTVHIRILDVNDCVPVFKQQYFYQIT-EGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQV-GKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQN-------DGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNI 2438
            ++DRE    Y+LTI+A DNG+P + + T ++ + + DVND  P F    +     EG   A   + +  VTA D D G N  + Y+I    D                  G++   G VDRE   S+   I A D G    +A  ++ V +LDVND  P F     +  ++  + ++ + G  + +  A D D GENGT+ Y      + + ++P Q +         G++   K+L   E    P  L+++A D G+PP      V +
Sbjct:  297 QLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEG---APAGSYVKDVTAMDADSGLNAKLRYSIVSGND--------LGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLF----TQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRY------NFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYP--LVVQAQDRGSPPLGSTAKVTV 542          

HSP 18 Score: 39.2762 bits (90), Expect = 8.326e-16
Identity = 30/104 (28.85%), Postives = 45/104 (43.27%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRF----------TLTENNNIGAPIGYVRAYDPDS-NENGRVSYQILNNDENYYFTI 1632
             D E+   Y++ +R  D G PPL G     + ++D NDN P      IRF          ++ E+   G     V   D DS   NG +S  I+  +E  +F +
Sbjct:  183 LDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPA-----IRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVL 281          

HSP 19 Score: 58.151 bits (139), Expect = 4.228e-15
Identity = 68/304 (22.37%), Postives = 112/304 (36.84%), Query Frame = 3
Query:  399 LEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQ-----WPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG---GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDL---NDTTYFTM 1277
            L+V V + D NDN P F       S+ E+S +G+ L     D L      +   F         R+   F+A R +T+ ++  +    P                             G  T  + ++DVNDN P       P    S +V E    G +  L      DS T NG++   I   + +   +     + G  +   +  L    +  Y    I A D G    R  + ++ + + D NDHAP  A+    A++ E       +  V   D D G+N++    +   ND  +F++
Sbjct:  120 LQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAALR----DLLHRGRGPLAVPFDPKTGMVSTRQPLDFEARRQYTLSLRAADGGNPPL---------------------------SGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMY-NLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLGWFSV 391          

HSP 20 Score: 41.5874 bits (96), Expect = 4.228e-15
Identity = 30/83 (36.14%), Postives = 35/83 (42.17%), Query Frame = 1
Query: 1345 DTFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSY 1593
            D   DRE  S   + I   D G  P       TVT++D ND  P F       T  EN+  G  +  V A D D  ENG V Y
Sbjct:  401 DGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRY 483          

HSP 21 Score: 55.0694 bits (131), Expect = 1.415e-14
Identity = 57/200 (28.50%), Postives = 89/200 (44.50%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSI 2264
            +DRE    Y+L + A D+G   L  +CTV +++LD ND  P F +       +      +  +L  +TA D+D G +G V YAI     H+    +     + +           +D E     +  + A D G+P  S+   ++V V D NDN P F   +    F +I  +  +G  +    A DPD   NG + YSI
Sbjct: 1035 LDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLS--VDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAIDRSTGSVFLARR--------LDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAF---LPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSI 1221          

HSP 22 Score: 42.743 bits (99), Expect = 1.415e-14
Identity = 35/114 (30.70%), Postives = 53/114 (46.49%), Query Frame = 1
Query: 1354 FDRESL------SFYSVLIRCIDLGRP-PLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFT-------ITILGKIE 1653
            FDRE+L      + +S  +   D GRP PL       V + D NDN P+F     + +++E+ +    +  V A D D   NG + Y I   +E   FT       IT+LG ++
Sbjct:  923 FDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGKFTVDASTGQITLLGSLD 1036          

HSP 23 Score: 50.8322 bits (120), Expect = 2.289e-14
Identity = 34/105 (32.38%), Postives = 47/105 (44.76%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITILGKIEAKWKL 1668
             DRE L  Y ++++  D G PPL      TV + D NDN P F       ++ EN   G  +  V A DPD   NG V YQ+   D   +    + G +  +  L
Sbjct:  512 LDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVNAVTGAVSTRVSL 616          

HSP 24 Score: 46.595 bits (109), Expect = 2.289e-14
Identity = 69/264 (26.14%), Postives = 112/264 (42.42%), Query Frame = 3
Query: 1653 SQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF-KQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNF-INISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNI 2438
            +++ +DRE +  Y L + A D G         V I + D  D  P F +  Y + + E     T+   +G V+A   DL  N  V Y I       +         +             +DRE+    Q  ++A   G   ++  A+V V V DVN++ P F    ++ ++ ++I+ D  V     +  A D D G+NG + Y I      E+   + +  DG+L +   L +RE  R    L + A D G  P +  VTVN+
Sbjct:  612 TRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTL---VGSVSASTLDL--NANVTYLIVSGDQRGSFSIEWSGGRIFTAN--------AIDREEQAFYQLRVVANSGG---VAGEASVSVLVHDVNNHAPVF----DRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEK---FGIFPDGQLYVRYEL-DRE-TREEYSLTVSAMDTGVEPLSSSVTVNV 850          

HSP 25 Score: 75.0998 bits (183), Expect = 1.095e-13
Identity = 84/282 (29.79%), Postives = 137/282 (48.58%), Query Frame = 3
Query: 1656 QMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF-KQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMV------SIQAEIIAYDNGKPQ-LSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTD-SQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQND---GRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYIPNNLTP 2465
            + E+DRE +++YSLT+ A D G   L+ + TV++ +LDVND  P+F    Y +   E      + +++G V A D D G NG V Y+  +            +N    +  G +    V DRE ++      S    ++A D G+P+ L   A V V V DVNDN P+F   + + +    +++ +Q+ +V A+    D D+G NG + Y+I      E N   +   D   G++ L  +L   E       L++ A+D+GT P A   TV ++ +  N  P
Sbjct:  817 RYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQ---EVGSLVGAVQATDADAGSNGGVTYSFEKP----------QVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTAS----DVDEGVNGALRYAI-----NEGNEGGKFTVDASTGQITLLGSLDREETASY--TLVVSATDSGTSPLAASCTVAVQVLDENDNP 1074          

HSP 26 Score: 54.6842 bits (130), Expect = 3.081e-13
Identity = 73/269 (27.14%), Postives = 120/269 (44.61%), Query Frame = 3
Query: 1653 SQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYF------YQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKP-QLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNI 2438
            ++  +D E + QY+L++ A D G P L+   T  I++LDVND  P  +  Y         + E     T+ A++    AD      NG +  +I       N + +  L+   +    +L +   +DRE++      I+A DNGKP   SA A+++V V DVND+ P+F           +S  +  G  + +  A D D G N  + YSI+S   +     + +     L+ T    +RE +     L I A D G  PK    ++ +
Sbjct:  179 TRQPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPT--ANGELSVSIV----GGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFA---LSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLGW---FSVDESTGLVTTDGKVDRE-VASSVVLNISAQDQGAQPKTAYTSLTV 434          

HSP 27 Score: 38.891 bits (89), Expect = 3.081e-13
Identity = 20/62 (32.26%), Postives = 32/62 (51.61%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPI 1539
             DRE+   Y++ ++  D G P   G     VT+ D NDN P F     R ++ E++ +GA +
Sbjct:   94 LDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAAL 155          

HSP 28 Score: 65.0846 bits (157), Expect = 9.605e-11
Identity = 58/222 (26.13%), Postives = 95/222 (42.79%), Query Frame = 3
Query:  279 FILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQ-----VLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKY 923
            F L + +G ++    +DRE    +A      +L    G+        + V + D NDN P+F  R    +I E+   G+E+   +A D D   N  +RY   DI S D      F+                   L + + +DRE    +EL + A D G   +  + ++ V++ DVND SP +     +   +E  +  P++ LQ   RDD    +GQ+ Y
Sbjct: 1892 FALNTVTGEVRLVRELDREARQSYA----LTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRY---DIASGDP--TGDFRLDPVLGT------------LAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENTQGPPVLILQVVARDDDLGSSGQVTY 2092          

HSP 29 Score: 44.669 bits (104), Expect = 4.816e-9
Identity = 75/345 (21.74%), Postives = 139/345 (40.29%), Query Frame = 3
Query:  270 NNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQVLEVM--VYIN--DENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIK--DIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQG---SCTITVSII--DVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFY--IAXXXXXXXXXXXXXMDLKTYITFFIT--AVDGGGRE-NSTA-VTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDL 1253
            +  F L   +G L     +DRE+       C  +   + +G  L     +Y+N  D NDN P          + E++  G+ L   +A D D   N+ + + I   D   R     N  Q                   L + + +DRE    + L++   D  +      S  + VS+I  DVNDN+P + +   +   ++      +  +QA D D  S  N  ++Y ++ +  +            A +++    + ++ +D +   ++ +T  AVD G     STA + + + D ND+AP     +  A+I E++     +  +   D D+G N +   D+
Sbjct: 1671 DGAFGLHPVTGALNVTRPLDRESRA-----CYVLRARATDGGGLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGR-FAVGNDGQ-------------------LSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAPEDSPVGAVVATVQAVDPD--SGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDI 1988          

HSP 30 Score: 34.2686 bits (77), Expect = 4.816e-9
Identity = 29/101 (28.71%), Postives = 43/101 (42.57%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAP--IGYVRAYDPDSNENGRVSYQILNNDENYYFTITILGKI 1650
             DRE  + Y + +R  D G P         VT+ D ND +P F          EN   G P  I  V A D D   +G+V+Y     ++   F+++  G +
Sbjct: 2012 LDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENTQ-GPPVLILQVVARDDDLGSSGQVTYAAAGGNDGGAFSVSPDGHV 2111          

HSP 31 Score: 58.151 bits (139), Expect = 1.504e-8
Identity = 75/266 (28.20%), Postives = 112/266 (42.11%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGE--PS-LNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVV---DREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQND-GRLILTKNL-REREGIRLPDRLIIRASDNGTPPKAELVTVNI 2438
            +DRE +  Y+L +   D     P+ L+    V + + DVND  P F         E +    + A++  V A D D G N  V YA+    D        G       L  +     +V   DRE   S    ++A D G+P L++ A + V V D NDN P+F     +     I+ D   G  +    A DPD+G NG + Y I S         ++L    G L + + L RER        L +RA D G P +++  +V +
Sbjct: 1791 LDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAPEDS---PVGAVVATVQAVDPDSGRNSYVEYAL--ATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFP---RREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGD---FRLDPVLGTLAVARPLDRERTASY---ELAVRARDGGGPARSDTASVRV 2042          

HSP 32 Score: 54.6842 bits (130), Expect = 1.516e-7
Identity = 69/287 (24.04%), Postives = 116/287 (40.42%), Query Frame = 3
Query:  402 EVMVYINDENDNIPQFSMRH-KTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG-----GRENSTAVTIEIEDCNDHAPNIA-IY----KSTASIRENDRTPLVLTSVMVNDDDK 1223
            EV V + D NDN P F       ++ +E++ +G ++ L TA D D  PN +  +  K +   +  R+          +  + + +    +L     +DRE    + L + AED G  ++ G   + V++ D NDN P +       +V E    G  +      RD      G +        PK  +++             ++     + +   T  + A DGG     GR  +TAV I++ D ND+ P I  +Y      +AS+ E+     V   V V D D 
Sbjct:    8 EVRVVVGDVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHAYKIVSGNEEGRL----------VPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAAL------RDLLHRGRGPLAVPF---DPKTGMVS-------------TRQPLDFEARRQYTLSLRAADGGNPPLSGR--ATAV-IQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADS 259          

HSP 33 Score: 53.5286 bits (127), Expect = 3.436e-7
Identity = 29/82 (35.37%), Postives = 41/82 (50.00%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
             D E+   Y + +   D GRPP     +  V + D NDN P F   D+  ++ EN  IG  +  V A DPD++ NG + Y I
Sbjct: 1140 LDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSI 1221          

HSP 34 Score: 48.9062 bits (115), Expect = 8.609e-6
Identity = 52/185 (28.11%), Postives = 84/185 (45.41%), Query Frame = 3
Query:  405 VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDR-FELILIAEDSG-----KQQGSCTITVSIIDVNDNSPQW--PTVNISKTVKECDRQGPLV-ELQAFDRDDSSTPNGQIKYKIS 932
            ++V++ D NDN P F       SI EN  IG+ +   TA D D++ N  + Y I            QF    +FTI  ++        +    EIDRE     FE+ + A D       ++     +TV + D NDN+P++  PT  +   ++     G +V  LQA D D++   N  ++Y ++
Sbjct: 1168 LVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSI----------ARQFPPGAHFTIDPESGE------ICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTAILVDGLRAA--AGSVVGTLQASDPDEAE--NAAVRYAVT 1332          
BLAST of Protocadherin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006996.1 (pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 gene:ENSPMAG00000006222.1 transcript:ENSPMAT00000006996.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.6918 bits (143), Expect = 3.484e-28
Identity = 86/276 (31.16%), Postives = 123/276 (44.57%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDT--CTVHIRILDVNDCVPVFKQ-QYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQM-----VSIQAEII-AYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQV------GKVLANFEAEDPDKGENGTITYSIISHKHMEQNLP---YQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNI 2438
            +DRE   QY L + A D G+ +   T   TV+I +LDVND  P ++   Y   I E     T    +  V+A D DL ENGT+ YAI    D  N    I     KI   G+      +DRE +      S+++ ++   D G P   A A+  V VL  + N        N+ +F+ +    QV         L    A DPD+G NG +TYS      M   LP   +QL     LI T    +RE +    +L + A+D GTP  +   T+++
Sbjct:  304 LDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTD---IFTVSAADPDLNENGTLVYAI----DPPNPFYRINAASGKIRTTGLQ-----LDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVND-------NEPSFVGLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYS------MTAALPRPDFQLDAATGLITTLVQLDREAVAA-YQLRLVATDRGTPALSSTTTLSL 553          

HSP 2 Score: 58.5362 bits (140), Expect = 3.484e-28
Identity = 61/214 (28.50%), Postives = 94/214 (43.93%), Query Frame = 3
Query:  732 EDSGKQQGSCTITVSIIDVNDNSP--QWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKEL--INRLFYIAXXXXXXXXXXXXXMDLKTYITFFIT--AVDGGGRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDT----TYFTMVKECLQSIKWTAALYVQYQKNP 1343
            E SG+  GS  + +++I+ NDN P    P  N+S  V E    G  V +Q    D  +   GQ+ Y  SD+S K  L   + L  +A +           +D +    F +T  A DGGG+E +  V I + D ND+ P         + REND +   +  V   D+D   N+Q    +  T    +YF++       +  T A  + Y+K P
Sbjct:    5 ETSGEHWGSARVHITLINENDNRPIFSLPLYNVS--VWENATLGTSV-VQVLATDLDAGVFGQVSYHFSDDSDKFSLDPASGLISVAAA-----------LDFEATPRFTVTVMARDGGGQETAGRVRINLLDVNDNTPVFQRDSYVGTARENDNSLTPVVRVRATDEDSPPNNQITYSILPTSAYSSYFSITVSGGYGVV-TLARALDYEKIP 203          

HSP 3 Score: 45.8246 bits (107), Expect = 3.484e-28
Identity = 28/71 (39.44%), Postives = 37/71 (52.11%), Query Frame = 1
Query: 1381 SVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPD-SNENGRVS 1590
            S+ I  +D G PPL       V + DENDN+P F  +     + EN   GA + YV A D D S E G++S
Sbjct:  208 SLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSPEYGQLS 278          

HSP 4 Score: 58.151 bits (139), Expect = 1.339e-25
Identity = 71/288 (24.65%), Postives = 120/288 (41.67%), Query Frame = 3
Query:  399 LEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG----KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGP-LVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGG---RENSTA-VTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINS 1235
            +  +V + DENDN P F     +++I EN   G+ +    A D D  P       I  +      R+N    +R   I   T+             +DRE + ++ LI+ A D G    ++ G  T+ ++++DVNDN P W  +  + T+ E    G  +  + A D D +   NG + Y I   +P   +      I  + L L  + L  +   +  +  ++  D G    R  ++A VT+ ++D ND+ P+         + E       L  V   D D+G N 
Sbjct:  225 VTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSPEYGQLSLIYSLEGSTQFRIN----ARSGDITSTTL-------------LDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPDLNE--NGTLVYAIDPPNPFYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQVTATDPDEGANG 493          

HSP 5 Score: 53.1434 bits (126), Expect = 1.339e-25
Identity = 39/98 (39.80%), Postives = 52/98 (53.06%), Query Frame = 3
Query: 1638 FREN--RSQMEIDREIKDQYSLTIMAKDNGEPS--LNDTCTVHIRILDVNDCVPVF-KQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAI 1916
            FR+   R+ + +DRE K  YSL I A DNG        T T+ + +LDVND  P+F +  Y   + E     T  AI+ +V A D D G NG V+Y I
Sbjct:  617 FRDGLVRTVVSLDRETKASYSLVIEAIDNGPAGSRRTGTTTLDVLVLDVNDNRPLFLEGSYEVSVPEN---VTRGAIILQVQATDIDEGINGRVWYRI 711          

HSP 6 Score: 43.8986 bits (102), Expect = 1.339e-25
Identity = 24/93 (25.81%), Postives = 45/93 (48.39%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
             DRE+++ Y + +   D G P L      ++ ++D NDNAP F       +L E+    + +  +   D DS  N  +S+ I   +++  F++
Sbjct:  523 LDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPTFHPARSAVSLMESVARDSVVISLNCTDADSGLNAELSFFITGGNQDGQFSV 615          

HSP 7 Score: 56.6102 bits (135), Expect = 2.313e-18
Identity = 73/275 (26.55%), Postives = 121/275 (44.00%), Query Frame = 3
Query: 1629 NHYFRENRSQ-------MEIDRE------IKDQYSLTIMAKDNGEPSLNDTCTVHIRIL--DVNDCVPVF-KQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFI-NISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNG 2402
            N ++R N +        +++DRE           S+ +   D G P    T +  + +L  DVND  P F    Y  Q+ EG      ++ L +VTA D D G NG V Y++       + Q +    L+   ++        +DRE + + Q  ++A D G P LS+   + + VLDVNDN P F    + ++ + +++ DS    V+ +    D D G N  +++ I       Q   + +     L+ T    +RE  +    L+I A DNG
Sbjct:  391 NPFYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEG---LPANSTLFQVTATDPDEGANGNVTYSMTAALPRPDFQLDAATGLITTLVQ--------LDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPTFHPARSAVSLMESVARDS----VVISLNCTDADSGLNAELSFFITGGNQDGQ---FSVGFRDGLVRTVVSLDRE-TKASYSLVIEAIDNG 646          

HSP 8 Score: 54.299 bits (129), Expect = 2.313e-18
Identity = 32/86 (37.21%), Postives = 44/86 (51.16%), Query Frame = 1
Query: 1348 TFFDRESLSFYSVLIRCID--LGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
            T  DRE++S Y +++R +D   G     G     +T++D NDN P +       T+ EN   G  I  V A DPD NENG + Y I
Sbjct:  302 TLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTLVYAI 387          

HSP 9 Score: 55.4546 bits (132), Expect = 1.520e-17
Identity = 72/338 (21.30%), Postives = 143/338 (42.31%), Query Frame = 3
Query:  279 FILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQ---VLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFE------LILIAEDSG----KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKE-CDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFN 1244
            F + + SG +     +DRE + ++  + + +     N Q   +  V + + D NDN P +      ++I EN+  G+++   +A D D   N  + Y I         R+N           I+T             ++DRE+++         +++   D G    +   S T+TV + DVNDN P +  +  +  V E       L ++ A D D+ +  NG + Y ++   P+ +     F +  ++  +++      +        + A D G     ++T +++ + D ND+AP     +S  S+ E+     V+ S+   D D G+N++ +
Sbjct:  289 FRINARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTLVYAIDP--PNPFYRINAASGK------IRTTG----------LQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQVTATDPDEGA--NGNVTYSMTAALPRPD-----FQLDAATGLITTLVQLDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPTFHPARSAVSLMESVARDSVVISLNCTDADSGLNAELS 601          

HSP 10 Score: 52.7582 bits (125), Expect = 1.520e-17
Identity = 33/97 (34.02%), Postives = 50/97 (51.55%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRP--PLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITI 1638
             DRE+ + YS++I  ID G       G     V ++D NDN P F       ++ EN   GA I  V+A D D   NGRV Y+I++ +++  F + +
Sbjct:  628 LDRETKASYSLVIEAIDNGPAGSRRTGTTTLDVLVLDVNDNRPLFLEGSYEVSVPENVTRGAIILQVQATDIDEGINGRVWYRIISGNQDGNFLVNV 724          

HSP 11 Score: 73.559 bits (179), Expect = 3.213e-13
Identity = 68/249 (27.31%), Postives = 115/249 (46.18%), Query Frame = 3
Query:  405 VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQ-GPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLK----TYITFFITAVDGGGRENSTAVT--IEIEDCNDHAP 1130
            V + + +ENDN P FS+    +S+ EN+ +G+ +    A DLD+     + Y   D    D  + +   AS   ++                  +D E   RF + ++A D G Q+ +  + ++++DVNDN+P +   +   T +E D    P+V ++A D D  S PN QI Y I   S      +  F I  S  +      + +D +      I+  I A+DGG    ++ VT  +E+ D ND++P
Sbjct:   16 VHITLINENDNRPIFSLPLYNVSVWENATLGTSVVQVLATDLDAGVFGQVSYHFSD----DSDKFSLDPASGLISV---------------AAALDFEATPRFTVTVMARDGGGQETAGRVRINLLDVNDNTPVFQRDSYVGTARENDNSLTPVVRVRATDED--SPPNNQITYSILPTS----AYSSYFSITVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSP 239          

HSP 12 Score: 46.595 bits (109), Expect = 7.194e-13
Identity = 33/89 (37.08%), Postives = 49/89 (55.06%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGE-PSL--NDTCTVHIRILDVNDCVPVFKQ-QYFYQITEGNGLATIHAIL-GKVTADDKDLGENGTVYYAI 1916
            +DRE   +Y LT+  +DN + PS    D+  + + ILD ND  PVF Q  Y  +I E +   T+  +L G + A D D G N T+ Y++
Sbjct: 1455 LDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSL 1543          

HSP 13 Score: 45.4394 bits (106), Expect = 7.194e-13
Identity = 25/75 (33.33%), Postives = 39/75 (52.00%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNEN 1578
             DRE+ +FY++ I   D+G PPL       V ++D +DN P F +     +L+E   + A +  VRA D +   N
Sbjct: 1347 LDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRVRASDANEGRN 1421          

HSP 14 Score: 50.0618 bits (118), Expect = 4.558e-12
Identity = 31/85 (36.47%), Postives = 39/85 (45.88%), Query Frame = 1
Query: 1381 SVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTEN-NNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
            S   R I L   P        + I DENDNAP FG+      LTE  +  G  +  V A DPD  +N RV Y I++ +    F I
Sbjct: 1139 SASTRGICLTATPAQATTSVLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVYAIVSGNTAATFGI 1223          

HSP 15 Score: 39.6614 bits (91), Expect = 4.558e-12
Identity = 58/191 (30.37%), Postives = 83/191 (43.46%), Query Frame = 3
Query: 1689 YSLTIMAKDNG-EPS--LNDTCTVHIRILDVNDCVPVFKQQYFYQI--TEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKF-KYPINKMNFINISTDSQVGKVLANFEAEDPDKGEN 2243
            Y L + A D   +P+  L  T TV + + DVND  P F + Y   I  +EG     I   +    A D+D G NG + Y+I    D   R   +               Y  +DRE        I+A D G P L++   V V VLDV+DN P F   P N     ++S  + V  +++   A D ++G N
Sbjct: 1245 YLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWFLRSYEGPIDVSEGQPGPRIATFM----ASDQDSGLNGELEYSI---IDGDPRNEFVISPADGDLRVRR---YVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANA----SLSEAAAVLAIVSRVRASDANEGRN 1421          

HSP 16 Score: 50.8322 bits (120), Expect = 2.277e-11
Identity = 66/259 (25.48%), Postives = 110/259 (42.47%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQ-----QYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVS----IQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQN--LPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTP 2408
            IDRE +  Y+L ++A D G P L+ +  V + + DVND  P F            ++ G+ +AT+ A                       + Y   N +    +  +  N   +    G+V   +++          +A D+G+P L   A + V+VLDVND++P F  P N    +NI+    V   +    A D D+G+NG + YS +    +       +++     +I T    +RE   +   LI+ ASD G P
Sbjct: 2018 IDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKAT----------------------ENYKGHNTKYTYKIAGIGKNAFTVHATSGLVTSTRLLKSYERFNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVFVLPPNG-TVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFRINATSGIISTARALDRESQAV-YSLILLASDQGQP 2252          

HSP 17 Score: 36.5798 bits (83), Expect = 2.277e-11
Identity = 25/83 (30.12%), Postives = 39/83 (46.99%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGS-DDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
            F  ++  F    I  +D G PP       +V ++D NDN P F S      ++ E    G  +  V A D D+  NG+V+++I
Sbjct: 1911 FVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVPIFLSPGGYAVSVVELGAPGTLVASVWATDADAGPNGQVTFRI 1993          

HSP 18 Score: 63.5438 bits (153), Expect = 3.123e-10
Identity = 37/83 (44.58%), Postives = 50/83 (60.24%), Query Frame = 3
Query: 1650 RSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF-KQQYFYQITEGNGLATIHAILGKVTADDKDLGEN 1895
            R  +E+DRE +  Y+LTIMAKD G P LN T TV +R+LDV+D  PVF        ++E    A + AI+ +V A D + G N
Sbjct: 1342 RRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEA---AAVLAIVSRVRASDANEGRN 1421          

HSP 19 Score: 62.7734 bits (151), Expect = 5.494e-10
Identity = 82/341 (24.05%), Postives = 141/341 (41.35%), Query Frame = 3
Query:  270 NNYFILQSHSGILKQRNNIDRE-------TMCKHADVCQKIILISINGQVLEVMVYINDENDNIPQFSMRHKTL-SIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTI-NRMKIPYLKLIKEIDREEIDRFELI-LIAEDSGKQQGSCTITVSII--DVNDNSPQWPTV-NISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYI--TFFITAVDGGGR--ENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQF 1241
            +N  ++ +  G +  +  +DRE       T+       ++ I +  N     V V + DENDN P+F     TL  ++E++  G+ L++  A D D+  N  +             R +    +R    +I  I N   +  + + K    E+  +F L  ++A D G    S T  +S+I  DVNDN P + +    + +V E    G LV    +  D  + PNGQ+ ++I      K        I  S   +       +D +T    T  + AVD G      S  V + ++D ND  P       T S+ E+      + +V   ++ KG N+++
Sbjct: 1773 DNAELIAALQGEITTQAALDREATDSYMLTVLSRDGGPREAIAVLTNKPGAYVYVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVS-----------ARAHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVPIFLSPGGYAVSVVELGAPGTLVA-SVWATDADAGPNGQVTFRIESGGGDK------LSIGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKATENYKGHNTKY 2095          

HSP 20 Score: 61.2326 bits (147), Expect = 1.602e-9
Identity = 86/384 (22.40%), Postives = 153/384 (39.84%), Query Frame = 3
Query:  141 KLKISENKGSGEDLINLKNYIIIHKLP-INSSGTYNIISNEPDINNYFILQSHSGILKQRN-NIDRETMCKHADVCQKIILISINGQ---------VLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSII--DVNDNSPQW-PTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGG----RENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQ 1238
             + I EN   G D+     + +    P +N +GT     + P  N ++ + + SG ++     +DRE +   +    + I++S   +            V V + D NDN P F      L + E     S L   TA D D   N  + Y +     R   +++   A+   T  +               ++DRE +  ++L L+A D G    S T T+S++  DVNDN+P + P  +    ++   R   ++ L   D D  S  N ++ + I+  +   +     F +      + +      + K   +  I A+D G     R  +T + + + D ND+ P         S+ EN     ++  V   D D+GIN +
Sbjct:  354 AVTIVENTPGGTDI-----FTVSAADPDLNENGTLVYAIDPP--NPFYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRPDFQLDA--ATGLITTLV---------------QLDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPTFHPARSAVSLMESVARDSVVISLNCTDAD--SGLNAELSFFITGGNQDGQ-----FSVGFRDGLVRTVVSLDRETKASYSLVIEAIDNGPAGSRRTGTTTLDVLVLDVNDNRPLFLEGSYEVSVPENVTRGAIILQVQATDIDEGINGR 706          

HSP 21 Score: 60.8474 bits (146), Expect = 2.170e-9
Identity = 55/190 (28.95%), Postives = 87/190 (45.79%), Query Frame = 3
Query:  405 VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSL---PT-ADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEI--DRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVE-----LQAFDRDDSSTPNGQIKYKISDNS 941
            ++V I DENDN P FS       I ENS  G+ L++   P  A D D   N+ + Y +               +S YF I     +R  +  + L + +DRE I   R EL ++ +D G++  +  + V+++DVNDN+   PT N++          P V      ++A DRD      G ++Y I+   
Sbjct: 1486 MIVTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSLLG------------GSSAYFLI---DRDRGNV-SMALGQGLDREGIPGGRLELTILVQDGGRRNATVRLGVTVLDVNDNT---PTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGG 1656          

HSP 22 Score: 42.3578 bits (98), Expect = 2.778e-9
Identity = 76/271 (28.04%), Postives = 118/271 (43.54%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVV------DREQMV--SIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKF---KYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASD--NGTPPKAELVTVNI 2438
            +D E   ++++T+MA+D G         V I +LDVND  PVF++  +      N  +    +  +V A D+D   N  + Y+I     +S+                +   YGVV      D E++   +I   I+A D G P L++    IV+V D NDN P F    Y I      NI   + V  V A    + P+ G+   I YS      +E +  +++      I +  L +RE +     LI+RA D  +G   K  + TVNI
Sbjct:   91 LDFEATPRFTVTVMARDGG--GQETAGRVRINLLDVNDNTPVFQRDSYVGTARENDNSLTPVV--RVRATDEDSPPNNQITYSILPTSAYSS-----------YFSITVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNSYSIAIPE--NILAGATVLYVNATDGDQSPEYGQLSLI-YS------LEGSTQFRINARSGDITSTTLLDREAVSQ-YILIVRAVDGGDGNDQKTGIATVNI 336          

HSP 23 Score: 37.7354 bits (86), Expect = 2.778e-9
Identity = 19/59 (32.20%), Postives = 32/59 (54.24%), Query Frame = 1
Query: 1444 VTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENY 1620
            +T+I+ENDN P F       ++ EN  +G  +  V A D D+   G+VSY   ++ + +
Sbjct:   18 ITLINENDNRPIFSLPLYNVSVWENATLGTSVVQVLATDLDAGVFGQVSYHFSDDSDKF 76          

HSP 24 Score: 60.077 bits (144), Expect = 3.421e-9
Identity = 67/237 (28.27%), Postives = 101/237 (42.62%), Query Frame = 3
Query: 1701 IMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPP 2411
            I+A D G P  + T  + + +LDVND VP+F     Y ++    L     ++  V A D D G NG V + I              L++   +    +     +DRE   +    ++A D G P LS  A V V V DVND +P F  P+  ++ +       VG  +A  +A +  KG N   TY I     + +N        G +  T+ L+  E       L   A+D+G PP
Sbjct: 1923 IVALDGGSPPRSTTFNLSVIVLDVNDNVPIFLSPGGYAVSVVE-LGAPGTLVASVWATDADAGPNGQVTFRIESG-------GGDKLSIGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLE---SLSVGSFVATVKATENYKGHNTKYTYKIAG---IGKNAFTVHATSGLVTSTRLLKSYERF----NLTAVATDHGRPP 2141          

