Kinesin-like protein

Overview
NameKinesin-like protein
Smed IDSMED30004988
Length (bp)2211
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Kinesin-like protein (SMED30004988) t-SNE clustered cells

Violin plots show distribution of expression levels for Kinesin-like protein (SMED30004988) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Kinesin-like protein (SMED30004988) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Kinesin-like protein (SMED30004988) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004988

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30004988SMESG000078501.1 SMESG000018967.1 SmedASXL_017628SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30004988SMESG000078501.1 SMESG000018967.1 SmedASXL_017628SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30004988SMESG000078501.1 SMESG000018967.1 dd_Smed_v4_9585_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30004988SMESG000078501.1 SMESG000018967.1 dd_Smed_v6_9585_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30004988SMESG000078501.1 SMESG000018967.1 dd_Smed_v4_9585_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
testis primordiumSMED30004988SMESG000078501.1 SMESG000018967.1 PL06020A2D07_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
neoblastSMED30004988SMESG000078501.1 SMESG000018967.1 SmWIOct06_004341GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30004988SMESG000078501.1 SMESG000018967.1 SMED_08094_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30004988SMESG000078501.1 SMESG000018967.1 SMED_08094_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30004988SMESG000078501.1 SMESG000018967.1 SmWIOct06_003419GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30004988SMESG000078501.1 SMESG000018967.1 SMED_04385_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30004988SMESG000078501.1 SMESG000018967.1 SMED_04385_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIF23 (kinesin family member 23 [Source:HGNC Symbol;Acc:HGNC:6392])

HSP 1 Score: 287.345 bits (734), Expect = 1.542e-84
Identity = 172/421 (40.86%), Postives = 249/421 (59.14%), Query Frame = 3
Query:   69 NTVEGVCVFCRLKPLNDENIKSCIQYENEFTISAVPPEINRKNT----KEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNFI--KRFLIKPDERNGFKVLGETDALFE------IVSNKNNYSRRSGDHDCVAYMNAISDDPF----EVNKVDNCTVFVSMVEIYGNNIKDLFIG------KREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVK--LNRDKSN----GECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRI 1247
            N  + V V+CR++PL   + + CI+  N  T+    PE  R N     KE +Y+F +VF  + +Q E+F+ VA PLV DL++ +NGLLF YGVTGSGKT++M G     G++ R +  +F  +     KR++ K ++RN   +  E DAL E      + + K + S+R  D +   + + I+   F    EV++     VFVS +EIY N I DL         K +  +   ++EDK  NMY+    EVEV+S  EA   F +G++ RRIA T+LN  SSRSH +FNI+LV+  L+ D  N     E ++++QLSL+DLAGSER  RT A G +L+EAG+IN SLM L++ M+ LR     G+  ++ YR +KLTHL K  F+   KVRMIVCV  K E+Y E L V+ FAE ++E+ +
Sbjct:   21 NLKDPVGVYCRVRPLGFPDQECCIEVINNTTVQLHTPEGYRLNRNGDYKETQYSFKQVFGTHTTQKELFDVVANPLVNDLIHGKNGLLFTYGVTGSGKTHTMTGSPGEGGLLPRCLDMIFNSIGSFQAKRYVFKSNDRNSMDIQCEVDALLERQKREAMPNPKTSSSKRQVDPE---FADMITVQEFCKAEEVDEDSVYGVFVSYIEIYNNYIYDLLEEVPFDPIKPKPPQSKLLREDKNHNMYVAGCTEVEVKSTEEAFEVFWRGQKKRRIANTHLNRESSRSHSVFNIKLVQAPLDADGDNVLQEKEQITISQLSLVDLAGSERTNRTRAEGNRLREAGNINQSLMTLRTCMDVLRENQMYGTNKMVPYRDSKLTHLFKNYFDGEGKVRMIVCVNPKAEDYEENLQVMRFAEVTQEVEV 438          

HSP 2 Score: 62.3882 bits (150), Expect = 2.340e-9
Identity = 36/112 (32.14%), Postives = 60/112 (53.57%), Query Frame = 3
Query: 1845 ENYLLHKDKHEIPTGTLNKFHVKNSIVSKNIKMKELGKASKYLLQRQS-GANNQFQTDYIEGNVTPTSGGGFAVELTGVETVKQSSYNNPRKRISSNSESPEYKKTKQEFSD 2177
            + ++ HK    + T T+ + HV ++I       K L K  KY+L  Q   ++ + +T  I+G++  T GGG +V+ T +ET+KQ S N  RKR SS     +    + E++D
Sbjct:  713 DRWVDHKPASNMQTETVMQPHVPHAITVSVANEKALAKCEKYMLTHQELASDGEIETKLIKGDIYKTRGGGQSVQFTDIETLKQESPNGSRKRRSSTVAPAQPDGAESEWTD 824          
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIF23 (kinesin family member 23 [Source:HGNC Symbol;Acc:HGNC:6392])

HSP 1 Score: 286.96 bits (733), Expect = 8.036e-84
Identity = 172/421 (40.86%), Postives = 249/421 (59.14%), Query Frame = 3
Query:   69 NTVEGVCVFCRLKPLNDENIKSCIQYENEFTISAVPPEINRKNT----KEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNFI--KRFLIKPDERNGFKVLGETDALFE------IVSNKNNYSRRSGDHDCVAYMNAISDDPF----EVNKVDNCTVFVSMVEIYGNNIKDLFIG------KREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVK--LNRDKSN----GECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRI 1247
            N  + V V+CR++PL   + + CI+  N  T+    PE  R N     KE +Y+F +VF  + +Q E+F+ VA PLV DL++ +NGLLF YGVTGSGKT++M G     G++ R +  +F  +     KR++ K ++RN   +  E DAL E      + + K + S+R  D +   + + I+   F    EV++     VFVS +EIY N I DL         K +  +   ++EDK  NMY+    EVEV+S  EA   F +G++ RRIA T+LN  SSRSH +FNI+LV+  L+ D  N     E ++++QLSL+DLAGSER  RT A G +L+EAG+IN SLM L++ M+ LR     G+  ++ YR +KLTHL K  F+   KVRMIVCV  K E+Y E L V+ FAE ++E+ +
Sbjct:   21 NLKDPVGVYCRVRPLGFPDQECCIEVINNTTVQLHTPEGYRLNRNGDYKETQYSFKQVFGTHTTQKELFDVVANPLVNDLIHGKNGLLFTYGVTGSGKTHTMTGSPGEGGLLPRCLDMIFNSIGSFQAKRYVFKSNDRNSMDIQCEVDALLERQKREAMPNPKTSSSKRQVDPE---FADMITVQEFCKAEEVDEDSVYGVFVSYIEIYNNYIYDLLEEVPFDPIKPKPPQSKLLREDKNHNMYVAGCTEVEVKSTEEAFEVFWRGQKKRRIANTHLNRESSRSHSVFNIKLVQAPLDADGDNVLQEKEQITISQLSLVDLAGSERTNRTRAEGNRLREAGNINQSLMTLRTCMDVLRENQMYGTNKMVPYRDSKLTHLFKNYFDGEGKVRMIVCVNPKAEDYEENLQVMRFAEVTQEVEV 438          

HSP 2 Score: 58.9214 bits (141), Expect = 3.214e-8
Identity = 36/112 (32.14%), Postives = 60/112 (53.57%), Query Frame = 3
Query: 1845 ENYLLHKDKHEIPTGTLNKFHVKNSIVSKNIKMKELGKASKYLLQRQS-GANNQFQTDYIEGNVTPTSGGGFAVELTGVETVKQSSYNNPRKRISSNSESPEYKKTKQEFSD 2177
            + ++ HK    + T T+ + HV ++I       K L K  KY+L  Q   ++ + +T  I+G++  T GGG +V+ T +ET+KQ S N  RKR SS     +    + E++D
Sbjct:  810 DRWVDHKPASNMQTETVMQPHVPHAITVSVANEKALAKCEKYMLTHQELASDGEIETKLIKGDIYKTRGGGQSVQFTDIETLKQESPNG-RKRRSSTVAPAQPDGAESEWTD 920          
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIF23 (kinesin family member 23 [Source:HGNC Symbol;Acc:HGNC:6392])

HSP 1 Score: 286.96 bits (733), Expect = 1.029e-83
Identity = 172/421 (40.86%), Postives = 249/421 (59.14%), Query Frame = 3
Query:   69 NTVEGVCVFCRLKPLNDENIKSCIQYENEFTISAVPPEINRKNT----KEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNFI--KRFLIKPDERNGFKVLGETDALFE------IVSNKNNYSRRSGDHDCVAYMNAISDDPF----EVNKVDNCTVFVSMVEIYGNNIKDLFIG------KREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVK--LNRDKSN----GECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRI 1247
            N  + V V+CR++PL   + + CI+  N  T+    PE  R N     KE +Y+F +VF  + +Q E+F+ VA PLV DL++ +NGLLF YGVTGSGKT++M G     G++ R +  +F  +     KR++ K ++RN   +  E DAL E      + + K + S+R  D +   + + I+   F    EV++     VFVS +EIY N I DL         K +  +   ++EDK  NMY+    EVEV+S  EA   F +G++ RRIA T+LN  SSRSH +FNI+LV+  L+ D  N     E ++++QLSL+DLAGSER  RT A G +L+EAG+IN SLM L++ M+ LR     G+  ++ YR +KLTHL K  F+   KVRMIVCV  K E+Y E L V+ FAE ++E+ +
Sbjct:   21 NLKDPVGVYCRVRPLGFPDQECCIEVINNTTVQLHTPEGYRLNRNGDYKETQYSFKQVFGTHTTQKELFDVVANPLVNDLIHGKNGLLFTYGVTGSGKTHTMTGSPGEGGLLPRCLDMIFNSIGSFQAKRYVFKSNDRNSMDIQCEVDALLERQKREAMPNPKTSSSKRQVDPE---FADMITVQEFCKAEEVDEDSVYGVFVSYIEIYNNYIYDLLEEVPFDPIKPKPPQSKLLREDKNHNMYVAGCTEVEVKSTEEAFEVFWRGQKKRRIANTHLNRESSRSHSVFNIKLVQAPLDADGDNVLQEKEQITISQLSLVDLAGSERTNRTRAEGNRLREAGNINQSLMTLRTCMDVLRENQMYGTNKMVPYRDSKLTHLFKNYFDGEGKVRMIVCVNPKAEDYEENLQVMRFAEVTQEVEV 438          

HSP 2 Score: 62.7734 bits (151), Expect = 2.204e-9
Identity = 36/112 (32.14%), Postives = 60/112 (53.57%), Query Frame = 3
Query: 1845 ENYLLHKDKHEIPTGTLNKFHVKNSIVSKNIKMKELGKASKYLLQRQS-GANNQFQTDYIEGNVTPTSGGGFAVELTGVETVKQSSYNNPRKRISSNSESPEYKKTKQEFSD 2177
            + ++ HK    + T T+ + HV ++I       K L K  KY+L  Q   ++ + +T  I+G++  T GGG +V+ T +ET+KQ S N  RKR SS     +    + E++D
Sbjct:  817 DRWVDHKPASNMQTETVMQPHVPHAITVSVANEKALAKCEKYMLTHQELASDGEIETKLIKGDIYKTRGGGQSVQFTDIETLKQESPNGSRKRRSSTVAPAQPDGAESEWTD 928          
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIF23 (kinesin family member 23 [Source:HGNC Symbol;Acc:HGNC:6392])

HSP 1 Score: 286.96 bits (733), Expect = 1.029e-83
Identity = 172/421 (40.86%), Postives = 249/421 (59.14%), Query Frame = 3
Query:   69 NTVEGVCVFCRLKPLNDENIKSCIQYENEFTISAVPPEINRKNT----KEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNFI--KRFLIKPDERNGFKVLGETDALFE------IVSNKNNYSRRSGDHDCVAYMNAISDDPF----EVNKVDNCTVFVSMVEIYGNNIKDLFIG------KREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVK--LNRDKSN----GECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRI 1247
            N  + V V+CR++PL   + + CI+  N  T+    PE  R N     KE +Y+F +VF  + +Q E+F+ VA PLV DL++ +NGLLF YGVTGSGKT++M G     G++ R +  +F  +     KR++ K ++RN   +  E DAL E      + + K + S+R  D +   + + I+   F    EV++     VFVS +EIY N I DL         K +  +   ++EDK  NMY+    EVEV+S  EA   F +G++ RRIA T+LN  SSRSH +FNI+LV+  L+ D  N     E ++++QLSL+DLAGSER  RT A G +L+EAG+IN SLM L++ M+ LR     G+  ++ YR +KLTHL K  F+   KVRMIVCV  K E+Y E L V+ FAE ++E+ +
Sbjct:   21 NLKDPVGVYCRVRPLGFPDQECCIEVINNTTVQLHTPEGYRLNRNGDYKETQYSFKQVFGTHTTQKELFDVVANPLVNDLIHGKNGLLFTYGVTGSGKTHTMTGSPGEGGLLPRCLDMIFNSIGSFQAKRYVFKSNDRNSMDIQCEVDALLERQKREAMPNPKTSSSKRQVDPE---FADMITVQEFCKAEEVDEDSVYGVFVSYIEIYNNYIYDLLEEVPFDPIKPKPPQSKLLREDKNHNMYVAGCTEVEVKSTEEAFEVFWRGQKKRRIANTHLNRESSRSHSVFNIKLVQAPLDADGDNVLQEKEQITISQLSLVDLAGSERTNRTRAEGNRLREAGNINQSLMTLRTCMDVLRENQMYGTNKMVPYRDSKLTHLFKNYFDGEGKVRMIVCVNPKAEDYEENLQVMRFAEVTQEVEV 438          

