Programmed cell death protein 10

Overview
NameProgrammed cell death protein 10
Smed IDSMED30004991
Length (bp)1317
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Programmed cell death protein 10 (SMED30004991) t-SNE clustered cells

Violin plots show distribution of expression levels for Programmed cell death protein 10 (SMED30004991) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Programmed cell death protein 10 (SMED30004991) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Programmed cell death protein 10 (SMED30004991) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Programmed cell death protein 10 vs. Ensembl Human
Match: PDCD10 (programmed cell death 10 [Source:HGNC Symbol;Acc:HGNC:8761])

HSP 1 Score: 147.902 bits (372), Expect = 1.509e-41
Identity = 83/191 (43.46%), Postives = 121/191 (63.35%), Query Frame = 1
Query:   97 VFEPVFEKLEQKSLSHTHTLKQSFAKVEQQYPGFSQNFLIGILNKLGLENEVDMSETFLRMASMAETGVVRNMRKQIYNILESKAHTLKEILSRIPDEISDRRSFLDTIREIAGAIKNLLDCVSEVITHLPTDNHKTSLEQAKRDFVKYSKRFSNTLKAFFRDNRPSEVYASANLLVNQTNMILLVVRDAA 669
            V  PVF +LE+ +LS   TL+ +F K E++ PG +Q+ ++ IL K  +E  V+ +E+ LRMA+      +    +  +  L  KA  LK+ILS+IPDEI+DR  FL TI++IA AIK LLD V+ V       N + +LE  K++FVKYSK FS+TLK +F+D +   V+ SAN L++QTN+IL   +  A
Sbjct:   25 VMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVE--VNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRR-ALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA 212          
BLAST of Programmed cell death protein 10 vs. Ensembl Human
Match: PDCD10 (programmed cell death 10 [Source:HGNC Symbol;Acc:HGNC:8761])

HSP 1 Score: 147.902 bits (372), Expect = 1.509e-41
Identity = 83/191 (43.46%), Postives = 121/191 (63.35%), Query Frame = 1
Query:   97 VFEPVFEKLEQKSLSHTHTLKQSFAKVEQQYPGFSQNFLIGILNKLGLENEVDMSETFLRMASMAETGVVRNMRKQIYNILESKAHTLKEILSRIPDEISDRRSFLDTIREIAGAIKNLLDCVSEVITHLPTDNHKTSLEQAKRDFVKYSKRFSNTLKAFFRDNRPSEVYASANLLVNQTNMILLVVRDAA 669
            V  PVF +LE+ +LS   TL+ +F K E++ PG +Q+ ++ IL K  +E  V+ +E+ LRMA+      +    +  +  L  KA  LK+ILS+IPDEI+DR  FL TI++IA AIK LLD V+ V       N + +LE  K++FVKYSK FS+TLK +F+D +   V+ SAN L++QTN+IL   +  A
Sbjct:   25 VMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVE--VNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRR-ALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA 212          
BLAST of Programmed cell death protein 10 vs. Ensembl Human
Match: PDCD10 (programmed cell death 10 [Source:HGNC Symbol;Acc:HGNC:8761])

HSP 1 Score: 147.902 bits (372), Expect = 1.509e-41
Identity = 83/191 (43.46%), Postives = 121/191 (63.35%), Query Frame = 1
Query:   97 VFEPVFEKLEQKSLSHTHTLKQSFAKVEQQYPGFSQNFLIGILNKLGLENEVDMSETFLRMASMAETGVVRNMRKQIYNILESKAHTLKEILSRIPDEISDRRSFLDTIREIAGAIKNLLDCVSEVITHLPTDNHKTSLEQAKRDFVKYSKRFSNTLKAFFRDNRPSEVYASANLLVNQTNMILLVVRDAA 669
            V  PVF +LE+ +LS   TL+ +F K E++ PG +Q+ ++ IL K  +E  V+ +E+ LRMA+      +    +  +  L  KA  LK+ILS+IPDEI+DR  FL TI++IA AIK LLD V+ V       N + +LE  K++FVKYSK FS+TLK +F+D +   V+ SAN L++QTN+IL   +  A
Sbjct:   25 VMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVE--VNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRR-ALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA 212          
BLAST of Programmed cell death protein 10 vs. Ensembl Human
Match: PDCD10 (programmed cell death 10 [Source:HGNC Symbol;Acc:HGNC:8761])

HSP 1 Score: 147.902 bits (372), Expect = 1.509e-41
Identity = 83/191 (43.46%), Postives = 121/191 (63.35%), Query Frame = 1
Query:   97 VFEPVFEKLEQKSLSHTHTLKQSFAKVEQQYPGFSQNFLIGILNKLGLENEVDMSETFLRMASMAETGVVRNMRKQIYNILESKAHTLKEILSRIPDEISDRRSFLDTIREIAGAIKNLLDCVSEVITHLPTDNHKTSLEQAKRDFVKYSKRFSNTLKAFFRDNRPSEVYASANLLVNQTNMILLVVRDAA 669
            V  PVF +LE+ +LS   TL+ +F K E++ PG +Q+ ++ IL K  +E  V+ +E+ LRMA+      +    +  +  L  KA  LK+ILS+IPDEI+DR  FL TI++IA AIK LLD V+ V       N + +LE  K++FVKYSK FS+TLK +F+D +   V+ SAN L++QTN+IL   +  A
Sbjct:   25 VMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVE--VNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRR-ALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA 212          
BLAST of Programmed cell death protein 10 vs. Ensembl Human
Match: PDCD10 (programmed cell death 10 [Source:HGNC Symbol;Acc:HGNC:8761])

HSP 1 Score: 147.902 bits (372), Expect = 1.509e-41
Identity = 83/191 (43.46%), Postives = 121/191 (63.35%), Query Frame = 1
Query:   97 VFEPVFEKLEQKSLSHTHTLKQSFAKVEQQYPGFSQNFLIGILNKLGLENEVDMSETFLRMASMAETGVVRNMRKQIYNILESKAHTLKEILSRIPDEISDRRSFLDTIREIAGAIKNLLDCVSEVITHLPTDNHKTSLEQAKRDFVKYSKRFSNTLKAFFRDNRPSEVYASANLLVNQTNMILLVVRDAA 669
            V  PVF +LE+ +LS   TL+ +F K E++ PG +Q+ ++ IL K  +E  V+ +E+ LRMA+      +    +  +  L  KA  LK+ILS+IPDEI+DR  FL TI++IA AIK LLD V+ V       N + +LE  K++FVKYSK FS+TLK +F+D +   V+ SAN L++QTN+IL   +  A
Sbjct:   25 VMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVE--VNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRR-ALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA 212          
BLAST of Programmed cell death protein 10 vs. Ensembl Celegans
Match: ccm-3 (Programmed cell death protein 10 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q17958])