HSP 25 Score: 40.4318 bits (93), Expect = 7.207e-9
Identity = 65/272 (23.90%), Postives = 102/272 (37.50%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEP-SLNDTCTVHIRILDVNDCVPVF-------KQQYFYQITEGNGLATIHAILGKVT-ADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVV----DREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKF--------------------KYPI--NKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIIS-----HKHMEQNLPYQLQNDGRLILTKNLREREGI 2360
            +DRE +  YSL ++A D G+P S   T  + + + D++D  PVF            + I E +   T    +G V+ A D D+G N  VYY I    +  N+                L+ +G++    D ++ VS    II   +  P  +                P+F                    ++P+  N      ++ D++VG  L   EA D D G N  + Y I+S     H        Y +   GR        ER+GI
Sbjct: 2232 LDRESQAVYSLILLASDQGQPVSYESTQPLQVVLDDIDDNEPVFIVLPDGGAPYQSFSIPEHSPPGT---AVGNVSGAVDADVGANAIVYYFIAAG-NEGNK--------------FNLSRWGLLVVLSDLDREVSPYYAIIVKASSNPNWTP----------AVTTGPEFDPSKDRTLREVRVYLEDINDQWPVFTNHEYTAGVAVDAKVGSELLQLEAVDRDVGNNSIVLYRILSILYIKHSSNSSTRMYNIFTLGRC---ARAGERDGI 2472          

HSP 26 Score: 38.1206 bits (87), Expect = 7.207e-9
Identity = 25/70 (35.71%), Postives = 34/70 (48.57%), Query Frame = 1
Query: 1402 DLGRPPLVGEKLFTVTIIDENDNAPKF--GSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILN 1605
            D GRPPL G+    V ++D ND+ P F    +     +TE   +   I  V A D D  +NG V Y  L+
Sbjct: 2136 DHGRPPLWGQAGLYVEVLDVNDHRPVFVLPPNGTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLH 2205          

HSP 27 Score: 40.817 bits (94), Expect = 4.608e-8
Identity = 28/98 (28.57%), Postives = 43/98 (43.88%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEK---LFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPI----GYVRAYDPDSNENGRVSYQILNNDENYYF 1626
             DRE ++ Y + +   D    P    K   +  VTI+DENDN+P F        + EN+  G  +    G + A D D   N  ++Y +L     Y+ 
Sbjct: 1455 LDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSLLGGSSAYFL 1552          

HSP 28 Score: 35.039 bits (79), Expect = 4.608e-8
Identity = 30/92 (32.61%), Postives = 45/92 (48.91%), Query Frame = 3
Query: 1665 IDRE--IKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF----KQQYFYQITEGNGLATIHAILGKVTADDKDLG--ENGTVYYAI 1916
            +DRE     +  LTI+ +D G    N T  + + +LDVND  P F    +  +  + +   G + I      V A D+DLG  + GTV Y+I
Sbjct: 1568 LDREGIPGGRLELTILVQDGGR--RNATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVI-----VVKAMDRDLGVCDAGTVRYSI 1652          

HSP 29 Score: 37.3502 bits (85), Expect = 1.094e-6
Identity = 31/105 (29.52%), Postives = 48/105 (45.71%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRP-PLVGEKLFTVTIIDENDNAPKF------GSDDIRFTLTENNNIGAPIGYVR-AYDPDSNENGRVSYQILNNDENYYFTITILG 1644
             DRES + YS+++   D G+P      +   V + D +DN P F      G+    F++ E++  G  +G V  A D D   N  V Y I   +E   F ++  G
Sbjct: 2232 LDRESQAVYSLILLASDQGQPVSYESTQPLQVVLDDIDDNEPVFIVLPDGGAPYQSFSIPEHSPPGTAVGNVSGAVDADVGANAIVYYFIAAGNEGNKFNLSRWG 2336          

HSP 30 Score: 33.4982 bits (75), Expect = 1.094e-6
Identity = 28/99 (28.28%), Postives = 48/99 (48.48%), Query Frame = 3
Query: 1662 EIDREIKDQYSLTIMAKDNG------------EPSLNDTC-TVHIRILDVNDCVPVFKQQYFYQITEGNGL-ATIHAILGKVTADDKDLGENGTVYYAI 1916
            ++DRE+   Y++ + A  N             +PS + T   V + + D+ND  PVF     ++ T G  + A + + L ++ A D+D+G N  V Y I
Sbjct: 2343 DLDREVSPYYAIIVKASSNPNWTPAVTTGPEFDPSKDRTLREVRVYLEDINDQWPVFTN---HEYTAGVAVDAKVGSELLQLEAVDRDVGNNSIVLYRI 2438          

HSP 31 Score: 51.2174 bits (121), Expect = 1.661e-6
Identity = 33/98 (33.67%), Postives = 48/98 (48.98%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDE-NYYFTITILG 1644
             D E+   ++V +   D G     G     + ++D NDN P F  D    T  EN+N   P+  VRA D DS  N +++Y IL     + YF+IT+ G
Sbjct:   91 LDFEATPRFTVTVMARDGGGQETAGR--VRINLLDVNDNTPVFQRDSYVGTARENDNSLTPVVRVRATDEDSPPNNQITYSILPTSAYSSYFSITVSG 186          

HSP 32 Score: 50.8322 bits (120), Expect = 2.617e-6
Identity = 26/98 (26.53%), Postives = 51/98 (52.04%), Query Frame = 1
Query: 1330 IKKIPDTFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYY 1623
            I+  P    DRE+ + Y++++  +D G PPL G  +  V + D ND  P F +     ++ E+ ++G+ +  V+A +     N + +Y+I    +N +
Sbjct: 2010 IRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKATENYKGHNTKYTYKIAGIGKNAF 2107          

HSP 33 Score: 49.6766 bits (117), Expect = 5.633e-6
Identity = 82/363 (22.59%), Postives = 140/363 (38.57%), Query Frame = 3
Query:  222 INSSGTYNIISNEPDINNYFILQSHSGILKQRN--NIDRETMCKH-ADVCQKIILISINGQVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAED-----SGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVEL---QAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMV---NDDDKGINSQFNCDLNDTTY 1268
            +N    Y+II  +P   N F++    G L+ R    +DRET   +   +  K +        L V V + D +DN P F       S+ E + + + +S   A D +                R+   + Q   + +           +   + + + +DRE +  + L L   D     S  ++ S  + V+I+D NDNSP +  V     + E    G ++ +     +  D     N  + Y +   S    LI+R       +L        +   +  +T  +   DGG R  +  + + + D ND+ P   +   TA + EN  +P V TSV+V    D D G+     CD     Y
Sbjct: 1313 LNGELEYSIIDGDP--RNEFVISPADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRVRASDAN--------------EGRNCAALLQHSPTSFCNGERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSLLGGSSAYFLIDRDRGNVSMALGQGLDREGIPGGRLELTILVQ--DGGRRNATVRLGVTVLDVNDNTPTFNVTSQTAHVLEN--SPAVGTSVIVVKAMDRDLGV-----CDAGTVRY 1650          
BLAST of Protocadherin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004042.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.2174 bits (121), Expect = 5.695e-23
Identity = 57/200 (28.50%), Postives = 92/200 (46.00%), Query Frame = 3
Query: 1683 DQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF-KQQYFYQITEGNGLATIHA---ILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIIS 2270
            ++YS  + A D G P L+   TV I I+  N   P F +++Y   +      AT+ A   IL  ++A D D   NG + Y++     +++R+ ++           +    G      + S+  E  A D G+P LS+ A  I+ V + N   P+F +P  +++   +  +   G  LA   A D D G NG I YSI S
Sbjct:  615 NKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVA-----ATVRAGTRIL-DMSAVDPDRDVNGQIAYSVVGG--NASRRFDVDAGGFLHLRASLAGDAG-----SIFSVTVE--ARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELS---LPENHPAGSSLARVTATDTDAGVNGAIVYSIAS 796          

HSP 2 Score: 50.0618 bits (118), Expect = 5.695e-23
Identity = 53/201 (26.37%), Postives = 91/201 (45.27%), Query Frame = 3
Query:  681 KEIDREEIDRFELILIAEDSGKQQGSC--TITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFIT--AVDGGG--RENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTT 1265
            + +D E    +EL++ A DSG    S    + V ++D+NDN+P++ +      V E      +V L A D+D  S  NGQ+ Y I D +     I  +F +  +      + +  +D +   ++ +T  A D G   +  +  V I + D ND++P      S A +RE+      +  V   D D+G N+     L D +
Sbjct:  292 RALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVVLTAVDKD--SGINGQVDYSIIDGN-----IGNVFRV--NPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQIFS-AHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPS 482          

HSP 3 Score: 44.669 bits (104), Expect = 5.695e-23
Identity = 28/89 (31.46%), Postives = 41/89 (46.07%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENY 1620
             +RE  S Y+V +R  D   P        T+ + D NDNAP+FG         E +   A +  V A D D   NG+V + + +  EN+
Sbjct:  500 LNREDRSGYAVKVRASD---PAWTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTENF 585          

HSP 4 Score: 56.225 bits (134), Expect = 2.298e-15
Identity = 26/71 (36.62%), Postives = 41/71 (57.75%), Query Frame = 1
Query: 1408 GRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENY 1620
            G P L G    TV + DENDN P+FG+ ++R  + E+  IG+ +  V A D D+  N  +SY++   D ++
Sbjct:    2 GEPRLTGTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGGDGHF 72          

HSP 5 Score: 44.669 bits (104), Expect = 2.298e-15
Identity = 26/85 (30.59%), Postives = 41/85 (48.24%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGE-PSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAI 1916
            +DRE ++ Y L + A D G  P L+ + T+ + + DVND  P F    +      +  A        VTA D D G NG + +++
Sbjct:   87 LDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVF--AVTARDADAGPNGDLRFSL 169          

HSP 6 Score: 59.6918 bits (143), Expect = 2.064e-14
Identity = 29/88 (32.95%), Postives = 46/88 (52.27%), Query Frame = 1
Query: 1372 SFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTIT 1635
            S +SV +   D GRPPL       +++ +EN  AP+F    +  +L EN+  G+ +  V A D D+  NG + Y I + D +  F I+
Sbjct:  719 SIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDIS 806          

HSP 7 Score: 37.7354 bits (86), Expect = 2.064e-14
Identity = 56/235 (23.83%), Postives = 100/235 (42.55%), Query Frame = 3
Query: 1662 EIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISH---KHMEQNLPYQLQNDGRLILTKNL-RERE 2354
            E+D E +  Y+L++ A D G  +  +   V I + DVND  P+     +Y +   N  +    ++  + A D D   N    Y++          +      +     G+L   G +D E   + +  + A++       + A V V +  VN+  P+F     + NF+ +S  + VG  + +  A D D G +GT+ Y +      K    N     ++ G +I++  L RERE
Sbjct:  817 ELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLV--MDAVDADSPSNAVTMYSL---------DDGEADLFVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQ--REYNFV-VSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVN-----EHTGEIIVSSQLDRERE 1032          

HSP 8 Score: 48.521 bits (114), Expect = 1.271e-13
Identity = 74/284 (26.06%), Postives = 117/284 (41.20%), Query Frame = 3
Query: 1644 ENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQND-GRLILTKNLRERE------GIRLPD-RLIIRASDNGTPPKAELVTVNIR-YIPNNLTPR 2468
            E RS   +DRE    Y LT+ A D G P+ + T  V I + D ND  P F Q +   + E    A +   + +V+  D D G N  + +++       +   + G   +             ++RE       ++ A D   P  +   +V + V DVNDN P+F        +I     S+   ++A   A D D G NG + + + S     Q   +++  D G +   + LR R+      G  L     ++ A D G PP +   TV I   +PN   PR
Sbjct:  391 EIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQIFSAHVRED---AAVGFPVLRVSTLDADEGPNAAITFSLLDPSLPFSIHPSTGEITVSRR----------LNREDRSGYAVKVRASD---PAWTVSTDVTIVVDDVNDNAPRFG---QTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRS-----QTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPR 650          

HSP 9 Score: 46.2098 bits (108), Expect = 1.271e-13
Identity = 29/93 (31.18%), Postives = 42/93 (45.16%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
             D E    Y +++   D G PP        V ++D NDNAP+F S      + EN      I  + A D DS  NG+V Y I++ +    F +
Sbjct:  294 LDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTP-PRTIVVLTAVDKDSGINGQVDYSIIDGNIGNVFRV 385          

HSP 10 Score: 68.9366 bits (167), Expect = 7.253e-12
Identity = 67/280 (23.93%), Postives = 116/280 (41.43%), Query Frame = 3
Query:  405 VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQG---SCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNS-------PKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGG--RENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMV 1208
            V V + DENDN+P+F       ++ E++ IGS+++L  A D D+  N+II Y ++                 +F++   T        +     +DRE  + + L + A D G   G   S T+ V++ DVND++P++               G  V      RD  + PNG +++ +S ++       P++ +I+                  L   +  +T  +   DGG   R   T VT+   D  +  P  A    + S RE D+ P    +V+ 
Sbjct:   12 VTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRG-------------GDGHFSVNPSTGQ------IITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAV-FAVTARDADAGPNGDLRFSLSGSASAGFSVDPRRGVIH--------------AARALQGPRDDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGEF-PRFAPGPRSFSFRE-DQPPGTTITVVA 255          

HSP 11 Score: 65.855 bits (159), Expect = 5.771e-11
Identity = 77/283 (27.21%), Postives = 122/283 (43.11%), Query Frame = 3
Query:  399 LEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITV--SIIDVNDNSPQWPTVNISKTVKECDRQG-PLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQ 1238
            L++ V + D NDN P+FS       + EN+   + + L TA D DS  N  + Y I D +  ++ R+N               N  +I   + +  +DRE +  +EL + A D G     CT+ V  S+ D NDNSP++  +  S  V+E    G P++ +   D D+   PN  I + + D S         F I  S+  ++       + ++     + A D      ST VTI ++D ND+AP            E      ++  V  +D D G N Q
Sbjct:  320 LKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVVL-TAVDKDSGINGQVDYSIIDGNIGNVFRVNP--------------NSGEI---RSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQI-FSAHVREDAAVGFPVLRVSTLDADEG--PNAAITFSLLDPSLP-------FSIHPSTGEITVSRRLNREDRSGYAVKVRASD-PAWTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQ 573          

HSP 12 Score: 63.929 bits (154), Expect = 2.205e-10
Identity = 70/251 (27.89%), Postives = 106/251 (42.23%), Query Frame = 3
Query: 1719 GEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGK-PQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYIPNNLTPR 2468
            GEP L  T TV + + D ND +P F           +  A I + +  V A D D G N  + Y +R    H +   + G  +   +          +DRE   S   E+ A D G  P LS+ A ++V V DVND+ P+F   +N        + +  G  +    A D D G NG + +S+        ++      D R  +    R  +G R    L +R SD G PP++ + TV +R+      PR
Sbjct:    2 GEPRLTGTGTVTVLVEDENDNLPRFGAAELRAAVPED--APIGSDVALVNATDADAGLNAIISYRLRGGDGHFSVNPSTGQIITTAS----------LDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRF---LNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAGFSV------DPRRGVIHAARALQGPRDDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGEFPR 231          

HSP 13 Score: 62.7734 bits (151), Expect = 6.063e-10
Identity = 69/248 (27.82%), Postives = 114/248 (45.97%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFY-QITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQ-NDGRLILTKNL--REREGIRLPDRLIIRASD 2396
            +D E +  Y L + A+D+G P  +    + + +LD+ND  P F    F+ ++ E     TI  +    TA DKD G NG V Y+I           NIG         G +     +DRE + S +  + A D G P       V++ V D NDN P+F     ++   ++  D+ VG  +      D D+G N  IT+S+     ++ +LP+ +  + G + +++ L   +R G  +     +RASD
Sbjct:  294 LDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVVL----TAVDKDSGINGQVDYSIIDG--------NIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRF----TQIFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSL-----LDPSLPFSIHPSTGEITVSRRLNREDRSGYAVK----VRASD 516          

HSP 14 Score: 55.8398 bits (133), Expect = 7.650e-8
Identity = 32/100 (32.00%), Postives = 53/100 (53.00%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNEN-GRVSYQILNNDENY--YFTITILG 1644
             DRES+  Y++ +  +D+G PP  G  +  V + D NDN P   +   +  +TEN   G  +  + A DPD   N G  ++Q+L +D  +  YF+++  G
Sbjct: 1134 LDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLLTSSAK--VTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSLSSSG 1231          

HSP 15 Score: 55.0694 bits (131), Expect = 1.118e-7
Identity = 80/353 (22.66%), Postives = 148/353 (41.93%), Query Frame = 3
Query:  222 INSSGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQV-LEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLV-ELQAFDRDDSSTPNGQI---------KYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENST--AVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQF 1241
            IN    Y+II    +I N F +  +SG ++  + +DRE +  +    +     S      ++V++ + DENDN P+F+    +  ++E++ +G  +   +  D D  PN+ I + + D              S  F+I   T        + + + ++RE+   + + + A D      S  +T+ + DVNDN+P++          E      LV  + A D DD +  NGQ+          +++  +S +   +  L Y         + G    +L  Y +F +TA+D G    S+   VTI I   N +AP     + +  +    R    +  +   D D+ +N Q 
Sbjct:  366 INGQVDYSIIDG--NIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQIF-SAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLD-------------PSLPFSIHPSTGE------ITVSRRLNREDRSGYAVKVRASDPAWTV-STDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGA--NGQVFFFMRSQTENFRVGRDSGEIHSVRPLRY------RDPAGGGSGANLNKY-SFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQI 686          

HSP 16 Score: 53.5286 bits (127), Expect = 3.315e-7
Identity = 26/89 (29.21%), Postives = 47/89 (52.81%), Query Frame = 1
Query: 1366 SLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
            +L+ YS ++  +D GRPPL  +   T+ I+  N NAP+F  +     +      G  I  + A DPD + NG+++Y ++  + +  F +
Sbjct:  613 NLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNASRRFDV 701          

HSP 17 Score: 50.447 bits (119), Expect = 2.914e-6
Identity = 31/89 (34.83%), Postives = 49/89 (55.06%), Query Frame = 3
Query: 1653 SQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQ-QYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAI 1916
            +Q  +D E K  Y LT+ A +  +     T  VH++I  VN+  P F Q +Y + ++E    A + A +G V A D+D G +GTV+Y +
Sbjct:  918 TQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSES---APVGAPVGSVFATDRDAGIDGTVFYML 1003          

HSP 18 Score: 50.0618 bits (118), Expect = 4.404e-6
Identity = 52/190 (27.37%), Postives = 81/190 (42.63%), Query Frame = 3
Query:  405 VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGS-CT-ITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLV-ELQAFDRDDSSTPNGQIKYKISDNSPKKELINR 965
             ++ + +EN   P+F+     LS+ EN   GS L+  TA D D+  N  I Y    I S D         S  F I   + + +      L+ E+D E    + L + A D G Q  + C+ +++S+ DVNDN P     +    + E    G  V  + A D D  S  N    Y + D      ++N+
Sbjct:  741 AIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVY---SIASGD--------GSGLFDISRASGDVL------LVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPS--NAVTMYSLDDGEADLFVLNQ 911          
BLAST of Protocadherin-1 vs. Ensembl Nematostella
Match: EDO35412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK9])

HSP 1 Score: 94.7449 bits (234), Expect = 3.201e-43
Identity = 89/331 (26.89%), Postives = 156/331 (47.13%), Query Frame = 3
Query:  279 FILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQ--GSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQG-PLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAI-----YKSTASIR-ENDRTPLVLTSVMVNDDDKGINSQ 1238
            F   S++G++     IDRET  +   +  ++  ++ + Q + V V ++D NDN P+F   + TL I+E+ D+ +   + TA D D+  N  + Y I    +     +         T+ + T            K +DRE  D ++L + A D G     G C I ++I+D ND++P +   +   ++ E  + G  ++ + A DRD  S  NG IKY I  ++ +    N +F +  S+  + ++     ++K   TF + A DGG   + +   VTI + D ND++P + I     +    +IR EN      +  ++V D D   NSQ
Sbjct:   42 FGFNSNTGVISTTARIDRETTTQ---ISLQLRTLNPSNQPISVQVQVDDINDNEPRFPTLYYTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVIT-----------KKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGS--NGDIKYAIDWDAIQS---NSIFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQ 353          

HSP 2 Score: 70.4774 bits (171), Expect = 3.201e-43
Identity = 79/259 (30.50%), Postives = 120/259 (46.33%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF-KQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNI 2438
            +DRE     ++TI A+D+G      + TV + I+D ND  P F K  Y   I+EG   A+I A + +V+A D D G+NG + Y I       N    +      +  +        +DRE        ++A D+G PQL +   V + + D+NDN P F YP+    F +I  +   GK+L    A D D+G N  I+Y II   +   N  + + +   +I T    + E +     LII A D G    A+   VN+
Sbjct:  488 LDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEG---ASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQ------LDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVF-YPVEY--FASIMENEPPGKLL-QVTATDADEGTNAVISYDIIGGNN---NGNFSIDSSTGVISTLASLDHE-VEEFFSLIISAKDGGNKYAAKTAVVNV 729          

HSP 3 Score: 50.447 bits (119), Expect = 3.201e-43
Identity = 29/110 (26.36%), Postives = 52/110 (47.27%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITILGKIEAKWKLIEKSK 1683
             DRE + FY++ +   D G P         + + D NDN+P F S+     ++E    G+ +  + A DPD  +NG VSY I   ++  +F +     +    K +++ +
Sbjct:  383 LDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSGLVTTAKPLDREQ 492          

HSP 4 Score: 88.1965 bits (217), Expect = 5.056e-34
Identity = 84/287 (29.27%), Postives = 134/287 (46.69%), Query Frame = 3
Query:  405 VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGK--QQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIE--IEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDL 1253
            V++ + D NDN P F+    T +I E +  GS +    A D D   N  + Y I   +     +++ FQ+    T                 K +DRE++    + + A+D G   + GS T+TV+IID NDN P++   +   T+ E    G  V LQ    D  S  NG+I Y+IS +  +   +N LF +   +  L ++     + K+  +F + A D G  +  ++V +E  I D ND+AP     +  ASI EN+  P  L  V   D D+G N+  + D+
Sbjct:  411 VLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVD-FQSGLVTT----------------AKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATV-LQVSATDVDSGDNGRITYEISSSDAQ---VNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMENEP-PGKLLQVTATDADEGTNAVISYDI 675          

HSP 5 Score: 51.2174 bits (121), Expect = 5.056e-34
Identity = 69/268 (25.75%), Postives = 119/268 (44.40%), Query Frame = 3
Query: 1662 EIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLAN---------FEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNI 2438
            ++DRE K QY L ++A+      L+   TV+I +LD ND  P F       I + +G   +  ++    A D D G+NG V Y +      SN +  + +N     ++       + D ++      +++A D+G P   +   + + +    ++ PKF            +  S V  VLA+           A D D G+NG + YSI   +  E+ L + +   G+L + K+L   + ++    LI+RA+D G P  +  V V I
Sbjct:  801 DMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSV--IVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLT-----SNAEGLLWINSTSGVIKLARK---LTDGDE-TQYTVQVLASDSGSPPQHS--TMTIHITLSINHPPKF------------TLSSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSI--PQGNEEGL-FGIFPGGKLYIRKSL--LQALKGSYDLIVRATDGGVPSFSASVPVTI 1038          

HSP 6 Score: 45.4394 bits (106), Expect = 5.056e-34
Identity = 30/99 (30.30%), Postives = 47/99 (47.47%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITILGKI 1650
             D E   F+S++I   D G        +  VT++++ DN P F  +   FT+ EN   G  +G  R Y    ++NG +SY I++ D    F +   G I
Sbjct:  699 LDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVG--RVYATTKDKNGSISYAIVSGDPTNLFLVDSTGGI 795          

HSP 7 Score: 72.7886 bits (177), Expect = 9.859e-26
Identity = 79/277 (28.52%), Postives = 120/277 (43.32%), Query Frame = 3
Query: 1650 RSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGV--------VDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYIPNN 2456
            R++  +D E+K+ Y+  ++A D G PS ND  TV I +LD ND  P  K  Y   +   NG   I +        +  L      Y  +  K  ++N Q  + +          +   G         +DRE +      +   D G P  S +  V++DV DVNDN P F    +     NIS  +Q G  +    A DPD+G+NGT++YSI     +     +Q+     L+ T    +RE +     + I A D+G+ PK    TV +  I  N
Sbjct:  266 RTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITY---LPPHNGDKAIRS--------ENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKVEFLGFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFT---SNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGW---FQVDFQSGLVTTAKPLDREQVS-SVTITITAQDHGSAPKTGSTTVTVTIIDGN 524          

HSP 8 Score: 63.929 bits (154), Expect = 9.859e-26
Identity = 34/82 (41.46%), Postives = 44/82 (53.66%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
             DRE+  FY + I   D G P L+G  L  +TI+DEND+AP F  +    ++ EN   G  I  V A D DS  NG + Y I
Sbjct:  164 LDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAI 245          

HSP 9 Score: 73.9442 bits (180), Expect = 2.501e-21
Identity = 43/114 (37.72%), Postives = 64/114 (56.14%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDE--NYYFTI-TILGKIEAKWKLIEKSKT 1686
             DRE +S  ++ I   D G  P  G    TVTIID NDN P+F     + T++E  +IGA +  V A D DS +NGR++Y+I ++D   N  F + T  G +  K +L  ++K+
Sbjct:  488 LDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKS 601          

HSP 10 Score: 47.7506 bits (112), Expect = 2.501e-21
Identity = 74/305 (24.26%), Postives = 124/305 (40.66%), Query Frame = 3
Query:  411 VYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQW-----PTVNISKTVKECDR--QGPLVELQAFDRDDSSTPNGQIKYKISDNSP----KKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTA--VTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDL---NDTTYF 1271
            + I DEND+ P F+      SI EN+  G  +   +A D DS  N  I+Y I           +  Q++  F +   T        ++  + +D E  + +   +IA D G   +    T+T++++D NDNSPQ      P  N  K ++  +      +  +   D+D  S  N Q + KI++       K E +   F        +  Q     +L  +    +   D G    ST   V I++ D ND++P       TA+I E  +    +  +   D D+G N   +  +   ND  +F
Sbjct:  194 ITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAID---------WDAIQSNSIFDLDSST------GVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKD--SNTNSQTELKITNGDDEGCFKVEFLGFYF--------IQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWF 473          

HSP 11 Score: 73.559 bits (179), Expect = 2.693e-21
Identity = 76/264 (28.79%), Postives = 115/264 (43.56%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMV----SIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYP--INKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNI 2438
            +D E    Y LTI A+D+G   L+ T  V + +LDVND  P+F  Q        N        +G+ TA D+D G N  + +++  +                 +    +     +D E M     S Q  ++A D G P+LS   ++ V V D NDN P F  P      + +N+ T            AEDPD+  NG +TYSIIS  +   NL     + G+L +   + +   I    +L I+ASD G P +     V++
Sbjct: 1327 LDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVREN--VNTGFPVGRCTASDRDTGTNAHIAFSMYSQ--------TPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPPAAAAGSSLNVMT----------ITAEDPDRNSNGKVTYSIISGNNGYFNL---HPSTGQLQMIHQIPDNPTIY---QLTIQASDGGQPSRQTQTVVSV 1564          

HSP 12 Score: 47.7506 bits (112), Expect = 2.693e-21
Identity = 27/93 (29.03%), Postives = 44/93 (47.31%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
             DRE+ S Y+++++  D     L       +T+ D ND  P F   D    +TE+  IG+ +  + A D D  +NG + Y I N +    F +
Sbjct: 1222 LDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDV 1314          

HSP 13 Score: 62.7734 bits (151), Expect = 1.356e-14
Identity = 40/97 (41.24%), Postives = 51/97 (52.58%), Query Frame = 3
Query: 1653 SQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQ-QYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSN 1940
            ++  +DRE  D Y L I A D G P+L   C ++I ILD ND  PVF Q  Y   I E        +IL +V+A D+D G NG + YAI      SN
Sbjct:  160 TKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGV--SIL-RVSAADRDSGSNGDIKYAIDWDAIQSN 253          

HSP 14 Score: 36.1946 bits (82), Expect = 1.356e-14
Identity = 25/93 (26.88%), Postives = 44/93 (47.31%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
             DRE+ +  S+ +R ++    P+  +    V + D NDN P+F +      + E+ ++        A DPD+  NG V Y I + D    F++
Sbjct:   57 IDRETTTQISLQLRTLNPSNQPISVQ----VQVDDINDNEPRFPTLYYTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTIASGDNTATFSL 145          

HSP 15 Score: 75.485 bits (184), Expect = 1.421e-13
Identity = 78/306 (25.49%), Postives = 136/306 (44.44%), Query Frame = 3
Query:  279 FILQSHSGILKQRNNIDRETMCKHADVCQKIILISIN-GQVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCT--ITVSIIDVNDNSPQWPTVNISKTVKECDRQG-PLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTY------ITFFITAVDGGGRENST--AVTIEIEDCNDHAPNIAIYKSTAS 1160
            F + S +G L     +DRET   +  V +     + N     ++ + + D ND  P F     T++I E++ IGS +    A D D   N +I+Y    I + ++  M   +++                 L + K +D E    +EL + A+D G    S T  +TV+++DVNDN+P +PT  ++ TV+E    G P+    A DRD  +  N  I + +   +P K         + +S       +  +DL+T           + A D G  + ST  ++T+++ D ND++P      + A+
Sbjct: 1207 FFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKY---SISNGNLAAMFDVESA--------------TGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGT--NAHIAFSMYSQTPSKTF-------SVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPPAAAA 1486          

HSP 16 Score: 53.5286 bits (127), Expect = 6.209e-12
Identity = 87/317 (27.44%), Postives = 132/317 (41.64%), Query Frame = 3
Query: 1620 LFYNHYFRENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQ-YFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKY-PINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYIPNNLTPRNNALPPGINKKSN---------DKNRFSGGNV 2537
             F N    E      +DRE    Y+L + A D    +L  T  + I + D ND  PVF +  Y   ITE    A I +++  + A DKD+G+NG + Y+I      SN       ++       I+     +D E     +  I A D+G   LS+  NV V+VLDVNDN P F   P+      N++T   VG+  A+    D D G N  I +S+ S    +         +   I   +L      R   +L++ A+D G+P  +   ++ ++    N        PP     S+         D +R S G V
Sbjct: 1207 FFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITED---ALIGSLVINLNASDKDIGQNGLIKYSI------SNGNLAAMFDVESATGRLIVAKS--LDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTAS----DRDTGTNAHIAFSMYSQTPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPPAAAAGSSLNVMTITAEDPDRNSNGKV 1508          

HSP 17 Score: 36.1946 bits (82), Expect = 6.209e-12
Identity = 18/59 (30.51%), Postives = 33/59 (55.93%), Query Frame = 1
Query: 1429 EKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILN 1605
            + +  VT+ D NDNAP F       T++E +  G+P+  ++A D D  +N +  Y +++
Sbjct: 1142 KAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVS 1200          