HSP 2 Score: 62.7734 bits (151), Expect = 2.204e-9
Identity = 36/112 (32.14%), Postives = 60/112 (53.57%), Query Frame = 3
Query: 1845 ENYLLHKDKHEIPTGTLNKFHVKNSIVSKNIKMKELGKASKYLLQRQS-GANNQFQTDYIEGNVTPTSGGGFAVELTGVETVKQSSYNNPRKRISSNSESPEYKKTKQEFSD 2177
            + ++ HK    + T T+ + HV ++I       K L K  KY+L  Q   ++ + +T  I+G++  T GGG +V+ T +ET+KQ S N  RKR SS     +    + E++D
Sbjct:  817 DRWVDHKPASNMQTETVMQPHVPHAITVSVANEKALAKCEKYMLTHQELASDGEIETKLIKGDIYKTRGGGQSVQFTDIETLKQESPNGSRKRRSSTVAPAQPDGAESEWTD 928          
BLAST of Kinesin-like protein vs. Ensembl Human
Match: KIF23 (kinesin family member 23 [Source:HGNC Symbol;Acc:HGNC:6392])

HSP 1 Score: 279.641 bits (714), Expect = 4.331e-82
Identity = 173/435 (39.77%), Postives = 250/435 (57.47%), Query Frame = 3
Query:   69 NTVEGVCVFCRLKPLNDENIKSCIQYENEFTISAVPPEINRKNT----KEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNFI--KRFLIKPDERNGFKVLGETDALFE------IVSNKNNYSRRSGDHDCVAYMNAISDDPF----EVNKVDNCTVFVSMVEIYGNNIKDLF-------IGKREAS-------------REVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVK--LNRDKSN----GECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRI 1247
            N  + V V+CR++PL   + + CI+  N  T+    PE  R N     KE +Y+F +VF  + +Q E+F+ VA PLV DL++ +NGLLF YGVTGSGKT++M G     G++ R +  +F  +     KR++ K ++RN   +  E DAL E      + + K + S+R  D +   + + I+   F    EV++     VFVS +EIY N I DL        I  +  S             +   ++EDK  NMY+    EVEV+S  EA   F +G++ RRIA T+LN  SSRSH +FNI+LV+  L+ D  N     E ++++QLSL+DLAGSER  RT A G +L+EAG+IN SLM L++ M+ LR     G+  ++ YR +KLTHL K  F+   KVRMIVCV  K E+Y E L V+ FAE ++E+ +
Sbjct:   21 NLKDPVGVYCRVRPLGFPDQECCIEVINNTTVQLHTPEGYRLNRNGDYKETQYSFKQVFGTHTTQKELFDVVANPLVNDLIHGKNGLLFTYGVTGSGKTHTMTGSPGEGGLLPRCLDMIFNSIGSFQAKRYVFKSNDRNSMDIQCEVDALLERQKREAMPNPKTSSSKRQVDPE---FADMITVQEFCKAEEVDEDSVYGVFVSYIEIYNNYIYDLLEEVPFDPIKPKWNSCSTPMRNTDFVPPQSKLLREDKNHNMYVAGCTEVEVKSTEEAFEVFWRGQKKRRIANTHLNRESSRSHSVFNIKLVQAPLDADGDNVLQEKEQITISQLSLVDLAGSERTNRTRAEGNRLREAGNINQSLMTLRTCMDVLRENQMYGTNKMVPYRDSKLTHLFKNYFDGEGKVRMIVCVNPKAEDYEENLQVMRFAEVTQEVEV 452          

HSP 2 Score: 62.7734 bits (151), Expect = 2.153e-9
Identity = 36/112 (32.14%), Postives = 60/112 (53.57%), Query Frame = 3
Query: 1845 ENYLLHKDKHEIPTGTLNKFHVKNSIVSKNIKMKELGKASKYLLQRQS-GANNQFQTDYIEGNVTPTSGGGFAVELTGVETVKQSSYNNPRKRISSNSESPEYKKTKQEFSD 2177
            + ++ HK    + T T+ + HV ++I       K L K  KY+L  Q   ++ + +T  I+G++  T GGG +V+ T +ET+KQ S N  RKR SS     +    + E++D
Sbjct:  667 DRWVDHKPASNMQTETVMQPHVPHAITVSVANEKALAKCEKYMLTHQELASDGEIETKLIKGDIYKTRGGGQSVQFTDIETLKQESPNGSRKRRSSTVAPAQPDGAESEWTD 778          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: zen-4 (Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc:Q8MQ03])

HSP 1 Score: 287.345 bits (734), Expect = 1.275e-85
Identity = 225/769 (29.26%), Postives = 364/769 (47.33%), Query Frame = 3
Query:   75 VEGVCVFCRLKPLNDENIKSCIQYENEFTISAVPP-EINRKNTKEIK--YTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEG--VAENPGVIGRTIKSLFRRLN-FIKRFLIKPDERNGFKVLGETDALF---EIVSNKNNYSRRSGDHDCVAY-MNAISDDPFEVNKVDNCTVFVSMVEIYGNNIKDLFIGKREASREVT---VKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNR--------DKSNGECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDI--IHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRIITRNEYLPTPRDQKIPMKVFDPLKSETNPICLETEYQRISDEVTRNLTAVKRYRTLEENPHDMINSIYEIWRIMANVEALQRAYXXXXXXXXXXXXXXXXXXXXXXIKELREKLQEKDQEIAKL--------RQQEAAESEIKSVYNG---------KLLTNYMGN-----GIRKSLR------ANPKSTVKNLANHFELKSANKPDITKTWP--------------------------------------SNKAHYNPRYNHQKEN---YLLHKDKHEIPTGT-LNKFHVKNSIVSKNIKMKELGKASKYLLQRQSGAN-NQFQTDYIEGNVTPTSGGGFAVELTGVETVKQSS 2099
             + + V CRL P    +  S I  +     + +PP +  R+N  +++  + F +VF+ N  Q+ VF   +  L+ +LL  +N LLF YGVTGSGKTY+M G       G++ RT+  +F  +N  +++ +  P   N F++    DA     ++ +++ + SR   D  C A  ++  +DD         C+VFV+ VEIY N   DL    R  SR +T   ++ D++  MY+   K+VEV S  EA+  F  GE  RR++ T LN +SSRSH +F I+LV   R           +   + V+QL L+DLAGSERAKRT   G +L EA  IN SLM L+  +  LR   K+ S+++  + YR +KLTHL K   E N K+RM++CV  KP++Y+E ++ L+FAE+S+ I +  + E +P+   ++IP   F    SE +         R+ D+ +R +     +   + N  D ++S+Y+  R +++++                    E      EI  L++ L +KD+EI KL        R+  + +  I S   G         KL+   M +       +K++R       NP  +V +L + F+ ++   P    T P                                        + + NP+Y  + ++    L H+  H +PTGT L      N+I +   +M +L K+ +Y L  Q   +     T+ ++GNV PT  GG AV    +E +   S
Sbjct:   25 TDSIEVVCRLCPYTG-STPSLIAIDEGSIQTVLPPAQFRRENAPQVEKVFRFGRVFSENDGQATVFERTSVDLILNLLKGQNSLLFTYGVTGSGKTYTMTGKPTETGTGLLPRTLDVIFNSINNRVEKCIFYPSALNTFEIRATLDAHLKRHQMAADRLSTSREITDRYCEAIKLSGYNDDMV-------CSVFVTYVEIYNNYCYDLLEDARNGSRVLTKREIRHDRQQQMYVDGAKDVEVSSSEEALEVFCLGEERRRVSSTLLNKDSSRSHSVFTIKLVMAPRAYETKSVYPTMDSSQIIVSQLCLVDLAGSERAKRTQNVGERLAEANSINQSLMTLRQCIEVLRRNQKSSSQNLEQVPYRQSKLTHLFKNYLEGNGKIRMVICVNPKPDDYDENMSALAFAEESQTIEVKKQVERMPS---ERIPHSFFTQWNSELDGSV------RMEDDGSREIPCPPTFCLTDCNDKDTVDSMYKYARKLSSLQNSSEEGPSSTLLTMIRQYMMEADYQRVEIARLKDSLNDKDEEIKKLRGFCSRYKRENASMKERIASCEQGEQENALVMEKLMEQKMEDRKIIQSQKKAMRNVRGIIDNPSPSVASLRSRFDQENVAHP----TAPIQTPPPPYQTPGRAPVFKKRLEATTSTTVMSGSSSGGSGQQGYVNPKYQRRSKSASRLLDHQPLHRVPTGTVLQSRTPANAIRTTKPEMHQLNKSGEYRLTHQEVDDEGNISTNIVKGNVIPTVSGGTAVFFNDIERLTHES 772          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: zen-4 (Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc:Q8MQ03])

HSP 1 Score: 280.796 bits (717), Expect = 3.599e-83
Identity = 224/769 (29.13%), Postives = 362/769 (47.07%), Query Frame = 3
Query:   75 VEGVCVFCRLKPLNDENIKSCIQYENEFTISAVPP-EINRKNTKEIK--YTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEG--VAENPGVIGRTIKSLFRRLN-FIKRFLIKPDERNGFKVLGETDALF---EIVSNKNNYSRRSGDHDCVAY-MNAISDDPFEVNKVDNCTVFVSMVEIYGNNIKDLFIGKREA---SREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNR--------DKSNGECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDI--IHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRIITRNEYLPTPRDQKIPMKVFDPLKSETNPICLETEYQRISDEVTRNLTAVKRYRTLEENPHDMINSIYEIWRIMANVEALQRAYXXXXXXXXXXXXXXXXXXXXXXIKELREKLQEKDQEIAKL--------RQQEAAESEIKSVYNG---------KLLTNYMGN-----GIRKSLR------ANPKSTVKNLANHFELKSANKPDITKTWP--------------------------------------SNKAHYNPRYNHQKEN---YLLHKDKHEIPTGT-LNKFHVKNSIVSKNIKMKELGKASKYLLQRQSGAN-NQFQTDYIEGNVTPTSGGGFAVELTGVETVKQSS 2099
             + + V CRL P    +  S I  +     + +PP +  R+N  +++  + F +VF+ N  Q+ VF   +  L+ +LL  +N LLF YGVTGSGKTY+M G       G++ RT+  +F  +N  +++ +  P   N F++    DA     ++ +++ + SR   D  C A  ++  +DD         C+VFV+ VEIY N   DL    R      RE+  + D++  MY+   K+VEV S  EA+  F  GE  RR++ T LN +SSRSH +F I+LV   R           +   + V+QL L+DLAGSERAKRT   G +L EA  IN SLM L+  +  LR   K+ S+++  + YR +KLTHL K   E N K+RM++CV  KP++Y+E ++ L+FAE+S+ I +  + E +P+   ++IP   F    SE +         R+ D+ +R +     +   + N  D ++S+Y+  R +++++                    E      EI  L++ L +KD+EI KL        R+  + +  I S   G         KL+   M +       +K++R       NP  +V +L + F+ ++   P    T P                                        + + NP+Y  + ++    L H+  H +PTGT L      N+I +   +M +L K+ +Y L  Q   +     T+ ++GNV PT  GG AV    +E +   S
Sbjct:   25 TDSIEVVCRLCPYTG-STPSLIAIDEGSIQTVLPPAQFRRENAPQVEKVFRFGRVFSENDGQATVFERTSVDLILNLLKGQNSLLFTYGVTGSGKTYTMTGKPTETGTGLLPRTLDVIFNSINNRVEKCIFYPSALNTFEIRATLDAHLKRHQMAADRLSTSREITDRYCEAIKLSGYNDDMV-------CSVFVTYVEIYNNYCYDLLEDARNGVLTKREI--RHDRQQQMYVDGAKDVEVSSSEEALEVFCLGEERRRVSSTLLNKDSSRSHSVFTIKLVMAPRAYETKSVYPTMDSSQIIVSQLCLVDLAGSERAKRTQNVGERLAEANSINQSLMTLRQCIEVLRRNQKSSSQNLEQVPYRQSKLTHLFKNYLEGNGKIRMVICVNPKPDDYDENMSALAFAEESQTIEVKKQVERMPS---ERIPHSFFTQWNSELDGSV------RMEDDGSREIPCPPTFCLTDCNDKDTVDSMYKYARKLSSLQNSSEEGPSSTLLTMIRQYMMEADYQRVEIARLKDSLNDKDEEIKKLRGFCSRYKRENASMKERIASCEQGEQENALVMEKLMEQKMEDRKIIQSQKKAMRNVRGIIDNPSPSVASLRSRFDQENVAHP----TAPIQTPPPPYQTPGRAPVFKKRLEATTSTTVMSGSSSGGSGQQGYVNPKYQRRSKSASRLLDHQPLHRVPTGTVLQSRTPANAIRTTKPEMHQLNKSGEYRLTHQEVDDEGNISTNIVKGNVIPTVSGGTAVFFNDIERLTHES 770          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: zen-4 (Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc:Q8MQ03])