HSP 1 Score: 115.546 bits (288), Expect = 9.281e-30
Identity = 75/213 (35.21%), Postives = 119/213 (55.87%), Query Frame = 1
Query:   55 NGENNVYHKLATPMVFEPVFEKLEQK---------SLSHTHTLKQSFAKVEQQYPGFSQNFLIGILNKLGLENEVDMSETFLRMASMAETG--VVRNMRKQI-YNILESKAHTLKEILSRIPDEISDRRSFLDTIREIAGAIKNLLDCVSEVITHLPTDNHKTSLEQAKRDFVKYSKRFSNTLKAFFRDNRPSEVYASANLLVNQTNMILLVV 657
            N E      +    ++ PV EK++Q+         +L+  HT   +    EQ  P F  +F   +L+   L   V++ E++LRM   + T   +V    +   Y  L  +A  L+ +LSR+P+E+SDR +FL+TI+ IA +IK LL+ ++ V   +P    + ++E+ KR+FV YSKRFSNTLK +F+D   ++V  SAN LV QT MI+  +
Sbjct:    2 NEEGGYLGAMTYQCLYSPVMEKIKQQHRDDPRASLALNKLHT---ALTTCEQASPSFLYDFTKVLLDDSELS--VNLQESYLRMHDTSPTNDLIVSGYEQNADYKELTKRAIELRRVLSRVPEEMSDRHAFLETIKLIASSIKKLLEAINAVYRIVPL-TAQPAVEKRKREFVHYSKRFSNTLKTYFKDQNANQVSVSANQLVFQTTMIVRTI 208          
BLAST of Programmed cell death protein 10 vs. Ensembl Fly
Match: Ccm3 (gene:FBgn0038331 transcript:FBtr0083094)

HSP 1 Score: 151.369 bits (381), Expect = 3.863e-43
Identity = 80/199 (40.20%), Postives = 127/199 (63.82%), Query Frame = 1
Query:   82 LATPMVFEPVFEKLEQKSLSHTHTLKQSFAKVEQQYPGFSQNFLIGILNKLGLENEVDMSETFLRM------ASMAETGVVRNMRKQIYNILESKAHTLKEILSRIPDEISDRRSFLDTIREIAGAIKNLLDCVSEVITHLPTDNHKTSLEQAKRDFVKYSKRFSNTLKAFFRDNRPSEVYASANLLVNQTNMILLVVR 660
            L  P++  P+F +LE++ +    +L+ +  K EQ  PGF  + +  I+ +  L   V+++E  LR+      A + E  + R   ++ +  L  K+  LK ILSRIPDEI+DR++FL+TI+EIA AIK LLD V+E+ + +P    K ++EQ K++FVKYSK+FS TLK +F++ +P+ V+ SA  L+ QTN I+L V+
Sbjct:   10 LVLPVILRPIFSQLERRDVGAAQSLRSAILKSEQNNPGFCYDLVATIVRRADLN--VNLNEAVLRLQGKITEADLNEYRLTRT--EEPFQELNRKSVALKVILSRIPDEINDRKTFLETIKEIASAIKKLLDVVNEIGSFIPGVTGKQAVEQRKKEFVKYSKKFSTTLKEYFKEGQPNAVFISALFLIRQTNQIMLTVK 204          
BLAST of Programmed cell death protein 10 vs. Ensembl Zebrafish
Match: pdcd10a (programmed cell death 10a [Source:NCBI gene;Acc:393527])

HSP 1 Score: 148.288 bits (373), Expect = 6.685e-42
Identity = 84/193 (43.52%), Postives = 125/193 (64.77%), Query Frame = 1
Query:   97 VFEPVFEKLEQKSLSHTHTLKQSFAKVEQQYPGFSQNFLIGILNKLGLENEVDMSETFLRMAS--MAETGVVRNMRKQIYNILESKAHTLKEILSRIPDEISDRRSFLDTIREIAGAIKNLLDCVSEVITHLPTDNHKTSLEQAKRDFVKYSKRFSNTLKAFFRDNRPSEVYASANLLVNQTNMILLVVRDAA 669
            V  PVF +LE  +LS   TL+ +F K E++ PG +Q+ ++ IL K  +E  ++ +E+ LRMA+  + E  + R  R+  +  L  +A  LK+ILS+IPDEI+DR  FL TI++IA AIK LLD V+ V       N + +LE  K++FVK+SK FS+TLK +F+D +   V+ASAN L++QTN+IL   +  A
Sbjct:   23 VMYPVFNELESVNLSAAQTLRAAFKKAEKENPGLTQDIIMKILEKKNVE--INFTESLLRMAADDVEEYMIDRPERE--FQDLNERARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRR-ALEHQKKEFVKHSKSFSDTLKTYFKDGKAINVFASANRLIHQTNLILQTFKTVA 210          
BLAST of Programmed cell death protein 10 vs. Ensembl Zebrafish
Match: pdcd10a (programmed cell death 10a [Source:NCBI gene;Acc:393527])

HSP 1 Score: 148.288 bits (373), Expect = 6.685e-42
Identity = 84/193 (43.52%), Postives = 125/193 (64.77%), Query Frame = 1
Query:   97 VFEPVFEKLEQKSLSHTHTLKQSFAKVEQQYPGFSQNFLIGILNKLGLENEVDMSETFLRMAS--MAETGVVRNMRKQIYNILESKAHTLKEILSRIPDEISDRRSFLDTIREIAGAIKNLLDCVSEVITHLPTDNHKTSLEQAKRDFVKYSKRFSNTLKAFFRDNRPSEVYASANLLVNQTNMILLVVRDAA 669
            V  PVF +LE  +LS   TL+ +F K E++ PG +Q+ ++ IL K  +E  ++ +E+ LRMA+  + E  + R  R+  +  L  +A  LK+ILS+IPDEI+DR  FL TI++IA AIK LLD V+ V       N + +LE  K++FVK+SK FS+TLK +F+D +   V+ASAN L++QTN+IL   +  A
Sbjct:   23 VMYPVFNELESVNLSAAQTLRAAFKKAEKENPGLTQDIIMKILEKKNVE--INFTESLLRMAADDVEEYMIDRPERE--FQDLNERARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRR-ALEHQKKEFVKHSKSFSDTLKTYFKDGKAINVFASANRLIHQTNLILQTFKTVA 210          
BLAST of Programmed cell death protein 10 vs. Ensembl Zebrafish
Match: pdcd10a (programmed cell death 10a [Source:NCBI gene;Acc:393527])