HSP 18 Score: 46.9802 bits (110), Expect = 1.458e-11
Identity = 66/235 (28.09%), Postives = 110/235 (46.81%), Query Frame = 3
Query: 1737 DTCTVHIRILDVNDCVPVFKQQ-YFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNI 2438
            D   V + + D+ND  PVF +  Y   ++E   L+   + + ++ A D D G+N   +Y++                    +  G L++   +DRE   S    + A D     L + A + + V D ND +P F  P +    +NI+ D+ +G ++ N  A D D G+NG I YS IS+ ++      +    GRLI+ K+L + E  +L + L I A D+G  P +  V V +
Sbjct: 1141 DKAIVIVTVTDLNDNAPVFSRAVYAITVSE---LSLPGSPVFRIKAMDADEGDNAKFFYSLVSG--------TGMDKFFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVF--PESDYT-VNITEDALIGSLVINLNASDKDIGQNGLIKYS-ISNGNLAAMFDVESAT-GRLIVAKSL-DFETTQLYE-LTITAQDHGLIPLSSTVNVTV 1357          

HSP 19 Score: 41.5874 bits (96), Expect = 1.458e-11
Identity = 23/97 (23.71%), Postives = 49/97 (50.52%), Query Frame = 1
Query: 1378 YSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITILGKIEAKWKL 1668
            Y +++R  D G P        T+ I D ND+   F ++  RF + EN++ G  +G + A+  D +    + Y +++++ ++   +   G+I  + +L
Sbjct: 1016 YDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISSESHFAVDVR-SGQITTRVRL 1111          

HSP 20 Score: 65.855 bits (159), Expect = 1.226e-10
Identity = 82/308 (26.62%), Postives = 135/308 (43.83%), Query Frame = 3
Query:  225 NSSGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKH--ADVCQKIILISINGQVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPL----VELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDH 1124
            N S +Y I+S +P   N F++ S  GI+K   ++DRE   ++  A + +   +  ++ Q   V + + D NDN PQFS     + I     +G  +    A DLD+  N ++RY              Q  ++    ++I + + +    +KL +++   +  ++ + ++A DSG      T+T+ I  ++ N P  P   +S  V       PL      + A D+D  S  NGQ+ Y I   + +      LF I      L  +   L  LK      + A DGG      S  VTI I+D NDH
Sbjct:  771 NGSISYAIVSGDP--TNLFLVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQA-TVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRY--------------QLTSNAEGLLWINSTSGV----IKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHIT-LSINHP--PKFTLSSYVTHVLASQPLSYQFFYVVAVDQD--SGKNGQLFYSIPQGNEEG-----LFGI-FPGGKLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDH 1046          

HSP 21 Score: 64.3142 bits (155), Expect = 3.554e-10
Identity = 72/302 (23.84%), Postives = 129/302 (42.72%), Query Frame = 3
Query:  273 NYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQ---------VLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQ--GSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAPNIAIY 1145
             +F +   SG++     +DRE +          + I+I  Q            V V I D NDN P+F       +I E + IG+ +   +A D+DS  N  I Y   +I S D +    F+ +             +   L    ++DRE    +   ++A+D G  Q   S  + ++I D+NDN+P +  V    ++ E +  G L+++ A D D+ +  N  I Y I   +      N  F I  S+  +S+      +++ + +  I+A DGG +  +    + +   N  A N+ ++
Sbjct:  471 GWFQVDFQSGLVTTAKPLDREQVSS--------VTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITY---EISSSDAQVNGLFELN------------TQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPGKLLQVTATDADEGT--NAVISYDIIGGNN-----NGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLN-KADNLPVF 741          

HSP 22 Score: 62.3882 bits (150), Expect = 1.283e-9
Identity = 65/208 (31.25%), Postives = 97/208 (46.63%), Query Frame = 3
Query: 1653 SQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQ-QYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPI-NKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIIS 2270
            ++ ++DRE K  YS T++AKD+G+P L  +  V + I D+ND  PVF   +YF  I E          L +VTA D D G N  + Y I    ++ N   +    ++             +D E        I A D G    +  A V V VL+  DN P F Y + N   + N+   + VG+V A        K +NG+I+Y+I+S
Sbjct:  591 TKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPGK----LLQVTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVISTLAS--------LDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYAT------TKDKNGSISYAIVS 780          

HSP 23 Score: 59.6918 bits (143), Expect = 7.249e-9
Identity = 89/328 (27.13%), Postives = 142/328 (43.29%), Query Frame = 3
Query:  237 TYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISING-----QVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCT--ITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLV-ELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIE--DCNDHAPNIAIYKSTASIRENDRTPLV 1190
            TY I S++  +N  F L + +G+L  ++ +DRET   ++      +L   +G       ++V + I+D NDN P F       SI EN   G  L + TA D D   N++I Y        DI   N    +  F+I   T        +  +  +D E  + F LI+ A+D G +  + T  + V++++  DN P +     + TV E   +G LV  + A  +D     NG I Y I    P       LF +  +   +   G    + K      + A  G  +  S   T+ IE  D ND+AP    + +++ I + D T LV
Sbjct:  566 TYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYS----FTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPGKLLQV-TATDADEGTNAVISY--------DIIGGNN---NGNFSIDSST------GVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKDK----NGSISYAIVSGDPTN-----LFLVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQ---FSTSSVIVDIDGTWLV 859          

HSP 24 Score: 59.3066 bits (142), Expect = 1.193e-8
Identity = 35/119 (29.41%), Postives = 57/119 (47.90%), Query Frame = 1
Query: 1291 YNQSNGRQLFMYNIKKIPDTFFDRESLSF-----YSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
            Y+ SNG    M++++         +SL F     Y + I   D G  PL      TV ++D NDNAP F +  +  T+ EN N G P+G   A D D+  N  +++ + +   +  F++
Sbjct: 1301 YSISNGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSV 1419          

HSP 25 Score: 58.9214 bits (141), Expect = 1.590e-8
Identity = 81/308 (26.30%), Postives = 128/308 (41.56%), Query Frame = 3
Query:  279 FILQSHSGILKQRNNIDRET--MCKHADVCQKIILISINGQVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEI----DRFELILIAEDSGKQQGSC--TITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIREN 1172
            F ++S +G L    ++D ET  + +     Q   LI ++  V  V V + D NDN P F  +  TL+++EN + G  +   TA D D+  N+ I +            M     S+ F++   T        +  I  ID E +    D F+L+++A D G  + S   +ITV + D NDNSP +    +S           ++ + A D D +S  NG++ Y I          N  ++    S        Q+ D  T     I A DGG   R+  T V++  E      P  +      S+ EN
Sbjct: 1312 FDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTV-NVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAF-----------SMYSQTPSKTFSVNSATCE------ITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGF----VSPPAAAAGSSLNVMTITAEDPDRNS--NGKVTYSIISG-------NNGYFNLHPSTGQLQMIHQIPDNPTIYQLTIQASDGGQPSRQTQTVVSVFKEGPIGGGPTFSSADYQGSVTEN 1588          

HSP 26 Score: 56.225 bits (134), Expect = 8.391e-8
Identity = 83/289 (28.72%), Postives = 121/289 (41.87%), Query Frame = 3
Query: 1593 SDFE*RRKLLFYNHYFRENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYF-YQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYIPNN 2456
            S FE   K   +N       +   IDRE   Q SL +   +   PS N   +V +++ D+ND  P F   Y+  +I E   + T + I    TA D D G NGTV Y I    + +              L  I      +DRE     Q  I A D G P L     + + +LD ND+ P F          +I+ +++ G  +    A D D G NG I Y+ I    ++ N  + L +   +I TK   + E ++      + ASD G P K +L TV I  +  N
Sbjct:   33 SAFEGSPKQFGFNSNTGVISTTARIDRETTTQISLQLRTLN---PS-NQPISVQVQVDDINDNEPRFPTLYYTLRIRESMDVNTTNPI---NTATDPDAGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKK--PLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFT---QNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYA-IDWDAIQSNSIFDLDSSTGVIRTKQNLDFE-VKNSYTFNVIASDGGVPSKNDLATVTINVLDTN 307          

HSP 27 Score: 51.2174 bits (121), Expect = 2.885e-6
Identity = 27/82 (32.93%), Postives = 42/82 (51.22%), Query Frame = 1
Query: 1378 YSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYY 1623
            + +++   D G P L   K  TV + DENDN+P F S       +  N     +  + A DPD N NG+V+Y I++ +  Y+
Sbjct: 1444 FQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPPAAAAGSSLN-----VMTITAEDPDRNSNGKVTYSIISGNNGYF 1520          
BLAST of Protocadherin-1 vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 85.5001 bits (210), Expect = 2.385e-36
Identity = 83/252 (32.94%), Postives = 119/252 (47.22%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKF---KYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPP 2411
            +DRE    Y+L + A + G    +      IR+LDVND  PVF    + +    N    I   + KVTA D+D GEN  V Y +    D S  + N    L+             +DRE   S    + A D+GKP  SAVA + + + D+NDN P+F   KY +      N +  S + +VLA+    DPD G NG +TYSIIS  H      +++ +    I    + +RE +   + L I A D+G PP
Sbjct: 1057 LDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHEN--LPIGQTVAKVTATDRDEGENAKVTYELSVG-DTSKFEVNPATGLVTTKRP--------LDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTE--NTANGSNILRVLAS----DPDAGANGRVTYSIISGNHGNA---FRIDSTTGRITVVGVVDREALASYN-LTISAKDSGVPP 1287          

HSP 2 Score: 75.0998 bits (183), Expect = 2.385e-36
Identity = 97/361 (26.87%), Postives = 147/361 (40.72%), Query Frame = 3
Query:  264 DINNYFILQSHSGILKQRNNIDRETMCKH-ADVCQKIILISINGQVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQW--PT-VNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKI-SDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIE--DCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLN---------DTTYFTMVKECL 1292
            D  + F + + +G++  +  +D E   ++   V  K         +  V V ++D NDN PQF+    T ++ EN   G  +   TA D DS  N  I Y I   +      M++F         I T    ++P       +DRE I  + L + A+D    +   + T+ +SI D NDN P +  P+  NIS+      R G   +L A DRD    PNG + Y I S N          F +   S  LS +     +     T  + A D G  + S   +I +   D ND+AP       +  IRE+      +  V V D D+G N      L+         D+T F + K  L
Sbjct:  623 DNTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGE------ITT----RVP-------LDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPSRFNISEDSPTGTRVG---QLTATDRDIG--PNGAVTYAIISGNQGNS------FQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSDNFTIDSTGFVLSKTPL 955          

HSP 3 Score: 31.9574 bits (71), Expect = 2.385e-36
Identity = 28/112 (25.00%), Postives = 46/112 (41.07%), Query Frame = 1
Query: 1348 TFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITILGKIEAKWKLIEKSK 1683
            T  D E+ + Y + +   D G P         +TII+ NDN P F S     ++ E+  I   +  + A D D      +++ I+  +    F      KI+    LI  +K
Sbjct:  953 TPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSDGTP---LTFDIVEGNAGSSF------KIDQSSGLISVAK 1055          

HSP 4 Score: 69.707 bits (169), Expect = 3.068e-33
Identity = 92/358 (25.70%), Postives = 153/358 (42.74%), Query Frame = 3
Query:  237 TYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQVLE-VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLI---KEIDREEIDRFELILIAEDSGK--QQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKI-SDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG-GRENSTA-VTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQ--FNCDLNDTTYFTM 1277
            T++I+  E +  + F +   SG++     +DRET   +  V +     S    V     + + D NDN P F+      S+ EN  IG  ++  TA D D   N+ + Y +       +   ++F+ +               P   L+   + +DRE+   + L + A D GK  Q     IT++I D+NDNSPQ+     + TV E    G  + L+    D  +  NG++ Y I S N          F I  ++  ++  G+   +        I+A D G     STA V I + D ND++P  A  +++  I E       +  V   D D+G N+Q  ++    DT+ F +
Sbjct: 1030 TFDIV--EGNAGSSFKIDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELS------VGDTSKFEVN---------------PATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNI-LRVLASDPDAGANGRVTYSIISGNH------GNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAI 1357          

HSP 5 Score: 62.003 bits (149), Expect = 3.068e-33
Identity = 76/262 (29.01%), Postives = 118/262 (45.04%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQA-EIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYI 2447
            +D E K QY L + A D+          V IR++++ND  P F QQ +      N   +   +  KV+A D+D    G++ Y+I    D      +    ++            V+DRE +VS+ A ++   D G P LS +  V + +LD NDN PKF       + +  S  S     LA   A D D+G N  ITY      ++ +N  + +     +I      +RE     D L I+A D+GTPP+A  +T+ +  I
Sbjct: 1475 LDFEEKSQYGLEVTATDS---KYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVV--KVSASDRD--SFGSLSYSIVGGKDSDKFSIDQRSGIISTAD--------VLDRE-LVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLA---ATDADEGTNARITY------NLSRNDAFMIGASSGVITLAQPLDRENKSTYD-LAIQARDHGTPPQASSITIRVTVI 1710          

HSP 6 Score: 50.0618 bits (118), Expect = 3.068e-33
Identity = 29/93 (31.18%), Postives = 46/93 (49.46%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
             +RE++  Y++ IR  D G P +  +K  TV + D NDN P F S     ++ EN+     +  V A D D   N  + Y I++ ++   F I
Sbjct: 1370 INRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKI 1462          

HSP 7 Score: 68.9366 bits (167), Expect = 1.812e-27
Identity = 88/337 (26.11%), Postives = 148/337 (43.92%), Query Frame = 3
Query:  279 FILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQVL-----EVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKE-CDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGR--ENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQ--FNCDLND 1259
            F + + +G+L  +  I+RET+  +       I  S  G  +     E+ V +ND NDN P F+ +    S++ENS   + +    ADD D   N+++RY I  I   D +R   F+ +    + + T              +D EE  ++ L + A DS K      +T+ +I++ND +P +   N + +V+E       +V++ A DRD      G + Y I       +     F I   S  +S+  +   +L +     +   D G     N T VTI+I D ND++P       ++SI EN         +   D D+G N++  +N   ND
Sbjct: 1355 FAINAMNGVLTVKKEINRETVPTYT----LTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSI--ISGNDEKR---FKINSTSGVIMTTT------------PLDFEEKSQYGLEVTATDS-KYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSF----GSLSYSIVGGKDSDK-----FSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRND 1660          

HSP 8 Score: 55.8398 bits (133), Expect = 1.812e-27
Identity = 33/106 (31.13%), Postives = 51/106 (48.11%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI-TILGKIEAKWKL 1668
             DRE+ S Y + I+  D G PP        VT+ID ND+ P   S  +R ++ EN      +  + A D D+  N  +++ +L+N+    FT+    G I  K  L
Sbjct: 1677 LDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNEHKSVFTLDNTTGDISTKVPL 1782          

HSP 9 Score: 37.7354 bits (86), Expect = 1.812e-27
Identity = 27/77 (35.06%), Postives = 41/77 (53.25%), Query Frame = 3
Query: 1653 SQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKD 1883
            +++ +DRE +  Y+L I   D G PSL+    V I ++D +D  P F Q   Y +T    L    +I+ +VTA D D
Sbjct: 1778 TKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRF-QPTEYNVTISESLPRGASIV-QVTARDID 1852          

HSP 10 Score: 60.077 bits (144), Expect = 2.370e-27
Identity = 34/106 (32.08%), Postives = 52/106 (49.06%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI-TILGKIEAKWKL 1668
            FDRE+ + Y V +R  D G P   G+    + I+D NDN P F S     ++ E+  IGA +  V A D D+  N  + Y   + + N+ FT+  + G +     L
Sbjct:  229 FDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLDAVTGVVTVSRSL 334          

HSP 11 Score: 57.3806 bits (137), Expect = 2.370e-27
Identity = 50/203 (24.63%), Postives = 93/203 (45.81%), Query Frame = 3
Query:  681 KEIDREEIDRFELILIAEDSGKQ--QGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDL--NDTTYFTM 1277
            ++ DRE   R+ L ++A+D+  +  +G   + + + D NDN+P++P  +    ++E      +  + A DRD  S  N  I Y +     K       F +   +  + +      + K   T  I+A DG  +  +    I ++D ND+AP  A+      + E+     ++  +   D D GIN++ +  L   DT+YFT+
Sbjct:   26 RKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTPAAQVAIVTATDRD--SGTNAAITYSLFSGENK-------FMMNSKTGEIRTVTPLDHETKDSYTMRISAFDG--KHTTFVPLITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSYFTV 217          

HSP 12 Score: 45.0542 bits (105), Expect = 2.370e-27
Identity = 27/85 (31.76%), Postives = 41/85 (48.24%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFK-QQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAI 1916
            +D E +  Y+L +   D G P L DT  + I + D+ND  PVF    Y  ++ E     T      +V+A D+D   NG + + I
Sbjct:  334 LDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGT------QVSATDRDSSTNGALVFGI 412          

HSP 13 Score: 62.003 bits (149), Expect = 1.840e-26
Identity = 82/334 (24.55%), Postives = 142/334 (42.51%), Query Frame = 3
Query:  279 FILQSHSG-ILKQRNNIDRETMCKH---------ADVCQKIILISINGQVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLV-ELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIE--DCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQF 1241
            F + S +G I       DRE+  ++         A+ C K       G+ + V++ + DENDN P+F +     +I+EN+   +++++ TA D DS  N+ I Y +             F     F +  KT        ++ +  +D E  D + + + A D GK      + +++ DVNDN+P +        V E    G +V +L A D D     N ++ Y +          +  ++   S   + ++G    + K      + A DGG    S   T+EIE  D ND+ P  +  + TAS+ E+      + +V  +D D G N+  
Sbjct:   12 FTIDSSTGSITTTGRKFDRESESRYRLTVLAQDAANRCHK-------GRTV-VVIDVKDENDNAPEFPLNSYVFNIRENTP-AAQVAIVTATDRDSGTNAAITYSL-------------FSGENKFMMNSKTGE------IRTVTPLDHETKDSYTMRISAFD-GKHTTFVPL-ITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGI--NARLSYSLVSG-------DTSYFTVDSQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADL 306          

HSP 14 Score: 52.373 bits (124), Expect = 1.840e-26
Identity = 72/258 (27.91%), Postives = 108/258 (41.86%), Query Frame = 3
Query: 1668 DREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFK-QQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNI 2438
            D E K +Y LT+ A+D G P   DT  V I I DVND  PVF    Y  QI E      I + +  VTA D D G  G + Y    +    N +    ++    ++         +DRE   S   ++ A D G    S+   V + + D+NDN P F+ P        +S  S  G  +    A D D   NG + Y++  +  +     + +     LI  K   + E  +    + + A D GTP ++ L  V +
Sbjct:  437 DYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPES---TVIGSTVVTVTATDLDSGPRGRLEY----RLISGNVKGAFNIDANSGSIRVSSE----LDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGPY----VFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNTDV-----FSINTSTGLITLKTQLDYEK-KTQYMVTVTAKDGGTPSRSSLTVVKV 673          

HSP 15 Score: 44.2838 bits (103), Expect = 1.840e-26
Identity = 29/93 (31.18%), Postives = 43/93 (46.24%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
             D E  S Y++ +   D G PPL       + + D NDN P F     +  + EN   G     V A D DS+ NG + + I+  +++  FTI
Sbjct:  334 LDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGT---QVSATDRDSSTNGALVFGIIKGNDDGVFTI 423          

HSP 16 Score: 84.7297 bits (208), Expect = 6.365e-26
Identity = 92/344 (26.74%), Postives = 156/344 (45.35%), Query Frame = 3
Query:  279 FILQSHSGILKQRNNIDRETMCKHADVCQ-KIILISINGQVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAED--SGKQQGSCTITVSIIDVNDNSP--QWPTV-NISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDL---NDTTYFTM 1277
            F +   +GI+    + D E   ++    Q +   + +     +V ++I D ND+ P FS  + +  I E++ IGS +   TA DLDS P   + Y           R+        F I   + +      +++  E+DRE    + L + A D  S  +  S  +T+++ D+NDNSP  Q P V  +S++     + G   ++ A D DDSS  NG ++Y +SDN+        +F I  S+  ++ +     + KT     +TA DGG   R + T V + ++D ND+ P  A    T ++ EN    + +  V   D D G N + +  +   N+   F M
Sbjct:  421 FTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEY-----------RLISGNVKGAFNIDANSGS------IRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGPYVFRVSESSSPGHQIG---QVAATDADDSS--NGDVRYALSDNT-------DVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAM 735          

HSP 17 Score: 52.373 bits (124), Expect = 6.365e-26
Identity = 29/93 (31.18%), Postives = 49/93 (52.69%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
             DRE+++ YS+ I   D      +      ++I DENDN P F +   RF ++E++  G  +G + A D D   NG V+Y I++ ++   F +
Sbjct:  748 LDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTF-TGPSRFNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNSFQL 839          

HSP 18 Score: 69.707 bits (169), Expect = 2.620e-25
Identity = 38/100 (38.00%), Postives = 55/100 (55.00%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI-TILGKI 1650
             DRE  + YS+ +  +D G+P        T+TI D NDN+P+F       T+TEN   G+ I  V A DPD+  NGRV+Y I++ +    F I +  G+I
Sbjct: 1161 LDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDSTTGRI 1260          

HSP 19 Score: 65.4698 bits (158), Expect = 2.620e-25
Identity = 95/372 (25.54%), Postives = 147/372 (39.52%), Query Frame = 3
Query:  225 NSSGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKH--------ADVCQKIILISINGQVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCT--ITVSIIDVNDNSPQWPT-VNISKTVKECDRQGPLVELQAFDRDDSSTP--------NGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTA--VTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLN--DTTYF 1271
            N + TY IIS   +  N F L   SGIL  R+ +DRET+  +        A   Q+ I  SI+  VL+V       NDN P+F     +  I+E++ + S +     +D D   N  I   +              + S  FTI        K P       +D E    ++L + A D G    S T  + ++II+VNDN P + +   ++   ++      +V+L A D D   TP        N    +KI  +S    +  RL                  +     T  + A + G +  S     TI + D ND+AP         S+ EN      +  V   D D+G N++   +L+  DT+ F
Sbjct:  821 NGAVTYAIISG--NQGNSFQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDV-------NDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSG------------EGSDNFTIDSTGFVLSKTP-------LDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSD--GTPLTFDIVEGNAGSSFKIDQSSGLISVAKRL----------------DRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKF 1146          

HSP 20 Score: 74.7146 bits (182), Expect = 4.119e-25
Identity = 84/273 (30.77%), Postives = 128/273 (46.89%), Query Frame = 3
Query: 1629 NHYFRENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYI 2447
            + +  E  +++ +DRE    YSLTI A D          TV+I I D ND  P F     + I+E +   T    +G++TA D+D+G NG V YAI      ++ Q +    +L +           +DRE + S    + A D G PQ S  A++ V VLDVNDN P+F+  +       I  D+ V   +   + ED D+G NG IT S+      E +  + + + G  +L+K   + E      +L + A D G+P K+    V I  I
Sbjct:  736 DRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPSRFNISEDSPTGT---RVGQLTATDRDIGPNGAVTYAIISGNQGNSFQLDPRSGILSVRS--------TLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSG---EIREDASVHSTVLQVKVEDKDEGSNGAITLSL----SGEGSDNFTIDSTG-FVLSKTPLDYE-TTAAYQLTVTARDGGSPSKSATAQVKITII 988          

HSP 21 Score: 59.6918 bits (143), Expect = 4.119e-25
Identity = 34/95 (35.79%), Postives = 46/95 (48.42%), Query Frame = 1
Query: 1348 TFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
            T  D E  + Y V +   D G P      +  V + D NDN P+F       T+ EN   G  + YV A D DS  NG++SY IL+ +EN  F +
Sbjct:  641 TQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAM 735          

HSP 22 Score: 68.1662 bits (165), Expect = 1.132e-23
Identity = 34/106 (32.08%), Postives = 56/106 (52.83%), Query Frame = 1
Query: 1351 FFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITILGKIEAKWKL 1668
              DRE+L+ Y++ I   D G PP V      +T+ DENDN+P F S++  + + E  +IG+ +  V A D D   N +V Y I+  D + +    + G +  K ++
Sbjct: 1265 VVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAMNGVLTVKKEI 1370          

HSP 23 Score: 61.6178 bits (148), Expect = 1.132e-23
Identity = 75/273 (27.47%), Postives = 127/273 (46.52%), Query Frame = 3
Query: 1656 QMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF-KQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFI-----NISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYIPNN 2456
            + EI+RE    Y+LTI A D G P +     + + + DVND  PVF  Q Y   + E +  +T  ++L  V ADD D+G N  + Y+I    D    + N    ++             +D E+      E+ A D+   + +A  NV + V+++ND  P F     + N+      N  T + V KV A+      D+   G+++YSI+  K  ++   + +     +I T ++ +RE + L   + +R +D G PP + L  V I+ +  N
Sbjct: 1367 KKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQST--SVL-TVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGVIMTTTP--------LDFEEKSQYGLEVTATDS---KYTAKTNVTIRVINLNDITPAFT----QQNYTASVRENSPTSTSVVKVSAS------DRDSFGSLSYSIVGGKDSDK---FSIDQRSGIISTADVLDRELVSLY-AIQVRVTDAGNPPLSNLTWVTIKILDEN 1611          

HSP 24 Score: 61.6178 bits (148), Expect = 7.131e-17
Identity = 34/90 (37.78%), Postives = 49/90 (54.44%), Query Frame = 1
Query: 1351 FFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGY---VRAYDPDSNENGRVSYQILNND 1611
              DRE +S Y++ +R  D G PPL      T+ I+DENDN+PKF S     ++ EN+   AP  +   + A D D   N R++Y +  ND
Sbjct: 1574 VLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENS---APSSFSFKLAATDADEGTNARITYNLSRND 1660          

HSP 25 Score: 45.0542 bits (105), Expect = 7.131e-17
Identity = 35/140 (25.00%), Postives = 56/140 (40.00%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSA 2084
            +DRE K  Y L I A+D+G P    + T+ + ++D+ND  P+            N     H +  ++ A D D G N  + +++      SN   ++                  +DREQ       I   D G P LS+
Sbjct: 1677 LDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVM--RILASDADTGLNAELTFSLL-----SNEHKSVFTLDNTTGDISTKVP---LDREQQAVYTLRIGVADKGNPSLSS 1806          

HSP 26 Score: 65.855 bits (159), Expect = 1.465e-16
Identity = 73/237 (30.80%), Postives = 109/237 (45.99%), Query Frame = 3
Query: 1650 RSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGI 2360
            R   E+DRE    YSL + A+D G  S + +  V I + D+ND  P+F+  Y ++++E +     H I G+V A D D   NG V YA+    D  +   + GL  LK            +D E+       + A D G P  S++  V V V DVNDN P+F      +    +  +   G  +    A D D G NG I+YSI+S     +N+ + +      I T+   +RE I
Sbjct:  536 RVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGPYVFRVSESSSPG--HQI-GQVAATDADDSSNGDVRYALSDNTDVFSINTSTGLITLKTQ----------LDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFA---KSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGN---ENMAFAMDRFTGEITTRVPLDRETI 753          

HSP 27 Score: 39.6614 bits (91), Expect = 1.465e-16
Identity = 29/104 (27.88%), Postives = 50/104 (48.08%), Query Frame = 1
Query: 1321 MYNIKKIPDTFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
            + +I K PD     E+ + Y + ++  D G P        T+ I D ND++P F   +    + E+  IG+ +  V A D DS   GR+ Y++++ +    F I
Sbjct:  429 IISIAKSPD----YENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNI 528          

HSP 28 Score: 75.485 bits (184), Expect = 9.678e-16
Identity = 85/333 (25.53%), Postives = 137/333 (41.14%), Query Frame = 3
Query:  279 FILQSHSGILKQRNNIDRE---------TMCKHADVCQKIILISINGQVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCT--ITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVE-LQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGG--RENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINS 1235
            F +   +G++  +  +DRE         T   H    Q          V  + + IND NDN PQFS    TL++ EN+  GS +    A D D+  N  + Y I   +  +  R++             T  R+ +     +  +DRE +  + L + A+DSG      T  + +++ D NDNSP + +   S  + E    G  V  + A DRD+ S  N Q+ Y I         IN +  +      ++ +      + TY T  I A D G     +   +T+ + D ND+ P         S+REN      + +V  +D D G N+
Sbjct: 1146 FEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQS--------AVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRID------------STTGRITV-----VGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGS--NAQVFYSIVRGDTSAFAINAMNGVLTVKKEINRET-----VPTY-TLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANA 1445          

HSP 29 Score: 27.335 bits (59), Expect = 9.678e-16
Identity = 25/95 (26.32%), Postives = 41/95 (43.16%), Query Frame = 1
Query: 1348 TFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
            T  D E  S Y + +   D        +   T+ +I+ ND  P F   +   ++ EN+     +  V A D DS   G +SY I+   ++  F+I
Sbjct: 1473 TPLDFEEKSQYGLEVTATD---SKYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDS--FGSLSYSIVGGKDSDKFSI 1562          

HSP 30 Score: 53.5286 bits (127), Expect = 2.729e-14
Identity = 80/347 (23.05%), Postives = 142/347 (40.92%), Query Frame = 3
Query:  240 YNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKI----PYLKLIKEIDREEIDRFELILIAEDSGKQQGS--CTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPL-VELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIE--DCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDL 1253
            Y+IIS   +    F + S SG++     +D E   ++    +     S       V + + + ND  P F+ ++ T S++ENS   + +   +A D DS                       F +  Y  +  K  ++  I      +     +DRE +  + + +   D+G    S    +T+ I+D NDNSP++ + + S ++ E         +L A D D+ +  N +I Y +S N          F I  SS  ++       + K+     I A D G    ++++TI +   D NDH P I       S+REN      +  ++ +D D G+N++    L
Sbjct: 1449 YSIISGNDE--KRFKINSTSGVIMTTTPLDFEEKSQYG--LEVTATDSKYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDS-----------------------FGSLSYSIVGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGT--NARITYNLSRND--------AFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSL 1758          

HSP 31 Score: 44.2838 bits (103), Expect = 2.729e-14
Identity = 27/77 (35.06%), Postives = 39/77 (50.65%), Query Frame = 1
Query: 1336 KIPDTFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPD 1566
            K+P    DRE  + Y++ I   D G P L       + +IDE+DN P+F   +   T++E+   GA I  V A D D
Sbjct: 1779 KVP---LDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRFQPTEYNVTISESLPRGASIVQVTARDID 1852          

HSP 32 Score: 73.559 bits (179), Expect = 4.504e-13
Identity = 84/253 (33.20%), Postives = 120/253 (47.43%), Query Frame = 3
Query: 1653 SQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQ-QYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTP 2408
            ++  +DRE +  YSL + A D+G+PS +    + + I D+ND  P F Q +Y   +TE    A    IL +V A D D G NG V Y+I    +H N            +  G + + GVVDRE + S    I A D+G P   + A V + V D NDN P F    N+ ++  I     +G  +A   A D D+G N  + YSI+  +           N G L + K +  RE +     L IRASD G+P
Sbjct: 1157 TKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENT--ANGSNIL-RVLASDPDAGANGRVTYSIISG-NHGN-------AFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFAS--NETSY-GIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIV--RGDTSAFAINAMN-GVLTVKKEI-NRETVPTY-TLTIRASDRGSP 1390          