HSP 1 Score: 270.396 bits (690), Expect = 1.852e-79
Identity = 214/725 (29.52%), Postives = 343/725 (47.31%), Query Frame = 3
Query:   90 VFCRLKPLNDENIKSCIQYENEFTISAVPP-EINRKNTKEIK--YTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEG--VAENPGVIGRTIKSLFRRLN-FIKRFLIKPDERNGFKVLGETDALF---EIVSNKNNYSRRSGDHDCVAY-MNAISDDPFEVNKVDNCTVFVSMVEIYGNNIKDLFIGKREASREVT---VKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNR--------DKSNGECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDI--IHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRIITRNEYLPTPRDQKIPMKVFDPLKSETNPICLETEYQRISDEVTRNLTAVKRYRTLEENPHDMINSIYEIWRIMANVEALQRAYXXXXXXXXXXXXXXXXXXXXXXIKELREKLQEKDQEIAKL--------RQQEAAESEIKSVYNG---------KLLTNYMGN-----GIRKSLR------ANPKSTVKNLANHFELKSANKPDITKTWP--------------------------------------SNKAHYNPRYNHQKEN---YLLHKDKHEIPTGT-LNKFHVKNSIVSKNIKMKELGKASKYLLQRQ 1985
            V CRL P    +  S I  +     + +PP +  R+N  +++  + F +VF+ N  Q+ VF   +  L+ +LL  +N LLF YGVTGSGKTY+M G       G++ RT+  +F  +N  +++ +  P   N F++    DA     ++ +++ + SR   D  C A  ++  +DD         C+VFV+ VEIY N   DL    R  SR +T   ++ D++  MY+   K+VEV S  EA+  F  GE  RR++ T LN +SSRSH +F I+LV   R           +   + V+QL L+DLAGSERAKRT   G +L EA  IN SLM L+  +  LR   K+ S+++  + YR +KLTHL K   E N K+RM++CV  KP++Y+E ++ L+FAE+S+ I +  + E +P+ R   IP   F    SE +         R+ D+ +R +     +   + N  D ++S+Y+  R +++++                    E      EI  L++ L +KD+EI KL        R+  + +  I S   G         KL+   M +       +K++R       NP  +V +L + F+ ++   P    T P                                        + + NP+Y  + ++    L H+  H +PTGT L      N+I +   +M +L K+ +Y L  Q
Sbjct:   30 VVCRLCPYTG-STPSLIAIDEGSIQTVLPPAQFRRENAPQVEKVFRFGRVFSENDGQATVFERTSVDLILNLLKGQNSLLFTYGVTGSGKTYTMTGKPTETGTGLLPRTLDVIFNSINNRVEKCIFYPSALNTFEIRATLDAHLKRHQMAADRLSTSREITDRYCEAIKLSGYNDDMV-------CSVFVTYVEIYNNYCYDLLEDARNGSRVLTKREIRHDRQQQMYVDGAKDVEVSSSEEALEVFCLGEERRRVSSTLLNKDSSRSHSVFTIKLVMAPRAYETKSVYPTMDSSQIIVSQLCLVDLAGSERAKRTQNVGERLAEANSINQSLMTLRQCIEVLRRNQKSSSQNLEQVPYRQSKLTHLFKNYLEGNGKIRMVICVNPKPDDYDENMSALAFAEESQTIEVKKQVERMPSER---IPHSFFTQWNSELDGSV------RMEDDGSREIPCPPTFCLTDCNDKDTVDSMYKYARKLSSLQNSSEEGPSSTLLTMIRQYMMEADYQRVEIARLKDSLNDKDEEIKKLRGFCSRYKRENASMKERIASCEQGEQENALVMEKLMEQKMEDRKIIQSQKKAMRNVRGIIDNPSPSVASLRSRFDQENVAHP----TAPIQTPPPPYQTPGRAPVFKKRLEATTSTTVMSGSSSGGSGQQGYVNPKYQRRSKSASRLLDHQPLHRVPTGTVLQSRTPANAIRTTKPEMHQLNKSGEYRLTHQ 733          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: zen-4 (Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc:Q8MQ03])

HSP 1 Score: 270.396 bits (690), Expect = 2.253e-79
Identity = 213/730 (29.18%), Postives = 346/730 (47.40%), Query Frame = 3
Query:   75 VEGVCVFCRLKPLNDENIKSCIQYENEFTISAVPP-EINRKNTKEIK--YTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEG--VAENPGVIGRTIKSLFRRLN-FIKRFLIKPDERNGFKVLGETDALF---EIVSNKNNYSRRSGDHDCVAY-MNAISDDPFEVNKVDNCTVFVSMVEIYGNNIKDLFIGKREASREVT---VKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNR--------DKSNGECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDI--IHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRIITRNEYLPTPRDQKIPMKVFDPLKSETNPICLETEYQRISDEVTRNLTAVKRYRTLEENPHDMINSIYEIWRIMANVEALQRAYXXXXXXXXXXXXXXXXXXXXXXIKELREKLQEKDQEIAKL--------RQQEAAESEIKSVYNG---------KLLTNYMGN-----GIRKSLR------ANPKSTVKNLANHFELKSANKPDITKTWP--------------------------------------SNKAHYNPRYNHQKEN---YLLHKDKHEIPTGT-LNKFHVKNSIVSKNIKMKELGKASKYLLQRQ 1985
             + + V CRL P    +  S I  +     + +PP +  R+N  +++  + F +VF+ N  Q+ VF   +  L+ +LL  +N LLF YGVTGSGKTY+M G       G++ RT+  +F  +N  +++ +  P   N F++    DA     ++ +++ + SR   D  C A  ++  +DD         C+VFV+ VEIY N   DL    R  SR +T   ++ D++  MY+   K+VEV S  EA+  F  GE  RR++ T LN +SSRSH +F I+LV   R           +   + V+QL L+DLAGSERAKRT   G +L EA  IN SLM L+  +  LR   K+ S+++  + YR +KLTHL K   E N K+RM++CV  KP++Y+E ++ L+FAE+S+ I +  + E +P+   ++IP   F    SE +         R+ D+ +R +     +   + N  D ++S+Y+  R +++++                    E      EI  L++ L +KD+EI KL        R+  + +  I S   G         KL+   M +       +K++R       NP  +V +L + F+ ++   P    T P                                        + + NP+Y  + ++    L H+  H +PTGT L      N+I +   +M +L K+ +Y L  Q
Sbjct:   25 TDSIEVVCRLCPYTG-STPSLIAIDEGSIQTVLPPAQFRRENAPQVEKVFRFGRVFSENDGQATVFERTSVDLILNLLKGQNSLLFTYGVTGSGKTYTMTGKPTETGTGLLPRTLDVIFNSINNRVEKCIFYPSALNTFEIRATLDAHLKRHQMAADRLSTSREITDRYCEAIKLSGYNDDMV-------CSVFVTYVEIYNNYCYDLLEDARNGSRVLTKREIRHDRQQQMYVDGAKDVEVSSSEEALEVFCLGEERRRVSSTLLNKDSSRSHSVFTIKLVMAPRAYETKSVYPTMDSSQIIVSQLCLVDLAGSERAKRTQNVGERLAEANSINQSLMTLRQCIEVLRRNQKSSSQNLEQVPYRQSKLTHLFKNYLEGNGKIRMVICVNPKPDDYDENMSALAFAEESQTIEVKKQVERMPS---ERIPHSFFTQWNSELDGSV------RMEDDGSREIPCPPTFCLTDCNDKDTVDSMYKYARKLSSLQNSSEEGPSSTLLTMIRQYMMEADYQRVEIARLKDSLNDKDEEIKKLRGFCSRYKRENASMKERIASCEQGEQENALVMEKLMEQKMEDRKIIQSQKKAMRNVRGIIDNPSPSVASLRSRFDQENVAHP----TAPIQTPPPPYQTPGRAPVFKKRLEATTSTTVMSGSSSGGSGQQGYVNPKYQRRSKSASRLLDHQPLHRVPTGTVLQSRTPANAIRTTKPEMHQLNKSGEYRLTHQ 733          
BLAST of Kinesin-like protein vs. Ensembl Celegans
Match: zen-4 (Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc:Q8MQ03])

HSP 1 Score: 270.396 bits (690), Expect = 2.253e-79
Identity = 213/730 (29.18%), Postives = 346/730 (47.40%), Query Frame = 3
Query:   75 VEGVCVFCRLKPLNDENIKSCIQYENEFTISAVPP-EINRKNTKEIK--YTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEG--VAENPGVIGRTIKSLFRRLN-FIKRFLIKPDERNGFKVLGETDALF---EIVSNKNNYSRRSGDHDCVAY-MNAISDDPFEVNKVDNCTVFVSMVEIYGNNIKDLFIGKREASREVT---VKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNR--------DKSNGECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDI--IHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRIITRNEYLPTPRDQKIPMKVFDPLKSETNPICLETEYQRISDEVTRNLTAVKRYRTLEENPHDMINSIYEIWRIMANVEALQRAYXXXXXXXXXXXXXXXXXXXXXXIKELREKLQEKDQEIAKL--------RQQEAAESEIKSVYNG---------KLLTNYMGN-----GIRKSLR------ANPKSTVKNLANHFELKSANKPDITKTWP--------------------------------------SNKAHYNPRYNHQKEN---YLLHKDKHEIPTGT-LNKFHVKNSIVSKNIKMKELGKASKYLLQRQ 1985
             + + V CRL P    +  S I  +     + +PP +  R+N  +++  + F +VF+ N  Q+ VF   +  L+ +LL  +N LLF YGVTGSGKTY+M G       G++ RT+  +F  +N  +++ +  P   N F++    DA     ++ +++ + SR   D  C A  ++  +DD         C+VFV+ VEIY N   DL    R  SR +T   ++ D++  MY+   K+VEV S  EA+  F  GE  RR++ T LN +SSRSH +F I+LV   R           +   + V+QL L+DLAGSERAKRT   G +L EA  IN SLM L+  +  LR   K+ S+++  + YR +KLTHL K   E N K+RM++CV  KP++Y+E ++ L+FAE+S+ I +  + E +P+   ++IP   F    SE +         R+ D+ +R +     +   + N  D ++S+Y+  R +++++                    E      EI  L++ L +KD+EI KL        R+  + +  I S   G         KL+   M +       +K++R       NP  +V +L + F+ ++   P    T P                                        + + NP+Y  + ++    L H+  H +PTGT L      N+I +   +M +L K+ +Y L  Q
Sbjct:   25 TDSIEVVCRLCPYTG-STPSLIAIDEGSIQTVLPPAQFRRENAPQVEKVFRFGRVFSENDGQATVFERTSVDLILNLLKGQNSLLFTYGVTGSGKTYTMTGKPTETGTGLLPRTLDVIFNSINNRVEKCIFYPSALNTFEIRATLDAHLKRHQMAADRLSTSREITDRYCEAIKLSGYNDDMV-------CSVFVTYVEIYNNYCYDLLEDARNGSRVLTKREIRHDRQQQMYVDGAKDVEVSSSEEALEVFCLGEERRRVSSTLLNKDSSRSHSVFTIKLVMAPRAYETKSVYPTMDSSQIIVSQLCLVDLAGSERAKRTQNVGERLAEANSINQSLMTLRQCIEVLRRNQKSSSQNLEQVPYRQSKLTHLFKNYLEGNGKIRMVICVNPKPDDYDENMSALAFAEESQTIEVKKQVERMPS---ERIPHSFFTQWNSELDGSV------RMEDDGSREIPCPPTFCLTDCNDKDTVDSMYKYARKLSSLQNSSEEGPSSTLLTMIRQYMMEADYQRVEIARLKDSLNDKDEEIKKLRGFCSRYKRENASMKERIASCEQGEQENALVMEKLMEQKMEDRKIIQSQKKAMRNVRGIIDNPSPSVASLRSRFDQENVAHP----TAPIQTPPPPYQTPGRAPVFKKRLEATTSTTVMSGSSSGGSGQQGYVNPKYQRRSKSASRLLDHQPLHRVPTGTVLQSRTPANAIRTTKPEMHQLNKSGEYRLTHQ 733          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: pav (gene:FBgn0011692 transcript:FBtr0073227)