HSP 1 Score: 148.288 bits (373), Expect = 6.685e-42
Identity = 84/193 (43.52%), Postives = 125/193 (64.77%), Query Frame = 1
Query:   97 VFEPVFEKLEQKSLSHTHTLKQSFAKVEQQYPGFSQNFLIGILNKLGLENEVDMSETFLRMAS--MAETGVVRNMRKQIYNILESKAHTLKEILSRIPDEISDRRSFLDTIREIAGAIKNLLDCVSEVITHLPTDNHKTSLEQAKRDFVKYSKRFSNTLKAFFRDNRPSEVYASANLLVNQTNMILLVVRDAA 669
            V  PVF +LE  +LS   TL+ +F K E++ PG +Q+ ++ IL K  +E  ++ +E+ LRMA+  + E  + R  R+  +  L  +A  LK+ILS+IPDEI+DR  FL TI++IA AIK LLD V+ V       N + +LE  K++FVK+SK FS+TLK +F+D +   V+ASAN L++QTN+IL   +  A
Sbjct:   23 VMYPVFNELESVNLSAAQTLRAAFKKAEKENPGLTQDIIMKILEKKNVE--INFTESLLRMAADDVEEYMIDRPERE--FQDLNERARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRR-ALEHQKKEFVKHSKSFSDTLKTYFKDGKAINVFASANRLIHQTNLILQTFKTVA 210          
BLAST of Programmed cell death protein 10 vs. Ensembl Zebrafish
Match: pdcd10b (programmed cell death 10b [Source:NCBI gene;Acc:405869])

HSP 1 Score: 143.28 bits (360), Expect = 6.631e-40
Identity = 81/191 (42.41%), Postives = 119/191 (62.30%), Query Frame = 1
Query:   97 VFEPVFEKLEQKSLSHTHTLKQSFAKVEQQYPGFSQNFLIGILNKLGLENEVDMSETFLRMASMAETGVVRNMRKQIYNILESKAHTLKEILSRIPDEISDRRSFLDTIREIAGAIKNLLDCVSEVITHLPTDNHKTSLEQAKRDFVKYSKRFSNTLKAFFRDNRPSEVYASANLLVNQTNMILLVVRDAA 669
            V  PVF +L + + S   TL+ +F K E++ PG +Q+ ++ IL K  +E  ++ +E+ LRMA+      +    +Q +  L  KA  LK ILS+IPDEI+DR  FL TI++IA AIK LLD V+ V       N + +LE  K++FVKYSK FS+TLK +F+D +   V+ SAN L++QTN+IL   +  A
Sbjct:   23 VMYPVFNELGRINPSAAQTLRAAFVKAEKENPGLTQDIIMKILEKKNVE--INFTESLLRMAADDVEEYMIKRPEQEFQDLNEKARALKHILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFRKYQYQNRR-ALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFISANRLIHQTNLILQTFKTVA 210          
BLAST of Programmed cell death protein 10 vs. Ensembl Xenopus
Match: casd1 (CAS1 domain containing 1 [Source:Xenbase;Acc:XB-GENE-994775])

HSP 1 Score: 139.813 bits (351), Expect = 1.629e-38
Identity = 81/184 (44.02%), Postives = 116/184 (63.04%), Query Frame = 1
Query:   97 VFEPVFEKLEQKSLSHTHTLKQSFAKVEQQYPGFSQNFLIGILNKLGLENEVDMSETFLRMASMAETGVVRNMRKQIYNILESKAHTLKEILSRIPDEISDRRSFLDTIREIAGAIKNLLDCVSEVITHLPTDNHKTSLEQAKRDFVKYSKRFSNTLKAFFRDNRPSEVYASANLLVNQTNMIL 648
            V  PVF +LE  +LS   TL+ +F K E++ PG +Q+ +  IL K  +E  V+ +E+ LRMA+      +    +  +  L  KA  LK+ILS+IPDEI+DR  FL TI++IA AIK LLD V+ V       N + +LE  K++FVKYSK FS+TLK +F+D +   V+ SA  L++QTN+IL
Sbjct:   25 VMYPVFNELEHVNLSAAQTLRAAFIKAEKENPGLTQDIITKILEKKSVE--VNFTESLLRMAADDVEEYMVERPEPEFQELNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRR-ALEHQKKEFVKYSKSFSDTLKTYFKDGKALNVFISAR-LIHQTNLIL 204          
BLAST of Programmed cell death protein 10 vs. Ensembl Xenopus
Match: casd1 (CAS1 domain containing 1 [Source:Xenbase;Acc:XB-GENE-994775])

HSP 1 Score: 131.339 bits (329), Expect = 1.446e-35
Identity = 75/173 (43.35%), Postives = 107/173 (61.85%), Query Frame = 1
Query:   97 VFEPVFEKLEQKSLSHTHTLKQSFAKVEQQYPGFSQNFLIGILNKLGLENEVDMSETFLRMASMAETGVVRNMRKQIYNILESKAHTLKEILSRIPDEISDRRSFLDTIREIAGAIKNLLDCVSEVITHLPTDNHKTSLEQAKRDFVKYSKRFSNTLKAFFRDNRPSEVYASA 615
            V  PVF +LE  +LS   TL+ +F K E++ PG +Q+ +  IL K  +E  V+ +E+ LRMA+      +    +  +  L  KA  LK+ILS+IPDEI+DR  FL TI++IA AIK LLD V+ V       N + +LE  K++FVKYSK FS+TLK +F+D +   V+ SA
Sbjct:   25 VMYPVFNELEHVNLSAAQTLRAAFIKAEKENPGLTQDIITKILEKKSVE--VNFTESLLRMAADDVEEYMVERPEPEFQELNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRR-ALEHQKKEFVKYSKSFSDTLKTYFKDGKALNVFISA 194          
BLAST of Programmed cell death protein 10 vs. Ensembl Mouse
Match: Pdcd10 (programmed cell death 10 [Source:MGI Symbol;Acc:MGI:1928396])

HSP 1 Score: 147.517 bits (371), Expect = 1.592e-41
Identity = 83/191 (43.46%), Postives = 121/191 (63.35%), Query Frame = 1
Query:   97 VFEPVFEKLEQKSLSHTHTLKQSFAKVEQQYPGFSQNFLIGILNKLGLENEVDMSETFLRMASMAETGVVRNMRKQIYNILESKAHTLKEILSRIPDEISDRRSFLDTIREIAGAIKNLLDCVSEVITHLPTDNHKTSLEQAKRDFVKYSKRFSNTLKAFFRDNRPSEVYASANLLVNQTNMILLVVRDAA 669
            V  PVF +LE+ +LS   TL+ +F K E++ PG +Q+ ++ IL K  +E  V+ +E+ LRMA+      +    +  +  L  KA  LK+ILS+IPDEI+DR  FL TI++IA AIK LLD V+ V       N + +LE  K++FVKYSK FS+TLK +F+D +   V+ SAN L++QTN+IL   +  A
Sbjct:   25 VMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVE--VNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRR-ALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFISANRLIHQTNLILQTFKTVA 212          
BLAST of Programmed cell death protein 10 vs. Ensembl Mouse
Match: Pdcd10 (programmed cell death 10 [Source:MGI Symbol;Acc:MGI:1928396])