HSP 33 Score: 47.7506 bits (112), Expect = 7.465e-13
Identity = 28/105 (26.67%), Postives = 53/105 (50.48%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITILGKIEAKWKL 1668
             DRE++  Y+++++  D G P         V+++D NDNAP+F        + E+ ++ + +  V+  D D   NG ++   L+ + +  FTI   G + +K  L
Sbjct:  852 LDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLS-LSGEGSDNFTIDSTGFVLSKTPL 955          

HSP 34 Score: 45.0542 bits (105), Expect = 7.465e-13
Identity = 21/47 (44.68%), Postives = 28/47 (59.57%), Query Frame = 3
Query: 1653 SQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF 1793
            S+  +D E    Y LT+ A+D G PS + T  V I I++VND VP F
Sbjct:  951 SKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSF 997          

HSP 35 Score: 63.5438 bits (153), Expect = 5.026e-10
Identity = 37/89 (41.57%), Postives = 47/89 (52.81%), Query Frame = 3
Query: 1650 RSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQ-QYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYA 1913
            R++   DRE K  Y + + A+D G PS +   TV I ILDVND  PVF   QY   + E      I A +  VTA DKD G N  + Y+
Sbjct:  224 RTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDED---VAIGAAMVTVTASDKDNGNNADLRYS 309          

HSP 36 Score: 55.0694 bits (131), Expect = 1.963e-7
Identity = 61/230 (26.52%), Postives = 104/230 (45.22%), Query Frame = 3
Query:  270 NNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQ-------VLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGP-LVELQAFDRDDSSTPNGQIKYKI 929
            N+ F L + +G++    ++D E    +A      + +S+  +          +++ +ND NDN P FS       ++EN+  G+++S   A D DS  N  + + I  I   D            FTI   T        + + K  D E   R++L + A D G   +  +  +T+ I DVND+SP +   N SK + E    G  +V + A D D  S P G+++Y++
Sbjct:  316 NHAFTLDAVTGVVTVSRSLDFEQRSSYA------LGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGTQVS---ATDRDSSTNGALVFGI--IKGND---------DGVFTIDGST------GIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLD--SGPRGRLEYRL 517          

HSP 37 Score: 50.0618 bits (118), Expect = 7.580e-6
Identity = 34/110 (30.91%), Postives = 52/110 (47.27%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITILGKIEAKWKLIEKSK 1683
            FDRES S Y + +   D       G  +  + + DENDNAP+F  +   F + EN    A +  V A D DS  N  ++Y + +  EN +   +  G+I     L  ++K
Sbjct:   28 FDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTP-AAQVAIVTATDRDSGTNAAITYSLFSG-ENKFMMNSKTGEIRTVTPLDHETK 135          
BLAST of Protocadherin-1 vs. Ensembl Nematostella
Match: EDO34815 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN97])

HSP 1 Score: 80.1073 bits (196), Expect = 9.881e-33
Identity = 85/345 (24.64%), Postives = 146/345 (42.32%), Query Frame = 3
Query:  258 EPDINNYFILQSHSGILKQRNNIDRE-TMCKHADVCQKIILISINGQVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVS---IIDVNDNSPQWPTVNISKTVKECDRQGPLVELQ------AFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVD--GGGRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLN 1256
            +P  N+ F L  ++G++K   N++R+ T   +  +      +        V + + D NDN P F+  + + ++ ENS +G+ L   TA D DS  N+ + Y +    S  +           F    K  N   I   ++   +DRE  D + L + A D G       I ++   I+D NDN P++     + +++E    GP V +Q      A DRD  S  N  ++Y+++ +   +  +N        +  +S       +  T  TF + A D  G G E+   V I + D ND+ P        ++I E       +  V  ND D G+N +    +N
Sbjct:   50 DPRSNSDFTLDPNTGMIKTARNLERQQTFSYNLTIGAADHGLPSFSATTRVSIVVGDLNDNNPVFNPTNYSTTVFENSPVGTSLLDVTATDADSGQNAYVTYSVTAGDSHGL-----------FRAVTKVSNHGTI---EVAGNLDREVNDFYNLTITATDGGVPISRTAIAIALVRILDRNDNVPKFSHARYTGSIQE--NSGPGVPVQMASSIMATDRDIES--NADVRYRLNGSDSIQFAVNP--RTGVITTRVSPPPSLDHERTTNYTFHVIAADQAGTGHESLAEVVIHVLDANDNTPRFIPSSIQSTISEAASIGQSVARVTANDPDSGLNGRIFFSIN 374          

HSP 2 Score: 51.6026 bits (122), Expect = 9.881e-33
Identity = 34/85 (40.00%), Postives = 46/85 (54.12%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQ-QYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAI 1916
            +DRE K  YS T+ A+D G   L     V++ I D ND  P F   QY   + +   + TI  +L  V A+D+D+G NG V YAI
Sbjct:  497 LDRETKQAYSFTVHARDGG--GLESNVAVNVEIGDENDNSPQFPTVQYQTDVIDRTPVGTI--VL-AVNAEDRDVGNNGHVTYAI 576          

HSP 3 Score: 48.9062 bits (115), Expect = 9.881e-33
Identity = 27/82 (32.93%), Postives = 39/82 (47.56%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
             DRE+ + Y + +  ID    P  G    TVT+ D NDN PKF        ++E   +G+ I    A DPD   N  ++Y +
Sbjct:  396 LDREAKAVYVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTPKFTKPAFNVDVSEGVAVGSVIVNATATDPDQGSNAAITYSM 477          

HSP 4 Score: 74.3294 bits (181), Expect = 5.897e-21
Identity = 78/283 (27.56%), Postives = 129/283 (45.58%), Query Frame = 3
Query:  396 VLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQW--PTVNISKTVKECDRQGP-LVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGI 1229
            + EV++++ D NDN P+F       +I E + IG  ++  TA+D DS  N  I + I            +F+  R   +            +++   +DRE    + L + A D     ++G  T+TV++ DVNDN+P++  P  N+   V E    G  +V   A D D  S  N  I Y +S   P        F I  ++  ++       + K   +F + A DGGG E++ AV +EI D ND++P     +    +   DRTP+    + VN +D+ +
Sbjct:  317 LAEVVIHVLDANDNTPRFIPSSIQSTISEAASIGQSVARVTANDPDSGLNGRIFFSINS------GSEGKFEIGRSDGV------------VRVSGSLDREAKAVYVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTPKFTKPAFNVD--VSEGVAVGSVIVNATATDPDQGS--NAAITYSMS--YPG-------FAINSNTGSVTITRPLDRETKQAYSFTVHARDGGGLESNVAVNVEIGDENDNSPQFPTVQYQTDVI--DRTPVGTIVLAVNAEDRDV 566          

HSP 5 Score: 46.2098 bits (108), Expect = 5.897e-21
Identity = 33/129 (25.58%), Postives = 56/129 (43.41%), Query Frame = 1
Query: 1339 IPDTF-------FDRESLSFYSVL-----IRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITILGKIEAKWKLIEKSKTN 1689
            +PDT         DRE  S Y+++     +   D G        L  +++ D NDN P+F   +   T+ EN  +G  +  V A D DS  N ++ Y +   D  +    +  G+I  +  +  ++K N
Sbjct:  584 VPDTGNINTSSKLDREQQSLYTLVHYVLNLSVTDHGVTQFTSFALLNISVTDFNDNQPQFNQSEYSATVLENMPVGTKVTMVTARDEDSGINSQIMYSLTGGDGVFSIEPST-GQIRLQKAINREAKEN 711          

HSP 6 Score: 66.2402 bits (160), Expect = 2.326e-19
Identity = 86/367 (23.43%), Postives = 147/367 (40.05%), Query Frame = 3
Query:  279 FILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQVLE------VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLV-ELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXX--XXXMDLKTYITFFI--TAVDGGGRENST--AVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYFTMVKECLQSIKWTAALYVQYQKN 1340
            F +    G+++   ++DRE     A     + + +I+G          V V + D NDN P+F+     + + E   +GS +   TA D D   N+ I Y                  S  +  F    N   +    + + +DRE    +   + A D G  + +  + V I D NDNSPQ+PTV     V +    G +V  + A DRD  +  NG + Y I        LI     +  +    +S     +   L T + + +  +  D G  + ++   + I + D ND+ P     + +A++ EN      +T V   D+D GINSQ    L        ++     I+   A+  + ++N
Sbjct:  381 FEIGRSDGVVRVSGSLDRE-----AKAVYVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTPKFTKPAFNVDVSEGVAVGSVIVNATATDPDQGSNAAITY------------------SMSYPGFAINSNTGSV---TITRPLDRETKQAYSFTVHARDGGGLESNVAVNVEIGDENDNSPQFPTVQYQTDVIDRTPVGTIVLAVNAEDRDVGN--NGHVTYAI--------LILPFIIVPDTGNINTSSKLDREQQSLYTLVHYVLNLSVTDHGVTQFTSFALLNISVTDFNDNQPQFNQSEYSATVLENMPVGTKVTMVTARDEDSGINSQIMYSLTGGDGVFSIEPSTGQIRLQKAINREAKEN 711          

HSP 7 Score: 48.9062 bits (115), Expect = 2.326e-19
Identity = 35/111 (31.53%), Postives = 49/111 (44.14%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENN-NIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITILGKIEAKWKLIEKSK 1683
             +RE+   Y V I   D G P L  +    V ++D NDN P F S     T++E N   G  +  V A D D   NG V+Y I++     +      G I  +  L  +SK
Sbjct:  704 INREAKENYHVTITASDRGTPVLSSDAKVHVHVLDVNDNPPVFTSRVYERTMSEGNAAAGEFVVQVNATDADVERNGHVTYTIMHGALGMFTINETTGVIRTQGVLNRESK 814          

HSP 8 Score: 56.225 bits (134), Expect = 2.381e-15
Identity = 75/261 (28.74%), Postives = 120/261 (45.98%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEP-SLNDTCTVHIRILDVNDCVPVFKQ-QYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNL-REREGIRLPDRLIIRASDNGTPPKAELVTVNI 2438
            +DRE+ D Y+LTI A D G P S        +RILD ND VP F   +Y   I E +G      +   + A D+D+  N  V Y +     + +      +N     +   ++    +D E+  +    +IA D       ++A V++ VLD NDN P+F   I       IS  + +G+ +A   A DPD G NG I +SI S    +  +    ++DG + ++ +L RE + + +   L + A D    P+    TV +
Sbjct:  180 LDREVNDFYNLTITATDGGVPISRTAIAIALVRILDRNDNVPKFSHARYTGSIQENSGPGVPVQMASSIMATDRDIESNADVRYRL-----NGSDSIQFAVNPRTGVITTRVSPPPSLDHERTTNYTFHVIAADQAGTGHESLAEVVIHVLDANDNTPRF---IPSSIQSTISEAASIGQSVARVTANDPDSGLNGRIFFSINSGSEGKFEIG---RSDGVVRVSGSLDREAKAVYV---LNVSAIDGSYSPREGYGTVTV 426          

HSP 9 Score: 45.4394 bits (106), Expect = 2.381e-15
Identity = 30/109 (27.52%), Postives = 48/109 (44.04%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYF----TITILGKIEAKWKL 1668
             +R+    Y++ I   D G P        ++ + D NDN P F   +   T+ EN+ +G  +  V A D DS +N  V+Y +   D +  F     ++  G IE    L
Sbjct:   72 LERQQTFSYNLTIGAADHGLPSFSATTRVSIVVGDLNDNNPVFNPTNYSTTVFENSPVGTSLLDVTATDADSGQNAYVTYSVTAGDSHGLFRAVTKVSNHGTIEVAGNL 180          

HSP 10 Score: 57.7658 bits (138), Expect = 6.242e-15
Identity = 70/247 (28.34%), Postives = 105/247 (42.51%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQ-ITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNG 2402
            +D E    Y+  ++A D           V I +LD ND  P F        I+E    A+I   + +VTA+D D G NG ++++I    +                 +G++ + G +DRE        + A D           V V + DVNDN PKF  P      +++S    VG V+ N  A DPD+G N  ITYS +S+     N      N G + +T+ L +RE  +      + A D G
Sbjct:  292 LDHERTTNYTFHVIAADQAGTGHESLAEVVIHVLDANDNTPRFIPSSIQSTISEA---ASIGQSVARVTANDPDSGLNGRIFFSINSGSE---------GKFEIGRSDGVVRVSGSLDREAKAVYVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTPKFTKPAFN---VDVSEGVAVGSVIVNATATDPDQGSNAAITYS-MSYPGFAIN-----SNTGSVTITRPL-DRE-TKQAYSFTVHARDGG 515          

HSP 11 Score: 42.3578 bits (98), Expect = 6.242e-15
Identity = 31/97 (31.96%), Postives = 44/97 (45.36%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRP-PLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPI---GYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
             DRE   FY++ I   D G P       +  V I+D NDN PKF       ++ EN+  G P+     + A D D   N  V Y+ LN  ++  F +
Sbjct:  180 LDREVNDFYNLTITATDGGVPISRTAIAIALVRILDRNDNVPKFSHARYTGSIQENSGPGVPVQMASSIMATDRDIESNADVRYR-LNGSDSIQFAV 275          

HSP 12 Score: 67.0106 bits (162), Expect = 4.089e-11
Identity = 38/90 (42.22%), Postives = 50/90 (55.56%), Query Frame = 3
Query: 1650 RSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQ-YFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAI 1916
            R Q  I+RE K+ Y +TI A D G P L+    VH+ +LDVND  PVF  + Y   ++EGN  A    +  +V A D D+  NG V Y I
Sbjct:  699 RLQKAINREAKENYHVTITASDRGTPVLSSDAKVHVHVLDVNDNPPVFTSRVYERTMSEGNAAAGEFVV--QVNATDADVERNGHVTYTI 786          

HSP 13 Score: 41.5874 bits (96), Expect = 1.556e-9
Identity = 28/83 (33.73%), Postives = 39/83 (46.99%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQIL 1602
             DRE+   YS  +   D G   L       V I DENDN+P+F +   +  + +   +G  +  V A D D   NG V+Y IL
Sbjct:  497 LDRETKQAYSFTVHARDGGG--LESNVAVNVEIGDENDNSPQFPTVQYQTDVIDRTPVGTIVLAVNAEDRDVGNNGHVTYAIL 577          

HSP 14 Score: 40.0466 bits (92), Expect = 1.556e-9
Identity = 70/271 (25.83%), Postives = 113/271 (41.70%), Query Frame = 3
Query: 1662 EIDREIKDQYSLT-----IMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQ-QYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYIPNN 2456
            ++DRE +  Y+L      +   D+G         ++I + D ND  P F Q +Y   + E   + T    +  VTA D+D G N  + Y++                       G + +   ++RE   +    I A D G P LS+ A V V VLDVNDN P F   + +        ++  G+ +    A D D   NG +TY+I+ H  +     + +     +I T+ +  RE       LI+ A D G  P  +  T+++  I  N
Sbjct:  595 KLDREQQSLYTLVHYVLNLSVTDHGVTQFTSFALLNISVTDFNDNQPQFNQSEYSATVLENMPVGTK---VTMVTARDEDSGINSQIMYSLTGG----------DGVFSIEPSTGQIRLQKAINREAKENYHVTITASDRGTPVLSSDAKVHVHVLDVNDNPPVFTSRVYERTMS--EGNAAAGEFVVQVNATDADVERNGHVTYTIM-HGALGM---FTINETTGVIRTQGVLNRESKDF-YTLIVMARDQGAVPYMDFGTIDVHVIDKN 845          

HSP 15 Score: 57.3806 bits (137), Expect = 3.837e-8
Identity = 56/227 (24.67%), Postives = 98/227 (43.17%), Query Frame = 3
Query:  279 FILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQVLEVMVY------INDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQ--QGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGP--LVELQAFDRDDSSTPNGQIKYKI 929
            FI+   +G +   + +DRE    +  V   + L   +  V +   +      + D NDN PQF+    + ++ EN  +G+++++ TA D DS  NS I Y +                   F+I   T        ++L K I+RE  + + + + A D G         + V ++DVNDN P + +    +T+ E +      +V++ A D D     NG + Y I
Sbjct:  581 FIIVPDTGNINTSSKLDREQQSLYTLVHYVLNLSVTDHGVTQFTSFALLNISVTDFNDNQPQFNQSEYSATVLENMPVGTKVTMVTARDEDSGINSQIMYSLT-------------GGDGVFSIEPST------GQIRLQKAINREAKENYHVTITASDRGTPVLSSDAKVHVHVLDVNDNPPVFTSRVYERTMSEGNAAAGEFVVQVNATDADVER--NGHVTYTI 786          
BLAST of Protocadherin-1 vs. Ensembl Nematostella
Match: EDO48237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKF4])

HSP 1 Score: 65.4698 bits (158), Expect = 1.414e-32
Identity = 87/333 (26.13%), Postives = 142/333 (42.64%), Query Frame = 3
Query:  276 YFILQSHSGILKQRNNIDRETMCKH------ADVCQKIILISINGQVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSI--IDVNDNSPQWPTVNISKTVKECDRQGPLV-ELQAFDRDDSSTPNGQIKYKI-SDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGR--ENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQ 1238
            YF +   +G++  +  +DRE + +H       D  +     S+ G  +++ + + D NDN P F        I E+  IG  +    A D DS  N  ++Y I          +N    +  F+I   +        + ++K++DRE++  + L + A+D G    S T+TV I  +DVND +PQ+     S T++E      LV  ++A D D  S  NG++ ++I S N      INR+      +  +  +     ++       +TA D G     N T V I + D ND+AP          I EN         V   D D G N +
Sbjct:   70 YFSIDQITGVITTKRGLDREFLDRHFFRVKAEDGGEP----SLEG-YMDLTINVLDVNDNGPIFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCI----------LNSDGDNSAFSIGEVS------GAVTVMKKLDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGS--NGEVFFEIVSGNDMNFFSINRI------NGEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGE 373          

HSP 2 Score: 61.2326 bits (147), Expect = 1.414e-32
Identity = 73/255 (28.63%), Postives = 117/255 (45.88%), Query Frame = 3
Query: 1680 KDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQ-YFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPD-RLIIRASDNGTPPKAELVTVNI 2438
            K  Y  ++ A D     L+ T  V++ + D N   P FK++ Y  ++ E   L T  ++L  V A D+D G N  + Y+I            +          G++   G +DRE++ + + E+ A D+G PQL A + V + + DVNDN P F  P  +     +  D + G  +    A D D G+N  I YS  S+   +    + + +   +I T    +RE I  P+  L + A+D GTPP    V V +
Sbjct:  509 KHVYVFSVSASDG---MLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGT--SVL-TVLATDRDTGSNAKISYSI----------ATLVPEFSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEA---KVREDIRPGGRVIEVSASDADIGKNAQIIYSFASNGDGQGT--FTIDSTQGIIRTLKPLDRETI--PEYELTVVATDQGTPPGQASVKVKV 740          

HSP 3 Score: 53.1434 bits (126), Expect = 1.414e-32
Identity = 31/99 (31.31%), Postives = 49/99 (49.49%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITILGKI 1650
             DRE +  ++  I+  D G P   G    T+T++D NDN PKF  ++   ++ EN+  G  +  V+A DPDS     V   + ++  +  F I   G I
Sbjct:  400 LDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTNVVYSIVSSSGHDRCFRINPQGLI 498          

HSP 4 Score: 79.337 bits (194), Expect = 8.112e-26
Identity = 79/291 (27.15%), Postives = 136/291 (46.74%), Query Frame = 3
Query:  432 DNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTI-FIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQ--QGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLV-ELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIE--DCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDL---NDTTYFTM 1277
            +N PQFS   +  S+ E++++G+ ++  +A D DS  N +IRY         +       ++ YF+I  I  +   K       + +DRE +DR    + AED G+   +G   +T++++DVNDN P +     +  + E    G  V  ++A D D  S  NG++KY I ++       N  F I   S  ++       +     T  + A D G    S  VT++I   D ND  P  +    +A+IRE+     ++T+V   D D+G N +   ++   ND  +F++
Sbjct:   15 NNPPQFSRLQEDASVSEDAEVGTVVATVSASDPDSGSNGMIRY--------SMSPSQNLMSATYFSIDQITGVITTK-------RGLDREFLDRHFFRVKAEDGGEPSLEGYMDLTINVLDVNDNGPIFERNIYAADIPEDKSIGDFVLAVRASDADSGS--NGEVKYCILNSDGD----NSAFSIGEVSGAVTVMKKLDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMNFFSI 284          

HSP 5 Score: 57.3806 bits (137), Expect = 8.112e-26
Identity = 28/86 (32.56%), Postives = 46/86 (53.49%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNND 1611
             D E +  +++L+   D G+P L  +    + +ID NDNAP+F S   +  + EN  +G     V+AYD D   NG +++  + ND
Sbjct:  297 LDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSFMQND 382          

HSP 6 Score: 73.9442 bits (180), Expect = 6.604e-24
Identity = 83/274 (30.29%), Postives = 123/274 (44.89%), Query Frame = 3
Query: 1662 EIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF-KQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHS----NRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPD-RLIIRASDNGTPPKAELVTVNIRYIPNNLTP 2465
            ++DRE    Y+L + A+D G P  + T TV I +LDVNDC P F K+ Y   I E      ++ ++  V A D D G NG V++ I    D +    NR N       K            +D E +      + A D G+P L     V + ++DVNDN P+F   ++      I  +  VG+     +A D D G NG IT+S      M+ +LP+ +  +   I  K   +RE  ++P     I+A D G P K     + I  +  N  P
Sbjct:  191 KLDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIRED---VPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMNFFSINRINGEVRVKQK------------LDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQF---VSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSF-----MQNDLPFSINENTGGISIKEELDRE--KVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNP 439          

HSP 7 Score: 56.6102 bits (135), Expect = 6.604e-24
Identity = 38/109 (34.86%), Postives = 57/109 (52.29%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNND-ENYYFTITILGKIEAKWKLIEK 1677
             DRE L  +   ++  D G P L G    T+ ++D NDN P F  +     + E+ +IG  +  VRA D DS  NG V Y ILN+D +N  F+I   G++     +++K
Sbjct:   86 LDREFLDRHFFRVKAEDGGEPSLEGYMDLTINVLDVNDNGPIFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGDNSAFSI---GEVSGAVTVMKK 191          

HSP 8 Score: 57.3806 bits (137), Expect = 5.173e-19
Identity = 33/106 (31.13%), Postives = 54/106 (50.94%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILN-NDENYYFTITILGKIEAKWKL 1668
             DRE +  Y++ ++  D G PP        +T++D ND  P+F       T+ E+  +   +  VRA D D   NG V ++I++ ND N++    I G++  K KL
Sbjct:  192 LDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMNFFSINRINGEVRVKQKL 297          

HSP 9 Score: 56.225 bits (134), Expect = 5.173e-19
Identity = 62/209 (29.67%), Postives = 99/209 (47.37%), Query Frame = 3
Query: 1644 ENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIIS 2270
            E R + ++D E+   ++L + A+D G+P L +  TV I ++DVND  P F   +F  +   N    +     +V A DKD G NG + ++  Q            L        G ++I   +DRE++      I A D G P     A + + +LD+NDN PKF     +    +I+ +S+ G  +   +A DPD G    + YSI+S
Sbjct:  290 EVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPEN--YAVGQEFYRVQAYDKDHGTNGEITFSFMQN----------DLPFSINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFS---QEEYHTSIAENSRWGTSVLQVKAIDPDSGPT-NVVYSIVS 482          

HSP 10 Score: 70.8626 bits (172), Expect = 3.217e-16
Identity = 67/207 (32.37%), Postives = 99/207 (47.83%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQ-YFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHM 2282
            +DRE  D++   + A+D GEPSL     + I +LDVND  P+F++  Y   I E     +I   +  V A D D G NG V Y I    D  N   +IG     + +         +DRE++ +   ++ A D G P  SA   V + +LDVND  P+F     K+    I  D  V +++    A D D+G NG + + I+S   M
Sbjct:   86 LDREFLDRHFFRVKAEDGGEPSLEGYMDLTINVLDVNDNGPIFERNIYAADIPEDK---SIGDFVLAVRASDADSGSNGEVKYCILNS-DGDNSAFSIGEVSGAVTVMKK------LDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFS---KKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDM 279          

HSP 11 Score: 33.4982 bits (75), Expect = 3.217e-16
Identity = 23/72 (31.94%), Postives = 34/72 (47.22%), Query Frame = 1
Query: 1465 DNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI---LNNDENYYFTI-TILGKIEAKWKL 1668
            +N P+F       +++E+  +G  +  V A DPDS  NG + Y +    N     YF+I  I G I  K  L
Sbjct:   15 NNPPQFSRLQEDASVSEDAEVGTVVATVSASDPDSGSNGMIRYSMSPSQNLMSATYFSIDQITGVITTKRGL 86          

HSP 12 Score: 70.8626 bits (172), Expect = 3.967e-12
Identity = 86/348 (24.71%), Postives = 153/348 (43.97%), Query Frame = 3
Query:  225 NSSGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQ---------VLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQ--QGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQG-PLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKG 1226
            N    Y I++++ D N+ F +   SG +     +DRE +  +         + +  Q          + V + + D ND  PQFS +  + +I+E+  +   ++   A D D   N  +  F + +   D   MN F           +INR+    +++ +++D E I  F L++ A+D G+       T+ +++IDVNDN+PQ+ + +    + E    G     +QA+D+D  +  NG+I +    N       +  F I  ++  +S +     +     TF I A D G   +E +  +TI + D ND+ P  +  +   SI EN R    +  V   D D G
Sbjct:  160 NGEVKYCILNSDGD-NSAFSIGEVSGAVTVMKKLDREKVPTYT--------LQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEV--FFEIVSGND---MNFF-----------SINRIN-GEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHGT--NGEITFSFMQN-------DLPFSINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSG 472          

HSP 13 Score: 56.9954 bits (136), Expect = 4.261e-12
Identity = 84/373 (22.52%), Postives = 151/373 (40.48%), Query Frame = 3
Query:  135 YIKLKISENKGSGEDLINLKNYIIIHKLPINSSGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHA-DVCQKIILISINGQVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDI-HSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQG-PLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQ 1238
            + +  I EN   G++   ++ Y   H    N   T++ + N+      F +  ++G +  +  +DRE + K    +  +   +       ++ + + D NDN P+FS      SI ENS  G+ +    A D DS P +++   +    H R  R                 IN   +  L      + + +  F    ++   G    +  + V++ D N ++P++   + S  VKE    G  ++ + A DRD  S  N +I Y I+   P+       F +  ++  + + G    +      F +TA D G    +  + V I I D ND+ P        A +RE+ R    +  V  +D D G N+Q
Sbjct:  343 HFQTMIPENYAVGQEFYRVQAYDKDHG--TNGEITFSFMQNDLP----FSINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTNVVYSIVSSSGHDRCFR-----------------INPQGLITLSCTLNYNTKHVYVFS---VSASDGMLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGS--NAKISYSIATLVPE-------FSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDADIGKNAQ 680          

HSP 14 Score: 33.113 bits (74), Expect = 4.261e-12
Identity = 27/106 (25.47%), Postives = 43/106 (40.57%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITI-LGKIEAKWKL 1668
             DRE++  Y + +   D G PP        V + D  D+ P F       T+ E+    +P+  V+A   D +    + Y I+  +    F I    G I+   KL
Sbjct:  710 LDRETIPEYELTVVATDQGTPPGQASVKVKVILEDVKDSPPLFEKPLYEVTVPEDTPPRSPVITVKAKSQDLSPETGMMYSIVRGNSPQVFDINPNTGAIQTLMKL 815          

HSP 15 Score: 51.9878 bits (123), Expect = 3.916e-11
Identity = 57/209 (27.27%), Postives = 92/209 (44.02%), Query Frame = 3
Query: 1650 RSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF-KQQYFYQITEG--NGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSII 2267
            ++   +DRE  D Y   + A D+G P L     V+I I DVND  PVF K  Y  ++ E    G   I     +V+A D D+G+N  + Y+     D               + +GI+     +DRE +   +  ++A D G P   A   V V + DV D+ P F+ P+ +   + +  D+     +   +A+  D      + YSI+
Sbjct:  599 KTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVI-----EVSASDADIGKNAQIIYSFASNGDGQG-------TFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPGQASVKVKVILEDVKDSPPLFEKPLYE---VTVPEDTPPRSPVITVKAKSQDLSPETGMMYSIV 792          

HSP 16 Score: 35.4242 bits (80), Expect = 3.916e-11
Identity = 18/60 (30.00%), Postives = 29/60 (48.33%), Query Frame = 1
Query: 1420 LVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
            L    L  V + D N +AP+F        + E+ ++G  +  V A D D+  N ++SY I
Sbjct:  523 LSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSI 582          

HSP 17 Score: 40.817 bits (94), Expect = 8.484e-9
Identity = 27/91 (29.67%), Postives = 45/91 (49.45%), Query Frame = 3
Query: 1650 RSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLG-ENGTVYYAIR 1919
            R+   +DRE   +Y LT++A D G P    +  V + + DV D  P+F++   Y++T          ++  V A  +DL  E G +Y  +R
Sbjct:  705 RTLKPLDRETIPEYELTVVATDQGTPPGQASVKVKVILEDVKDSPPLFEKP-LYEVTVPEDTPPRSPVI-TVKAKSQDLSPETGMMYSIVR 793          

HSP 18 Score: 38.1206 bits (87), Expect = 8.484e-9
Identity = 28/94 (29.79%), Postives = 39/94 (41.49%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNN-DENYYFTI 1632
             DRE +  Y   +   D G P L  +    + I D NDN P F        + E+   G  +  V A D D  +N ++ Y   +N D    FTI
Sbjct:  604 LDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSFASNGDGQGTFTI 697          
BLAST of Protocadherin-1 vs. Ensembl Nematostella
Match: EDO40470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S751])

HSP 1 Score: 67.0106 bits (162), Expect = 4.194e-30
Identity = 84/348 (24.14%), Postives = 150/348 (43.10%), Query Frame = 3
Query:  285 LQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQVLEVMVYINDENDNIPQF--SMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKE-CDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRE---NSTAVTIEIEDCNDHAPNIAIYKSTAS---IRENDRTPLVLTSVMVNDDDKGINSQFNCDL-NDTTYFTMVKECL 1292
            L+ ++G++  +  +DRE +  +      I+  S   +   V+VY+ D NDN P F      K +  + + D   +L    A D D   NS   Y I   +  ++ ++   + +         +N   I        +DRE +D + L + A D G     G   +++++ D NDN P++  V+ S T+ E  D    ++++ A D+D  +  N +I+Y I  +S  +     +F I  ++  + +      + K      + A D G      +S  V IE+ D ND+ P I +  +      + EN      +  V V+D D G N + N  L     YF+M  + L
Sbjct:    7 LEYNAGVITTKTVLDREKVSAY---NLTIVEFSTPPKSYTVLVYVQDLNDNSPSFVRGTSAKLVVFENDKDFRQKL---IAVDSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDGDLYADLVVNASSI-------GVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGT--NAEIQYSIETHSDPQA----IFGIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVL 335          

HSP 2 Score: 53.1434 bits (126), Expect = 4.194e-30
Identity = 32/97 (32.99%), Postives = 44/97 (45.36%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDEN----YYFTI 1632
             DRE+   + +   CID G PP   EK F + + D ND APKF        + EN  +   +  V A D D   N  + Y I N  E+    ++F I
Sbjct:  347 LDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAI 443          