HSP 1 Score: 278.87 bits (712), Expect = 1.573e-81
Identity = 163/425 (38.35%), Postives = 253/425 (59.53%), Query Frame = 3
Query:   66 DNTVEGVCVFCRLKPLNDENIKSCIQYENEFTISAVPPEINRKNTK-------EIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLN--FIKRFLIKPDERNGFKVLGETDALFEIVSNKNN-------YSRRSGDHDC-VAYMNAISDDPFEVNKVDNC-TVFVSMVEIYGNNIKDLF--IGKREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGE-------CLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDI----IHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRI 1247
            D   + V VFCR++PL  +   + ++ +N  TI+  P +   ++ K       E++Y F  VF  +A+Q +V+  VA PLV++LL  RN LLF YGVTGSGKTY+M G   + G++ R +  LFR ++    K+F+ KPD+ NGF++L E DAL E     N        ++ R  D D  +A   ++   P      DN  +VFV+ +EIY N++ DL    G ++  +   ++ED   +M++H V EVEV++  +A+  F+ G++ +R+  T LN  SSRSH +FNIRLV+   D S GE        ++V+QLSL+DLAGSER+ RT  +G +L+EAG+INNSLM L++ +  LR      S  +    + YR +K+TH+ K  F+   +V MIVC+  + E+Y+E + V+ FAE ++E++I
Sbjct:   31 DKARDPVNVFCRVRPLQSDADLTSLRVKNSTTIALNPQDQLLQHHKPHNGAQREVQYIFKHVFQPDATQQDVYAAVAQPLVENLLKGRNSLLFTYGVTGSGKTYTMTGNLRHRGIMPRCLDVLFRTISDYQAKKFVFKPDKLNGFEILSEEDALLERQHEMNQRFAGSGRFAFRHKDSDPEIASQASVEPIPLLGLDEDNMYSVFVTYIEIYNNSVYDLLEDSGIQKTLQSKIIREDANRHMFVHGVTEVEVKTVEDALEVFQMGQKRKRMGHTVLNAESSRSHSVFNIRLVQAPTD-SQGENVVQDRQNITVSQLSLVDLAGSERSSRTKNTGVRLREAGNINNSLMTLRTCLEYLRENQLAASNGLAPKKVPYRDSKITHMFKNYFDGEGQVSMIVCINPRIEDYDENMQVMKFAEMTQEVQI 454          

HSP 2 Score: 51.9878 bits (123), Expect = 2.097e-6
Identity = 39/129 (30.23%), Postives = 64/129 (49.61%), Query Frame = 3
Query: 1770 ANKPDITKTWPSNKAHYNPRYNHQK---ENYLLHKDKHEIPTGTLNKFHVKN-SIVSKNIKMKEL---GKASKYLLQRQSGANNQFQTDYIEGNVTPTSGGGFAVELTGVETVKQ-SSYNNPRKRISSN 2132
            A + DI  T     A  N R+   +   + +L H+  + +P GT+ + ++KN   V+K   +KEL   G     L+ + +  +   +T   +GNV PT GGG  V    VE +KQ S  ++P ++  SN
Sbjct:  720 ATRTDIYATPRHGAAAANNRHRRSRSAGDKWLEHRAANPVPLGTIMQPYLKNRKSVTKLTDLKELTAHGTTKYCLVSQDADTDGDVETKLYKGNVIPTCGGGAQVVFNDVECLKQKSPVHSPTRKRPSN 848          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: sub (gene:FBgn0003545 transcript:FBtr0340277)

HSP 1 Score: 160.229 bits (404), Expect = 4.181e-41
Identity = 125/414 (30.19%), Postives = 194/414 (46.86%), Query Frame = 3
Query:   69 NTVEGVCVFCRLKPLNDENIKSCIQYENEFTISA--VPPEINRKNTKEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFR----------RLNFIKRFLIKPDERNGFKVLGETDALFEIVSNKNNYSRR-----SGDHDCVAYMNAISDDPFEVNKVDNCTVFVSMVEIYGNNIKDLFI--GKREASREVTVKEDK----RSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEI 1241
            N   G  VF RL+P+ D +    +  E    I++  V    N  N  E  + FT +F+    Q ++++    P    ++      +  YG +GSGKTY++ G     G+I R ++++F           +L  I   ++   +    K L     L ++  + + + +R      GDH    +    S D        +  V+VS VEIY   + DL     K++   EV  K  K    + ++++  +  V V S  EA+   R G++    A T++N NSSRSHC+F + ++K NR     +    +     DLAGSER   TG SG +LKEA +IN SLM L   ++      K  + DII YR +KLT LL+ +     K+ MIV V    + Y E LNVL+FA  +K I
Sbjct:   83 NVETGPQVFLRLRPVKDASKAYIVSEEANVLITSCKVDSTSNNVNRMEKHFGFTSIFDSTVGQRDIYDTCVGP---KIMEEECVTIMTYGTSGSGKTYTLLGDDVRAGIIPRALENIFTIYQDTVFRSPKLKLINGSIVFLQDDASLKELQIRKKLLDLCPDISAHHQRLKQVIDGDH---MFETKASTDV-------SVLVWVSFVEIYNELVYDLLAIPPKQDKLGEVPRKNLKIVGNKGHVFIKGLTSVFVTSSEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTVDILKYNRSGITTQ----SSYKFCDLAGSERVNNTGTSGLRLKEAKNINTSLMVLGRCLDAASTVQKKKNADIIPYRDSKLTMLLQAALLGKEKLAMIVTVTPLDKYYEENLNVLNFASIAKNI 479          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: sub (gene:FBgn0003545 transcript:FBtr0086881)

HSP 1 Score: 160.229 bits (404), Expect = 4.181e-41
Identity = 125/414 (30.19%), Postives = 194/414 (46.86%), Query Frame = 3
Query:   69 NTVEGVCVFCRLKPLNDENIKSCIQYENEFTISA--VPPEINRKNTKEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFR----------RLNFIKRFLIKPDERNGFKVLGETDALFEIVSNKNNYSRR-----SGDHDCVAYMNAISDDPFEVNKVDNCTVFVSMVEIYGNNIKDLFI--GKREASREVTVKEDK----RSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEI 1241
            N   G  VF RL+P+ D +    +  E    I++  V    N  N  E  + FT +F+    Q ++++    P    ++      +  YG +GSGKTY++ G     G+I R ++++F           +L  I   ++   +    K L     L ++  + + + +R      GDH    +    S D        +  V+VS VEIY   + DL     K++   EV  K  K    + ++++  +  V V S  EA+   R G++    A T++N NSSRSHC+F + ++K NR     +    +     DLAGSER   TG SG +LKEA +IN SLM L   ++      K  + DII YR +KLT LL+ +     K+ MIV V    + Y E LNVL+FA  +K I
Sbjct:   83 NVETGPQVFLRLRPVKDASKAYIVSEEANVLITSCKVDSTSNNVNRMEKHFGFTSIFDSTVGQRDIYDTCVGP---KIMEEECVTIMTYGTSGSGKTYTLLGDDVRAGIIPRALENIFTIYQDTVFRSPKLKLINGSIVFLQDDASLKELQIRKKLLDLCPDISAHHQRLKQVIDGDH---MFETKASTDV-------SVLVWVSFVEIYNELVYDLLAIPPKQDKLGEVPRKNLKIVGNKGHVFIKGLTSVFVTSSEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTVDILKYNRSGITTQ----SSYKFCDLAGSERVNNTGTSGLRLKEAKNINTSLMVLGRCLDAASTVQKKKNADIIPYRDSKLTMLLQAALLGKEKLAMIVTVTPLDKYYEENLNVLNFASIAKNI 479          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: Khc-73 (gene:FBgn0019968 transcript:FBtr0346265)

HSP 1 Score: 154.451 bits (389), Expect = 3.057e-38
Identity = 117/402 (29.10%), Postives = 189/402 (47.01%), Query Frame = 3
Query:   84 VCVFCRLKPLNDENI----KSCIQYENEFTISAVPPEINRKNTKEIK-YTFTKVF-------NGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNFIKRFLIKPDERNGFKVLGETDALFEIVSNKNNYSRRSGDHDCVAYMNAISDDPFEVNKVDNCTVFVSMVEIYGNNIKDLFIGKREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNG-ECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKH---KTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEI 1241
            + V  R++P N   I    K  ++ E + TI   PP + +   K+ K + F   F          ASQ  VF+ V   ++ +     N  +FAYG TGSGK+Y+M G  E+ G+I R                               D LF  ++NK+                     P  + KV+     VS +EIY   + DL +  +   + + V+E      Y+  + ++ V S  +      +G ++R +A TN+N  SSRSH +F++ L ++  D++ G     V+++SL+DLAGSERA +TGA G +LKE  +IN SL  L  +++KL  +    K+G+   + YR + LT LLK +   N +  M+  +    + Y ETL+ L +A+ +K I
Sbjct:    6 IKVAVRVRPFNRREIELDTKCIVEMEKQQTILQNPPPLEKIERKQPKTFAFDHCFYSLNPEDENFASQETVFDCVGRGILDNAFQGYNACIFAYGQTGSGKSYTMMGTQESKGIIPRLC-----------------------------DQLFSAIANKST--------------------PELMYKVE-----VSYMEIYNEKVHDL-LDPKPNKQSLKVREHNVMGPYVDGLSQLAVTSYQDIDNLMTEGNKSRTVAATNMNAESSRSHAVFSVVLTQILTDQATGVSGEKVSRMSLVDLAGSERAVKTGAVGDRLKEGSNINKSLTTLGLVISKLADQSNGKKSGNDKFVPYRDSVLTWLLKDNLGGNSRTVMVATISPSADNYEETLSTLRYADRAKRI 352          
BLAST of Kinesin-like protein vs. Ensembl Fly
Match: Khc-73 (gene:FBgn0019968 transcript:FBtr0329955)

HSP 1 Score: 154.451 bits (389), Expect = 3.186e-38
Identity = 117/402 (29.10%), Postives = 189/402 (47.01%), Query Frame = 3
Query:   84 VCVFCRLKPLNDENI----KSCIQYENEFTISAVPPEINRKNTKEIK-YTFTKVF-------NGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNFIKRFLIKPDERNGFKVLGETDALFEIVSNKNNYSRRSGDHDCVAYMNAISDDPFEVNKVDNCTVFVSMVEIYGNNIKDLFIGKREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNG-ECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKH---KTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEI 1241
            + V  R++P N   I    K  ++ E + TI   PP + +   K+ K + F   F          ASQ  VF+ V   ++ +     N  +FAYG TGSGK+Y+M G  E+ G+I R                               D LF  ++NK+                     P  + KV+     VS +EIY   + DL +  +   + + V+E      Y+  + ++ V S  +      +G ++R +A TN+N  SSRSH +F++ L ++  D++ G     V+++SL+DLAGSERA +TGA G +LKE  +IN SL  L  +++KL  +    K+G+   + YR + LT LLK +   N +  M+  +    + Y ETL+ L +A+ +K I
Sbjct:    6 IKVAVRVRPFNRREIELDTKCIVEMEKQQTILQNPPPLEKIERKQPKTFAFDHCFYSLNPEDENFASQETVFDCVGRGILDNAFQGYNACIFAYGQTGSGKSYTMMGTQESKGIIPRLC-----------------------------DQLFSAIANKST--------------------PELMYKVE-----VSYMEIYNEKVHDL-LDPKPNKQSLKVREHNVMGPYVDGLSQLAVTSYQDIDNLMTEGNKSRTVAATNMNAESSRSHAVFSVVLTQILTDQATGVSGEKVSRMSLVDLAGSERAVKTGAVGDRLKEGSNINKSLTTLGLVISKLADQSNGKKSGNDKFVPYRDSVLTWLLKDNLGGNSRTVMVATISPSADNYEETLSTLRYADRAKRI 352          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: kif23 (kinesin family member 23 [Source:ZFIN;Acc:ZDB-GENE-991019-4])

HSP 1 Score: 275.789 bits (704), Expect = 1.953e-80
Identity = 164/424 (38.68%), Postives = 241/424 (56.84%), Query Frame = 3
Query:   66 DNTVEGVCVFCRLKPLNDENIKSCIQYENEFTISAVPPEINRKNT----KEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNF--IKRFLIKPDERNGFKVLGETDALFEIVSNKNNYS------RRSGDHDCVAYMNAISDDPFEVNKVDNC------TVFVSMVEIYGNNIKDLFIG------KREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECLS------VNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRI 1247
            +N  + V V+CR++PL  E+ + CI+  +  TI    P+  + N     KE +Y+F KVF    +Q E+F DVA PL +DL++ +NGLLF YGVTGSGKT++M G     G++ R++  +F  +     KR++ KPD++NG +V  + DAL +     +  S       R  D +   + + IS  P E  K +        +VFVS +EIY N I DL         K +  +   ++ED+  NMY+    EVEV+S  EA   F +G++ RRIA T LN  SSRSH +F ++L +   D      L       V+QL L+DLAGSER  RT A G +L+EAG+IN SLM L++ +  LR     G+  ++ YR +K+THL K  F+   KVRM+VCV  K ++Y ETL V+ FAE ++E+ +
Sbjct:   20 NNQKDPVGVYCRVRPLGAEDEECCIEVISNTTIQLHAPDGLKANRNGEFKETQYSFKKVFGIKTTQRELFEDVAKPLAQDLIHGKNGLLFTYGVTGSGKTHTMTGSPGQGGLLPRSLDMIFNSIGPYQAKRYVFKPDDKNGMEVQNQVDALLDRQKRDSQTSVPKTPNTRRVDPE---FADMIS--PEEACKAEGVDEDSSYSVFVSYIEIYNNYIYDLLEETPFDPIKPKPPQSKILREDQNHNMYVAGCTEVEVKSTEEAFEVFWRGQKKRRIANTQLNRESSRSHSVFIVKLAQAPLDADGDNVLQDKNQVNVSQLCLVDLAGSERTSRTRAEGNRLREAGNINQSLMTLRTCIEVLRENQMCGTNKMVPYRDSKVTHLFKNYFDGEGKVRMVVCVNPKADDYEETLLVMRFAEMTQEVEV 438          