HSP 1 Score: 114.775 bits (286), Expect = 5.234e-30
Identity = 64/141 (45.39%), Postives = 90/141 (63.83%), Query Frame = 1
Query:  247 EVDMSETFLRMASMAETGVVRNMRKQIYNILESKAHTLKEILSRIPDEISDRRSFLDTIREIAGAIKNLLDCVSEVITHLPTDNHKTSLEQAKRDFVKYSKRFSNTLKAFFRDNRPSEVYASANLLVNQTNMILLVVRDAA 669
            EV+ +E+ LRMA+      +    +  +  L  KA  LK+ILS+IPDEI+DR  FL TI++IA AIK LLD V+ V       N + +LE  K++FVKYSK FS+TLK +F+D +   V+ SAN L++QTN+IL   +  A
Sbjct:   10 EVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRR-ALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFISANRLIHQTNLILQTFKTVA 149          
BLAST of Programmed cell death protein 10 vs. UniProt/SwissProt
Match: sp|Q6PHH3|PD10A_DANRE (Programmed cell death protein 10-A OS=Danio rerio OX=7955 GN=pdcd10a PE=1 SV=2)

HSP 1 Score: 148.288 bits (373), Expect = 5.046e-41
Identity = 84/193 (43.52%), Postives = 125/193 (64.77%), Query Frame = 1
Query:   97 VFEPVFEKLEQKSLSHTHTLKQSFAKVEQQYPGFSQNFLIGILNKLGLENEVDMSETFLRMAS--MAETGVVRNMRKQIYNILESKAHTLKEILSRIPDEISDRRSFLDTIREIAGAIKNLLDCVSEVITHLPTDNHKTSLEQAKRDFVKYSKRFSNTLKAFFRDNRPSEVYASANLLVNQTNMILLVVRDAA 669
            V  PVF +LE  +LS   TL+ +F K E++ PG +Q+ ++ IL K  +E  ++ +E+ LRMA+  + E  + R  R+  +  L  +A  LK+ILS+IPDEI+DR  FL TI++IA AIK LLD V+ V       N + +LE  K++FVK+SK FS+TLK +F+D +   V+ASAN L++QTN+IL   +  A
Sbjct:   23 VMYPVFNELESVNLSAAQTLRAAFKKAEKENPGLTQDIIMKILEKKNVE--INFTESLLRMAADDVEEYMIDRPERE--FQDLNERARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRR-ALEHQKKEFVKHSKSFSDTLKTYFKDGKAINVFASANRLIHQTNLILQTFKTVA 210          
BLAST of Programmed cell death protein 10 vs. UniProt/SwissProt
Match: sp|Q9BUL8|PDC10_HUMAN (Programmed cell death protein 10 OS=Homo sapiens OX=9606 GN=PDCD10 PE=1 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 7.244e-41
Identity = 83/191 (43.46%), Postives = 121/191 (63.35%), Query Frame = 1
Query:   97 VFEPVFEKLEQKSLSHTHTLKQSFAKVEQQYPGFSQNFLIGILNKLGLENEVDMSETFLRMASMAETGVVRNMRKQIYNILESKAHTLKEILSRIPDEISDRRSFLDTIREIAGAIKNLLDCVSEVITHLPTDNHKTSLEQAKRDFVKYSKRFSNTLKAFFRDNRPSEVYASANLLVNQTNMILLVVRDAA 669
            V  PVF +LE+ +LS   TL+ +F K E++ PG +Q+ ++ IL K  +E  V+ +E+ LRMA+      +    +  +  L  KA  LK+ILS+IPDEI+DR  FL TI++IA AIK LLD V+ V       N + +LE  K++FVKYSK FS+TLK +F+D +   V+ SAN L++QTN+IL   +  A
Sbjct:   25 VMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVE--VNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRR-ALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA 212          
BLAST of Programmed cell death protein 10 vs. UniProt/SwissProt
Match: sp|Q6NX65|PDC10_RAT (Programmed cell death protein 10 OS=Rattus norvegicus OX=10116 GN=Pdcd10 PE=2 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 9.668e-41
Identity = 83/191 (43.46%), Postives = 121/191 (63.35%), Query Frame = 1
Query:   97 VFEPVFEKLEQKSLSHTHTLKQSFAKVEQQYPGFSQNFLIGILNKLGLENEVDMSETFLRMASMAETGVVRNMRKQIYNILESKAHTLKEILSRIPDEISDRRSFLDTIREIAGAIKNLLDCVSEVITHLPTDNHKTSLEQAKRDFVKYSKRFSNTLKAFFRDNRPSEVYASANLLVNQTNMILLVVRDAA 669
            V  PVF +LE+ +LS   TL+ +F K E++ PG +Q+ ++ IL K  +E  V+ +E+ LRMA+      +    +  +  L  KA  LK+ILS+IPDEI+DR  FL TI++IA AIK LLD V+ V       N + +LE  K++FVKYSK FS+TLK +F+D +   V+ SAN L++QTN+IL   +  A
Sbjct:   23 VMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVE--VNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRR-ALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFISANRLIHQTNLILQTFKTVA 210          
BLAST of Programmed cell death protein 10 vs. UniProt/SwissProt
Match: sp|Q8VE70|PDC10_MOUSE (Programmed cell death protein 10 OS=Mus musculus OX=10090 GN=Pdcd10 PE=1 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 1.113e-40
Identity = 83/191 (43.46%), Postives = 121/191 (63.35%), Query Frame = 1
Query:   97 VFEPVFEKLEQKSLSHTHTLKQSFAKVEQQYPGFSQNFLIGILNKLGLENEVDMSETFLRMASMAETGVVRNMRKQIYNILESKAHTLKEILSRIPDEISDRRSFLDTIREIAGAIKNLLDCVSEVITHLPTDNHKTSLEQAKRDFVKYSKRFSNTLKAFFRDNRPSEVYASANLLVNQTNMILLVVRDAA 669
            V  PVF +LE+ +LS   TL+ +F K E++ PG +Q+ ++ IL K  +E  V+ +E+ LRMA+      +    +  +  L  KA  LK+ILS+IPDEI+DR  FL TI++IA AIK LLD V+ V       N + +LE  K++FVKYSK FS+TLK +F+D +   V+ SAN L++QTN+IL   +  A
Sbjct:   25 VMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVE--VNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRR-ALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFISANRLIHQTNLILQTFKTVA 212          
BLAST of Programmed cell death protein 10 vs. UniProt/SwissProt
Match: sp|Q8AVR4|PDC10_XENLA (Programmed cell death protein 10 OS=Xenopus laevis OX=8355 GN=pdcd10 PE=2 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 1.784e-40
Identity = 83/191 (43.46%), Postives = 120/191 (62.83%), Query Frame = 1
Query:   97 VFEPVFEKLEQKSLSHTHTLKQSFAKVEQQYPGFSQNFLIGILNKLGLENEVDMSETFLRMASMAETGVVRNMRKQIYNILESKAHTLKEILSRIPDEISDRRSFLDTIREIAGAIKNLLDCVSEVITHLPTDNHKTSLEQAKRDFVKYSKRFSNTLKAFFRDNRPSEVYASANLLVNQTNMILLVVRDAA 669
            V  PVF +LE+ +LS   TL+ +F K E++ PG +Q+ +  IL K  +E  V+ +E+ LRMA+      +    +  +  L  KA  LK+ILS+IPDEI+DR  FL TI++IA AIK LLD V+ V       N + +LE  K++FVKYSK FS+TLK +F+D +   V+ SAN L++QTN+IL   +  A