HSP 3 Score: 51.2174 bits (121), Expect = 4.194e-30
Identity = 32/103 (31.07%), Postives = 50/103 (48.54%), Query Frame = 3
Query: 1626 YNHYFRENRSQ------MEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAI 1916
            Y H+F  + S        ++DRE   Q  LT++  D G P L+D C+V + + D ND  P F Q  +      N  +    +  ++ A D D+GEN  + Y+I
Sbjct:  437 YLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVV--QLLAQDPDIGENSLILYSI 537          

HSP 4 Score: 63.5438 bits (153), Expect = 4.724e-28
Identity = 93/286 (32.52%), Postives = 131/286 (45.80%), Query Frame = 3
Query: 1656 QMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQ-QYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPD-KGENGTITYSIISH-KHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYIPNNLTPRNNALPPGINKKS 2504
            + ++DRE  ++Y+L ++A D+G P  + +  V + + DVND  P F+Q  Y + + E   +AT    LG V+A D D G NG V Y    ++D    Q  +     KI          V+DRE   S    I+A D G         V V V DVND  PKF    NK + + ++ D  VG  L    A D D +G N  ITY I++  K    N     Q  G L L   L +RE +     L + ASD G     E +T    YI  N+   N+  P  IN+ +
Sbjct:  971 KSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVAT---YLGAVSASDSDEGSNGHVTY----RFDTQVAQFIVDKQTGKITTSQ------VLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSK--NKYS-VTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGPKAFSLN-----QVTGVLTLVSPL-DRE-VTHRHILHVVASDKGGNQSLETIT----YIEINVLDVNDNYPVFINETT 1229          

HSP 5 Score: 53.9138 bits (128), Expect = 4.724e-28
Identity = 85/353 (24.08%), Postives = 144/353 (40.79%), Query Frame = 3
Query:  270 NNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQVLEVMVYIN--DENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQG--SCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLV-ELQAFDRDDSSTPNGQIKYKIS-DNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFIT--AVDGG-----GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLT--SVMVNDDDKGINSQFNCDL--NDTTYFTM 1277
            N  F L    G++     +D E    +     ++      G+     V+++  D NDN P F     ++   EN+ IG  +    A D DS   +I R+ I+           Q  A   F++    +       + L K +DRE  D + L + A D G Q       + ++++DVND  P +     + T++E  +   ++  + A  RD  +  N ++ Y IS  N+    LIN    +              +D +   + ++T  A D G     G  N   VTI + D ND++P      S+  +R  + TP+  T  +V V D D G+  + +  L  N  T F +
Sbjct:  541 NTPFFLDPRKGLVTNSRTLDHEVQSSY---TFQVAATDGGGRSCNATVHVSLTDLNDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIE-----------QGNADEVFSVDGSGL-------ITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGT--NAEVVYSISKGNTDNIVLINSTGTL---------YLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYAN---VTIAVIDINDNSPQFN--SSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPGTLFNL 856          

HSP 6 Score: 46.595 bits (109), Expect = 4.724e-28
Identity = 32/101 (31.68%), Postives = 48/101 (47.52%), Query Frame = 1
Query: 1366 SLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITILGKIEAKWKL 1668
            S   Y++ ++  D G PP     +  + ++D ND +P FG+      + E     + I  V A D DS ENGR+SY   +  +   F +   GKI  K KL
Sbjct:  874 SARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFGLRNGGKIFIKSKL 974          

HSP 7 Score: 82.4185 bits (202), Expect = 1.417e-23
Identity = 89/334 (26.65%), Postives = 146/334 (43.71%), Query Frame = 3
Query:  279 FILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQV------LEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSEL-SLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTIT---VSIIDVNDNSPQWPTVNISKTVKECDRQGPLVE-LQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTA---VTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQ 1238
            FI+   +G +     +DRE    +        +++ +G         +V V + D ND  P+FS    ++++ E+  +GS L +L   DD    PNS I Y I  +       +NQ                     L L+  +DRE   R  L ++A D G  Q   TIT   ++++DVNDN P +      KTV E    G +V  + A D D     NG+++YKI + +      +  F I  ++  +S+      ++       ++A D G ++  T+   VTI +ED ND+ P          I EN      +T++  +DDD G+NS+
Sbjct: 1062 FIVDKQTGKITTSQVLDREAKASYV-----FSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMI--VAGPKAFSLNQVTG-----------------VLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGD--NGKVRYKIVNGN-----TDGTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDDSGLNSR 1364          

HSP 8 Score: 46.9802 bits (110), Expect = 1.417e-23
Identity = 29/93 (31.18%), Postives = 47/93 (50.54%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLG---RPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYY 1623
             DRE +S YS+ +R  D     +  L       + I D NDNAPKF S ++ + + E+      +  + A DPD+ + G V Y+I++ D   +
Sbjct: 1393 IDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLTYVM-EDEPFNFQVTSITALDPDTGQGGNVEYRIVSPDTGKF 1484          

HSP 9 Score: 55.0694 bits (131), Expect = 3.066e-23
Identity = 87/327 (26.61%), Postives = 133/327 (40.67%), Query Frame = 3
Query:  387 NGQVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKT---INRMKIPYLKLIKEIDREEIDRFELILI-AEDSGKQQ---GSCTITVSIIDVNDNSPQWP---TVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDN----SPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAV--DGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYFTMVKECLQSIKWTA 1313
            N   L + + + D NDN P+FS    + +I EN D+G+ +   +A D D   N+ I+Y I + HS              F I   T   +N +++ Y          E  R  LI++ AED G       S  + + ++DVNDN+P      T+  S  V E    G  V   +    DS   NG++   +       S K +++N    IA           Q +D +T+  FF+ AV  D G   R    +  I + D ND AP    +     + EN     ++  V   D D G NS+    + +TT      E    + W A
Sbjct:  152 NHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSI-ETHS---------DPQAIFGIHPTTGVIVNNVRLDY----------EAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGK-NGEVNVTLEGGDGYFSMKFDVLNDESIIA---------VGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTT------ESRSYLHWFA 442          

HSP 10 Score: 50.447 bits (119), Expect = 3.066e-23
Identity = 30/85 (35.29%), Postives = 40/85 (47.06%), Query Frame = 1
Query: 1348 TFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQIL 1602
            T  DRE +    + +   D G PPL       V + D NDN P F       +L EN+  G+P+  + A DPD  EN  + Y IL
Sbjct:  454 TDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSIL 538          

HSP 11 Score: 42.743 bits (99), Expect = 3.066e-23
Identity = 69/278 (24.82%), Postives = 116/278 (41.73%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQ-----QYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPD-RLIIRASDNGTPPKAELVTVNIRYIP-NNLTPRNNA 2477
            +D E++  Y+  + A D G  S N   TVH+ + D+ND  PVF       +YF     G  +  + AI       D+D  +     + I Q              +  ++  G++ +  ++DRE   +    + A D G  Q S    ++   +   +++P   +   + NF  I   SQ   V+ +  A   DKG N  + YSI   K    N+   + + G L L   +      ++P   L ++A D GTPP      V I  I  N+ +P+ N+
Sbjct:  559 LDHEVQSSYTFQVAATDGGGRSCN--ATVHVSLTDLNDNQPVFDPSSYSVEYFENTRIGQSICQLKAI-------DRDSPKFAITRFIIEQG---------NADEVFSVDGSGLITLAKLLDRETQDNYLLTVKAVDGGG-QDSVNKAIVNITVLDVNDEPPI-FSKAEYNF-TIQEHSQALSVIGHVHAISRDKGTNAEVVYSI--SKGNTDNI-VLINSTGTLYLQSEVDHE---KIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQFNS 809          

HSP 12 Score: 53.1434 bits (126), Expect = 1.430e-22
Identity = 69/234 (29.49%), Postives = 102/234 (43.59%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNG---EPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFIN-ISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLRERE 2354
            IDRE   +YSL + A D     +  L +T T+ I I D+ND  P F  +    + E       +  +  +TA D D G+ G V Y I                       G+L + G +D E +      I A D G P L++     V V+DVNDN P+F   +    FI  +S +   G  +    A D D G N  +TYSI S   M++   + +     LI+T ++ +RE
Sbjct: 1393 IDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLTYVMEDEPF---NFQVTSITALDPDTGQGGNVEYRIVSP---------DTGKFSLDLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDL----FIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMDK---FSIDKHSGLIVTNSILDRE 1607          

HSP 13 Score: 52.373 bits (124), Expect = 1.430e-22
Identity = 72/285 (25.26%), Postives = 112/285 (39.30%), Query Frame = 3
Query:  402 EVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQ--GSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQG-PLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGR---ENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQ 1238
            +V V ++D NDN P F        ++EN  + + L   +A D D   N  + Y                   R+ T   + I   +   +   + +DRE    +   ++A D G         +TV + DVND SP++     S TV E    G  L+ L A D DD   PN  I Y I    PK   +N++  +      L  +      L       + A D GG    E  T + I + D ND+ P      +  ++ E      V+ +V+  D D+G N +
Sbjct: 1001 DVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTY-------------------RFDTQVAQFIVDKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATD-DDQQGPNSDITYMIV-AGPKAFSLNQVTGVLTLVSPLDREVTHRHILH------VVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGK 1258          

HSP 14 Score: 40.4318 bits (93), Expect = 1.430e-22
Identity = 27/94 (28.72%), Postives = 44/94 (46.81%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPL-VGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
             D E  + Y + +   D+G+       +L T+ + D NDN P F  + I   + EN  I   +  ++A+D DS  N R+ Y I +     +F I
Sbjct: 1287 LDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQSPRAHFKI 1380          

HSP 15 Score: 67.0106 bits (162), Expect = 1.931e-22
Identity = 79/270 (29.26%), Postives = 122/270 (45.19%), Query Frame = 3
Query: 1689 YSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAI--------LGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAE--LVTVNIRYIPNNLTPR 2468
            Y+L + A+D G P  + T  + ++++DVND  PVF          GN   T H +        + +V A D D GENG + YA   K D S      G  +   +          +DRE +     ++IA D+G P+ S+ A+V V V DVNDN P F+       F  +  +  V   L    A D D+G NG +TY     +   Q   + +      I T  + +RE  +      I A+D G+ P+ +   VTV +R + N+ +P+
Sbjct:  878 YTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVF----------GNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFGLRNGGKIFIKSK---------LDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQA--SYAFF-VKENEPVATYLGAVSASDSDEGSNGHVTY-----RFDTQVAQFIVDKQTGKITTSQVLDREA-KASYVFSIVATDGGSSPRVDKTQVTVIVRDV-NDCSPK 1118          

HSP 16 Score: 58.151 bits (139), Expect = 1.931e-22
Identity = 32/84 (38.10%), Postives = 45/84 (53.57%), Query Frame = 1
Query: 1357 DRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNN 1608
            D E +    + ++  D G PPL G    T+ +ID NDN+P+F S  I   L E+  IG     V  +D DS   GRVS+ +L+N
Sbjct:  766 DHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQFNSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSN 849          

HSP 17 Score: 46.595 bits (109), Expect = 2.502e-18
Identity = 31/86 (36.05%), Postives = 45/86 (52.33%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKD-NGEPSLNDTCTVHIRILDVNDCVPVF-KQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAI 1916
            +DRE+  ++ L ++A D  G  SL     + I +LDVND  PVF  +  F  + E      I +++  V A D D G+NG V Y I
Sbjct: 1181 LDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEK---LPIGSVVAAVLAVDSDQGDNGKVRYKI 1263          

HSP 18 Score: 45.0542 bits (105), Expect = 2.502e-18
Identity = 72/286 (25.17%), Postives = 116/286 (40.56%), Query Frame = 3
Query:  405 VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDR-FELILIAEDSGKQQGSCT--ITVSIIDVNDNSPQWPTVNISKTVKECDRQGP---LVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGG--RENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQ 1238
            V + + D NDN PQF+     + + E++ IG      +  D DS                 + R++    S   T+F    N      L L K ID     R + L + A+D G    S T  + + ++DVND SP +   N S T    +   P   ++E+ A D D  S  NG+I Y         ++    F +           L   D++ Y    + A+D G   R +S  V + ++D ND+ P+         ++EN+     L +V  +D D+G N  
Sbjct:  793 VTIAVIDINDNSPQFNSSSILVRLPEDTPIGHTFYTVSVFDADSGV---------------LGRVSFSLLSNPGTLFNLDSNTGA---LSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFG--NWSYTAHVLETTPPDSNIIEVVATDVD--SGENGRISYAF-----DSKVDTSKFGLRNGGKIFIKSKLDREDIEEY-NLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGH 1050          

HSP 19 Score: 39.6614 bits (91), Expect = 2.502e-18
Identity = 26/84 (30.95%), Postives = 41/84 (48.81%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSN-ENGRVSYQIL 1602
             DRE+ + Y   I   D G  P V +   TV + D ND +PKF  +    T+ E+  +G+ +  + A D D    N  ++Y I+
Sbjct: 1077 LDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIV 1160          

HSP 20 Score: 68.9366 bits (167), Expect = 1.489e-16
Identity = 71/229 (31.00%), Postives = 110/229 (48.03%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF-KQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKF-KYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLR 2345
            +DRE  D + L  +  D G+P      +  I + DVNDC P F +  Y  ++ E    AT++ ++  V A D+D G N  + Y I    +  +  +   ++     +    +    +DREQ+  +   ++ +D G P LS   +VIV++ D NDN P F +   N   F N  + S V ++L    A+DPD GEN  I YSI++      N P+ L  D R  L  N R
Sbjct:  347 LDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWEN---ATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATD----LDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLL----AQDPDIGENSLILYSILT-----PNTPFFL--DPRKGLVTNSR 557          

HSP 21 Score: 36.5798 bits (83), Expect = 1.489e-16
Identity = 28/100 (28.00%), Postives = 45/100 (45.00%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRP-PLVGEKLFTVTIIDENDNAPKFGSDDIRFTL------TENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
             D E+   Y ++++  D G    L    +  + ++D NDN P      + +TL      TEN  IG  +  V   D DS +NG V+  +   D   YF++
Sbjct:  236 LDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVI---HVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDG--YFSM 330          

HSP 22 Score: 56.6102 bits (135), Expect = 2.841e-16
Identity = 86/340 (25.29%), Postives = 142/340 (41.76%), Query Frame = 3
Query:  297 SGILKQRNNIDRETMCKHADVCQKI---ILISINGQVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQ--GSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQG-PLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXM--DLKTYITFFITAVDGGGRENSTAVTIEIE--DCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLN---DTTYFTM 1277
            SG++     +DRET   +    + +      S+N  ++ + V   D ND  P FS      +IQE+S   S +    A   D   N+ + Y I                S+  T  I  IN     YL+   E+D E+I    L + A+D G     G   +T+++ID+NDNSPQ+ + +I   + E    G     +  FD D      G++ + +  N         LF +  ++  LS   L       ++Y T  + A DGG    S+   +E++  D ND++P    +  TA + E       +  V+  D D G N + +   +   DT+ F +
Sbjct:  652 SGLITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVL--DVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSI----------------SKGNTDNIVLINSTGTLYLQ--SEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQFNSSSILVRLPEDTPIGHTFYTVSVFDADSGVL--GRVSFSLLSNP------GTLFNLDSNTGALSLTKLIDYGNSARSY-TLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFGL 962          

HSP 23 Score: 48.1358 bits (113), Expect = 2.841e-16
Identity = 30/98 (30.61%), Postives = 44/98 (44.90%), Query Frame = 1
Query: 1303 NGRQLFMYNIKKIPDTFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQ 1596
            NG ++F+        +  DRE +  Y++ +  ID G P         V + D NDN P F      F + EN  +   +G V A D D   NG V+Y+
Sbjct:  964 NGGKIFI-------KSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYR 1054          

HSP 24 Score: 49.2914 bits (116), Expect = 1.455e-14
Identity = 25/83 (30.12%), Postives = 41/83 (49.40%), Query Frame = 1
Query: 1351 FFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
              DRE+   Y + ++ +D G    V + +  +T++D ND  P F   +  FT+ E++   + IG+V A   D   N  V Y I
Sbjct:  660 LLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSI 742          

HSP 25 Score: 49.2914 bits (116), Expect = 1.455e-14
Identity = 72/263 (27.38%), Postives = 112/263 (42.59%), Query Frame = 3
Query: 1656 QMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF-KQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKF-KYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNI 2438
            Q E+D E      LT+ AKD G P L     V I ++D+ND  P F       ++ E   +   H     V+  D D G  G V +++      +        +         L  YG   R   + +QA+    D G P  S+ A + + V+DVND  P F  +            DS + +V+A     D D GENG I+Y+  S     +   + L+N G++ +   L +RE I   +  +I A D+GTP ++    V +
Sbjct:  762 QSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQFNSSSILVRLPEDTPIG--HTFY-TVSVFDADSGVLGRVSFSLLS----NPGTLFNLDSNTGALSLTKLIDYGNSARSYTLPVQAQ----DGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVAT----DVDSGENGRISYAFDSKVDTSK---FGLRNGGKIFIKSKL-DREDIEEYNLKVI-AIDHGTPRRSSSADVKV 1004          

HSP 26 Score: 50.8322 bits (120), Expect = 1.952e-14
Identity = 28/75 (37.33%), Postives = 42/75 (56.00%), Query Frame = 3
Query: 1686 QYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYY 1910
            QYSLTI A D G P L+   T+ + + D ++  P F +  +     GN  A I   +G+VTA D+D G+ G V++
Sbjct: 2585 QYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSFNRMDYKFDVPGN--AKIGDFVGQVTATDRDSGDQGRVFF 2657          

HSP 27 Score: 47.3654 bits (111), Expect = 1.952e-14
Identity = 28/96 (29.17%), Postives = 49/96 (51.04%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKF---GSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
             D E++  + V +R  D G PP+  +   T+ ++D NDN P F   G +D++  + EN  + + +  + A D DS  N R+S+ ++       F I
Sbjct: 2470 LDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQ--VLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLI 2563          

HSP 28 Score: 50.8322 bits (120), Expect = 2.413e-14
Identity = 77/292 (26.37%), Postives = 128/292 (43.84%), Query Frame = 3
Query: 1659 MEIDREIKDQYSLTIMAKDNGEP-SLNDTCTVHIRILDVNDCVPVFKQQYF----YQITEGNGLATIHAILGKVTADDKDLGENGTV---------YYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNF-INISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPY-QLQNDGRLILTKNLREREGIRLPD-RLIIRASDNGTPPKAELVTVNIRYIPNNLTPRNNALP 2483
            + +D E K  Y + + A+D G    L+ +  V I +LDVND  PV    Y     YQ+TE    ATI   + +V+  D D G+NG V         Y+++  K+D  N ++ I +                +DRE       + +  D G P  +   +  ++V DVND  PKF    ++  +   +  ++ V  ++A   A D D G N  + Y+I +       L +  +     +I T    +RE  ++P   L +   D G+PP ++  +V +     NLT  N+  P
Sbjct:  234 VRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTEN---ATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSM--KFDVLNDESIIAVGQS-------------LDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKF----DRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDRE--QIPQVVLTVLVHDRGSPPLSDNCSVIV-----NLTDSNDNDP 496          

HSP 29 Score: 46.9802 bits (110), Expect = 2.413e-14
Identity = 29/81 (35.80%), Postives = 39/81 (48.15%), Query Frame = 1
Query: 1357 DRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
            DRE L  Y + I   D G P   G    ++T+ D NDN P+F +     T+ EN ++G  I  V A D D   N  + Y I
Sbjct:  131 DRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSI 211          

HSP 30 Score: 50.8322 bits (120), Expect = 4.271e-14
Identity = 36/93 (38.71%), Postives = 50/93 (53.76%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
             D E +  Y++ I   DLG PPL   +LF V ++D NDN P+F  D    T++EN   G  +  V AYD DS  N  ++Y I +  E   F+I
Sbjct: 1499 LDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMDKFSI 1591          

HSP 31 Score: 46.2098 bits (108), Expect = 4.271e-14
Identity = 71/261 (27.20%), Postives = 104/261 (39.85%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYF-YQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRL-ILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIR 2441
            +DRE KD Y LT+ A     P    + +V I ++D ND  P F       ++ E +    I+ +    T  D D G N  V Y+I       N      +      L         +DRE   S Q  + A D   P  +A AN+ + + D NDN P F+     +    IS  +  G  + N  A D D G NG I Y++ +  +   ++      D R  I+    R    I+        A D G  PK  +V V I+
Sbjct: 1604 LDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISPVVTLKVPENSPARLIYTL----TVQDLDYGNNTKVLYSIMS----GNTDGAFTIGRSTGELSTTTK----LDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQ---QSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSNDTYGVYSI------DSRTGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIK 1843          

HSP 32 Score: 72.0182 bits (175), Expect = 1.431e-12
Identity = 79/262 (30.15%), Postives = 127/262 (48.47%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF-KQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYI 2447
            +DRE +D Y LT+ A D G     +   V+I +LDVND  P+F K +Y + I E    +   +++G V A  +D G N  V Y+I +             N++ IN  G L +   VD E++ S+   + A D G P L   ANV + V+D+NDN P+F    +    + +  D+ +G         D D G  G +++S++S+     NL     N G L LTK +      R    L ++A D G+PP++    + ++ +
Sbjct:  661 LDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQE---HSQALSVIGHVHAISRDKGTNAEVVYSISKG---------NTDNIVLINSTGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQFN---SSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPGTLFNLD---SNTGALSLTKLIDYGNSAR-SYTLPVQAQDGGSPPRSSTAMLELKVV 903          

HSP 33 Score: 51.9878 bits (123), Expect = 6.082e-12
Identity = 79/291 (27.15%), Postives = 117/291 (40.21%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF-KQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDK----------------------------GENGTITYSI-ISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLI---IRASDNGTPPKAELVTVNI 2438
            +D E    + L ++A   G  SLN    + I ++D ND  P F       Q+ E  G      ++ KVTA D D G NG V Y+I    +               +  G +    ++DRE   S    I   D+G P  S    V V V D+NDN P F    + ++ +NI  D++ G V+ +  A D DK                            G N  I YS  I++      + Y++  D  +I   + R    +R+ D  I   ++A D G PP+  LV V I
Sbjct: 2025 LDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVV-KVTATDVDSGTNGKVTYSIWTGNEAG--------VFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLF----DPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNS---DQIDYKIDADTGVI---SARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRI 2296          

HSP 34 Score: 37.7354 bits (86), Expect = 6.082e-12
Identity = 23/84 (27.38%), Postives = 45/84 (53.57%), Query Frame = 1
Query: 1378 YSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKF-GSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYF 1626
            +++ I   D G PPL G  +  + I +  D+ P+F      R ++ EN+ +G+ I  VRA    ++ + +V+Y I++ ++   F
Sbjct: 1928 HALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSYITTVRAR---ASSDAQVTYSIISGNKGRAF 2008          

HSP 35 Score: 65.855 bits (159), Expect = 1.280e-10
Identity = 77/275 (28.00%), Postives = 123/275 (44.73%), Query Frame = 3
Query: 1629 NHYFR-ENRSQM-----EIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQ-YFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTV 2432
            ++YFR   RS +      +D E K ++ L + A D+  PS      V+I + DVND  PVF Q  Y  Q +EG  + T   I+  V+A DKD G NG V++AI+   D  +   +    +++            +D E + +    + A D G P +    +V + VLD+NDN P F+ P    N + +  +  +   L    A D D G N  +++++I      Q L    +  G L                 L I+A+D G PP +  +T+
Sbjct: 2347 SNYFRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGT---IVVNVSAADKDSGANGRVWFAIQSGDDKGSFAIDRKTGVIRTQR--------ALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVP--GPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTG--QGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITI 2606          

HSP 36 Score: 62.003 bits (149), Expect = 1.838e-9
Identity = 62/243 (25.51%), Postives = 109/243 (44.86%), Query Frame = 3
Query:  417 INDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIF-IKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGS--CTITVSIIDVNDNSPQWPTVNISKTVKECDRQG-PLVELQAFDRDDSSTPNGQIKYKI-SDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAP 1130
            + D ND  P+F        + EN+ + + +++  A D D   NS + Y I           N  ++  Y   F I   + M    +    ++DRE+I +  L ++  D G    S  C++ V++ D NDN P +   + + ++ E    G P+V+L A D D     N  I Y I + N+P        F++      +++      ++++  TF + A DGGGR  +  V + + D ND+ P
Sbjct:  379 VGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTI----------ANTTESRSYLHWFAIDPSSGM----ITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGE--NSLILYSILTPNTP--------FFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGGGRSCNATVHVSLTDLNDNQP 597          

HSP 37 Score: 54.6842 bits (130), Expect = 3.194e-7
Identity = 74/260 (28.46%), Postives = 119/260 (45.77%), Query Frame = 3
Query: 1647 NRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQ-QYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKP-QLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRAS--DNGTPPK 2414
            N S + +DRE  D Y L I A D G P+ +    + I + D ND  P F    Y   I E   + T  +IL +V+A DKD+G N  + Y+I     HS+ Q   G++     +   + +     R  ++ ++AE    D G   QLS+ A V ++VLDVNDN P             ++ ++ +G  +A     D D G+NG +  ++        ++ + + ND  +I      +RE     D   ++A   D G PP+
Sbjct:  124 NASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGT--SIL-QVSASDKDIGTNAEIQYSIET---HSDPQAIFGIHPTTGVIVNNVRLDYEAKRSYLIVVKAE----DKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGY-FSMKFDVLNDESIIAVGQSLDRE---THDHFFLKAVCIDKGDPPR 369          

HSP 38 Score: 53.1434 bits (126), Expect = 7.609e-7
Identity = 78/274 (28.47%), Postives = 111/274 (40.51%), Query Frame = 3
Query: 1644 ENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQ-YFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMV--------SIQAEI----IAYDNGKPQLSAXXXXXXXXXXXXXXKPKF-KYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDR----LIIRASDNGTPP 2411
            E  +  ++DRE K  Y L++ AKD   P       + I I D ND  PVF+Q  Y   I+E     T  +IL  +TA DKD G NG + Y +                           +Y +  R  +V        SI+ E     IA D G+    A+  V + + D N++ P+F K P     F N S  + V  V A     D DK  NG +TY +   K+       +         T ++R   G   P +    L I A D+G+PP
Sbjct: 1701 ELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGT--SIL-NLTASDKDSGSNGNIVYTLSND---------------------TYGVYSIDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTAT--DADTDKSTNGKVTYRLDDSKNSTSLFVVESN-------TGSVRTSAGFSNPPQGRHALYIIAEDHGSPP 1941          

HSP 39 Score: 50.447 bits (119), Expect = 5.896e-6
Identity = 30/80 (37.50%), Postives = 41/80 (51.25%), Query Frame = 1
Query: 1354 FDRESLSFY--SVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRV 1587
            FD E+ + Y  S+ I+  D G PPL       V + DE++  P F   D +F +  N  IG  +G V A D DS + GRV
Sbjct: 2576 FDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSFNRMDYKFDVPGNAKIGDFVGQVTATDRDSGDQGRV 2655          

HSP 40 Score: 50.0618 bits (118), Expect = 6.747e-6
Identity = 46/180 (25.56%), Postives = 77/180 (42.78%), Query Frame = 3
Query:  405 VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG-----KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKI 929
            V +Y+ D NDN P F        I EN  I + ++   A D DS  NS I Y I     R   ++N                  +   ++    IDREEI  + L + A D       +   + T+ + I D+NDN+P++ + N++  +++      +  + A D D      G ++Y+I
Sbjct: 1316 VTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQSPRAHFKINS-----------------ETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLTYVMEDEPFNFQVTSITALDPDTGQ--GGNVEYRI 1476          
BLAST of Protocadherin-1 vs. Ensembl Medaka
Match: pcdh7a (protocadherin-7-like [Source:NCBI gene;Acc:101167176])

HSP 1 Score: 97.8265 bits (242), Expect = 7.563e-45
Identity = 112/390 (28.72%), Postives = 166/390 (42.56%), Query Frame = 3
Query:  270 NNYFILQSHSGILKQR-NNIDRETMCKHADVCQKII---------LISING------QVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRY-FIKD-----------IHSRDIRRMNQF------------QASRYFTIFIKTI-NRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQG-PLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYK--------STASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYFTM 1277
            + YF + + +G L      IDRE + +    CQ I           +S+ G       +LE  V I D NDN P FS     LS++EN  IG+   LPTA D D   N I RY  ++D                I R++                S  F + +  I +  K P L +   +DRE+ D +ELIL   D G   +     + VSI DVNDN PQ+        + E    G P+++++A DRD     NGQ++Y     +   E + RL  +  ++ +LS       +  T + F +TA D G   R + T V + + D ND+ P + I K          A + EN      +  V V+D D+G N    C +     FT+
Sbjct:   75 SEYFKIDNVTGELTTGPRRIDREKLPQ----CQMIFDENECFLDFEVSVIGPLQSWVDLLEGRVVITDINDNTPSFSSPVLQLSVEENRPIGTLYLLPTATDRDFGRNGIDRYELVQDNGAGSSAAKRTAGGNPITRVDGLDRRGRSGDNGGGARSSVFELQVADIPDGEKQPQLIVKGILDREQKDSYELILRVRDGGNPPRSSQALLRVSITDVNDNGPQFERSTYEAEITENAPPGTPVLQVRASDRDIGV--NGQVEYVFGAAT---ESVRRLLRLDEATGWLSVLHRIDREDVTQLRFTVTARDRGQPPRTDRTTVVLSVRDENDNVPVVDIRKIGRILVRDGAALVPENVLVDTPVALVQVSDRDQGENGAVTCTVVGDVPFTL 455          

HSP 2 Score: 80.4925 bits (197), Expect = 7.563e-45
Identity = 79/264 (29.92%), Postives = 132/264 (50.00%), Query Frame = 3
Query: 1650 RSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVV------DREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQL----QNDGRLILTKNLRER-EGIRLPDRLIIRASDNGTP 2408
            R+   +DRE +D+Y L ++AKD G P L  + TV +++ D ND  P F Q+ F    + N LA  ++ +G VT  D D GEN  +   I  + D ++ +   G +  K  L  I N  G +      DRE++ +    + A D G+P+ +A A V + V D NDN P+   P N+ ++  +   S    ++    A D D G+N  + Y+++         P++L      +G + L + L  R +G+    RL++R +D+G P
Sbjct:  586 RATEVLDREQRDRYELRVIAKDKGIPPLQGSATVVVQVTDRNDNAPKFVQEIFTFYVKENLLA--NSPVGMVTVTDADEGENAELSLFI--EMDGADTKKVEGGDGEKEELFSIENNTGTIFSSASFDREKLSTYTFRVRAVDGGEPRKTATATVSLFVTDENDNAPEITSPANE-SYTLLPPASSARTIVRTVTATDLDSGQNADLRYALVGGN------PFRLFEIGNTNGVITLAEPLERRHKGLH---RLVVRVNDSGIP 835          

HSP 3 Score: 44.669 bits (104), Expect = 7.563e-45
Identity = 36/110 (32.73%), Postives = 50/110 (45.45%), Query Frame = 1
Query: 1303 NGRQLFMYNIKKIPDTFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
            N ++ F++          D E+   YSV I  +D G P L       V ++D ND+AP F    +     ENN+ G  +  V A D DS +N  V Y IL+   N  F I
Sbjct:  475 NKKKYFLHT-----SALLDYEATKEYSVTIVAVDSGSPSLSSNSSLMVRVVDINDHAPAFAQSIVEVHFAENNSPGERVVTVVATDADSGKNAEVVY-ILDPASNGPFYI 578          