HSP 2 Score: 53.5286 bits (127), Expect = 9.510e-7
Identity = 41/140 (29.29%), Postives = 69/140 (49.29%), Query Frame = 3
Query: 1764 KSANKPDITKTWPSNKAHYNPRYNHQKENYLLHKDKHEIPTGTLNKFHVKNSIVSKNIKMKELGKASKYLLQRQSGANN-QFQTDYIEGNVTPTSGGGFAVELTGVETVKQ-SSYNNPRKRISSNSESPEYKKTKQEFSD 2177
            K +  P    T P  +  +   ++   E ++ HK    +   T+ + ++ N+I       K L K  KY+L  Q  A++ + QT  I+G V  T GGG +V+ T +ET+KQ +     RKR SS S  P+ +  +  ++D
Sbjct:  697 KRSASPSPAPTGPPVRPLHRRSHSAGGERWVDHKPTTNVDLDTVMQPNIPNAIKVNAPNEKALSKCDKYVLTHQEVASDGEIQTKLIKGEVFKTRGGGQSVQFTDIETLKQETPVAASRKRRSSES-GPDSEPMEGNWTD 835          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: kif23 (kinesin family member 23 [Source:ZFIN;Acc:ZDB-GENE-991019-4])

HSP 1 Score: 275.789 bits (704), Expect = 1.953e-80
Identity = 164/424 (38.68%), Postives = 241/424 (56.84%), Query Frame = 3
Query:   66 DNTVEGVCVFCRLKPLNDENIKSCIQYENEFTISAVPPEINRKNT----KEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNF--IKRFLIKPDERNGFKVLGETDALFEIVSNKNNYS------RRSGDHDCVAYMNAISDDPFEVNKVDNC------TVFVSMVEIYGNNIKDLFIG------KREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECLS------VNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRI 1247
            +N  + V V+CR++PL  E+ + CI+  +  TI    P+  + N     KE +Y+F KVF    +Q E+F DVA PL +DL++ +NGLLF YGVTGSGKT++M G     G++ R++  +F  +     KR++ KPD++NG +V  + DAL +     +  S       R  D +   + + IS  P E  K +        +VFVS +EIY N I DL         K +  +   ++ED+  NMY+    EVEV+S  EA   F +G++ RRIA T LN  SSRSH +F ++L +   D      L       V+QL L+DLAGSER  RT A G +L+EAG+IN SLM L++ +  LR     G+  ++ YR +K+THL K  F+   KVRM+VCV  K ++Y ETL V+ FAE ++E+ +
Sbjct:   20 NNQKDPVGVYCRVRPLGAEDEECCIEVISNTTIQLHAPDGLKANRNGEFKETQYSFKKVFGIKTTQRELFEDVAKPLAQDLIHGKNGLLFTYGVTGSGKTHTMTGSPGQGGLLPRSLDMIFNSIGPYQAKRYVFKPDDKNGMEVQNQVDALLDRQKRDSQTSVPKTPNTRRVDPE---FADMIS--PEEACKAEGVDEDSSYSVFVSYIEIYNNYIYDLLEETPFDPIKPKPPQSKILREDQNHNMYVAGCTEVEVKSTEEAFEVFWRGQKKRRIANTQLNRESSRSHSVFIVKLAQAPLDADGDNVLQDKNQVNVSQLCLVDLAGSERTSRTRAEGNRLREAGNINQSLMTLRTCIEVLRENQMCGTNKMVPYRDSKVTHLFKNYFDGEGKVRMVVCVNPKADDYEETLLVMRFAEMTQEVEV 438          

HSP 2 Score: 53.5286 bits (127), Expect = 9.510e-7
Identity = 41/140 (29.29%), Postives = 69/140 (49.29%), Query Frame = 3
Query: 1764 KSANKPDITKTWPSNKAHYNPRYNHQKENYLLHKDKHEIPTGTLNKFHVKNSIVSKNIKMKELGKASKYLLQRQSGANN-QFQTDYIEGNVTPTSGGGFAVELTGVETVKQ-SSYNNPRKRISSNSESPEYKKTKQEFSD 2177
            K +  P    T P  +  +   ++   E ++ HK    +   T+ + ++ N+I       K L K  KY+L  Q  A++ + QT  I+G V  T GGG +V+ T +ET+KQ +     RKR SS S  P+ +  +  ++D
Sbjct:  697 KRSASPSPAPTGPPVRPLHRRSHSAGGERWVDHKPTTNVDLDTVMQPNIPNAIKVNAPNEKALSKCDKYVLTHQEVASDGEIQTKLIKGEVFKTRGGGQSVQFTDIETLKQETPVAASRKRRSSES-GPDSEPMEGNWTD 835          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: kif23 (kinesin family member 23 [Source:ZFIN;Acc:ZDB-GENE-991019-4])

HSP 1 Score: 271.552 bits (693), Expect = 8.248e-79
Identity = 166/439 (37.81%), Postives = 243/439 (55.35%), Query Frame = 3
Query:   66 DNTVEGVCVFCRLKPLNDENIKSCIQYENEFTISAVPPEINRKNT----KEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNF--IKRFLIKPDERNGFKVLGETDALFEIVSNKNNYS------RRSGDHDCVAYMNAISDDPFEVNKVDNC------TVFVSMVEIYGNNIKDL------------FIGKREASREVT---------VKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECLS------VNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRI 1247
            +N  + V V+CR++PL  E+ + CI+  +  TI    P+  + N     KE +Y+F KVF    +Q E+F DVA PL +DL++ +NGLLF YGVTGSGKT++M G     G++ R++  +F  +     KR++ KPD++NG +V  + DAL +     +  S       R  D +   + + IS  P E  K +        +VFVS +EIY N I DL            + G     R +T         ++ED+  NMY+    EVEV+S  EA   F +G++ RRIA T LN  SSRSH +F ++L +   D      L       V+QL L+DLAGSER  RT A G +L+EAG+IN SLM L++ +  LR     G+  ++ YR +K+THL K  F+   KVRM+VCV  K ++Y ETL V+ FAE ++E+ +
Sbjct:   20 NNQKDPVGVYCRVRPLGAEDEECCIEVISNTTIQLHAPDGLKANRNGEFKETQYSFKKVFGIKTTQRELFEDVAKPLAQDLIHGKNGLLFTYGVTGSGKTHTMTGSPGQGGLLPRSLDMIFNSIGPYQAKRYVFKPDDKNGMEVQNQVDALLDRQKRDSQTSVPKTPNTRRVDPE---FADMIS--PEEACKAEGVDEDSSYSVFVSYIEIYNNYIYDLLEETPFDPIKPKWNGAGTPVRNITEFIPPQSKILREDQNHNMYVAGCTEVEVKSTEEAFEVFWRGQKKRRIANTQLNRESSRSHSVFIVKLAQAPLDADGDNVLQDKNQVNVSQLCLVDLAGSERTSRTRAEGNRLREAGNINQSLMTLRTCIEVLRENQMCGTNKMVPYRDSKVTHLFKNYFDGEGKVRMVVCVNPKADDYEETLLVMRFAEMTQEVEV 453          

HSP 2 Score: 53.5286 bits (127), Expect = 9.479e-7
Identity = 41/140 (29.29%), Postives = 69/140 (49.29%), Query Frame = 3
Query: 1764 KSANKPDITKTWPSNKAHYNPRYNHQKENYLLHKDKHEIPTGTLNKFHVKNSIVSKNIKMKELGKASKYLLQRQSGANN-QFQTDYIEGNVTPTSGGGFAVELTGVETVKQ-SSYNNPRKRISSNSESPEYKKTKQEFSD 2177
            K +  P    T P  +  +   ++   E ++ HK    +   T+ + ++ N+I       K L K  KY+L  Q  A++ + QT  I+G V  T GGG +V+ T +ET+KQ +     RKR SS S  P+ +  +  ++D
Sbjct:  712 KRSASPSPAPTGPPVRPLHRRSHSAGGERWVDHKPTTNVDLDTVMQPNIPNAIKVNAPNEKALSKCDKYVLTHQEVASDGEIQTKLIKGEVFKTRGGGQSVQFTDIETLKQETPVAASRKRRSSES-GPDSEPMEGNWTD 850          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: kif20ba (kinesin family member 20Ba [Source:ZFIN;Acc:ZDB-GENE-041111-213])

HSP 1 Score: 186.037 bits (471), Expect = 2.679e-48
Identity = 131/429 (30.54%), Postives = 227/429 (52.91%), Query Frame = 3
Query:   78 EGVCVFCRLKPLNDENI-----KSCIQYENEFTISAVPPEIN---RKNTKEI-----KYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLN--FIKRFLIKPD-------------------ERNGFKVLGETDALFEIVSNKNNYSRRSGDHDCVAYMNAISDDPFEVNKVDNCTVFVSMVEIYGNNIKDLFIGKRE-ASREVTVK--EDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRIIT 1253
            E + V+ R++P +   I     + C+  +   T+   PP+ +   R + K +     ++ F++V+  + +Q ++F+     LV+++L  +N L+F YGVT +GKT++  G   NPG++ R++  +F  L      +  +KP                    +RN  K+  E+DA   I  + +      G    ++ +N+   D  E++     +++VS  EIY  NI DL       ASR+  ++  +D + N ++ ++K V+V S  EA+   + G+RN+ I+ T LN  SSRSH IF++R++K+  D       SV++L+L DLAGSER  +T   G +LKEAG+IN SL+ L   +N LR   +  ++  + +R +KLTH L+  F       MIV + Q    Y+ETLNVL F+  ++++ ++T
Sbjct:   42 EHLKVYLRIRPFSAVEIENGESQDCVTIQRPDTVLLKPPQTSLSARLSDKSVPVTAQRFQFSQVYGPDTTQKDIFDGTVNGLVRNVLEGQNSLVFTYGVTNAGKTFTFLGPDTNPGILPRSLNMIFSSLEGRIFTQMCLKPQRCRDFIRLTKEQQNEEAASKRNLLKLFKESDAQRSISGHCSKSDIEDGSM--LSDVNSAVLD-VEMDMHTRFSIWVSFCEIYNENIHDLLEQHASNASRKTNLRLCQDVKGNSFIKDLKWVQVSSAEEALKVMKLGKRNQSISSTKLNLLSSRSHSIFSVRILKVE-DVGIPRVESVSELALCDLAGSERCAKTQNKGERLKEAGNINTSLLSLGKCINALRNNQQ--ARQHVPFRESKLTHYLQGYFTGRGSACMIVNINQCSSMYDETLNVLKFSAVAQKVVVLT 464          
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Match: kif20ba (kinesin family member 20Ba [Source:ZFIN;Acc:ZDB-GENE-041111-213])

HSP 1 Score: 186.037 bits (471), Expect = 2.679e-48
Identity = 131/429 (30.54%), Postives = 227/429 (52.91%), Query Frame = 3
Query:   78 EGVCVFCRLKPLNDENI-----KSCIQYENEFTISAVPPEIN---RKNTKEI-----KYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLN--FIKRFLIKPD-------------------ERNGFKVLGETDALFEIVSNKNNYSRRSGDHDCVAYMNAISDDPFEVNKVDNCTVFVSMVEIYGNNIKDLFIGKRE-ASREVTVK--EDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRIIT 1253
            E + V+ R++P +   I     + C+  +   T+   PP+ +   R + K +     ++ F++V+  + +Q ++F+     LV+++L  +N L+F YGVT +GKT++  G   NPG++ R++  +F  L      +  +KP                    +RN  K+  E+DA   I  + +      G    ++ +N+   D  E++     +++VS  EIY  NI DL       ASR+  ++  +D + N ++ ++K V+V S  EA+   + G+RN+ I+ T LN  SSRSH IF++R++K+  D       SV++L+L DLAGSER  +T   G +LKEAG+IN SL+ L   +N LR   +  ++  + +R +KLTH L+  F       MIV + Q    Y+ETLNVL F+  ++++ ++T
Sbjct:   42 EHLKVYLRIRPFSAVEIENGESQDCVTIQRPDTVLLKPPQTSLSARLSDKSVPVTAQRFQFSQVYGPDTTQKDIFDGTVNGLVRNVLEGQNSLVFTYGVTNAGKTFTFLGPDTNPGILPRSLNMIFSSLEGRIFTQMCLKPQRCRDFIRLTKEQQNEEAASKRNLLKLFKESDAQRSISGHCSKSDIEDGSM--LSDVNSAVLD-VEMDMHTRFSIWVSFCEIYNENIHDLLEQHASNASRKTNLRLCQDVKGNSFIKDLKWVQVSSAEEALKVMKLGKRNQSISSTKLNLLSSRSHSIFSVRILKVE-DVGIPRVESVSELALCDLAGSERCAKTQNKGERLKEAGNINTSLLSLGKCINALRNNQQ--ARQHVPFRESKLTHYLQGYFTGRGSACMIVNINQCSSMYDETLNVLKFSAVAQKVVVLT 464          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: cldn34 (claudin 34 [Source:Xenbase;Acc:XB-GENE-6462643])