Sbjct:   25 VMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIITKILEKKSVE--VNFTESLLRMAADDVEEYMVERPEPEFQELNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRR-ALEHQKKEFVKYSKSFSDTLKTYFKDGKALNVFISANRLIHQTNLILQTFKTVA 212          
BLAST of Programmed cell death protein 10 vs. TrEMBL
Match: A0A4S2LPB4 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005822 PE=4 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 6.026e-56
Identity = 94/189 (49.74%), Postives = 134/189 (70.90%), Query Frame = 1
Query:   94 MVFEPVFEKLEQKSLSHTHTLKQSFAKVEQQYPGFSQNFLIGILNKLGLENEVDMSETFLRMASMAETGVVRNMRKQIYNILESKAHTLKEILSRIPDEISDRRSFLDTIREIAGAIKNLLDCVSEVITHLPTDNHKTSLEQAKRDFVKYSKRFSNTLKAFFRDNRPSEVYASANLLVNQTNMILLVVR 660
            +VFEP F K+E+   + T  LK++F+KVE++ PGFSQ F+IG+L +LG+E EVD+SE  LR+A   E GV R+ R+   + +E+KA  LK  LS IPD+ISDRRSF++ I+ IA AIK +LD V++V+  L     + +L++ KR F+ Y ++FS TLKA+F+DN    VY SAN LVNQ N+ LL++R
Sbjct:   25 VVFEPTFTKMEEIDYASTKRLKEAFSKVEKRCPGFSQEFIIGLLQRLGVEKEVDLSELSLRLAGFQEGGVHRSSRRPYLSEIEAKAQVLKASLSSIPDKISDRRSFIELIKVIANAIKQVLDAVTQVLDALQHSTQRQALDEQKRSFLHYCRQFSATLKAYFKDNNQQAVYNSANRLVNQANLTLLIIR 213          
BLAST of Programmed cell death protein 10 vs. TrEMBL
Match: H2KTN8 (Programmed cell death protein 10 OS=Clonorchis sinensis OX=79923 GN=pdcd10 PE=4 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 7.624e-56
Identity = 94/189 (49.74%), Postives = 134/189 (70.90%), Query Frame = 1
Query:   94 MVFEPVFEKLEQKSLSHTHTLKQSFAKVEQQYPGFSQNFLIGILNKLGLENEVDMSETFLRMASMAETGVVRNMRKQIYNILESKAHTLKEILSRIPDEISDRRSFLDTIREIAGAIKNLLDCVSEVITHLPTDNHKTSLEQAKRDFVKYSKRFSNTLKAFFRDNRPSEVYASANLLVNQTNMILLVVR 660
            +VFEP F K+E+   + T  LK++F+KVE++ PGFSQ F+IG+L +LG+E EVD+SE  LR+A   E GV R+ R+   + +E+KA  LK  LS IPD+ISDRRSF++ I+ IA AIK +LD V++V+  L     + +L++ KR F+ Y ++FS TLKA+F+DN    VY SAN LVNQ N+ LL++R
Sbjct:   25 VVFEPTFTKMEEIDYAATKRLKEAFSKVEKRCPGFSQEFIIGLLQRLGVEKEVDLSELSLRLAGFQEGGVHRSSRRPYLSEIEAKAQVLKASLSTIPDKISDRRSFIELIKVIANAIKQVLDAVTQVLDALQHSTQRQALDEQKRSFLHYCRQFSATLKAYFKDNNQQAVYNSANRLVNQANLTLLIIR 213          
BLAST of Programmed cell death protein 10 vs. TrEMBL
Match: A0A074ZX12 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_01930 PE=4 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 9.143e-56
Identity = 94/189 (49.74%), Postives = 134/189 (70.90%), Query Frame = 1
Query:   94 MVFEPVFEKLEQKSLSHTHTLKQSFAKVEQQYPGFSQNFLIGILNKLGLENEVDMSETFLRMASMAETGVVRNMRKQIYNILESKAHTLKEILSRIPDEISDRRSFLDTIREIAGAIKNLLDCVSEVITHLPTDNHKTSLEQAKRDFVKYSKRFSNTLKAFFRDNRPSEVYASANLLVNQTNMILLVVR 660
            +VFEP F K+E+   + T  LK++F+KVE++ PGFSQ F+IG+L +LG+E EVD+SE  LR+A   E GV R+ R+   + +E+KA  LK  LS IPD+ISDRRSF++ I+ IA AIK +LD V++V+  L     + +L++ KR F+ Y ++FS TLKA+F+DN    VY SAN LVNQ N+ LL++R
Sbjct:   25 VVFEPTFTKMEEIDYTATKRLKEAFSKVEKRCPGFSQEFIIGLLQRLGVEKEVDLSELSLRLAGFQEGGVHRSSRRPYLSEIEAKAQVLKASLSTIPDKISDRRSFIELIKVIANAIKQVLDAVTQVLDALQHSTQRQALDEQKRSFLHYCRQFSATLKAYFKDNNQQAVYNSANRLVNQANLTLLIIR 213          
BLAST of Programmed cell death protein 10 vs. TrEMBL
Match: Q5D8L4 (Programmed cell death protein 10 OS=Schistosoma japonicum OX=6182 GN=EWB00_008161 PE=2 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 3.369e-55
Identity = 94/193 (48.70%), Postives = 135/193 (69.95%), Query Frame = 1
Query:   85 ATPMVFEPVFEKLEQKSLSHTHTLKQSFAKVEQQYPGFSQNFLIGILNKLGLENEVDMSETFLRMASMAETGVVRNMRKQIYNILESKAHTLKEILSRIPDEISDRRSFLDTIREIAGAIKNLLDCVSEVITHLPTDNHKTSLEQAKRDFVKYSKRFSNTLKAFFRDNRPSEVYASANLLVNQTNMILLVVRD 663
            A  ++FEP F K+E+++ S T  LK++F KVE++YPGFS++F++G+L ++G+++E+D++ET LR+A++ E    R  R      LE  A TLK ILS IPDEI+DRR+F++ I+ IA AIK LL  V      LP    K  LE  KR F+ Y ++FS+TLK +FR+N  + V++SANLLVNQTN+IL VV D
Sbjct:   22 AKQVIFEPTFAKMEKENYSLTQRLKEAFYKVEKRYPGFSKDFMVGLLQRMGVDSEIDVTETCLRIAALQECDNPRTSRNPRVLELELTAKTLKTILSSIPDEITDRRAFIEVIKGIADAIKMLLAAVGAFYDALPPGTQKKCLEDQKRKFITYCRKFSDTLKQYFRNNDQTVVFSSANLLVNQTNLILFVVHD 214          
BLAST of Programmed cell death protein 10 vs. TrEMBL
Match: A0A183KXJ1 (Uncharacterized protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS19788 PE=4 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 1.132e-53
Identity = 93/193 (48.19%), Postives = 134/193 (69.43%), Query Frame = 1
Query:   85 ATPMVFEPVFEKLEQKSLSHTHTLKQSFAKVEQQYPGFSQNFLIGILNKLGLENEVDMSETFLRMASMAETGVVRNMRKQIYNILESKAHTLKEILSRIPDEISDRRSFLDTIREIAGAIKNLLDCVSEVITHLPTDNHKTSLEQAKRDFVKYSKRFSNTLKAFFRDNRPSEVYASANLLVNQTNMILLVVRD 663
            A  ++FEP F K+E+++ + T  LK++F KVE++YPGFS++F+IG+L ++G+++E+D++ET LR+A++ E    R  R      LE  A TLK ILS IPDEI DRR+F++ I+ IA AIK LL  V      LP    K  LE  KR F+ Y ++FS+TLK +FR+N  + V++SANLLV+QTN+IL VV D
Sbjct:   22 AKQVIFEPTFAKMEKENYALTQRLKEAFYKVEKRYPGFSKDFMIGLLQRMGVDSEIDVTETCLRIAALQECDNPRTSRNPRVLELELTAKTLKTILSSIPDEIIDRRAFIEVIKGIADAIKMLLAAVGAFYDTLPPGTQKKCLEDQKRKFITYCRKFSDTLKQYFRNNDQTVVFSSANLLVSQTNLILFVVHD 214          
BLAST of Programmed cell death protein 10 vs. Ensembl Cavefish
Match: pdcd10b (programmed cell death 10 [Source:NCBI gene;Acc:103039132])