HSP 4 Score: 52.7582 bits (125), Expect = 1.802e-12
Identity = 84/306 (27.45%), Postives = 126/306 (41.18%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYF-YQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQK------YDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFI-NISTDSQVGKVLANFEAEDPDKGENGTITYSI---------ISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYI------PNNLTPRNNA---LPPGINKKS 2504
            +D E   +YS+TI+A D+G PSL+   ++ +R++D+ND  P F Q        E N   +    +  V A D D G+N  V Y +          D  N                      V+DREQ    +  +IA D G P L   A V+V V D NDN PKF   I       N+  +S VG V       D D+GEN  ++  I         +     E+   + ++N+   I +    +RE +       +RA D G P K    TV++         P   +P N +   LPP  + ++
Sbjct:  487 LDYEATKEYSVTIVAVDSGSPSLSSNSSLMVRVVDINDHAPAFAQSIVEVHFAENN---SPGERVVTVVATDADSGKNAEVVYILDPASNGPFYIDADNGDIRATE---------------VLDREQRDRYELRVIAKDKGIPPLQGSATVVVQVTDRNDNAPKFVQEIFTFYVKENLLANSPVGMVTVT----DADEGENAELSLFIEMDGADTKKVEGGDGEKEELFSIENNTGTIFSSASFDREKLST-YTFRVRAVDGGEPRKTATATVSLFVTDENDNAPEITSPANESYTLLPPASSART 769          

HSP 5 Score: 40.817 bits (94), Expect = 1.802e-12
Identity = 26/93 (27.96%), Postives = 42/93 (45.16%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAP-----KFGSDDIR---FTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNN 1608
             DRE ++     +   D G+PP        +++ DENDN P     K G   +R     + EN  +  P+  V+  D D  ENG V+  ++ +
Sbjct:  358 IDREDVTQLRFTVTARDRGQPPRTDRTTVVLSVRDENDNVPVVDIRKIGRILVRDGAALVPENVLVDTPVALVQVSDRDQGENGAVTCTVVGD 450          

HSP 6 Score: 44.669 bits (104), Expect = 1.426e-11
Identity = 29/95 (30.53%), Postives = 46/95 (48.42%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGS--DDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
            FDRE LS Y+  +R +D G P        ++ + DENDNAP+  S  ++    L   ++    +  V A D DS +N  + Y ++  +    F I
Sbjct:  708 FDREKLSTYTFRVRAVDGGEPRKTATATVSLFVTDENDNAPEITSPANESYTLLPPASSARTIVRTVTATDLDSGQNADLRYALVGGNPFRLFEI 802          

HSP 7 Score: 39.2762 bits (90), Expect = 1.426e-11
Identity = 80/386 (20.73%), Postives = 150/386 (38.86%), Query Frame = 3
Query:  147 KISENKGSGEDLINLKNYIIIHKLPINSSGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISIN--GQV-----LEVMVYINDENDNIP--------QFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCT--ITVSIIDVNDNSPQWPTVNISKTVKECDRQGP-LVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFN 1244
            +I+EN   G  ++ ++       + +N    Y   +    +     L   +G L   + IDRE      DV Q    ++    GQ        V++ + DENDN+P        +  +R     + EN  + + ++L    D D   N  +   +       ++   +              N+ K  +L     +D E    + + ++A DSG    S    + V ++D+ND++P +    +     E +  G  +V + A D D  S  N ++ Y +   S      N  FYI   +  + +  +   + +      + A D G    + S  V +++ D ND+AP       T  ++EN      +  V V D D+G N++ +
Sbjct:  301 EITENAPPGTPVLQVRASD--RDIGVNGQVEYVFGAATESVRRLLRLDEATGWLSVLHRIDRE------DVTQLRFTVTARDRGQPPRTDRTTVVLSVRDENDNVPVVDIRKIGRILVRDGAALVPENVLVDTPVALVQVSDRDQGENGAVTCTVVGDVPFTLKPAGETVLPPLPADEALDKNKKKY-FLHTSALLDYEATKEYSVTIVAVDSGSPSLSSNSSLMVRVVDINDHAPAFAQSIVEVHFAENNSPGERVVTVVATDAD--SGKNAEVVYILDPAS------NGPFYIDADNGDIRATEVLDREQRDRYELRVIAKDKGIPPLQGSATVVVQVTDRNDNAPKFVQEIFTFYVKENLLANSPVGMVTVTDADEGENAELS 669          

HSP 8 Score: 25.7942 bits (55), Expect = 1.426e-11
Identity = 12/33 (36.36%), Postives = 18/33 (54.55%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRI 1763
            ++R  K  + L +   D+G PSL  T  VH+ I
Sbjct:  815 LERRHKGLHRLVVRVNDSGIPSLCATTLVHVFI 847          

HSP 9 Score: 62.003 bits (149), Expect = 4.364e-9
Identity = 65/234 (27.78%), Postives = 106/234 (45.30%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQ-YFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFI-----------NISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLIL 2330
            +DRE KD Y L +  +D G P  +    + + I DVND  P F++  Y  +ITE     T   +L +V A D+D+G NG V Y      +   R   +      +++         +DRE +  ++  + A D G+P  +    V++ V D NDN P     I K+  I           N+  D+ V  V    +  D D+GENG +T +++       ++P+ L+  G  +L
Sbjct:  251 LDREQKDSYELILRVRDGGNPPRSSQALLRVSITDVNDNGPQFERSTYEAEITENAPPGT--PVL-QVRASDRDIGVNGQVEYVFGAATESVRRLLRLDEATGWLSVLHR------IDREDVTQLRFTVTARDRGQPPRTDRTTVVLSVRDENDNVPVVD--IRKIGRILVRDGAALVPENVLVDTPVALV----QVSDRDQGENGAVTCTVVG------DVPFTLKPAGETVL 463          

HSP 10 Score: 61.2326 bits (147), Expect = 6.495e-9
Identity = 36/103 (34.95%), Postives = 47/103 (45.63%), Query Frame = 1
Query: 1315 LFMYNIKKIPDT----------FFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSY 1593
            +F   +  IPD             DRE    Y +++R  D G PP   + L  V+I D NDN P+F        +TEN   G P+  VRA D D   NG+V Y
Sbjct:  228 VFELQVADIPDGEKQPQLIVKGILDREQKDSYELILRVRDGGNPPRSSQALLRVSITDVNDNGPQFERSTYEAEITENAPPGTPVLQVRASDRDIGVNGQVEY 330          

HSP 11 Score: 55.0694 bits (131), Expect = 5.513e-7
Identity = 30/80 (37.50%), Postives = 38/80 (47.50%), Query Frame = 1
Query: 1351 FFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVS 1590
              DRE    Y + +   D G PPL G     V + D NDNAPKF  +   F + EN    +P+G V   D D  EN  +S
Sbjct:  590 VLDREQRDRYELRVIAKDKGIPPLQGSATVVVQVTDRNDNAPKFVQEIFTFYVKENLLANSPVGMVTVTDADEGENAELS 669          
BLAST of Protocadherin-1 vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 100.908 bits (250), Expect = 3.555e-44
Identity = 105/374 (28.07%), Postives = 165/374 (44.12%), Query Frame = 3
Query:  210 HKLPINSSGTYNIISNEPDINNYFILQSHSG-ILKQRNNIDRETM--CK----------HADVCQKIILISINGQVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQ--GSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKIS---DNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENS--TAVTIEIEDCNDHAPNIAIY--------KSTASIRENDRTPLVLTSVMVNDDDKGINSQFNC 1247
            H LP +S   Y +    P    Y  +   +G I      IDRET+  C+            +V    +L + + +++E  + + D NDN PQF +   T+S+ EN+ +G+  S+P A D DSE N +  Y +               A+  F + +      K+P L ++  +DRE  D ++L + A D G  Q      + V + D NDNSP++   +    V E    G  V LQ    D    PNG+I+Y +    D  PK   I+R   I      L  + +  +      +F++ A D G +  S  T VTIE+ D ND+AP + I         +  A+I E+      +  V V+D D+G N+   C
Sbjct:   45 HGLP-DSGHLYKLEVGAP----YLRVDGKTGDIFTTEIPIDRETLRDCRSLVKGKPCYLEFEVSVTDLLQNPSPRLIEGRIEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSERNGVADYAL----------TAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSV-LQVKADDSDMGPNGEIEYSLHQAVDPVPKLLRIDRTTGIIYVKGPLDREEINSL------SFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTC 396          

HSP 2 Score: 76.2554 bits (186), Expect = 3.555e-44
Identity = 85/271 (31.37%), Postives = 124/271 (45.76%), Query Frame = 3
Query: 1644 ENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFK-QQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQL----QNDGRLILTKNL-REREGIRLPDRLIIRASDNGTPPKAELVTVNI 2438
            E +++  +DRE K++Y   + A D G P    T TV I++LD ND  P F    Y + + E   +  +  + G VT  D D GEN  V+ ++         QN  G  L  I+           DRE+  S    + A D G+P  S+   V ++VLD NDN P    P N  +F  +S  +     +   EAED D G N  + +SI          PYQL     + G + L K + R+  G+    RL++R SD G PP+     V+I
Sbjct:  527 EVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLE--NMPPLSPV-GMVTVLDMDKGENAHVHLSVEPDGGKFVVQNGTGTILSSIS----------FDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVVTKPSNS-SFRQLSPVASPDSHVDVVEAEDLDSGPNADLVFSIAGGN------PYQLFRISPSSGEITLAKEMTRKHGGLH---RLVVRVSDRGKPPRHATALVHI 774          

HSP 3 Score: 43.8986 bits (102), Expect = 3.555e-44
Identity = 32/102 (31.37%), Postives = 41/102 (40.20%), Query Frame = 1
Query: 1303 NGRQLFMYNIKKIPDTFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNN 1608
            N R+ F+        T  D E +  Y V I  +D G P L       V + D NDN+P F          E N  G  I  V A D DS  N  + Y I+ +
Sbjct:  416 NKRKYFLQTT-----TPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGD 512          

HSP 4 Score: 60.077 bits (144), Expect = 1.093e-18
Identity = 72/278 (25.90%), Postives = 120/278 (43.17%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTA------DDKDLGEN--------GTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNL---PYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYI 2447
            +DRE  +  S  ++A+D G    +    V I + D ND  P  + +    +T   G+A I   +   TA       DKD GEN        G V + +R   D ++                       +D E++   + EI+A D+G P LS+  ++ V V DVNDN P F   I +++F   + ++Q G+ + +  A D D G N  + Y+I+   +++      P   +   R  L +  +ER   R      + A+D G+P      TV I+ +
Sbjct:  309 LDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTSDNKRKYFLQTTTP----------LDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDF---AEENQPGETILDVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFR------VTAADKGSPVHKGTATVVIKVL 567          

HSP 5 Score: 54.6842 bits (130), Expect = 1.093e-18
Identity = 27/82 (32.93%), Postives = 41/82 (50.00%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
             DRE    Y + I+ +D G P    + L  V + D NDN+PKF        ++EN+ +G  +  V+A D D   NG + Y +
Sbjct:  202 LDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSL 283          

HSP 6 Score: 49.2914 bits (116), Expect = 1.195e-17
Identity = 81/278 (29.14%), Postives = 121/278 (43.53%), Query Frame = 3
Query: 1635 YFRENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYF-YQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFI-NISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNL--REREGIRLPDRLIIRASDNGTPPKAELVTVNIRYIPNN 2456
            YF +  + ++ +R +K +Y + I+A D+G P+L+ T ++ +++ DVND  PVF    F     E N       IL  VTA D D G N  ++Y I          + I          G +     +DRE     +  + A D G P     A V++ VLD NDN PKF       + + N+   S VG V       D DKGEN  +  S+           + +QN    IL+     RE+E         ++A D G PP++  V V I  +  N
Sbjct:  420 YFLQTTTPLDYER-VK-EYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPG--ETIL-DVTATDADSGTNAELFYNIVG-------DSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVT----VLDMDKGENAHVHLSVEPDGGK-----FVVQNGTGTILSSISFDREKESSYT---FRLKAVDGGEPPRSSYVGVTINVLDEN 673          

HSP 7 Score: 44.2838 bits (103), Expect = 1.195e-17
Identity = 49/191 (25.65%), Postives = 77/191 (40.31%), Query Frame = 3
Query:  771 VSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQ-AFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMD--LKTYITFFITAVDGGG--RENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYFTMVKECLQSIKWTAALYVQ 1328
            + + D+NDN+PQ+P   ++ +V E    G L  +  A DRD  S  NG   Y ++       L                  L  +D  LK      I AVDGG   R +   + + + D ND++P        A + EN      +  V  +D D G N +    L+       V + L+  + T  +YV+
Sbjct:  120 IEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRD--SERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQA--VDPVPKLLRIDRTTGIIYVK 306          

HSP 8 Score: 36.965 bits (84), Expect = 1.195e-17
Identity = 23/87 (26.44%), Postives = 37/87 (42.53%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFT--------LTENNNIGAPIGYVRAYDPDSNENGRVS 1590
             DRE ++  S  +   D G  P   +   T+ + D+NDNAP      I           ++E+  +G  +  V+  D D  EN  V+
Sbjct:  309 LDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVT 395          

HSP 9 Score: 65.0846 bits (157), Expect = 8.003e-17
Identity = 71/298 (23.83%), Postives = 132/298 (44.30%), Query Frame = 3
Query:  405 VMVYINDENDNIPQFSMRHKTL--------SIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCT--ITVSIIDVNDNSPQW-PTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGG--RENSTAVTIEIEDCNDHAPNIAIYKSTASIREN--DRTPLVLTSVMVNDDDKGINSQFNCDL 1253
            V + + D+NDN P   +R   L        +I E+  +G+ ++L    D D   N+++   +       +R  +   +      F++T              +D E +  + + ++A DSG    S T  + V + DVNDNSP + PT+      +E      ++++ A D D  +  N ++ Y I  +S     I  LF I  ++  + ++     + K    F +TA D G    + +  V I++ DCND+ P   +   + S+ EN    +P+ + +V+  D DKG N+  +  +
Sbjct:  337 VTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTSDNKRKYFLQTTT-----------PLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGT--NAELFYNIVGDS----YIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVL--DMDKGENAHVHLSV 615          

HSP 10 Score: 39.2762 bits (90), Expect = 8.003e-17
Identity = 27/97 (27.84%), Postives = 45/97 (46.39%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAP---IGYVRAYDPDSNENGRVSYQILNNDENYYFTIT 1635
            FDRE  S Y+  ++ +D G PP       T+ ++DENDN P   +     +  + + + +P   +  V A D DS  N  + + I   +    F I+
Sbjct:  637 FDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVV-TKPSNSSFRQLSPVASPDSHVDVVEAEDLDSGPNADLVFSIAGGNPYQLFRIS 732          

HSP 11 Score: 23.483 bits (49), Expect = 8.003e-17
Identity = 10/34 (29.41%), Postives = 17/34 (50.00%), Query Frame = 3
Query: 1662 EIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRI 1763
            E+ R+    + L +   D G+P  + T  VHI +
Sbjct:  743 EMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYV 776          

HSP 12 Score: 75.8702 bits (185), Expect = 6.654e-16
Identity = 69/223 (30.94%), Postives = 111/223 (49.78%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQ-QYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFI-------NISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQ 2309
            +DRE+KD Y LTI A D G P       + + + D ND  P F+   Y  +++E + +   H++L +V ADD D+G NG + Y++ Q  D   +       L      GI+ + G +DRE++ S+   ++A D G    S+   V ++V D NDN P  +  I  +  +       NIS D  VG  +A  +  D D+GEN  +T  +        ++P+QL+
Sbjct:  202 LDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVG--HSVL-QVKADDSDMGPNGEIEYSLHQAVDPVPK------LLRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVE--IRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAG------DVPFQLR 407          

HSP 13 Score: 29.261 bits (64), Expect = 6.654e-16
Identity = 17/52 (32.69%), Postives = 25/52 (48.08%), Query Frame = 1
Query: 1444 VTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
            + + D NDN P+F    +  ++ EN  +GA      A D DS  NG   Y +
Sbjct:  120 IEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSERNGVADYAL 171          

HSP 14 Score: 56.225 bits (134), Expect = 2.040e-15
Identity = 83/363 (22.87%), Postives = 139/363 (38.29%), Query Frame = 3
Query:  249 ISNEPDINNYFILQ---SHSGILKQR---NNIDRETMCKHADVCQKIILISING-------QVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCT--ITVSIIDVNDNSPQWPTVNIS--------KTVKECDRQGPLVEL-QAFDRDDSSTP------NGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQF 1241
            ++  PD    F LQ      G L Q     N+DRE    +      + + +++G       Q L + V + D NDN P+F        + ENS +G  +    ADD D  PN  I Y +              QA       ++      I Y+K    +DREEI+     ++A D G Q  S    +T+ + D NDN+P      I           + E    G  V L Q  D+D+           G + +++   S       R +++  ++     +      +K Y    I AVD G     ++ ++ +++ D ND++P  +         E ++    +  V   D D G N++ 
Sbjct:  171 LTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSY-----DLTIKAVDGGNPQRYSQAL-LRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSL-------------HQAVDPVPKLLRIDRTTGIIYVK--GPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTSDNKRKYFLQTTTPLDYER------VKEY-RVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAEL 505          

HSP 15 Score: 46.9802 bits (110), Expect = 2.040e-15
Identity = 27/84 (32.14%), Postives = 36/84 (42.86%), Query Frame = 1
Query: 1348 TFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
            T  DRE    Y   +   D G P   G     + ++D NDN PKF      F++ EN    +P+G V   D D  EN  V   +
Sbjct:  532 TPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLSV 615          
BLAST of Protocadherin-1 vs. Ensembl Medaka
Match: ENSORLT00000037422.1 (pep primary_assembly:ASM223467v1:10:14795752:14799434:-1 gene:ENSORLG00000025685.1 transcript:ENSORLT00000037422.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 108.612 bits (270), Expect = 5.030e-44
Identity = 100/342 (29.24%), Postives = 155/342 (45.32%), Query Frame = 3
Query:  276 YFILQSHSGILKQRNNIDRETMCKHADVCQKIILISING--QVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTI-NRMKIPYLKLIKEIDREEIDRFELILIAEDSGK--QQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLV-ELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYFTM 1277
            YF + +  G L   + IDRE +C  +  C   + I I    Q+  + V I D NDN P F      + I E+   G    L  A+D D   N +  Y +    S+D            FT+ +K I N  KIP L L K +DRE+     L L A D G   + G+  IT++++D+NDN PQ+        VKE    G  V   +A D D+   PNG+I+Y +  ++    L   LFY+  +S  +  +     + ++     I+A D G    E    V +++ D ND+AP I +   + S+ E+  +  V+  + V D D G   +    L  T+ F +
Sbjct:   72 YFSVDAGRGELVVNDRIDREALCGQSASCLLPLQIVIENPLQLHRMEVEIKDVNDNAPTFLKSDHVIEIAESRVAGVRFPLEMAEDPDVGSNGLKTYTL----SKD----------ECFTLKVKEIENGRKIPELVLTKSLDREKKAVHSLFLTAVDGGNPVKSGTSKITINVLDINDNVPQFENAFYKVDVKENIANGSFVISTRAADVDEG--PNGEIEYSLGVHTHPSVL--ELFYVDAASGDIYLKRQLDHETQSSYRIDISAKDKGFPKMEGHCTVQVDVIDVNDNAPEIILTSKSTSVPEDSSSGTVVALLSVRDLDSGDYGKVTLQLLKTSSFAL 395          

HSP 2 Score: 63.929 bits (154), Expect = 5.030e-44
Identity = 39/97 (40.21%), Postives = 51/97 (52.58%), Query Frame = 1
Query: 1318 FMYNIKKIPDTFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNN 1608
            F  N   I +   DRES+S YS+ +   D G PPL+  K   V+I D NDN P F        L EN   G+ +  V A D DS EN ++SY IL++
Sbjct:  399 FSNNYALITNGPLDRESISDYSIEVTAKDSGTPPLLSTKTIPVSITDVNDNPPVFTQRSYNVYLKENGVPGSILFSVSASDLDSGENAKISYSILDS 495          

HSP 3 Score: 47.3654 bits (111), Expect = 5.030e-44
Identity = 33/106 (31.13%), Postives = 43/106 (40.57%), Query Frame = 3
Query: 1653 SQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPV-----------FKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHS 1937
            S    D E    + + + AKD G PSL+   TVH+ ILD ND  P               Q   +  +   L T      KVTA D D G N  + Y + +  D S
Sbjct:  517 SMHSFDYEKLKVFEIHVQAKDQGSPSLSSNATVHVFILDQNDNAPAVIYPSSAALGSLSHQRMPRSAKAGHLVT------KVTAVDADSGHNALISYRLAEATDAS 616          

HSP 4 Score: 82.0333 bits (201), Expect = 9.768e-23
Identity = 79/270 (29.26%), Postives = 124/270 (45.93%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYP----INKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRL----ILTKNLREREGIRLPD----RLIIRASDNGTPPKAELVTVNI 2438
            +DRE    YS+ + AKD+G P L  T T+ + I DVND  PVF Q+ +    + NG+    +IL  V+A D D GEN  + Y+I    D   +  ++   +   +  G +      D E++   +  + A D G P LS+ A V V +LD NDN P   YP    +  ++   +   ++ G ++    A D D G N  I+Y +                D  L    + T  +R +  +   D    RLI+   D+G P ++  VTV+I
Sbjct:  411 LDRESISDYSIEVTAKDSGTPPLLSTKTIPVSITDVNDNPPVFTQRSYNVYLKENGVPG--SILFSVSASDLDSGENAKISYSI---LDSKVQDVSVSSYVYMNSENGSIYSMHSFDYEKLKVFEIHVQAKDQGSPSLSSNATVHVFILDQNDNAPAVIYPSSAALGSLSHQRMPRSAKAGHLVTKVTAVDADSGHNALISYRLAE------------ATDASLFTVSLYTGEVRTKRAVSEQDDSSQRLILEIKDDGEPLQSATVTVSI 663          

HSP 5 Score: 46.2098 bits (108), Expect = 9.768e-23
Identity = 26/84 (30.95%), Postives = 42/84 (50.00%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILN 1605
             D E+ S Y + I   D G P + G     V +ID NDNAP+        ++ E+++ G  +  +   D DS + G+V+ Q+L 
Sbjct:  306 LDHETQSSYRIDISAKDKGFPKMEGHCTVQVDVIDVNDNAPEIILTSKSTSVPEDSSSGTVVALLSVRDLDSGDYGKVTLQLLK 389          

HSP 6 Score: 68.5514 bits (166), Expect = 1.879e-19
Identity = 83/327 (25.38%), Postives = 140/327 (42.81%), Query Frame = 3
Query:  321 NIDRETMCKHADVCQKIILISINGQ------VLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIK---YKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRE--NSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDT 1262
            ++DRE    H+     + L +++G         ++ + + D NDN+PQF      + ++EN   GS +    A D+D  PN  I Y +  +H+                +F        I YLK  +++D E    + + + A+D G  K +G CT+ V +IDVNDN+P+    + S +V E    G +V L +  RD  S   G++     K S  + K    N    I    L   S     ++        +TA D G     ++  + + I D ND+ P          ++EN     +L SV  +D D G N++ +  + D+
Sbjct:  197 SLDREKKAVHS-----LFLTAVDGGNPVKSGTSKITINVLDINDNVPQFENAFYKVDVKENIANGSFVISTRAADVDEGPNGEIEYSLG-VHTH----------PSVLELFYVDAASGDI-YLK--RQLDHETQSSYRIDISAKDKGFPKMEGHCTVQVDVIDVNDNAPEIILTSKSTSVPEDSSSGTVVALLSV-RDLDSGDYGKVTLQLLKTSSFALKPSFSNNYALITNGPLDRESISDYSIE--------VTAKDSGTPPLLSTKTIPVSITDVNDNPPVFTQRSYNVYLKENGVPGSILFSVSASDLDSGENAKISYSILDS 495          

HSP 7 Score: 48.521 bits (114), Expect = 1.879e-19
Identity = 32/116 (27.59%), Postives = 53/116 (45.69%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPK--FGSDDIRFTLTENN-----NIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITI-LGKIEAKWKLIEK 1677
            FD E L  + + ++  D G P L       V I+D+NDNAP   + S     +L+          G  +  V A D DS  N  +SY++    +   FT+++  G++  K  + E+
Sbjct:  521 FDYEKLKVFEIHVQAKDQGSPSLSSNATVHVFILDQNDNAPAVIYPSSAALGSLSHQRMPRSAKAGHLVTKVTAVDADSGHNALISYRLAEATDASLFTVSLYTGEVRTKRAVSEQ 636          

HSP 8 Score: 62.7734 bits (151), Expect = 4.830e-18
Identity = 69/265 (26.04%), Postives = 123/265 (46.42%), Query Frame = 3
Query: 1656 QMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVP-VFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLP---YQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNI 2438
            + ++D E +  Y + I AKD G P +   CTV + ++DVND  P +        + E +   T+ A+L   +  D D G+ G V   + +    + + +      L  N        G +DRE +     E+ A D+G P L +   + V + DVNDN P F     +   + +  +   G +L +  A D D GEN  I+YSI+  K  + ++    Y    +G  I + +  + E +++ + + ++A D G+P  +   TV++
Sbjct:  303 KRQLDHETQSSYRIDISAKDKGFPKMEGHCTVQVDVIDVNDNAPEIILTSKSTSVPEDSSSGTVVALL---SVRDLDSGDYGKVTLQLLKTSSFALKPSFSNNYALITN--------GPLDRESISDYSIEVTAKDSGTPPLLSTKTIPVSITDVNDNPPVF---TQRSYNVYLKENGVPGSILFSVSASDLDSGENAKISYSILDSKVQDVSVSSYVYMNSENGS-IYSMHSFDYEKLKVFE-IHVQAKDQGSPSLSSNATVHV 551          

HSP 9 Score: 49.6766 bits (117), Expect = 4.830e-18
Identity = 29/95 (30.53%), Postives = 47/95 (49.47%), Query Frame = 1
Query: 1327 NIKKIPDTFF----DRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
            N +KIP+       DRE  + +S+ +  +D G P   G    T+ ++D NDN P+F +   +  + EN   G+ +   RA D D   NG + Y +
Sbjct:  185 NGRKIPELVLTKSLDREKKAVHSLFLTAVDGGNPVKSGTSKITINVLDINDNVPQFENAFYKVDVKENIANGSFVISTRAADVDEGPNGEIEYSL 279          

HSP 10 Score: 62.003 bits (149), Expect = 3.714e-13
Identity = 83/281 (29.54%), Postives = 126/281 (44.84%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLI-IRASDNGTPPKAELVTVNIRYIPNNLTPRNNALPPGINKKS 2504
            +DRE K  +SL + A D G P  + T  + I +LD+ND VP F +  FY++     +A    ++    A D D G NG + Y++      S  +                     +D E   S + +I A D G P++     V VDV+DVNDN P+    I      ++  DS  G V+A     D D G+ G +T  ++  K     L     N+  LI    L +RE I   D  I + A D+GTPP      ++ + IP ++T  N+  PP   ++S
Sbjct:  198 LDREKKAVHSLFLTAVDGGNPVKSGTSKITINVLDINDNVPQF-ENAFYKVDVKENIANGSFVI-STRAADVDEGPNGEIEYSLGVHTHPSVLELFYVDAASGDIYLKRQ-----LDHETQSSYRIDISAKDKGFPKMEGHCTVQVDVIDVNDNAPEI---ILTSKSTSVPEDSSSGTVVALLSVRDLDSGDYGKVTLQLL--KTSSFALKPSFSNNYALITNGPL-DRESIS--DYSIEVTAKDSGTPP-----LLSTKTIPVSITDVNDN-PPVFTQRS 457          

HSP 11 Score: 33.8834 bits (76), Expect = 3.714e-13
Identity = 22/63 (34.92%), Postives = 28/63 (44.44%), Query Frame = 1
Query: 1444 VTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
            V I D NDNAP F   D    + E+   G       A DPD   NG  +Y  L+ DE +   +
Sbjct:  119 VEIKDVNDNAPTFLKSDHVIEIAESRVAGVRFPLEMAEDPDVGSNGLKTY-TLSKDECFTLKV 180          

HSP 12 Score: 52.373 bits (124), Expect = 3.642e-6
Identity = 55/187 (29.41%), Postives = 89/187 (47.59%), Query Frame = 3
Query:  405 VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGS--CTITVSIIDVNDNSPQ--WPTVNI-----SKTVKECDRQGPLV-ELQAFDRDDSSTPNGQIKYKISD 935
            + V I D NDN P F+ R   + ++EN   GS L   +A DLDS  N+ I Y I D   +D+        S Y  +++ + N      +  +   D E++  FE+ + A+D G    S   T+ V I+D NDN+P   +P+         + +    + G LV ++ A D D  S  N  I Y++++
Sbjct:  439 IPVSITDVNDNPPVFTQRSYNVYLKENGVPGSILFSVSASDLDSGENAKISYSILDSKVQDV------SVSSY--VYMNSENGS----IYSMHSFDYEKLKVFEIHVQAKDQGSPSLSSNATVHVFILDQNDNAPAVIYPSSAALGSLSHQRMPRSAKAGHLVTKVTAVDAD--SGHNALISYRLAE 611          
BLAST of Protocadherin-1 vs. Ensembl Medaka
Match: ENSORLT00000036341.1 (pep primary_assembly:ASM223467v1:10:14795752:14799378:-1 gene:ENSORLG00000025685.1 transcript:ENSORLT00000036341.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 108.612 bits (270), Expect = 5.782e-44
Identity = 100/342 (29.24%), Postives = 155/342 (45.32%), Query Frame = 3
Query:  276 YFILQSHSGILKQRNNIDRETMCKHADVCQKIILISING--QVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTI-NRMKIPYLKLIKEIDREEIDRFELILIAEDSGK--QQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLV-ELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYFTM 1277
            YF + +  G L   + IDRE +C  +  C   + I I    Q+  + V I D NDN P F      + I E+   G    L  A+D D   N +  Y +    S+D            FT+ +K I N  KIP L L K +DRE+     L L A D G   + G+  IT++++D+NDN PQ+        VKE    G  V   +A D D+   PNG+I+Y +  ++    L   LFY+  +S  +  +     + ++     I+A D G    E    V +++ D ND+AP I +   + S+ E+  +  V+  + V D D G   +    L  T+ F +
Sbjct:   74 YFSVDAGRGELVVNDRIDREALCGQSASCLLPLQIVIENPLQLHRMEVEIKDVNDNAPTFLKSDHVIEIAESRVAGVRFPLEMAEDPDVGSNGLKTYTL----SKD----------ECFTLKVKEIENGRKIPELVLTKSLDREKKAVHSLFLTAVDGGNPVKSGTSKITINVLDINDNVPQFENAFYKVDVKENIANGSFVISTRAADVDEG--PNGEIEYSLGVHTHPSVL--ELFYVDAASGDIYLKRQLDHETQSSYRIDISAKDKGFPKMEGHCTVQVDVIDVNDNAPEIILTSKSTSVPEDSSSGTVVALLSVRDLDSGDYGKVTLQLLKTSSFAL 397          