HSP 1 Score: 286.96 bits (733), Expect = 8.745e-84
Identity = 168/422 (39.81%), Postives = 250/422 (59.24%), Query Frame = 3
Query:   69 NTVEGVCVFCRLKPLNDENIKSCIQYENEFTISAVPPEINRKNT----KEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRL-NF-IKRFLIKPDERNGFKVLGETDALFE--------IVSNKNNYSRRSGDHDCVAYMNAISDDPFEVNKVDN---CTVFVSMVEIYGNNIKDLFIG------KREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVK--LNRDKSN----GECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRI 1247
            N  + V V+CR++PL+  + + CI+  NE T+   PP+  + N     KE +Y++ +VF    +Q E+F+ V+ PLV+D++  +NGLLF YGVTGSGKT++M G   + G++ R +  +F  + NF  KR++ KPD++NG  V  E DAL E         +  +   SR+  D +    +N    +  +V  VD     +VFVS +EIY N I DL         K +  +   ++ED   NMY+    EVEV+S  EA   F KG++ RRIA T LN  SSRSH +F I+L +  L+ D  N     E ++++QLSL+DLAGSER  RT A G++L+EAG+IN SLM L++ +  LR     G+  ++ YR +KLTHL K  F+   KVRMIVCV  K +++ E+L V+ FAE ++E+ +
Sbjct:   22 NQKDPVGVYCRVRPLSPSDQECCIEVINETTVQLHPPDGCKANRNGEYKETQYSYKQVFGTQVTQKELFDVVSRPLVEDVIRGKNGLLFTYGVTGSGKTHTMTGSPGDGGLLPRCLSMIFNSIGNFQAKRYVFKPDDKNGMDVQNEVDALLERQKREVQPQLITRTPLSRQRMDPEFADMINI--QEQCKVEDVDEDSVYSVFVSYIEIYNNYIYDLLEEVPLDPIKPKPPQSRILREDLNHNMYIAGCTEVEVKSTEEAFDIFWKGQKRRRIANTQLNRESSRSHSVFMIKLAQAPLDADGDNVLQEREQITLSQLSLVDLAGSERTNRTKAEGSRLREAGNINQSLMTLRTCIEVLRENQLCGTNKMVPYRDSKLTHLFKNYFDGEGKVRMIVCVNPKADDFEESLQVMRFAEMTQEVEV 441          

HSP 2 Score: 62.3882 bits (150), Expect = 2.581e-9
Identity = 41/126 (32.54%), Postives = 69/126 (54.76%), Query Frame = 3
Query: 1821 NPRYNHQK----ENYLLHKDKHEIPTGTLNKFHVKNSIVSKNIKMKELGKASKYLL-QRQSGANNQFQTDYIEGNVTPTSGGGFAVELTGVETVK-QSSYNNPRKRISSNS-ESPEYKKTKQEFSD 2177
            +PR+   +    E ++ HK    + T T+ + H+  SI       K L K  KY+L  +Q  ++ + +T  I+G+V  T GGG +V+ T +ET++ QS  +  RKR SS S + P+ + T  E++D
Sbjct:  802 HPRHRRSRSAGTERWVDHKPTSSVETDTVMQPHIPKSIKVSVASEKALAKCEKYMLTHQQLASDGEIETKLIKGDVFKTRGGGQSVQFTDIETLRQQSPPSGGRKRRSSPSNQPPQGETTDSEWTD 927          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: cldn34 (claudin 34 [Source:Xenbase;Acc:XB-GENE-6462643])

HSP 1 Score: 280.026 bits (715), Expect = 2.486e-82
Identity = 169/433 (39.03%), Postives = 250/433 (57.74%), Query Frame = 3
Query:   69 NTVEGVCVFCRLKPLNDENIKSCIQYENEFTISAVPPEINRKNT----KEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRL-NF-IKRFLIKPDERNGFKVLGETDALFE--------IVSNKNNYSRRSGDHDCVAYMNAISDDPFEVNKVDN---CTVFVSMVEIYGNNIKDLF-------------IGKREA----SREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVK--LNRDKSN----GECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRI 1247
            N  + V V+CR++PL+  + + CI+  NE T+   PP+  + N     KE +Y++ +VF    +Q E+F+ V+ PLV+D++  +NGLLF YGVTGSGKT++M G   + G++ R +  +F  + NF  KR++ KPD++NG  V  E DAL E         +  +   SR+  D +    +N    +  +V  VD     +VFVS +EIY N I DL                 R A     +   ++ED   NMY+    EVEV+S  EA   F KG++ RRIA T LN  SSRSH +F I+L +  L+ D  N     E ++++QLSL+DLAGSER  RT A G++L+EAG+IN SLM L++ +  LR     G+  ++ YR +KLTHL K  F+   KVRMIVCV  K +++ E+L V+ FAE ++E+ +
Sbjct:   22 NQKDPVGVYCRVRPLSPSDQECCIEVINETTVQLHPPDGCKANRNGEYKETQYSYKQVFGTQVTQKELFDVVSRPLVEDVIRGKNGLLFTYGVTGSGKTHTMTGSPGDGGLLPRCLSMIFNSIGNFQAKRYVFKPDDKNGMDVQNEVDALLERQKREVQPQLITRTPLSRQRMDPEFADMINI--QEQCKVEDVDEDSVYSVFVSYIEIYNNYIYDLLEEVPLDPIKPKWNTPGRNAEFIPPQSRILREDLNHNMYIAGCTEVEVKSTEEAFDIFWKGQKRRRIANTQLNRESSRSHSVFMIKLAQAPLDADGDNVLQEREQITLSQLSLVDLAGSERTNRTKAEGSRLREAGNINQSLMTLRTCIEVLRENQLCGTNKMVPYRDSKLTHLFKNYFDGEGKVRMIVCVNPKADDFEESLQVMRFAEMTQEVEV 452          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: cldn34 (claudin 34 [Source:Xenbase;Acc:XB-GENE-6462643])

HSP 1 Score: 280.796 bits (717), Expect = 5.655e-82
Identity = 169/433 (39.03%), Postives = 250/433 (57.74%), Query Frame = 3
Query:   69 NTVEGVCVFCRLKPLNDENIKSCIQYENEFTISAVPPEINRKNT----KEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRL-NF-IKRFLIKPDERNGFKVLGETDALFE--------IVSNKNNYSRRSGDHDCVAYMNAISDDPFEVNKVDN---CTVFVSMVEIYGNNIKDLF-------------IGKREA----SREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVK--LNRDKSN----GECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRI 1247
            N  + V V+CR++PL+  + + CI+  NE T+   PP+  + N     KE +Y++ +VF    +Q E+F+ V+ PLV+D++  +NGLLF YGVTGSGKT++M G   + G++ R +  +F  + NF  KR++ KPD++NG  V  E DAL E         +  +   SR+  D +    +N    +  +V  VD     +VFVS +EIY N I DL                 R A     +   ++ED   NMY+    EVEV+S  EA   F KG++ RRIA T LN  SSRSH +F I+L +  L+ D  N     E ++++QLSL+DLAGSER  RT A G++L+EAG+IN SLM L++ +  LR     G+  ++ YR +KLTHL K  F+   KVRMIVCV  K +++ E+L V+ FAE ++E+ +
Sbjct:   22 NQKDPVGVYCRVRPLSPSDQECCIEVINETTVQLHPPDGCKANRNGEYKETQYSYKQVFGTQVTQKELFDVVSRPLVEDVIRGKNGLLFTYGVTGSGKTHTMTGSPGDGGLLPRCLSMIFNSIGNFQAKRYVFKPDDKNGMDVQNEVDALLERQKREVQPQLITRTPLSRQRMDPEFADMINI--QEQCKVEDVDEDSVYSVFVSYIEIYNNYIYDLLEEVPLDPIKPKWNTPGRNAEFIPPQSRILREDLNHNMYIAGCTEVEVKSTEEAFDIFWKGQKRRRIANTQLNRESSRSHSVFMIKLAQAPLDADGDNVLQEREQITLSQLSLVDLAGSERTNRTKAEGSRLREAGNINQSLMTLRTCIEVLRENQLCGTNKMVPYRDSKLTHLFKNYFDGEGKVRMIVCVNPKADDFEESLQVMRFAEMTQEVEV 452          

HSP 2 Score: 62.3882 bits (150), Expect = 2.704e-9
Identity = 41/126 (32.54%), Postives = 69/126 (54.76%), Query Frame = 3
Query: 1821 NPRYNHQK----ENYLLHKDKHEIPTGTLNKFHVKNSIVSKNIKMKELGKASKYLL-QRQSGANNQFQTDYIEGNVTPTSGGGFAVELTGVETVKQSS-YNNPRKRISSNS-ESPEYKKTKQEFSD 2177
            +PR+   +    E ++ HK    + T T+ + H+  SI       K L K  KY+L  +Q  ++ + +T  I+G+V  T GGG +V+ T +ET++Q S  +  RKR SS S + P+ + T  E++D
Sbjct:  725 HPRHRRSRSAGTERWVDHKPTSSVETDTVMQPHIPKSIKVSVASEKALAKCEKYMLTHQQLASDGEIETKLIKGDVFKTRGGGQSVQFTDIETLRQQSPPSGGRKRRSSPSNQPPQGETTDSEWTD 850          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: cldn34 (claudin 34 [Source:Xenbase;Acc:XB-GENE-6462643])

HSP 1 Score: 281.182 bits (718), Expect = 1.405e-81
Identity = 169/433 (39.03%), Postives = 250/433 (57.74%), Query Frame = 3
Query:   69 NTVEGVCVFCRLKPLNDENIKSCIQYENEFTISAVPPEINRKNT----KEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRL-NF-IKRFLIKPDERNGFKVLGETDALFE--------IVSNKNNYSRRSGDHDCVAYMNAISDDPFEVNKVDN---CTVFVSMVEIYGNNIKDLF-------------IGKREA----SREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVK--LNRDKSN----GECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRI 1247
            N  + V V+CR++PL+  + + CI+  NE T+   PP+  + N     KE +Y++ +VF    +Q E+F+ V+ PLV+D++  +NGLLF YGVTGSGKT++M G   + G++ R +  +F  + NF  KR++ KPD++NG  V  E DAL E         +  +   SR+  D +    +N    +  +V  VD     +VFVS +EIY N I DL                 R A     +   ++ED   NMY+    EVEV+S  EA   F KG++ RRIA T LN  SSRSH +F I+L +  L+ D  N     E ++++QLSL+DLAGSER  RT A G++L+EAG+IN SLM L++ +  LR     G+  ++ YR +KLTHL K  F+   KVRMIVCV  K +++ E+L V+ FAE ++E+ +
Sbjct:   22 NQKDPVGVYCRVRPLSPSDQECCIEVINETTVQLHPPDGCKANRNGEYKETQYSYKQVFGTQVTQKELFDVVSRPLVEDVIRGKNGLLFTYGVTGSGKTHTMTGSPGDGGLLPRCLSMIFNSIGNFQAKRYVFKPDDKNGMDVQNEVDALLERQKREVQPQLITRTPLSRQRMDPEFADMINI--QEQCKVEDVDEDSVYSVFVSYIEIYNNYIYDLLEEVPLDPIKPKWNTPGRNAEFIPPQSRILREDLNHNMYIAGCTEVEVKSTEEAFDIFWKGQKRRRIANTQLNRESSRSHSVFMIKLAQAPLDADGDNVLQEREQITLSQLSLVDLAGSERTNRTKAEGSRLREAGNINQSLMTLRTCIEVLRENQLCGTNKMVPYRDSKLTHLFKNYFDGEGKVRMIVCVNPKADDFEESLQVMRFAEMTQEVEV 452          

HSP 2 Score: 62.3882 bits (150), Expect = 2.847e-9
Identity = 41/126 (32.54%), Postives = 69/126 (54.76%), Query Frame = 3
Query: 1821 NPRYNHQK----ENYLLHKDKHEIPTGTLNKFHVKNSIVSKNIKMKELGKASKYLL-QRQSGANNQFQTDYIEGNVTPTSGGGFAVELTGVETVK-QSSYNNPRKRISSNS-ESPEYKKTKQEFSD 2177
            +PR+   +    E ++ HK    + T T+ + H+  SI       K L K  KY+L  +Q  ++ + +T  I+G+V  T GGG +V+ T +ET++ QS  +  RKR SS S + P+ + T  E++D
Sbjct:  813 HPRHRRSRSAGTERWVDHKPTSSVETDTVMQPHIPKSIKVSVASEKALAKCEKYMLTHQQLASDGEIETKLIKGDVFKTRGGGQSVQFTDIETLRQQSPPSGGRKRRSSPSNQPPQGETTDSEWTD 938          
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Match: cldn34 (claudin 34 [Source:Xenbase;Acc:XB-GENE-6462643])