HSP 1 Score: 150.214 bits (378), Expect = 1.161e-42
Identity = 83/191 (43.46%), Postives = 122/191 (63.87%), Query Frame = 1
Query:   97 VFEPVFEKLEQKSLSHTHTLKQSFAKVEQQYPGFSQNFLIGILNKLGLENEVDMSETFLRMASMAETGVVRNMRKQIYNILESKAHTLKEILSRIPDEISDRRSFLDTIREIAGAIKNLLDCVSEVITHLPTDNHKTSLEQAKRDFVKYSKRFSNTLKAFFRDNRPSEVYASANLLVNQTNMILLVVRDAA 669
            V  PVF +LE+ +LS   TL+ +F K E++ PG +Q+ ++ IL K  +E  ++ +E+ LRMA+      +    +Q +  L  KA  LK+ILS+IPDEI+DR  FL TI++IA AIK LLD V+ V       N + +LE  K++FVKYSK FS+TLK +F+D +   V+ SAN L++QTN+IL   +  A
Sbjct:   23 VMYPVFNELERINLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKNME--INFTESLLRMAADDVEEYMIKRPEQEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRR-ALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFISANRLIHQTNLILQTFKTVA 210          
BLAST of Programmed cell death protein 10 vs. Ensembl Cavefish
Match: pdcd10a (programmed cell death protein 10 [Source:NCBI gene;Acc:103036474])

HSP 1 Score: 148.288 bits (373), Expect = 5.606e-42
Identity = 84/193 (43.52%), Postives = 124/193 (64.25%), Query Frame = 1
Query:   97 VFEPVFEKLEQKSLSHTHTLKQSFAKVEQQYPGFSQNFLIGILNKLGLENEVDMSETFLRMAS--MAETGVVRNMRKQIYNILESKAHTLKEILSRIPDEISDRRSFLDTIREIAGAIKNLLDCVSEVITHLPTDNHKTSLEQAKRDFVKYSKRFSNTLKAFFRDNRPSEVYASANLLVNQTNMILLVVRDAA 669
            V  PVF +LE+ +LS   TL+ +F K E++ PG +Q  ++ IL K  +E  ++ +E+ LRMA+  + E  + R  R+  +  L  +A  LK+ILS+IPDEI+DR  FL TI++IA AIK LLD V+ V       N + +LE  K++FVKYSK FS+TLK +F+D +   V+ SAN L++QTN+IL   +  A
Sbjct:   23 VMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQEIILKILEKKNVE--INFTESLLRMAADDVKEYMIERPERE--FQDLNERARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRR-ALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFISANRLIHQTNLILQTFKTVA 210          
BLAST of Programmed cell death protein 10 vs. Ensembl Sea Lamprey
Match: pdcd10a (programmed cell death 10a [Source:NCBI gene;Acc:393527])

HSP 1 Score: 118.627 bits (296), Expect = 7.282e-32
Identity = 65/165 (39.39%), Postives = 97/165 (58.79%), Query Frame = 1
Query:  154 LKQSFAKVEQQYPGFSQNFLIGILNKLGLENEVDMSETFLRMASMAETGVVRNMRKQIYNILESKAHTLKEILSRIPDEISDRRSFLDTIREIAGAIKNLLDCVSEVITHLPTDNHKTSLEQAKRDFVKYSKRFSNTLKAFFRDNRPSEVYASANLLVNQTNMIL 648
            L+ +F K E   PG ++  ++G+L +  +   +D  E  LRM             +  +  L +KA +LK ILS+IPDE+SDR  FL TI+  A AI+ LLD V+ V    P  N++ +LE  K++FV +SK FS+ LK +F+D + + V+ SA+ LV QTN IL
Sbjct:   12 LRDAFTKAESLSPGLTEELVLGVLQRQAVN--LDFPEVLLRMTRQNLDDCSIKRPEPEFQDLNNKARSLKLILSKIPDEMSDRTQFLQTIKHTASAIRELLDSVNLVFRKYPNQNNRRALENQKKEFVVHSKSFSDALKTYFKDGKSASVHESASRLVYQTNAIL 174          
BLAST of Programmed cell death protein 10 vs. Ensembl Nematostella
Match: EDO34838 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN69])

HSP 1 Score: 131.339 bits (329), Expect = 5.376e-36
Identity = 78/201 (38.81%), Postives = 116/201 (57.71%), Query Frame = 1
Query:   82 LATPMVFEPVFEKLEQKSLSHT-HTLKQSFAKVEQQYPGFSQNFLIGILNKLGLENEVDMSETFLRMASMAETGVVRNMRKQIYNILESKAHTLKEILSRIPDEISDRRSFLDTIREIAGAIKNLLDCVSEVITHLPT----DNHKTSLEQAKRDFVKYSKRFSNTLKAFFRDNRPSEVYASANLLVNQTNMILLVVRDAA 669
            LA  ++  PV ++L ++    T   ++++F + E++ PG +Q  + GI+ K    + ++M++  L  A         N  +  +  L  KA  LK ILS+IP EI+DR  FL TI++IA AIK LLD V+EV  +  T      +K  LE  K++FVKYSK FS+TLK +F+D +   VY SAN L+NQTN IL   + A 
Sbjct:   14 LALSVIIRPVLDELSKEYDEDTVKKIQKAFHQAEKENPGITQELVSGIMKKES--DGINMNKALLSCAGYNTDEYNTNREEHEFVNLTKKARDLKTILSKIPSEINDRSKFLQTIKDIASAIKELLDAVNEVFKNCQTVGKMQQYKKVLEHNKKEFVKYSKSFSDTLKQYFKDGKADAVYVSANRLINQTNNILYTFKLAG 212          
BLAST of Programmed cell death protein 10 vs. Ensembl Nematostella
Match: EDO29041 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4S4])