HSP 2 Score: 63.929 bits (154), Expect = 5.782e-44
Identity = 39/97 (40.21%), Postives = 51/97 (52.58%), Query Frame = 1
Query: 1318 FMYNIKKIPDTFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNN 1608
            F  N   I +   DRES+S YS+ +   D G PPL+  K   V+I D NDN P F        L EN   G+ +  V A D DS EN ++SY IL++
Sbjct:  401 FSNNYALITNGPLDRESISDYSIEVTAKDSGTPPLLSTKTIPVSITDVNDNPPVFTQRSYNVYLKENGVPGSILFSVSASDLDSGENAKISYSILDS 497          

HSP 3 Score: 47.3654 bits (111), Expect = 5.782e-44
Identity = 33/106 (31.13%), Postives = 43/106 (40.57%), Query Frame = 3
Query: 1653 SQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPV-----------FKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHS 1937
            S    D E    + + + AKD G PSL+   TVH+ ILD ND  P               Q   +  +   L T      KVTA D D G N  + Y + +  D S
Sbjct:  519 SMHSFDYEKLKVFEIHVQAKDQGSPSLSSNATVHVFILDQNDNAPAVIYPSSAALGSLSHQRMPRSAKAGHLVT------KVTAVDADSGHNALISYRLAEATDAS 618          

HSP 4 Score: 82.0333 bits (201), Expect = 1.043e-22
Identity = 79/270 (29.26%), Postives = 124/270 (45.93%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYP----INKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRL----ILTKNLREREGIRLPD----RLIIRASDNGTPPKAELVTVNI 2438
            +DRE    YS+ + AKD+G P L  T T+ + I DVND  PVF Q+ +    + NG+    +IL  V+A D D GEN  + Y+I    D   +  ++   +   +  G +      D E++   +  + A D G P LS+ A V V +LD NDN P   YP    +  ++   +   ++ G ++    A D D G N  I+Y +                D  L    + T  +R +  +   D    RLI+   D+G P ++  VTV+I
Sbjct:  413 LDRESISDYSIEVTAKDSGTPPLLSTKTIPVSITDVNDNPPVFTQRSYNVYLKENGVPG--SILFSVSASDLDSGENAKISYSI---LDSKVQDVSVSSYVYMNSENGSIYSMHSFDYEKLKVFEIHVQAKDQGSPSLSSNATVHVFILDQNDNAPAVIYPSSAALGSLSHQRMPRSAKAGHLVTKVTAVDADSGHNALISYRLAE------------ATDASLFTVSLYTGEVRTKRAVSEQDDSSQRLILEIKDDGEPLQSATVTVSI 665          

HSP 5 Score: 46.2098 bits (108), Expect = 1.043e-22
Identity = 26/84 (30.95%), Postives = 42/84 (50.00%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILN 1605
             D E+ S Y + I   D G P + G     V +ID NDNAP+        ++ E+++ G  +  +   D DS + G+V+ Q+L 
Sbjct:  308 LDHETQSSYRIDISAKDKGFPKMEGHCTVQVDVIDVNDNAPEIILTSKSTSVPEDSSSGTVVALLSVRDLDSGDYGKVTLQLLK 391          

HSP 6 Score: 68.5514 bits (166), Expect = 2.525e-19
Identity = 83/327 (25.38%), Postives = 140/327 (42.81%), Query Frame = 3
Query:  321 NIDRETMCKHADVCQKIILISINGQ------VLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIK---YKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRE--NSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDT 1262
            ++DRE    H+     + L +++G         ++ + + D NDN+PQF      + ++EN   GS +    A D+D  PN  I Y +  +H+                +F        I YLK  +++D E    + + + A+D G  K +G CT+ V +IDVNDN+P+    + S +V E    G +V L +  RD  S   G++     K S  + K    N    I    L   S     ++        +TA D G     ++  + + I D ND+ P          ++EN     +L SV  +D D G N++ +  + D+
Sbjct:  199 SLDREKKAVHS-----LFLTAVDGGNPVKSGTSKITINVLDINDNVPQFENAFYKVDVKENIANGSFVISTRAADVDEGPNGEIEYSLG-VHTH----------PSVLELFYVDAASGDI-YLK--RQLDHETQSSYRIDISAKDKGFPKMEGHCTVQVDVIDVNDNAPEIILTSKSTSVPEDSSSGTVVALLSV-RDLDSGDYGKVTLQLLKTSSFALKPSFSNNYALITNGPLDRESISDYSIE--------VTAKDSGTPPLLSTKTIPVSITDVNDNPPVFTQRSYNVYLKENGVPGSILFSVSASDLDSGENAKISYSILDS 497          

HSP 7 Score: 48.1358 bits (113), Expect = 2.525e-19
Identity = 32/116 (27.59%), Postives = 53/116 (45.69%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPK--FGSDDIRFTLTENN-----NIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITI-LGKIEAKWKLIEK 1677
            FD E L  + + ++  D G P L       V I+D+NDNAP   + S     +L+          G  +  V A D DS  N  +SY++    +   FT+++  G++  K  + E+
Sbjct:  523 FDYEKLKVFEIHVQAKDQGSPSLSSNATVHVFILDQNDNAPAVIYPSSAALGSLSHQRMPRSAKAGHLVTKVTAVDADSGHNALISYRLAEATDASLFTVSLYTGEVRTKRAVSEQ 638          

HSP 8 Score: 62.7734 bits (151), Expect = 5.372e-18
Identity = 69/265 (26.04%), Postives = 123/265 (46.42%), Query Frame = 3
Query: 1656 QMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVP-VFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLP---YQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNI 2438
            + ++D E +  Y + I AKD G P +   CTV + ++DVND  P +        + E +   T+ A+L   +  D D G+ G V   + +    + + +      L  N        G +DRE +     E+ A D+G P L +   + V + DVNDN P F     +   + +  +   G +L +  A D D GEN  I+YSI+  K  + ++    Y    +G  I + +  + E +++ + + ++A D G+P  +   TV++
Sbjct:  305 KRQLDHETQSSYRIDISAKDKGFPKMEGHCTVQVDVIDVNDNAPEIILTSKSTSVPEDSSSGTVVALL---SVRDLDSGDYGKVTLQLLKTSSFALKPSFSNNYALITN--------GPLDRESISDYSIEVTAKDSGTPPLLSTKTIPVSITDVNDNPPVF---TQRSYNVYLKENGVPGSILFSVSASDLDSGENAKISYSILDSKVQDVSVSSYVYMNSENGS-IYSMHSFDYEKLKVFE-IHVQAKDQGSPSLSSNATVHV 553          

HSP 9 Score: 49.6766 bits (117), Expect = 5.372e-18
Identity = 29/95 (30.53%), Postives = 47/95 (49.47%), Query Frame = 1
Query: 1327 NIKKIPDTFF----DRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
            N +KIP+       DRE  + +S+ +  +D G P   G    T+ ++D NDN P+F +   +  + EN   G+ +   RA D D   NG + Y +
Sbjct:  187 NGRKIPELVLTKSLDREKKAVHSLFLTAVDGGNPVKSGTSKITINVLDINDNVPQFENAFYKVDVKENIANGSFVISTRAADVDEGPNGEIEYSL 281          

HSP 10 Score: 62.003 bits (149), Expect = 3.964e-13
Identity = 83/281 (29.54%), Postives = 126/281 (44.84%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLI-IRASDNGTPPKAELVTVNIRYIPNNLTPRNNALPPGINKKS 2504
            +DRE K  +SL + A D G P  + T  + I +LD+ND VP F +  FY++     +A    ++    A D D G NG + Y++      S  +                     +D E   S + +I A D G P++     V VDV+DVNDN P+    I      ++  DS  G V+A     D D G+ G +T  ++  K     L     N+  LI    L +RE I   D  I + A D+GTPP      ++ + IP ++T  N+  PP   ++S
Sbjct:  200 LDREKKAVHSLFLTAVDGGNPVKSGTSKITINVLDINDNVPQF-ENAFYKVDVKENIANGSFVI-STRAADVDEGPNGEIEYSLGVHTHPSVLELFYVDAASGDIYLKRQ-----LDHETQSSYRIDISAKDKGFPKMEGHCTVQVDVIDVNDNAPEI---ILTSKSTSVPEDSSSGTVVALLSVRDLDSGDYGKVTLQLL--KTSSFALKPSFSNNYALITNGPL-DRESIS--DYSIEVTAKDSGTPP-----LLSTKTIPVSITDVNDN-PPVFTQRS 459          

HSP 11 Score: 33.8834 bits (76), Expect = 3.964e-13
Identity = 22/63 (34.92%), Postives = 28/63 (44.44%), Query Frame = 1
Query: 1444 VTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
            V I D NDNAP F   D    + E+   G       A DPD   NG  +Y  L+ DE +   +
Sbjct:  121 VEIKDVNDNAPTFLKSDHVIEIAESRVAGVRFPLEMAEDPDVGSNGLKTY-TLSKDECFTLKV 182          

HSP 12 Score: 51.9878 bits (123), Expect = 3.968e-6
Identity = 55/187 (29.41%), Postives = 89/187 (47.59%), Query Frame = 3
Query:  405 VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGS--CTITVSIIDVNDNSPQ--WPTVNI-----SKTVKECDRQGPLV-ELQAFDRDDSSTPNGQIKYKISD 935
            + V I D NDN P F+ R   + ++EN   GS L   +A DLDS  N+ I Y I D   +D+        S Y  +++ + N      +  +   D E++  FE+ + A+D G    S   T+ V I+D NDN+P   +P+         + +    + G LV ++ A D D  S  N  I Y++++
Sbjct:  441 IPVSITDVNDNPPVFTQRSYNVYLKENGVPGSILFSVSASDLDSGENAKISYSILDSKVQDV------SVSSY--VYMNSENGS----IYSMHSFDYEKLKVFEIHVQAKDQGSPSLSSNATVHVFILDQNDNAPAVIYPSSAALGSLSHQRMPRSAKAGHLVTKVTAVDAD--SGHNALISYRLAE 613          
BLAST of Protocadherin-1 vs. Ensembl Medaka
Match: ENSORLT00000041785.1 (protocadherin gamma-C5 [Source:NCBI gene;Acc:101169865])

HSP 1 Score: 100.908 bits (250), Expect = 6.850e-44
Identity = 98/342 (28.65%), Postives = 156/342 (45.61%), Query Frame = 3
Query:  276 YFILQSHSGILKQRNNIDRETMCKHADVCQKIILISING--QVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTI-NRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLV-ELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGR--ENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYFTM 1277
            YF + +  G L   + IDRE +C+ +  C   + + I+   Q+ +V V I D NDN P F    K L I E++  G+   L TA DLD   NS+  Y +    S+D           YF++ +K +    K P L L K +DRE++   +L + A D G   + G   I + ++D NDN P +       T+ E   +  +V +L A D DD    NG+++Y     +P   L   +F I   S  +   G    +  +     ++A D G    E   +V IE+ D ND+AP I +     S+ EN  +  V+  +   D D G N +    +  ++ F +
Sbjct:   92 YFSVDAGRGELLVNDRIDREALCRQSASCVLTLQVVIDKPLQLFKVEVEIIDINDNSPVFPSSEKNLQIAESTAAGTRFPLDTALDLDVGVNSVRSYTL----SKD----------DYFSLNVKDMAGGRKNPELVLSKTLDREKMPTHQLTITAVDGGNPNKSGISQINIYVLDNNDNFPVFEKNVYKVTLSENSEKSSIVLKLAAKDSDDGV--NGEVEYSFGPQTPDAVL--SVFGINKDSGEIRLIGNLDFETTSSYEIDVSATDKGTPKMEGHCSVHIEVLDVNDNAPYIFLTSQPNSVPENAPSGTVVALISARDLDSGDNGKVTLQVPKSSPFKL 415          

HSP 2 Score: 71.2478 bits (173), Expect = 6.850e-44
Identity = 42/97 (43.30%), Postives = 53/97 (54.64%), Query Frame = 1
Query: 1318 FMYNIKKIPDTFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNN 1608
            F  N   I     DRE+ S YSV I   DLG PPL  +K+ +VTI D NDN P F        L EN   G+ +  V A D DS+EN ++SY IL++
Sbjct:  419 FSDNYALITSRALDRETFSEYSVEITATDLGSPPLSNKKMISVTITDVNDNPPVFTQRSYNVYLKENGVPGSILFSVSASDLDSSENAKISYSILDS 515          

HSP 3 Score: 47.3654 bits (111), Expect = 6.850e-44
Identity = 33/104 (31.73%), Postives = 44/104 (42.31%), Query Frame = 3
Query: 1653 SQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNG---------LATIHAILGKVTADDKDLGENGTVYYAIRQKYDHS 1937
            S    D E    + + + AKD G PSL+   TVH+ ILD ND  P       Y  +   G          A    ++ KVTA D D G N  + Y + +  D S
Sbjct:  537 SMHSFDYEKLKVFEIHVQAKDQGSPSLSSNATVHVFILDQNDNAPAV----IYPSSAALGSLSHQRMPRSAKAGHLVTKVTAVDADSGHNAWISYRLAEATDAS 636          

HSP 4 Score: 73.1738 bits (178), Expect = 6.944e-20
Identity = 76/270 (28.15%), Postives = 122/270 (45.19%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYP----INKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRL----ILTKNLREREGIRLPD----RLIIRASDNGTPPKAELVTVNI 2438
            +DRE   +YS+ I A D G P L++   + + I DVND  PVF Q+ +    + NG+    +IL  V+A D D  EN  + Y+I    D   +  ++   +   +  G +      D E++   +  + A D G P LS+ A V V +LD NDN P   YP    +  ++   +   ++ G ++    A D D G N  I+Y +                D  L    + T  +R +  +   D    RLI+   D+G P ++  VTV+I
Sbjct:  431 LDRETFSEYSVEITATDLGSPPLSNKKMISVTITDVNDNPPVFTQRSYNVYLKENGVPG--SILFSVSASDLDSSENAKISYSI---LDSKVQDVSVSSYVYMNSENGSIYSMHSFDYEKLKVFEIHVQAKDQGSPSLSSNATVHVFILDQNDNAPAVIYPSSAALGSLSHQRMPRSAKAGHLVTKVTAVDADSGHNAWISYRLAE------------ATDASLFTVSLYTGEVRTKRAVSEQDDSSQRLILEIKDDGEPLQSATVTVSI 683          

HSP 5 Score: 45.4394 bits (106), Expect = 6.944e-20
Identity = 25/82 (30.49%), Postives = 40/82 (48.78%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
             D E+ S Y + +   D G P + G     + ++D NDNAP         ++ EN   G  +  + A D DS +NG+V+ Q+
Sbjct:  326 LDFETTSSYEIDVSATDKGTPKMEGHCSVHIEVLDVNDNAPYIFLTSQPNSVPENAPSGTVVALISARDLDSGDNGKVTLQV 407          

HSP 6 Score: 67.781 bits (164), Expect = 3.040e-19
Identity = 78/325 (24.00%), Postives = 140/325 (43.08%), Query Frame = 3
Query:  324 IDRETMCKHADVCQKIILISINGQ------VLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSG--KQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFF--ITAVDGGGR--ENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDT 1262
            +DRE M  H     ++ + +++G       + ++ +Y+ D NDN P F      +++ ENS+  S +    A D D   N  + Y                      ++F    +  +I   +LI  +D E    +E+ + A D G  K +G C++ + ++DVNDN+P     +   +V E    G +V L +  RD  S  NG++  ++  +SP K         A  S   +    + +D +T+  +   ITA D G     N   +++ I D ND+ P          ++EN     +L SV  +D D   N++ +  + D+
Sbjct:  218 LDREKMPTH-----QLTITAVDGGNPNKSGISQINIYVLDNNDNFPVFEKNVYKVTLSENSEKSSIVLKLAAKDSDDGVNGEVEY-----------SFGPQTPDAVLSVFGINKDSGEI---RLIGNLDFETTSSYEIDVSATDKGTPKMEGHCSVHIEVLDVNDNAPYIFLTSQPNSVPENAPSGTVVALISA-RDLDSGDNGKVTLQVPKSSPFK-------LKASFSDNYALITSRALDRETFSEYSVEITATDLGSPPLSNKKMISVTITDVNDNPPVFTQRSYNVYLKENGVPGSILFSVSASDLDSSENAKISYSILDS 515          

HSP 7 Score: 48.521 bits (114), Expect = 3.040e-19
Identity = 32/116 (27.59%), Postives = 53/116 (45.69%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPK--FGSDDIRFTLTENN-----NIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITI-LGKIEAKWKLIEK 1677
            FD E L  + + ++  D G P L       V I+D+NDNAP   + S     +L+          G  +  V A D DS  N  +SY++    +   FT+++  G++  K  + E+
Sbjct:  541 FDYEKLKVFEIHVQAKDQGSPSLSSNATVHVFILDQNDNAPAVIYPSSAALGSLSHQRMPRSAKAGHLVTKVTAVDADSGHNAWISYRLAEATDASLFTVSLYTGEVRTKRAVSEQ 656          

HSP 8 Score: 57.3806 bits (137), Expect = 4.229e-11
Identity = 71/252 (28.17%), Postives = 125/252 (49.60%), Query Frame = 3
Query: 1665 IDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQ---NDGRLILTKNLREREGIRLPDRLIIRASDNGTPP 2411
            +DRE    + LTI A D G P+ +    ++I +LD ND  PVF++   Y++T     +   +I+ K+ A D D G NG V Y+   +   +     +          G + + G +D E   S + ++ A D G P++    +V ++VLDVNDN P + +  ++ N  ++  ++  G V+A   A D D G+NG +T  +       ++ P++L+   +D   ++T    +RE       + I A+D G+PP
Sbjct:  218 LDREKMPTHQLTITAVDGGNPNKSGISQINIYVLDNNDNFPVFEKN-VYKVTLSEN-SEKSSIVLKLAAKDSDDGVNGEVEYSFGPQTPDA-----VLSVFGINKDSGEIRLIGNLDFETTSSYEIDVSATDKGTPKMEGHCSVHIEVLDVNDNAP-YIFLTSQPN--SVPENAPSGTVVALISARDLDSGDNGKVTLQV------PKSSPFKLKASFSDNYALITSRALDRETFS-EYSVEITATDLGSPP 452          

HSP 9 Score: 31.187 bits (69), Expect = 4.229e-11
Identity = 31/100 (31.00%), Postives = 45/100 (45.00%), Query Frame = 1
Query: 1354 FDRESL---SFYSVLIRCIDLGRPPLVGEKLFTVT--IIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITI 1638
             DRE+L   S   VL   + + +P     +LF V   IID NDN+P F S +    + E+   G       A D D   N   SY +  +D   YF++ +
Sbjct:  108 IDREALCRQSASCVLTLQVVIDKP----LQLFKVEVEIIDINDNSPVFPSSEKNLQIAESTAAGTRFPLDTALDLDVGVNSVRSYTLSKDD---YFSLNV 200          

HSP 10 Score: 53.5286 bits (127), Expect = 1.353e-6
Identity = 64/236 (27.12%), Postives = 108/236 (45.76%), Query Frame = 3
Query:  270 NNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQVLE----VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGS--CTITVSIIDVNDNSPQ--WPTVNI-----SKTVKECDRQGPLV-ELQAFDRDDSSTPNGQIKYKISD 935
            +NY ++ S +        +DRET  +++    +I    +    L     + V I D NDN P F+ R   + ++EN   GS L   +A DLDS  N+ I Y I D   +D+        S Y  +++ + N      +  +   D E++  FE+ + A+D G    S   T+ V I+D NDN+P   +P+         + +    + G LV ++ A D D  S  N  I Y++++
Sbjct:  421 DNYALITSRA--------LDRETFSEYS---VEITATDLGSPPLSNKKMISVTITDVNDNPPVFTQRSYNVYLKENGVPGSILFSVSASDLDSSENAKISYSILDSKVQDV------SVSSY--VYMNSENGS----IYSMHSFDYEKLKVFEIHVQAKDQGSPSLSSNATVHVFILDQNDNAPAVIYPSSAALGSLSHQRMPRSAKAGHLVTKVTAVDAD--SGHNAWISYRLAE 631          
BLAST of Protocadherin-1 vs. Planmine SMEST
Match: SMESG000007877.1 (SMESG000007877.1)

HSP 1 Score: 1021.15 bits (2639), Expect = 0.000e+0
Identity = 574/593 (96.80%), Postives = 579/593 (97.64%), Query Frame = 3
Query: 1629 NHYFR-----ENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYIPNNLTPRNNALPPGINKKSNDKNRFSGGNVDNYRDSDSTDNMTXXXXXXXXXXXXXXXXXXXXXXTYFSGRFSRSRQLDLTHEKELNNYCTDGTGNYECDLLNANAASCHEDFNKMAMGSISSPATDKNNYTHLMRMNEAKYTPIHLNSNYIQSLCSSGSVPVQSSILQANSDSRNYEQCIQTRRELNDKPTAQIPGNKWSSIENIALSNNEFKSSIKSHDNSFFYNAHSYAAYINQFGAEEKDSSSTVDDNHSNNKTKIKQQTLPFSHHLKSPKDEQQLLTYQPIIXXXXXXXXXXXXXTKSHSKKCYVSSSFV 3392
            N+YF      +  ++ + DREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQNNIGLNLLKINLEGILNIYGVVDREQMVSIQAEIIAYDNGKPQLSAVANVIVDVLDVNDNKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTK LREREGIRLPDRLIIRASDNG PPKAELVTVNIRYIPNNLTPRNNALPPGINKKSNDKNRFSGGNVDNYRDSDSTDNMTLLYILVGILFVVFIIVLLVLVYTYFSGRFSRSRQLDLTHEKELNNYCTDGTGNYECDLLNANAASCHEDFNKMAMGSISSPATDKNNYTHLMRMNEAKYTPIHLNSNYIQSLCSSGSVPVQSSILQANSDSRNYEQCIQTRRELNDKPTAQIPGNKWSSIENIALSNN FKSSIKSHDNSFFYNAHSYAAYINQFGAEEKDSSSTVDDNHSNNKTKIKQQTLP SHHLKSPKDEQQLLTYQPIIASSGPNPNSNNASTKSHSKKCYVSSSFV
Sbjct:  502 NYYFTITILGKIEAKWKFDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQNNIGLNLLKINLEGILNIYGVVDREQMVSIQAEIIAYDNGKPQLSAVANVIVDVLDVNDNKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKYLREREGIRLPDRLIIRASDNGIPPKAELVTVNIRYIPNNLTPRNNALPPGINKKSNDKNRFSGGNVDNYRDSDSTDNMTLLYILVGILFVVFIIVLLVLVYTYFSGRFSRSRQLDLTHEKELNNYCTDGTGNYECDLLNANAASCHEDFNKMAMGSISSPATDKNNYTHLMRMNEAKYTPIHLNSNYIQSLCSSGSVPVQSSILQANSDSRNYEQCIQTRRELNDKPTAQIPGNKWSSIENIALSNNGFKSSIKSHDNSFFYNAHSYAAYINQFGAEEKDSSSTVDDNHSNNKTKIKQQTLPSSHHLKSPKDEQQLLTYQPIIASSGPNPNSNNASTKSHSKKCYVSSSFV 1094          

HSP 2 Score: 769.615 bits (1986), Expect = 0.000e+0
Identity = 389/391 (99.49%), Postives = 390/391 (99.74%), Query Frame = 3
Query:  114 MLICKTFYIKLKISENKGSGEDLINLKNYIIIHKLPINSSGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYFTMVKE 1286
            MLICKTFYIKLKISENKGSGEDLINLKNYIIIHKLPINSSGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQVLEVMV INDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKT+NRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAGSSLFLSSQGLQLMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYFTMVKE
Sbjct:    1 MLICKTFYIKLKISENKGSGEDLINLKNYIIIHKLPINSSGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHADVCQKIILISINGQVLEVMVDINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTMNRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAGSSLFLSSQGLQLMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYFTMVKE 391          

HSP 3 Score: 265.774 bits (678), Expect = 0.000e+0
Identity = 126/129 (97.67%), Postives = 128/129 (99.22%), Query Frame = 1
Query: 1282 KNVYNQSNGRQLFMYNIKKIPDTFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITILGKIEAKWKL 1668
            ++VYNQSNGRQLFMYNIKKIPDTFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITILGKIEAKWK 
Sbjct:  391 EDVYNQSNGRQLFMYNIKKIPDTFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITILGKIEAKWKF 519          

HSP 4 Score: 45.8246 bits (107), Expect = 3.007e-11
Identity = 81/354 (22.88%), Postives = 140/354 (39.55%), Query Frame = 3
Query:  306 LKQRNNIDRETMCKHADVCQKIILISINGQ---VLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTAD-DLDSEPNSIIRYFIKDIHSRD--IRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNS----PKKELINR-----LFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDL---NDTTYFTMVKECLQSIKW 1307
            LK    IDRE +    D  + I++   +G+      + V I D NDN PQ+   + + +++E    G  + L   D D  S PN  I+Y I D   +   I R+     S  F      ++   +  + L   I           + A D G ++ S  +T+ I D ND++P       + +++E DR  PLV       DD    N Q    ++D +     K+++ N+     LF      +  +    + +   ++ +  I  +D G          T+ I D ND+AP         ++ EN+     +  V   D D   N + +  +   ++  YFT+        KW
Sbjct:  186 LKLIKEIDREEI----DRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAGSSLF------LSSQGLQLMDLKTYI--------TFFITAVDGGGRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRT-PLVLTSVMVNDDDKGINSQFNCDLNDTTYFTMVKEDVYNQSNGRQLFMYNIKKIPDTFFDRESL---SFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITILGKIEAKW 517          

HSP 5 Score: 42.743 bits (99), Expect = 3.007e-11
Identity = 33/85 (38.82%), Postives = 39/85 (45.88%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENN---NIGAPIGYVRAYDPDSNENGRVSYQI 1599
            FDRE    YS+ I   D G P L       + I+D ND  P F      + +TE N    I A +G V A D D  ENG V Y I
Sbjct:  519 FDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYF-YQITEGNGLATIHAILGKVTADDKDLGENGTVYYAI 602          

HSP 6 Score: 56.6102 bits (135), Expect = 1.069e-7
Identity = 78/266 (29.32%), Postives = 113/266 (42.48%), Query Frame = 3
Query: 1668 DREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYF-YQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFK----YPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSI---ISHKHMEQNLPYQLQN---DGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTV 2432
            DRE    YS+ I   D G P L       + I+D ND  P F      + +TE N +    A +G V A D D  ENG V Y I       N   N    +  +        +   DRE        I+A DNG+P L+    V + +LDVND  P FK    Y I + N +     + +  +L    A+D D GENGT+ Y+I     H + + N+   L     +G L +   +   + + +   +I  A DNG P  + +  V
Sbjct:  416 DRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIG---APIGYVRAYDPDSNENGRVSYQIL------NNDENYYFTITILGKIEAKWKF---DREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGL-----ATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQNNIGLNLLKINLEGILNIYGVVDREQMVSIQAEII--AYDNGKPQLSAVANV 662          

HSP 7 Score: 20.0162 bits (40), Expect = 1.069e-7
Identity = 16/64 (25.00%), Postives = 27/64 (42.19%), Query Frame = 1
Query: 1441 TVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
            T+ I D ND+AP         ++ EN+     +  V   D D   N + +  +  ND  Y+  +
Sbjct:  328 TIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDL--NDTTYFTMV 389          

HSP 8 Score: 55.8398 bits (133), Expect = 2.014e-7
Identity = 61/247 (24.70%), Postives = 110/247 (44.53%), Query Frame = 3
Query:  405 VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQ--GSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQG-PLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAP 1130
            V + I D ND+ P  ++   T SI+EN      L+    +D D   NS     + D     + + + +  S    +F+  I ++   +       DRE +  + +++   D G+    G    TV+IID NDN+P++ + +I  T+ E +  G P+  ++A+D D  S  NG++ Y+I +N          ++       + ++     ++K   +  I A D G     ++  V I I D ND  P
Sbjct:  327 VTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYFTMVKEDVYNQSNGRQLFMYNIKKIPDTFF------DRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPD--SNENGRVSYQILNND------ENYYFTITILGKIEAKWKFDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVP 559          

HSP 9 Score: 38.5058 bits (88), Expect = 4.112e-7
Identity = 18/42 (42.86%), Postives = 29/42 (69.05%), Query Frame = 3
Query: 1662 EIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVP 1787
            EIDRE  D++ L ++A+D+G+     +CT+ + I+DVND  P
Sbjct:  191 EIDREEIDRFELILIAEDSGKQQ--GSCTITVSIIDVNDNSP 230          

HSP 10 Score: 36.1946 bits (82), Expect = 4.112e-7
Identity = 27/83 (32.53%), Postives = 43/83 (51.81%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKL-FTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
             DRE++  ++ + + I L    + G+ L   V I DENDN P+F       ++ EN++IG+ +    A D DS  N  + Y I
Sbjct:   71 IDRETMCKHADVCQKIIL--ISINGQVLEVMVDINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFI 151          

HSP 11 Score: 53.9138 bits (128), Expect = 8.427e-7
Identity = 42/135 (31.11%), Postives = 70/135 (51.85%), Query Frame = 3
Query:  411 VYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQ--GSCTITVSIIDVNDNSPQW 809
            V I DENDN P+F       ++ EN++IG+ +    A D DS  N  + Y I          +N    + YFTI I  + +++  +     + DRE  D++ L ++A+D+G+     +CT+ + I+DVND  P +
Sbjct:  445 VTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI----------LNN-DENYYFTITI--LGKIEAKW-----KFDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF 561          
BLAST of Protocadherin-1 vs. Planmine SMEST
Match: SMESG000007877.1 (SMESG000007877.1)

HSP 1 Score: 1021.15 bits (2639), Expect = 0.000e+0
Identity = 574/593 (96.80%), Postives = 579/593 (97.64%), Query Frame = 3
Query: 1629 NHYFR-----ENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYIPNNLTPRNNALPPGINKKSNDKNRFSGGNVDNYRDSDSTDNMTXXXXXXXXXXXXXXXXXXXXXXTYFSGRFSRSRQLDLTHEKELNNYCTDGTGNYECDLLNANAASCHEDFNKMAMGSISSPATDKNNYTHLMRMNEAKYTPIHLNSNYIQSLCSSGSVPVQSSILQANSDSRNYEQCIQTRRELNDKPTAQIPGNKWSSIENIALSNNEFKSSIKSHDNSFFYNAHSYAAYINQFGAEEKDSSSTVDDNHSNNKTKIKQQTLPFSHHLKSPKDEQQLLTYQPIIXXXXXXXXXXXXXTKSHSKKCYVSSSFV 3392
            N+YF      +  ++ + DREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQNNIGLNLLKINLEGILNIYGVVDREQMVSIQAEIIAYDNGKPQLSAVANVIVDVLDVNDNKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTK LREREGIRLPDRLIIRASDNG PPKAELVTVNIRYIPNNLTPRNNALPPGINKKSNDKNRFSGGNVDNYRDSDSTDNMTLLYILVGILFVVFIIVLLVLVYTYFSGRFSRSRQLDLTHEKELNNYCTDGTGNYECDLLNANAASCHEDFNKMAMGSISSPATDKNNYTHLMRMNEAKYTPIHLNSNYIQSLCSSGSVPVQSSILQANSDSRNYEQCIQTRRELNDKPTAQIPGNKWSSIENIALSNN FKSSIKSHDNSFFYNAHSYAAYINQFGAEEKDSSSTVDDNHSNNKTKIKQQTLP SHHLKSPKDEQQLLTYQPIIASSGPNPNSNNASTKSHSKKCYVSSSFV
Sbjct:  427 NYYFTITILGKIEAKWKFDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQNNIGLNLLKINLEGILNIYGVVDREQMVSIQAEIIAYDNGKPQLSAVANVIVDVLDVNDNKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKYLREREGIRLPDRLIIRASDNGIPPKAELVTVNIRYIPNNLTPRNNALPPGINKKSNDKNRFSGGNVDNYRDSDSTDNMTLLYILVGILFVVFIIVLLVLVYTYFSGRFSRSRQLDLTHEKELNNYCTDGTGNYECDLLNANAASCHEDFNKMAMGSISSPATDKNNYTHLMRMNEAKYTPIHLNSNYIQSLCSSGSVPVQSSILQANSDSRNYEQCIQTRRELNDKPTAQIPGNKWSSIENIALSNNGFKSSIKSHDNSFFYNAHSYAAYINQFGAEEKDSSSTVDDNHSNNKTKIKQQTLPSSHHLKSPKDEQQLLTYQPIIASSGPNPNSNNASTKSHSKKCYVSSSFV 1019          