HSP 1 Score: 276.944 bits (707), Expect = 7.169e-81
Identity = 165/415 (39.76%), Postives = 248/415 (59.76%), Query Frame = 3
Query:   90 VFCRLKPLNDENIKSCIQYENEFTISAVPPEINRKNT----KEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRL-NF-IKRFLIKPDERNGFKVLGETDALFE--------IVSNKNNYSRRSGDHDCVAYMNAISDDPFEVNKVDN---CTVFVSMVEIYGNNIKDLF------IGKREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVK--LNRDKSN----GECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRI 1247
            V+CR++PL+  + + CI+  NE T+   PP+  + N     KE +Y++ +VF    +Q E+F+ V+ PLV+D++  +NGLLF YGVTGSGKT++M G   + G++ R +  +F  + NF  KR++ KPD++NG  V  E DAL E         +  +   SR+  D +    +N    +  +V  VD     +VFVS +EIY N I DL         K +  +   ++ED   NMY+    EVEV+S  EA   F KG++ RRIA T LN  SSRSH +F I+L +  L+ D  N     E ++++QLSL+DLAGSER  RT A G++L+EAG+IN SLM L++ +  LR +++     ++ YR +KLTHL K  F+   KVRMIVCV  K +++ E+L V+ FAE ++E+ +
Sbjct:    4 VYCRVRPLSPSDQECCIEVINETTVQLHPPDGCKANRNGEYKETQYSYKQVFGTQVTQKELFDVVSRPLVEDVIRGKNGLLFTYGVTGSGKTHTMTGSPGDGGLLPRCLSMIFNSIGNFQAKRYVFKPDDKNGMDVQNEVDALLERQKREVQPQLITRTPLSRQRMDPEFADMINI--QEQCKVEDVDEDSVYSVFVSYIEIYNNYIYDLLEEVPLDPIKPKPPQSRILREDLNHNMYIAGCTEVEVKSTEEAFDIFWKGQKRRRIANTQLNRESSRSHSVFMIKLAQAPLDADGDNVLQEREQITLSQLSLVDLAGSERTNRTKAEGSRLREAGNINQSLMTLRTCIEVLR-ENQLYVYVMVPYRDSKLTHLFKNYFDGEGKVRMIVCVNPKADDFEESLQVMRFAEMTQEVEV 415          

HSP 2 Score: 62.003 bits (149), Expect = 3.515e-9
Identity = 39/114 (34.21%), Postives = 64/114 (56.14%), Query Frame = 3
Query: 1845 ENYLLHKDKHEIPTGTLNKFHVKNSIVSKNIKMKELGKASKYLL-QRQSGANNQFQTDYIEGNVTPTSGGGFAVELTGVETVKQSS-YNNPRKRISSNS-ESPEYKKTKQEFSD 2177
            E ++ HK    + T T+ + H+  SI       K L K  KY+L  +Q  ++ + +T  I+G+V  T GGG +V+ T +ET++Q S  +  RKR SS S + P+ + T  E++D
Sbjct:  694 ERWVDHKPTSSVETDTVMQPHIPKSIKVSVASEKALAKCEKYMLTHQQLASDGEIETKLIKGDVFKTRGGGQSVQFTDIETLRQQSPPSGGRKRRSSPSNQPPQGETTDSEWTD 807          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kif23 (kinesin family member 23 [Source:MGI Symbol;Acc:MGI:1919069])

HSP 1 Score: 281.952 bits (720), Expect = 1.978e-85
Identity = 173/435 (39.77%), Postives = 251/435 (57.70%), Query Frame = 3
Query:   69 NTVEGVCVFCRLKPLNDENIKSCIQYENEFTISAVPPEINRKNT----KEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNFI--KRFLIKPDERNGFKVLGETDALFE------IVSNKNNYSRRSGDHDCVAYMNAISDDPF----EVNKVDNCTVFVSMVEIYGNNIKDLF----------------IGKREA----SREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVK--LNRDKSN----GECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRI 1247
            N  + V V+CR++PL+  + + C++  N  T+    PE  R N     KE +Y+F +VF  + +Q E+F+ VA PLV DL++ +NGLLF YGVTGSGKTY+M G   + G++ R +  +F  +     KR++ K ++RN  ++  E DAL E      +   K   S+R  D +   + + I+   F    EV++     VFVS +EIY N I DL                    R A     +  T++EDK  NMY+    EVEV+S  EA   F +G++ RRIA T+LN  SSRSH +F+I+LV+  L+ D  N     E ++++QLSL+DLAGSER  RT A G +L+EAG+IN SLM L++ M  LR     G+  ++ YR +KLTHL K  F+   KVRMIVCV  K E+Y E+L V+ FAE ++E+ +
Sbjct:   21 NLKDPVGVYCRVRPLSFPDQECCVEVINSTTLQLHTPEGYRLNRNGDYKETQYSFKRVFGTHTTQKELFDVVANPLVDDLIHGKNGLLFTYGVTGSGKTYTMTGSPGSGGLLPRCLNMIFNSIGSFQAKRYVFKSNDRNSMEIQCEVDALLERQKREALPIPKTPSSKRQADPE---FADMINVQEFCKAEEVDEDSVYGVFVSYIEIYNNYIYDLLEEVQFDPIKPKWNGCSTPMRNAESVLPQSKTLREDKNHNMYVAGCTEVEVKSTEEAFEVFWRGQKKRRIANTHLNRESSRSHSVFSIKLVQAPLDADGDNVLQEKEQITISQLSLVDLAGSERTNRTKAEGNRLREAGNINQSLMTLRTCMEVLRENQTYGTNKMVPYRDSKLTHLFKNYFDGEGKVRMIVCVNPKAEDYEESLQVMRFAEVTQEVEV 452          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kif23 (kinesin family member 23 [Source:MGI Symbol;Acc:MGI:1919069])

HSP 1 Score: 290.041 bits (741), Expect = 4.424e-85
Identity = 172/421 (40.86%), Postives = 251/421 (59.62%), Query Frame = 3
Query:   69 NTVEGVCVFCRLKPLNDENIKSCIQYENEFTISAVPPEINRKNT----KEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNFI--KRFLIKPDERNGFKVLGETDALFE------IVSNKNNYSRRSGDHDCVAYMNAISDDPF----EVNKVDNCTVFVSMVEIYGNNIKDLFIG------KREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVK--LNRDKSN----GECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRI 1247
            N  + V V+CR++PL+  + + C++  N  T+    PE  R N     KE +Y+F +VF  + +Q E+F+ VA PLV DL++ +NGLLF YGVTGSGKTY+M G   + G++ R +  +F  +     KR++ K ++RN  ++  E DAL E      +   K   S+R  D +   + + I+   F    EV++     VFVS +EIY N I DL         K +  +  T++EDK  NMY+    EVEV+S  EA   F +G++ RRIA T+LN  SSRSH +F+I+LV+  L+ D  N     E ++++QLSL+DLAGSER  RT A G +L+EAG+IN SLM L++ M  LR     G+  ++ YR +KLTHL K  F+   KVRMIVCV  K E+Y E+L V+ FAE ++E+ +
Sbjct:   21 NLKDPVGVYCRVRPLSFPDQECCVEVINSTTLQLHTPEGYRLNRNGDYKETQYSFKRVFGTHTTQKELFDVVANPLVDDLIHGKNGLLFTYGVTGSGKTYTMTGSPGSGGLLPRCLNMIFNSIGSFQAKRYVFKSNDRNSMEIQCEVDALLERQKREALPIPKTPSSKRQADPE---FADMINVQEFCKAEEVDEDSVYGVFVSYIEIYNNYIYDLLEEVQFDPIKPKLPQSKTLREDKNHNMYVAGCTEVEVKSTEEAFEVFWRGQKKRRIANTHLNRESSRSHSVFSIKLVQAPLDADGDNVLQEKEQITISQLSLVDLAGSERTNRTKAEGNRLREAGNINQSLMTLRTCMEVLRENQTYGTNKMVPYRDSKLTHLFKNYFDGEGKVRMIVCVNPKAEDYEESLQVMRFAEVTQEVEV 438          

HSP 2 Score: 62.003 bits (149), Expect = 2.334e-9
Identity = 37/110 (33.64%), Postives = 58/110 (52.73%), Query Frame = 3
Query: 1851 YLLHKDKHEIPTGTLNKFHVKNSIVSKNIKMKELGKASKYLLQRQS-GANNQFQTDYIEGNVTPTSGGGFAVELTGVETVKQSSYNNPRKRISSNSESPEYKKTKQEFSD 2177
            ++ HK    + T T+ + HV ++I       K L K  KY+L  Q   ++ + QT  I+G+V  T GGG +V+ T +ET+KQ      RKR SS     +   T+ E++D
Sbjct:  812 WVDHKPASNVQTETVMQPHVPHAITVSVANEKALAKCEKYMLTHQELASDGEIQTKVIKGDVYKTRGGGQSVQFTDIETLKQELPTGSRKRRSSTLAPAQPDGTESEWTD 921          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kif20b (kinesin family member 20B [Source:MGI Symbol;Acc:MGI:2444576])

HSP 1 Score: 187.578 bits (475), Expect = 8.672e-49
Identity = 134/424 (31.60%), Postives = 220/424 (51.89%), Query Frame = 3
Query:   84 VCVFCRLKPLN----DENIKSCIQYENEFTISAVPPE-----INRKNTKEI--KYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLN--FIKRFLIKPDERNGFKVLGETDALFEIVSNKNNYSRR---------SGDHDCVAYMNAISDDPFE--VNKVDNC---------TVFVSMVEIYGNNIKDLFI---GKREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRI 1247
            VC+  R++P      +   + C+Q  +  ++    P+     ++ K++ ++  K++F+KVF    SQ E F       VKDLL   + L+F YG+T SGKTY+ +G  EN G++ RT+  LF  L      +   KP     +  L  +D   E  +NKN   R+         S D  C    N+++   FE  VN  D           +V+VS  EIY  +I DLF+    K +  + + + +D +   ++ +++ V+V    EA    + G +++ +A T LNN SSRSH IF IR++++  D        V++LSL DLAGSER+ +T   G +L+EAG+IN SL+ L   +N L+   K+  +  + +R +KLTH  ++ F    K+ MI+ + Q    Y+ETLNVL F+  ++ + +
Sbjct:   61 VCL--RIRPFTQSEKEHEAEGCVQVLDSQSVLLKDPQSILGHLSEKSSGQVAQKFSFSKVFGPETSQKEFFLGCIMQPVKDLLEGHSRLIFTYGLTNSGKTYTFQGTEENIGILPRTLNVLFDSLQERLYTKMSFKPHRCREYLKLS-SDQEKEESANKNTLLRQIKEVTIHNDSYDVLCGHLTNSLTIPEFEESVNSCDQSSLNVDNIKYSVWVSFFEIYNESIYDLFVPVSSKFQKRKMLRLSQDIKGYSFIKDLQWVQVSDSKEAYRLLKLGVKHQSVAFTKLNNASSRSHSIFTIRILQIE-DSEIPRVTRVSELSLCDLAGSERSMKTQNEGERLREAGNINTSLLTLGKCINVLKNSEKSKVQH-VPFRESKLTHYFQSFFTGKGKICMIINISQSCSAYDETLNVLKFSTTAQRVYV 479          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kif20b (kinesin family member 20B [Source:MGI Symbol;Acc:MGI:2444576])