HSP 1 Score: 81.2629 bits (199), Expect = 5.279e-19
Identity = 43/91 (47.25%), Postives = 56/91 (61.54%), Query Frame = 1
Query:  409 FLDTIREIAGAIKNLLDCVSEVITHLPT----DNHKTSLEQAKRDFVKYSKRFSNTLKAFFRDNRPSEVYASANLLVNQTNMILLVVRDAA 669
            +    R+IA AIK LLD V+EV  +  T      +K  LE  K++FVKYSK FS+TLK +F+D +   VY SAN L+NQTN IL   + A 
Sbjct:    2 YFRIYRDIASAIKELLDAVNEVFKNCQTVGKMQQYKKVLEHNKKEFVKYSKSFSDTLKQYFKDGKADAVYVSANRLINQTNNILYTFKLAG 92          
BLAST of Programmed cell death protein 10 vs. Ensembl Medaka
Match: pdcd10b (programmed cell death 10 [Source:NCBI gene;Acc:101168412])

HSP 1 Score: 147.132 bits (370), Expect = 1.447e-41
Identity = 85/204 (41.67%), Postives = 125/204 (61.27%), Query Frame = 1
Query:   58 GENNVYHKLATPMVFEPVFEKLEQKSLSHTHTLKQSFAKVEQQYPGFSQNFLIGILNKLGLENEVDMSETFLRMASMAETGVVRNMRKQIYNILESKAHTLKEILSRIPDEISDRRSFLDTIREIAGAIKNLLDCVSEVITHLPTDNHKTSLEQAKRDFVKYSKRFSNTLKAFFRDNRPSEVYASANLLVNQTNMILLVVRDAA 669
             E N    +    V  PVF +LE+ + S   TL+ +F K E++ PG +Q+ ++ IL K  ++  ++ +E+ LRMA+      + +  +Q +  L  KA  LK ILS+IPDEI+DR  FL TI++IA AIK LLD V+ VI      N + +LE  KR+FVKYSK FS+TLK +F+D +   V+ SAN L++QTN+IL   +  A
Sbjct:   10 AETNSMVSMTLYAVMFPVFNELERINPSAAQTLRAAFIKAERENPGLTQDIIMKILEKKNVQ--INFTESLLRMAADDVKEFMIDRPEQEFQDLNEKARALKHILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVIKKYQYQNRR-ALENQKREFVKYSKSFSDTLKIYFKDGKAINVFISANRLIHQTNLILQTFKTVA 210          
BLAST of Programmed cell death protein 10 vs. Planmine SMEST
Match: SMESG000031167.1 (SMESG000031167.1)