HSP 2 Score: 618.616 bits (1594), Expect = 0.000e+0
Identity = 314/316 (99.37%), Postives = 315/316 (99.68%), Query Frame = 3
Query:  339 MCKHADVCQKIILISINGQVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYFTMVKE 1286
            MCKHADVCQKIILISINGQVLEVMV INDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKT+NRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAGSSLFLSSQGLQLMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYFTMVKE
Sbjct:    1 MCKHADVCQKIILISINGQVLEVMVDINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTMNRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAGSSLFLSSQGLQLMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYFTMVKE 316          

HSP 3 Score: 265.774 bits (678), Expect = 0.000e+0
Identity = 126/129 (97.67%), Postives = 128/129 (99.22%), Query Frame = 1
Query: 1282 KNVYNQSNGRQLFMYNIKKIPDTFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITILGKIEAKWKL 1668
            ++VYNQSNGRQLFMYNIKKIPDTFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITILGKIEAKWK 
Sbjct:  316 EDVYNQSNGRQLFMYNIKKIPDTFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITILGKIEAKWKF 444          

HSP 4 Score: 45.8246 bits (107), Expect = 3.516e-11
Identity = 81/354 (22.88%), Postives = 140/354 (39.55%), Query Frame = 3
Query:  306 LKQRNNIDRETMCKHADVCQKIILISINGQ---VLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTAD-DLDSEPNSIIRYFIKDIHSRD--IRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNS----PKKELINR-----LFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDL---NDTTYFTMVKECLQSIKW 1307
            LK    IDRE +    D  + I++   +G+      + V I D NDN PQ+   + + +++E    G  + L   D D  S PN  I+Y I D   +   I R+     S  F      ++   +  + L   I           + A D G ++ S  +T+ I D ND++P       + +++E DR  PLV       DD    N Q    ++D +     K+++ N+     LF      +  +    + +   ++ +  I  +D G          T+ I D ND+AP         ++ EN+     +  V   D D   N + +  +   ++  YFT+        KW
Sbjct:  111 LKLIKEIDREEI----DRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAGSSLF------LSSQGLQLMDLKTYI--------TFFITAVDGGGRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRT-PLVLTSVMVNDDDKGINSQFNCDLNDTTYFTMVKEDVYNQSNGRQLFMYNIKKIPDTFFDRESL---SFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITILGKIEAKW 442          

HSP 5 Score: 42.743 bits (99), Expect = 3.516e-11
Identity = 33/85 (38.82%), Postives = 39/85 (45.88%), Query Frame = 1
Query: 1354 FDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENN---NIGAPIGYVRAYDPDSNENGRVSYQI 1599
            FDRE    YS+ I   D G P L       + I+D ND  P F      + +TE N    I A +G V A D D  ENG V Y I
Sbjct:  444 FDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYF-YQITEGNGLATIHAILGKVTADDKDLGENGTVYYAI 527          

HSP 6 Score: 56.225 bits (134), Expect = 1.388e-7
Identity = 79/266 (29.70%), Postives = 113/266 (42.48%), Query Frame = 3
Query: 1668 DREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYF-YQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFK----YPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSI---ISHKHMEQNLPYQLQN---DGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTV 2432
            DRE    YS+ I   D G P L       + I+D ND  P F      + +TE N    I A +G V A D D  ENG V Y I       N   N    +  +        +   DRE        I+A DNG+P L+    V + +LDVND  P FK    Y I + N +     + +  +L    A+D D GENGT+ Y+I     H + + N+   L     +G L +   +   + + +   +I  A DNG P  + +  V
Sbjct:  341 DRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNN---IGAPIGYVRAYDPDSNENGRVSYQIL------NNDENYYFTITILGKIEAKWKF---DREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGL-----ATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQNNIGLNLLKINLEGILNIYGVVDREQMVSIQAEII--AYDNGKPQLSAVANV 587          

HSP 7 Score: 20.0162 bits (40), Expect = 1.388e-7
Identity = 16/64 (25.00%), Postives = 27/64 (42.19%), Query Frame = 1
Query: 1441 TVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTI 1632
            T+ I D ND+AP         ++ EN+     +  V   D D   N + +  +  ND  Y+  +
Sbjct:  253 TIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDL--NDTTYFTMV 314          

HSP 8 Score: 55.8398 bits (133), Expect = 2.244e-7
Identity = 61/247 (24.70%), Postives = 110/247 (44.53%), Query Frame = 3
Query:  405 VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQ--GSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQG-PLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAP 1130
            V + I D ND+ P  ++   T SI+EN      L+    +D D   NS     + D     + + + +  S    +F+  I ++   +       DRE +  + +++   D G+    G    TV+IID NDN+P++ + +I  T+ E +  G P+  ++A+D D  S  NG++ Y+I +N          ++       + ++     ++K   +  I A D G     ++  V I I D ND  P
Sbjct:  252 VTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYFTMVKEDVYNQSNGRQLFMYNIKKIPDTFF------DRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPD--SNENGRVSYQILNND------ENYYFTITILGKIEAKWKFDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVP 484          

HSP 9 Score: 53.9138 bits (128), Expect = 7.867e-7
Identity = 42/135 (31.11%), Postives = 70/135 (51.85%), Query Frame = 3
Query:  411 VYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQ--GSCTITVSIIDVNDNSPQW 809
            V I DENDN P+F       ++ EN++IG+ +    A D DS  N  + Y I          +N    + YFTI I  + +++  +     + DRE  D++ L ++A+D+G+     +CT+ + I+DVND  P +
Sbjct:  370 VTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI----------LNN-DENYYFTITI--LGKIEAKW-----KFDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVF 486          

HSP 10 Score: 38.5058 bits (88), Expect = 8.583e-7
Identity = 18/42 (42.86%), Postives = 29/42 (69.05%), Query Frame = 3
Query: 1662 EIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVP 1787
            EIDRE  D++ L ++A+D+G+     +CT+ + I+DVND  P
Sbjct:  116 EIDREEIDRFELILIAEDSGKQQ--GSCTITVSIIDVNDNSP 155          

HSP 11 Score: 35.039 bits (79), Expect = 8.583e-7
Identity = 20/52 (38.46%), Postives = 28/52 (53.85%), Query Frame = 1
Query: 1444 VTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQI 1599
            V I DENDN P+F       ++ EN++IG+ +    A D DS  N  + Y I
Sbjct:   25 VDINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFI 76          
BLAST of Protocadherin-1 vs. Planmine SMEST
Match: SMESG000066775.1 (SMESG000066775.1)

HSP 1 Score: 239.195 bits (609), Expect = 1.076e-88
Identity = 154/404 (38.12%), Postives = 231/404 (57.18%), Query Frame = 3
Query:   72 IHLSISIIFGILIEMLICKTFYIKLKISENKGSGEDLINLKNYIIIHKLPINSSGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHA-DVCQKIILISINGQVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRM-----NQFQASRYFTIFIKTINRMKI-PYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDT 1262
            I L I IIF I + +    T  ++  + EN   G  + N+  Y  +++LP NSS +  + +NE D  +YF L   SG L  ++ +DRET+C++  + C   + +  +   +++++ IND NDN+P F    K ++IQEN  IG+   LP A D DS    +  Y+I      D         N FQ   +F I      + +I P L++IK IDREE   F  ILIA D G Q GSCT+TV + DVNDN+P+W   N    ++EC  +G ++EL A DRDD +T NG + Y++SD +  +++++++FYI G+ L L++  +  +  +  I  +ITA DG GR N T+V I IEDCNDH P I+I      + EN +  ++LT+V V D+DKG N  F C LND+
Sbjct:    3 IELDILIIFSIKLVI----TLNVEFSVDENCRIGHVVGNV--YSKLNQLP-NSSRSSLMKANEKD--SYFSLNRTSGDLIVKSFLDRETICENTKETCSMKLYLDQDTHAIQIVIEINDINDNVPVFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQ---FFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIAADFGNQTGSCTVTVLVTDVNDNAPEWTKDNYKVNIQECQSEGDILELIANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDS 394          

HSP 2 Score: 109.383 bits (272), Expect = 1.076e-88
Identity = 56/123 (45.53%), Postives = 83/123 (67.48%), Query Frame = 1
Query: 1321 MYNIKKIPDTFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITILGKIEAKWKLIEKSKTN 1689
            +Y I+  PDT FDRE +S Y+V I+C+D G P +   + F++ IID NDNAP+F +    F + ENN IG+ +G VRA D DS+ NG + Y ILN+++N  F I+I G+I++K K  ++ KT+
Sbjct:  410 IYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDN--FAISIYGEIQSKIKF-DREKTD 529          

HSP 3 Score: 208.764 bits (530), Expect = 9.024e-55
Identity = 173/453 (38.19%), Postives = 268/453 (59.16%), Query Frame = 3
Query: 1638 FRENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQ----KYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIR-LPDRLIIRASDNGTPPKAELVTVNIRYIPNNLTPRNNALPPGINKKSN--DKNRFSGGNVDNYRDSDST--------DNMTXXXXXXXXXXXXXXXXXXXXXXTYFSGRFS------------RSRQLDL-THEKELNNYCTDGTGNYECDLLNANAASCHEDFNKMAMGSISSPATDKNNYTHLMRMNEAKYTPIHLNSNYIQSL 2912
            + E +S+++ DRE  D Y   + A+DNGEP LND+  V ++I D+NDC PVF++ YF++ITE  G +  +  L ++ A DKDLG+NGTV Y +          +++      NL+K++ +G ++IYG +DRE++ SIQ  + A+D+G P LS    +I++VLD+NDN P F +P N MNF+N+S + ++GK +   + +D D+G NGTIT+S+I+    E N P+++Q++G +I+  +++E    R LPDRLII+ASD G  PK  + T+ IRYI ++LT   N+ P  I KKS+  D N F     ++ ++  ST        D+M +LY L  ILF +F+IVL VLV+ Y+S  +S             + QLDL T+ KE+ N       N +C+       S +ED       ++     D ++YTHLM ++ +KYTP+  N     SL
Sbjct:  514 YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISIYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRE-NFPFKIQSEGEIIIAHSMKEFSNFRSLPDRLIIKASDLGQNPKNNIATLYIRYI-HSLT---NSNPTSIGKKSHSSDNNNFGFRLKNDNKNPISTKNFNPNLSDSMMVLYSLAAILFFIFLIVLFVLVFIYWSKHYSVNDRYSKKIYKAGNVQLDLDTNLKEMKNVTKSIRSNRDCE------TSGNED-----ASAVCFIGDDGSSYTHLMMLSNSKYTPMLHNPGSPGSL 950          

HSP 4 Score: 68.9366 bits (167), Expect = 2.009e-11
Identity = 89/306 (29.08%), Postives = 136/306 (44.44%), Query Frame = 3
Query: 1635 YFRENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQY-FYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVV------DREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINIS---TDSQVGKVLANFEAEDPDKGENGTITYSIISHKHM----EQNLPYQLQN------DGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYI------PNNLTPRNN 2474
            Y  E       DRE    Y++ I   D G P+++      I I+DVND  P F  +   + + E N    I + +G+V A D D   NG + Y+I    D+                   ++IYG +      DRE+  S +  + A DNG+PQL+    V V + D+ND  P F+    K  F  I+    +S   + L   +A D D G+NGT+ Y +I  K +       L  +L+N      DG + +  NL +RE I    +L+++A D+G P  +   T+ I  +      P  L P NN
Sbjct:  411 YKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENN---PIGSTVGQVRAMDLDSSNNGHIVYSILNSNDN-----------------FAISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFE----KDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISIYGNL-DREEIS-SIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNN 690          

HSP 5 Score: 67.781 bits (164), Expect = 5.328e-11
Identity = 78/252 (30.95%), Postives = 115/252 (45.63%), Query Frame = 3
Query:  423 DENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQ--GSCTITVSIIDVNDNSPQWPT---VNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSP---------KKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIE--DCNDHAP 1130
            D NDN P+F  + K   + EN+ IGS +    A DLDS  N  I Y I  ++S D      F  S Y  I      + KI +       DRE+ D +E ++ A D+G+ Q   S  + V I D+ND +P +       I+++  E  +   L +++A D+D     NG +KY++ D  P         K EL N L  ++          L   ++ + I   + A D G    ST  TI IE  D ND+AP
Sbjct:  455 DVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSI--LNSND-----NFAISIYGEI------QSKIKF-------DREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQ--NGTVKYRLIDVKPIGIPGNSKLKAELRN-LIKVSFDGAISIYGNLDREEISS-IQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAP 682          
BLAST of Protocadherin-1 vs. Planmine SMEST
Match: SMESG000059440.1 (SMESG000059440.1)

HSP 1 Score: 220.705 bits (561), Expect = 1.402e-73
Identity = 127/322 (39.44%), Postives = 186/322 (57.76%), Query Frame = 3
Query:  324 IDRETMCKHADVCQKIILIS----INGQVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYFTM 1277
            IDRE +C+    C     ++     + Q+ E+ + I D NDN P F    KT+ I EN    SE SLP A D DSE   + +Y++K I S             YF + I   N +  PYL++I ++DRE I  FE  L A D G  QG C I V I DVNDN+PQW  +   K + EC  +  +++L A D+DD  T  GQI++KIS+NS   E+I R+FYI  S L+L+   L+    +   +  + A DG GR N T + +EI+DCNDH P I ++ S+  I+EN+++ +++T + V D+D+GINS+F+C LNDT + ++
Sbjct:   86 IDREEICQPISKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVKKYYLKSISSSIYEN--------YFEL-IDHGNNIN-PYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFK-ENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSL 396          

HSP 2 Score: 77.411 bits (189), Expect = 1.402e-73
Identity = 41/104 (39.42%), Postives = 61/104 (58.65%), Query Frame = 1
Query: 1303 NGRQLFMYNIKKIPDTFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDE 1614
            NG Q  ++ +  IP  +FDRE  S YSV + C D G P +   ++ T+ I DENDN P F ++   F+++E+  IG  IG V A D DS+ N  ++Y I+ + E
Sbjct:  406 NGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYE 509          

HSP 3 Score: 165.622 bits (418), Expect = 3.407e-41
Identity = 107/289 (37.02%), Postives = 170/289 (58.82%), Query Frame = 3
Query: 1584 SVISDFE*RRKLLFYNHYFRENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYP-INKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYI 2447
            S+I D+E  ++    NH  + + +++ +DRE+KD+Y  T+ AKDNGEP+LND+C + I +LDVND +P     Y ++I E       H  +GK+ A D+D+G+NGT  + +R +    + Q         +  EG +  +G +DRE++  I   +   DNG P  +A   V ++VLDVNDN+PKF YP +N  N++NI+ D   G ++   +A D D G NG+I Y++ +  H +    + +Q+DG++IL K L  +  I+ PDRL++ A D GTP  +   T+ IRY 
Sbjct:  503 SIIGDYE-VKETFGINHNGQIHLNKI-LDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQ---------VYNEGKIIYFGNIDREKVDKIDVLVDVIDNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKD--LFSIQSDGQIILKKKLDTK--IKNPDRLVVEARDQGTPSLSATTTLYIRYF 776          

HSP 4 Score: 85.1149 bits (209), Expect = 2.618e-16
Identity = 80/292 (27.40%), Postives = 129/292 (44.18%), Query Frame = 3
Query:  405 VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQ--QGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGP---LVELQAFDRDDSSTPNGQIKYKISDNSPKKELI----NRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGG--RENSTAVTIEIEDCNDHAPNIAIYKSTA----SIRENDRTPLVLTSVMVNDDDKGINS 1235
            + ++I+DENDN P F    KT SI E++ IG E+ +  A D DS PN+II Y I          +  ++    F I            + L K +DRE  DR+E  + A+D+G+     SC I + ++DVNDN P+  T    K V+  +R+     + +L A DRD     NG  ++++   S   ++      ++ Y          +          I   +  +D G   R  +T V IE+ D ND+ P        A    +I ++     ++  V   D+D G+N 
Sbjct:  451 ITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSI----------IGDYEVKETFGI-------NHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQ--NGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREKVDK----------IDVLVDVIDNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNG 713          

HSP 5 Score: 51.9878 bits (123), Expect = 1.095e-12
Identity = 44/137 (32.12%), Postives = 64/137 (46.72%), Query Frame = 1
Query: 1288 VYNQSNGRQLFMYNIKKIPDTFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIR----FTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILN-NDENYYFTITILGKIEAKWKLIEKSK 1683
            VYN+  G+ ++  NI        DRE +    VL+  ID G PP        + ++D NDN PKF    +       +T++   G+ +G V+A D D   NG + Y + N N     F+I   G+I  K KL  K K
Sbjct:  622 VYNE--GKIIYFGNI--------DREKVDKIDVLVDVIDNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQIILKKKLDTKIK 748          

HSP 6 Score: 41.5874 bits (96), Expect = 1.095e-12
Identity = 71/303 (23.43%), Postives = 126/303 (41.58%), Query Frame = 3
Query:  369 IILISINGQVLE----VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEI--DREEIDRFELILIAEDSGKQQGSCT--ITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIR--ENDRTPLVLTSVMVNDDDKGINSQF 1241
            I++I+ +G+       + + I D ND+ P   +   +L I+EN      ++  T  D D   NS     + D +   +  M        +T  ++   + KI  L  I  +  DRE+  R+ + +I  D+G    S +  IT+ I D NDN P + T   + ++ E  + G  + +    +D  S+PN  I Y I  +   KE      +    +  +    +   ++K    F + A D G     +S  + I + D ND+ P I+   S   +   E +     +  +  +D D G N  F
Sbjct:  319 IVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSM--------YTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGI-VIAKDSDSSPNNIITYSIIGDYEVKET-----FGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTF 607          

HSP 7 Score: 61.2326 bits (147), Expect = 5.387e-9
Identity = 75/266 (28.20%), Postives = 128/266 (48.12%), Query Frame = 3
Query: 1659 MEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQY-FYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGK--VLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYI 2447
            +  DRE   +YS+ ++  DNG P+++ +  + I I D ND  P F+ ++  + I+E    A I   +G V A D D   N  + Y+I   Y+              IN  G +++  ++DRE     +  + A DNG+P L+    + + VLDVNDN P+        +F  + +  +  K   +    A D D G+NGT  + + S       +  Q+ N+G++I   N+ +RE +   D +++   DNG PP+    TV+I  +
Sbjct:  421 LYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISED---AKIGHEIGIVIAKDSDSSPNNIITYSIIGDYE--------VKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS---TSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSR---STPIDIQVYNEGKIIYFGNI-DREKVDKID-VLVDVIDNGNPPRTATTTVHIEVL 667          
BLAST of Protocadherin-1 vs. Planmine SMEST
Match: SMESG000059440.1 (SMESG000059440.1)

HSP 1 Score: 220.705 bits (561), Expect = 1.437e-73
Identity = 127/322 (39.44%), Postives = 186/322 (57.76%), Query Frame = 3
Query:  324 IDRETMCKHADVCQKIILIS----INGQVLEVMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYFTM 1277
            IDRE +C+    C     ++     + Q+ E+ + I D NDN P F    KT+ I EN    SE SLP A D DSE   + +Y++K I S             YF + I   N +  PYL++I ++DRE I  FE  L A D G  QG C I V I DVNDN+PQW  +   K + EC  +  +++L A D+DD  T  GQI++KIS+NS   E+I R+FYI  S L+L+   L+    +   +  + A DG GR N T + +EI+DCNDH P I ++ S+  I+EN+++ +++T + V D+D+GINS+F+C LNDT + ++
Sbjct:   86 IDREEICQPISKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVKKYYLKSISSSIYEN--------YFEL-IDHGNNIN-PYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEAKVLQLNAQDKDDPQTIGGQIRFKISENSQNYEMIVRIFYITESILYLNIGALKSFK-ENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSL 396          

HSP 2 Score: 77.411 bits (189), Expect = 1.437e-73
Identity = 41/104 (39.42%), Postives = 61/104 (58.65%), Query Frame = 1
Query: 1303 NGRQLFMYNIKKIPDTFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDE 1614
            NG Q  ++ +  IP  +FDRE  S YSV + C D G P +   ++ T+ I DENDN P F ++   F+++E+  IG  IG V A D DS+ N  ++Y I+ + E
Sbjct:  406 NGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSIIGDYE 509          

HSP 3 Score: 165.622 bits (418), Expect = 3.602e-41
Identity = 107/289 (37.02%), Postives = 170/289 (58.82%), Query Frame = 3
Query: 1584 SVISDFE*RRKLLFYNHYFRENRSQMEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYP-INKMNFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYI 2447
            S+I D+E  ++    NH  + + +++ +DRE+KD+Y  T+ AKDNGEP+LND+C + I +LDVND +P     Y ++I E       H  +GK+ A D+D+G+NGT  + +R +    + Q         +  EG +  +G +DRE++  I   +   DNG P  +A   V ++VLDVNDN+PKF YP +N  N++NI+ D   G ++   +A D D G NG+I Y++ +  H +    + +Q+DG++IL K L  +  I+ PDRL++ A D GTP  +   T+ IRY 
Sbjct:  503 SIIGDYE-VKETFGINHNGQIHLNKI-LDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPIDIQ---------VYNEGKIIYFGNIDREKVDKIDVLVDVIDNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKD--LFSIQSDGQIILKKKLDTK--IKNPDRLVVEARDQGTPSLSATTTLYIRYF 776          

HSP 4 Score: 85.1149 bits (209), Expect = 2.828e-16
Identity = 80/292 (27.40%), Postives = 129/292 (44.18%), Query Frame = 3
Query:  405 VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEIDREEIDRFELILIAEDSGKQ--QGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGP---LVELQAFDRDDSSTPNGQIKYKISDNSPKKELI----NRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGGG--RENSTAVTIEIEDCNDHAPNIAIYKSTA----SIRENDRTPLVLTSVMVNDDDKGINS 1235
            + ++I+DENDN P F    KT SI E++ IG E+ +  A D DS PN+II Y I          +  ++    F I            + L K +DRE  DR+E  + A+D+G+     SC I + ++DVNDN P+  T    K V+  +R+     + +L A DRD     NG  ++++   S   ++      ++ Y          +          I   +  +D G   R  +T V IE+ D ND+ P        A    +I ++     ++  V   D+D G+N 
Sbjct:  451 ITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSI----------IGDYEVKETFGI-------NHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQ--NGTFRFRVRSRSTPIDIQVYNEGKIIYFGNIDREKVDK----------IDVLVDVIDNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNG 713          

HSP 5 Score: 51.9878 bits (123), Expect = 1.132e-12
Identity = 44/137 (32.12%), Postives = 64/137 (46.72%), Query Frame = 1
Query: 1288 VYNQSNGRQLFMYNIKKIPDTFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIR----FTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILN-NDENYYFTITILGKIEAKWKLIEKSK 1683
            VYN+  G+ ++  NI        DRE +    VL+  ID G PP        + ++D NDN PKF    +       +T++   G+ +G V+A D D   NG + Y + N N     F+I   G+I  K KL  K K
Sbjct:  622 VYNE--GKIIYFGNI--------DREKVDKIDVLVDVIDNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQIILKKKLDTKIK 748          

HSP 6 Score: 41.5874 bits (96), Expect = 1.132e-12
Identity = 71/303 (23.43%), Postives = 126/303 (41.58%), Query Frame = 3
Query:  369 IILISINGQVLE----VMVYINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTINRMKIPYLKLIKEI--DREEIDRFELILIAEDSGKQQGSCT--ITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKISDNSPKKELINRLFYIAXXXXXXXXXXXXXMDLKTYITFFITAVDGG--GRENSTAVTIEIEDCNDHAPNIAIYKSTASIR--ENDRTPLVLTSVMVNDDDKGINSQF 1241
            I++I+ +G+       + + I D ND+ P   +   +L I+EN      ++  T  D D   NS     + D +   +  M        +T  ++   + KI  L  I  +  DRE+  R+ + +I  D+G    S +  IT+ I D NDN P + T   + ++ E  + G  + +    +D  S+PN  I Y I  +   KE      +    +  +    +   ++K    F + A D G     +S  + I + D ND+ P I+   S   +   E +     +  +  +D D G N  F
Sbjct:  319 IVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSM--------YTSPLENGGQKKIFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGI-VIAKDSDSSPNNIITYSIIGDYEVKET-----FGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTF 607          

HSP 7 Score: 60.8474 bits (146), Expect = 5.917e-9
Identity = 75/266 (28.20%), Postives = 128/266 (48.12%), Query Frame = 3
Query: 1659 MEIDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQY-FYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQXXXXXXXXXXXXXXXXXXYGVVDREQMVSIQAEIIAYDNGKPQLSAXXXXXXXXXXXXXXKPKFKYPINKMNFINISTDSQVGK--VLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKNLREREGIRLPDRLIIRASDNGTPPKAELVTVNIRYI 2447
            +  DRE   +YS+ ++  DNG P+++ +  + I I D ND  P F+ ++  + I+E    A I   +G V A D D   N  + Y+I   Y+              IN  G +++  ++DRE     +  + A DNG+P L+    + + VLDVNDN P+        +F  + +  +  K   +    A D D G+NGT  + + S       +  Q+ N+G++I   N+ +RE +   D +++   DNG PP+    TV+I  +
Sbjct:  421 LYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISED---AKIGHEIGIVIAKDSDSSPNNIITYSIIGDYE--------VKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEIS---TSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSR---STPIDIQVYNEGKIIYFGNI-DREKVDKID-VLVDVIDNGNPPRTATTTVHIEVL 667          
The following BLAST results are available for this feature:
BLAST of Protocadherin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH12.114e-4626.29protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655][more]
PCDH13.871e-4626.29protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655][more]
PCDH11X4.113e-4424.94protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11X1.282e-4324.94protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11X1.368e-4324.94protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-12.648e-2726.22FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-12.956e-2726.22FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-12.564e-1829.23CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
cdh-42.633e-1437.80Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI... [more]
hmr-12.165e-1228.70Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ds1.353e-3926.06gene:FBgn0284247 transcript:FBtr0078045[more]
ds1.353e-3926.06gene:FBgn0284247 transcript:FBtr0343249[more]
stan1.263e-3726.96gene:FBgn0024836 transcript:FBtr0304900[more]
stan1.359e-3726.96gene:FBgn0024836 transcript:FBtr0304899[more]
stan1.359e-3726.96gene:FBgn0024836 transcript:FBtr0300578[more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh2ab94.734e-5329.75protocadherin 2 alpha b 9 [Source:ZFIN;Acc:ZDB-GEN... [more]
pcdh1a1.315e-4427.68protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
CT030123.11.414e-4428.37protocadherin 1b [Source:NCBI gene;Acc:572016][more]
CT030123.11.549e-4428.37protocadherin 1b [Source:NCBI gene;Acc:572016][more]
CT030123.11.950e-4428.37protocadherin 1b [Source:NCBI gene;Acc:572016][more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000027070.13.521e-4927.06pep primary_assembly:Xenopus_tropicalis_v9.1:3:190... [more]
PCDHAC21.791e-4529.45protocadherin alpha subfamily C, 2 [Source:NCBI ge... [more]
ENSXETT00000047804.12.385e-4531.91protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
ENSXETT00000047801.12.928e-4531.91protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
ENSXETT00000047798.13.777e-4531.91protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdh12.966e-4726.29protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh12.966e-4726.29protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh16.115e-4526.22protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh11x1.220e-4426.09protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x3.905e-4426.09protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Protocadherin-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q08174|PCDH1_HUMAN9.405e-4626.29Protocadherin-1 OS=Homo sapiens OX=9606 GN=PCDH1 P... [more]
sp|Q9BZA7|PC11X_HUMAN6.087e-4324.94Protocadherin-11 X-linked OS=Homo sapiens OX=9606 ... [more]
sp|Q71M42|PC11X_PANTR7.056e-4324.94Protocadherin-11 X-linked OS=Pan troglodytes OX=95... [more]
sp|Q6WYY1|PC11X_PANPA7.659e-4324.94Protocadherin-11 X-linked OS=Pan paniscus OX=9597 ... [more]
sp|Q6WXV7|PC11X_PONPY2.710e-4224.94Protocadherin-11 X-linked OS=Pongo pygmaeus OX=960... [more]
back to top
BLAST of Protocadherin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DHT61.147e-6632.73Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8H4K26.020e-6532.21Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GS007.157e-6532.21Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GLZ21.803e-6432.21Uncharacterized protein OS=Macrostomum lignano OX=... [more]
K1P7M18.922e-5726.36Protocadherin-11 Y-linked OS=Crassostrea gigas OX=... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000053628.16.447e-4728.29pep primary_assembly:Astyanax_mexicanus-2.0:8:8891... [more]
pcdh1a1.018e-4629.09protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a3.421e-4629.09protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh7a3.531e-4329.13protocadherin 7a [Source:ZFIN;Acc:ZDB-GENE-120206-... [more]
pcdh95.584e-4327.61protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-199f5.11.352e-3825.95protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660][more]
ENSPMAT00000010725.11.563e-3527.25pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 ... [more]
ENSPMAT00000008517.11.919e-3221.13pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
ENSPMAT00000006996.13.484e-2831.16pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 g... [more]
ENSPMAT00000004042.15.695e-2328.50pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO354123.201e-4326.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461892.385e-3632.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348159.881e-3324.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482371.414e-3226.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404704.194e-3024.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh7a7.563e-4528.72protocadherin-7-like [Source:NCBI gene;Acc:1011671... [more]
pcdh1a3.555e-4428.07protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
ENSORLT00000037422.15.030e-4429.24pep primary_assembly:ASM223467v1:10:14795752:14799... [more]
ENSORLT00000036341.15.782e-4429.24pep primary_assembly:ASM223467v1:10:14795752:14799... [more]
ENSORLT00000041785.16.850e-4428.65protocadherin gamma-C5 [Source:NCBI gene;Acc:10116... [more]
back to top
BLAST of Protocadherin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000007877.13.007e-1196.80SMESG000007877.1[more]
SMESG000007877.13.516e-1196.80SMESG000007877.1[more]
SMESG000066775.11.076e-8838.12SMESG000066775.1[more]
SMESG000059440.11.402e-7339.44SMESG000059440.1[more]
SMESG000059440.11.437e-7339.44SMESG000059440.1[more]
back to top