HSP 1 Score: 432.95 bits (1112), Expect = 3.629e-153
Identity = 209/209 (100.00%), Postives = 209/209 (100.00%), Query Frame = 1
Query:   43 MSNSNGENNVYHKLATPMVFEPVFEKLEQKSLSHTHTLKQSFAKVEQQYPGFSQNFLIGILNKLGLENEVDMSETFLRMASMAETGVVRNMRKQIYNILESKAHTLKEILSRIPDEISDRRSFLDTIREIAGAIKNLLDCVSEVITHLPTDNHKTSLEQAKRDFVKYSKRFSNTLKAFFRDNRPSEVYASANLLVNQTNMILLVVRDAA 669
            MSNSNGENNVYHKLATPMVFEPVFEKLEQKSLSHTHTLKQSFAKVEQQYPGFSQNFLIGILNKLGLENEVDMSETFLRMASMAETGVVRNMRKQIYNILESKAHTLKEILSRIPDEISDRRSFLDTIREIAGAIKNLLDCVSEVITHLPTDNHKTSLEQAKRDFVKYSKRFSNTLKAFFRDNRPSEVYASANLLVNQTNMILLVVRDAA
Sbjct:    1 MSNSNGENNVYHKLATPMVFEPVFEKLEQKSLSHTHTLKQSFAKVEQQYPGFSQNFLIGILNKLGLENEVDMSETFLRMASMAETGVVRNMRKQIYNILESKAHTLKEILSRIPDEISDRRSFLDTIREIAGAIKNLLDCVSEVITHLPTDNHKTSLEQAKRDFVKYSKRFSNTLKAFFRDNRPSEVYASANLLVNQTNMILLVVRDAA 209          
The following BLAST results are available for this feature:
BLAST of Programmed cell death protein 10 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PDCD101.509e-4143.46programmed cell death 10 [Source:HGNC Symbol;Acc:H... [more]
PDCD101.509e-4143.46programmed cell death 10 [Source:HGNC Symbol;Acc:H... [more]
PDCD101.509e-4143.46programmed cell death 10 [Source:HGNC Symbol;Acc:H... [more]
PDCD101.509e-4143.46programmed cell death 10 [Source:HGNC Symbol;Acc:H... [more]
PDCD101.509e-4143.46programmed cell death 10 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Programmed cell death protein 10 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ccm-39.281e-3035.21Programmed cell death protein 10 homolog [Source:... [more]
back to top
BLAST of Programmed cell death protein 10 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ccm33.863e-4340.20gene:FBgn0038331 transcript:FBtr0083094[more]
back to top
BLAST of Programmed cell death protein 10 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
pdcd10a6.685e-4243.52programmed cell death 10a [Source:NCBI gene;Acc:39... [more]
pdcd10a6.685e-4243.52programmed cell death 10a [Source:NCBI gene;Acc:39... [more]
pdcd10a6.685e-4243.52programmed cell death 10a [Source:NCBI gene;Acc:39... [more]
pdcd10b6.631e-4042.41programmed cell death 10b [Source:NCBI gene;Acc:40... [more]
back to top
BLAST of Programmed cell death protein 10 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
casd11.629e-3844.02CAS1 domain containing 1 [Source:Xenbase;Acc:XB-GE... [more]
casd11.446e-3543.35CAS1 domain containing 1 [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of Programmed cell death protein 10 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Pdcd101.592e-4143.46programmed cell death 10 [Source:MGI Symbol;Acc:MG... [more]
Pdcd105.234e-3045.39programmed cell death 10 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Programmed cell death protein 10 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6PHH3|PD10A_DANRE5.046e-4143.52Programmed cell death protein 10-A OS=Danio rerio ... [more]
sp|Q9BUL8|PDC10_HUMAN7.244e-4143.46Programmed cell death protein 10 OS=Homo sapiens O... [more]
sp|Q6NX65|PDC10_RAT9.668e-4143.46Programmed cell death protein 10 OS=Rattus norvegi... [more]
sp|Q8VE70|PDC10_MOUSE1.113e-4043.46Programmed cell death protein 10 OS=Mus musculus O... [more]
sp|Q8AVR4|PDC10_XENLA1.784e-4043.46Programmed cell death protein 10 OS=Xenopus laevis... [more]
back to top
BLAST of Programmed cell death protein 10 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LPB46.026e-5649.74Uncharacterized protein OS=Opisthorchis felineus O... [more]
H2KTN87.624e-5649.74Programmed cell death protein 10 OS=Clonorchis sin... [more]
A0A074ZX129.143e-5649.74Uncharacterized protein OS=Opisthorchis viverrini ... [more]
Q5D8L43.369e-5548.70Programmed cell death protein 10 OS=Schistosoma ja... [more]
A0A183KXJ11.132e-5348.19Uncharacterized protein OS=Schistosoma curassoni O... [more]
back to top
BLAST of Programmed cell death protein 10 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pdcd10b1.161e-4243.46programmed cell death 10 [Source:NCBI gene;Acc:103... [more]
pdcd10a5.606e-4243.52programmed cell death protein 10 [Source:NCBI gene... [more]
back to top
BLAST of Programmed cell death protein 10 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pdcd10a7.282e-3239.39programmed cell death 10a [Source:NCBI gene;Acc:39... [more]
back to top
BLAST of Programmed cell death protein 10 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Programmed cell death protein 10 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO348385.376e-3638.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO290415.279e-1947.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Programmed cell death protein 10 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pdcd10b1.447e-4141.67programmed cell death 10 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Programmed cell death protein 10 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000031167.13.629e-153100.00SMESG000031167.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004991 ID=SMED30004991|Name=Programmed cell death protein 10|organism=Schmidtea mediterranea sexual|type=transcript|length=1317bp
AAATAGGAAAACTTTTAAATTACTTTCACCGCTAAGAATAAAATGAGTAA
TTCAAATGGTGAAAATAATGTTTATCACAAATTAGCTACTCCGATGGTCT
TTGAACCAGTTTTTGAGAAACTCGAACAAAAAAGTCTTAGCCATACTCAT
ACATTAAAACAATCATTTGCAAAAGTCGAACAACAATATCCTGGATTTTC
TCAGAATTTTTTGATTGGGATATTGAATAAGTTGGGGTTAGAAAACGAAG
TCGATATGTCGGAAACGTTTTTACGAATGGCGTCAATGGCGGAAACTGGC
GTGGTTAGAAACATGAGAAAGCAAATTTACAATATACTAGAGAGTAAGGC
TCACACTCTAAAAGAAATTCTCAGTCGAATTCCAGATGAAATAAGTGATC
GGAGAAGTTTCCTTGACACAATTAGAGAAATTGCAGGTGCCATCAAAAAC
CTTTTGGACTGTGTTTCTGAAGTTATTACACATTTACCCACAGATAACCA
TAAAACGAGTTTAGAACAAGCTAAAAGGGATTTTGTAAAATATTCTAAAA
GATTCAGCAACACATTGAAGGCCTTCTTCAGAGATAACCGCCCTTCTGAA
GTCTACGCCAGCGCTAATTTGCTAGTCAATCAAACGAATATGATTTTATT
GGTTGTTCGAGATGCTGCCTGACGGTACAAGAGGTGGTCAAGATTCAGAT
GGGGGTGGCATAAGATAATTTTGACTACCTCAATTATATGTCTACCTATT
AGAACCATATTGTTATGGCCTCTGTATCATTGGCGATCGTATCTCTTTTG
TGTATTCAGTATATTCATCATTGTGTTCAGTTCTCTGTATATATCAGCTA
CTATTAAAAGTTACGTGGAGCCTTTCAGCTCCTACAAAGAAGCTATTGAA
TATCAATCAATGTTGATGCGATATTTTTCAGTTGACCGTTTGGTTAATTT
CCACTTTTATTATTATTTCGCTTAATATTTTTCTGTGGGACAACTTTTAT
AAGTCGTTTTTGTTGTTTTTATAGATGCTGCTAAATGAGGTGTTTACACG
CGCCTATAAATGTGTCTGTTTGTGTCAGTAGATTGGATTGTTTTTTATAT
AAAAATGTTGATTGGTTTGATGATTATAATTTCGTTGTAACAAGAGGTGA
TTTGATTTTATGATAAATTATCTAAAAACTATTTTAATTTTCTATTTGTT
GAACTACTAATTTGTAATAAATTGACATTTAATCGGCTCAGGATTATTTT
ATTTGATATTCGAATGGTATTATTTATTTAAGTTGAATTTACCGCCTGTG
TAAAATCGATTCCAAGG
back to top

protein sequence of SMED30004991-orf-1

>SMED30004991-orf-1 ID=SMED30004991-orf-1|Name=SMED30004991-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=210bp
MSNSNGENNVYHKLATPMVFEPVFEKLEQKSLSHTHTLKQSFAKVEQQYP
GFSQNFLIGILNKLGLENEVDMSETFLRMASMAETGVVRNMRKQIYNILE
SKAHTLKEILSRIPDEISDRRSFLDTIREIAGAIKNLLDCVSEVITHLPT
DNHKTSLEQAKRDFVKYSKRFSNTLKAFFRDNRPSEVYASANLLVNQTNM
ILLVVRDAA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000074oocyte
PLANA:0000101muscle cell
PLANA:0000103central nervous system
PLANA:0000204ovary
PLANA:0000231vitelline gland
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR009652PDCD10
Vocabulary: cellular component
TermDefinition
GO:0000139Golgi membrane
GO:0005737cytoplasm
GO:0005794Golgi apparatus
GO:0005829cytosol
GO:0005886plasma membrane
GO:0016020membrane
GO:0070062extracellular exosome
Vocabulary: biological process
TermDefinition
GO:0001525angiogenesis
GO:0006915apoptotic process
GO:0008284positive regulation of cell proliferation
GO:0010628positive regulation of gene expression
GO:0010629negative regulation of gene expression
GO:0030335positive regulation of cell migration
GO:0032874positive regulation of stress-activated MAPK cascade
GO:0033138positive regulation of peptidyl-serine phosphorylation
GO:0036481intrinsic apoptotic signaling pathway in response to hydrogen peroxide
GO:0042542response to hydrogen peroxide
GO:0043066negative regulation of apoptotic process
GO:0043406positive regulation of MAP kinase activity
GO:0044319wound healing, spreading of cells
GO:0045747positive regulation of Notch signaling pathway
GO:0050821protein stabilization
GO:0051683establishment of Golgi localization
GO:0071902positive regulation of protein serine/threonine kinase activity
GO:0090051negative regulation of cell migration involved in sprouting angiogenesis
GO:0090168Golgi reassembly
GO:1903588negative regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0019901protein kinase binding
GO:0042803protein homodimerization activity
GO:0047485protein N-terminus binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.120.1950coord: 1..209
e-value: 9.8E-71
score: 239.1
NoneNo IPR availablePFAMPF06840DUF1241coord: 12..158
e-value: 2.6E-44
score: 150.5
IPR009652Programmed cell death protein 10PANTHERPTHR13250TF-1 CELL APOPTOSIS RELATED PROTEIN-15coord: 5..208