HSP 1 Score: 187.578 bits (475), Expect = 9.382e-49
Identity = 134/424 (31.60%), Postives = 220/424 (51.89%), Query Frame = 3
Query:   84 VCVFCRLKPLN----DENIKSCIQYENEFTISAVPPE-----INRKNTKEI--KYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLN--FIKRFLIKPDERNGFKVLGETDALFEIVSNKNNYSRR---------SGDHDCVAYMNAISDDPFE--VNKVDNC---------TVFVSMVEIYGNNIKDLFI---GKREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRI 1247
            VC+  R++P      +   + C+Q  +  ++    P+     ++ K++ ++  K++F+KVF    SQ E F       VKDLL   + L+F YG+T SGKTY+ +G  EN G++ RT+  LF  L      +   KP     +  L  +D   E  +NKN   R+         S D  C    N+++   FE  VN  D           +V+VS  EIY  +I DLF+    K +  + + + +D +   ++ +++ V+V    EA    + G +++ +A T LNN SSRSH IF IR++++  D        V++LSL DLAGSER+ +T   G +L+EAG+IN SL+ L   +N L+   K+  +  + +R +KLTH  ++ F    K+ MI+ + Q    Y+ETLNVL F+  ++ + +
Sbjct:   61 VCL--RIRPFTQSEKEHEAEGCVQVLDSQSVLLKDPQSILGHLSEKSSGQVAQKFSFSKVFGPETSQKEFFLGCIMQPVKDLLEGHSRLIFTYGLTNSGKTYTFQGTEENIGILPRTLNVLFDSLQERLYTKMSFKPHRCREYLKLS-SDQEKEESANKNTLLRQIKEVTIHNDSYDVLCGHLTNSLTIPEFEESVNSCDQSSLNVDNIKYSVWVSFFEIYNESIYDLFVPVSSKFQKRKMLRLSQDIKGYSFIKDLQWVQVSDSKEAYRLLKLGVKHQSVAFTKLNNASSRSHSIFTIRILQIE-DSEIPRVTRVSELSLCDLAGSERSMKTQNEGERLREAGNINTSLLTLGKCINVLKNSEKSKVQH-VPFRESKLTHYFQSFFTGKGKICMIINISQSCSAYDETLNVLKFSTTAQRVYV 479          
BLAST of Kinesin-like protein vs. Ensembl Mouse
Match: Kif18a (kinesin family member 18A [Source:MGI Symbol;Acc:MGI:2446977])

HSP 1 Score: 167.162 bits (422), Expect = 1.731e-42
Identity = 119/402 (29.60%), Postives = 187/402 (46.52%), Query Frame = 3
Query:   66 DNTVEGVCVFCRLKPLNDENIKSCIQYENEFTI----SAVPPEINRKNTKEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNFIKRFLIKPDERNGFKVLGETDALFEIVSNKNNYSRRSGDHDCVAYMNAISDDPFEVNKVDNCTVFVSMVEIYGNNIKDLFIGKREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKL-----RMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIR 1244
            +NT E    FC++  + D++I S    + E +          +I ++  K++K+ F  VF+  ++Q EVF     P++   LN  N  +FAYG TGSGKT++M G A  PGV+  T+  L                   FK + E                                    + +   C+  VS +E+Y   I+DL       S  + V+ED +  + +  +   + +S  E +     G +NR    T++N  SSRSH +F I L + ++  S  + + + ++SLIDLAGSERA  +GA G++  E  +IN SL+ L +++N L     R +H       I YR +KLT LLK S   NC+  MI  V      Y++T N L +A  +KEI+
Sbjct:   21 ENTKEKAVQFCKVVHVVDKHILSFDPKQEEISFFHRKKTTNFDITKRQNKDLKFVFDAVFDETSTQMEVFEHTTKPILHSFLNGYNCTVFAYGATGSGKTHTMLGSAAEPGVMYLTMLDL-------------------FKCIDE------------------------------------IKEEKECSTAVSYLEVYNEQIRDLLTN----SGPLAVREDSQKGVVVQGLTLHQPKSSEEILQLLDNGNKNRTQHPTDVNAVSSRSHAVFQIYLRQQDKTASINQNVRIAKMSLIDLAGSERASVSGAKGSRFVEGTNINKSLLALGNVINALANTKRRNQH-------IPYRNSKLTRLLKDSLGGNCQTIMIAAVSPSSLFYDDTYNTLKYANRAKEIK 356          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|E9Q5G3|KIF23_MOUSE (Kinesin-like protein KIF23 OS=Mus musculus OX=10090 GN=Kif23 PE=1 SV=1)

HSP 1 Score: 290.041 bits (741), Expect = 3.094e-84
Identity = 172/421 (40.86%), Postives = 251/421 (59.62%), Query Frame = 3
Query:   69 NTVEGVCVFCRLKPLNDENIKSCIQYENEFTISAVPPEINRKNT----KEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNFI--KRFLIKPDERNGFKVLGETDALFE------IVSNKNNYSRRSGDHDCVAYMNAISDDPF----EVNKVDNCTVFVSMVEIYGNNIKDLFIG------KREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVK--LNRDKSN----GECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRI 1247
            N  + V V+CR++PL+  + + C++  N  T+    PE  R N     KE +Y+F +VF  + +Q E+F+ VA PLV DL++ +NGLLF YGVTGSGKTY+M G   + G++ R +  +F  +     KR++ K ++RN  ++  E DAL E      +   K   S+R  D +   + + I+   F    EV++     VFVS +EIY N I DL         K +  +  T++EDK  NMY+    EVEV+S  EA   F +G++ RRIA T+LN  SSRSH +F+I+LV+  L+ D  N     E ++++QLSL+DLAGSER  RT A G +L+EAG+IN SLM L++ M  LR     G+  ++ YR +KLTHL K  F+   KVRMIVCV  K E+Y E+L V+ FAE ++E+ +
Sbjct:   21 NLKDPVGVYCRVRPLSFPDQECCVEVINSTTLQLHTPEGYRLNRNGDYKETQYSFKRVFGTHTTQKELFDVVANPLVDDLIHGKNGLLFTYGVTGSGKTYTMTGSPGSGGLLPRCLNMIFNSIGSFQAKRYVFKSNDRNSMEIQCEVDALLERQKREALPIPKTPSSKRQADPE---FADMINVQEFCKAEEVDEDSVYGVFVSYIEIYNNYIYDLLEEVQFDPIKPKLPQSKTLREDKNHNMYVAGCTEVEVKSTEEAFEVFWRGQKKRRIANTHLNRESSRSHSVFSIKLVQAPLDADGDNVLQEKEQITISQLSLVDLAGSERTNRTKAEGNRLREAGNINQSLMTLRTCMEVLRENQTYGTNKMVPYRDSKLTHLFKNYFDGEGKVRMIVCVNPKAEDYEESLQVMRFAEVTQEVEV 438          

HSP 2 Score: 62.003 bits (149), Expect = 1.633e-8
Identity = 37/110 (33.64%), Postives = 58/110 (52.73%), Query Frame = 3
Query: 1851 YLLHKDKHEIPTGTLNKFHVKNSIVSKNIKMKELGKASKYLLQRQS-GANNQFQTDYIEGNVTPTSGGGFAVELTGVETVKQSSYNNPRKRISSNSESPEYKKTKQEFSD 2177
            ++ HK    + T T+ + HV ++I       K L K  KY+L  Q   ++ + QT  I+G+V  T GGG +V+ T +ET+KQ      RKR SS     +   T+ E++D
Sbjct:  812 WVDHKPASNVQTETVMQPHVPHAITVSVANEKALAKCEKYMLTHQELASDGEIQTKVIKGDVYKTRGGGQSVQFTDIETLKQELPTGSRKRRSSTLAPAQPDGTESEWTD 921          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|Q02241|KIF23_HUMAN (Kinesin-like protein KIF23 OS=Homo sapiens OX=9606 GN=KIF23 PE=1 SV=3)

HSP 1 Score: 286.96 bits (733), Expect = 4.943e-83
Identity = 172/421 (40.86%), Postives = 249/421 (59.14%), Query Frame = 3
Query:   69 NTVEGVCVFCRLKPLNDENIKSCIQYENEFTISAVPPEINRKNT----KEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNFI--KRFLIKPDERNGFKVLGETDALFE------IVSNKNNYSRRSGDHDCVAYMNAISDDPF----EVNKVDNCTVFVSMVEIYGNNIKDLFIG------KREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVK--LNRDKSN----GECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRI 1247
            N  + V V+CR++PL   + + CI+  N  T+    PE  R N     KE +Y+F +VF  + +Q E+F+ VA PLV DL++ +NGLLF YGVTGSGKT++M G     G++ R +  +F  +     KR++ K ++RN   +  E DAL E      + + K + S+R  D +   + + I+   F    EV++     VFVS +EIY N I DL         K +  +   ++EDK  NMY+    EVEV+S  EA   F +G++ RRIA T+LN  SSRSH +FNI+LV+  L+ D  N     E ++++QLSL+DLAGSER  RT A G +L+EAG+IN SLM L++ M+ LR     G+  ++ YR +KLTHL K  F+   KVRMIVCV  K E+Y E L V+ FAE ++E+ +
Sbjct:   21 NLKDPVGVYCRVRPLGFPDQECCIEVINNTTVQLHTPEGYRLNRNGDYKETQYSFKQVFGTHTTQKELFDVVANPLVNDLIHGKNGLLFTYGVTGSGKTHTMTGSPGEGGLLPRCLDMIFNSIGSFQAKRYVFKSNDRNSMDIQCEVDALLERQKREAMPNPKTSSSKRQVDPE---FADMITVQEFCKAEEVDEDSVYGVFVSYIEIYNNYIYDLLEEVPFDPIKPKPPQSKLLREDKNHNMYVAGCTEVEVKSTEEAFEVFWRGQKKRRIANTHLNRESSRSHSVFNIKLVQAPLDADGDNVLQEKEQITISQLSLVDLAGSERTNRTRAEGNRLREAGNINQSLMTLRTCMDVLRENQMYGTNKMVPYRDSKLTHLFKNYFDGEGKVRMIVCVNPKAEDYEENLQVMRFAEVTQEVEV 438          

HSP 2 Score: 62.7734 bits (151), Expect = 1.059e-8
Identity = 36/112 (32.14%), Postives = 60/112 (53.57%), Query Frame = 3
Query: 1845 ENYLLHKDKHEIPTGTLNKFHVKNSIVSKNIKMKELGKASKYLLQRQS-GANNQFQTDYIEGNVTPTSGGGFAVELTGVETVKQSSYNNPRKRISSNSESPEYKKTKQEFSD 2177
            + ++ HK    + T T+ + HV ++I       K L K  KY+L  Q   ++ + +T  I+G++  T GGG +V+ T +ET+KQ S N  RKR SS     +    + E++D
Sbjct:  817 DRWVDHKPASNMQTETVMQPHVPHAITVSVANEKALAKCEKYMLTHQELASDGEIETKLIKGDIYKTRGGGQSVQFTDIETLKQESPNGSRKRRSSTVAPAQPDGAESEWTD 928          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|Q80WE4|KI20B_MOUSE (Kinesin-like protein KIF20B OS=Mus musculus OX=10090 GN=Kif20b PE=1 SV=3)

HSP 1 Score: 187.578 bits (475), Expect = 6.066e-48
Identity = 134/424 (31.60%), Postives = 220/424 (51.89%), Query Frame = 3
Query:   84 VCVFCRLKPLN----DENIKSCIQYENEFTISAVPPE-----INRKNTKEI--KYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLN--FIKRFLIKPDERNGFKVLGETDALFEIVSNKNNYSRR---------SGDHDCVAYMNAISDDPFE--VNKVDNC---------TVFVSMVEIYGNNIKDLFI---GKREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRI 1247
            VC+  R++P      +   + C+Q  +  ++    P+     ++ K++ ++  K++F+KVF    SQ E F       VKDLL   + L+F YG+T SGKTY+ +G  EN G++ RT+  LF  L      +   KP     +  L  +D   E  +NKN   R+         S D  C    N+++   FE  VN  D           +V+VS  EIY  +I DLF+    K +  + + + +D +   ++ +++ V+V    EA    + G +++ +A T LNN SSRSH IF IR++++  D        V++LSL DLAGSER+ +T   G +L+EAG+IN SL+ L   +N L+   K+  +  + +R +KLTH  ++ F    K+ MI+ + Q    Y+ETLNVL F+  ++ + +
Sbjct:   61 VCL--RIRPFTQSEKEHEAEGCVQVLDSQSVLLKDPQSILGHLSEKSSGQVAQKFSFSKVFGPETSQKEFFLGCIMQPVKDLLEGHSRLIFTYGLTNSGKTYTFQGTEENIGILPRTLNVLFDSLQERLYTKMSFKPHRCREYLKLS-SDQEKEESANKNTLLRQIKEVTIHNDSYDVLCGHLTNSLTIPEFEESVNSCDQSSLNVDNIKYSVWVSFFEIYNESIYDLFVPVSSKFQKRKMLRLSQDIKGYSFIKDLQWVQVSDSKEAYRLLKLGVKHQSVAFTKLNNASSRSHSIFTIRILQIE-DSEIPRVTRVSELSLCDLAGSERSMKTQNEGERLREAGNINTSLLTLGKCINVLKNSEKSKVQH-VPFRESKLTHYFQSFFTGKGKICMIINISQSCSAYDETLNVLKFSTTAQRVYV 479          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|Q96Q89|KI20B_HUMAN (Kinesin-like protein KIF20B OS=Homo sapiens OX=9606 GN=KIF20B PE=1 SV=3)

HSP 1 Score: 176.792 bits (447), Expect = 2.170e-44
Identity = 119/364 (32.69%), Postives = 189/364 (51.92%), Query Frame = 3
Query:  210 KYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLN--FIKRFLIKPDERNGFKVLGETDALFEIVSNKNNYSRR------SGDHDCVAY---MNAISDDPFEVNKVD------------NCTVFVSMVEIYGNNIKDLFI---GKREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFA 1223
            K++F+KVF    +Q E F       VKDLL  ++ L+F YG+T SGKTY+ +G  EN G++ RT+  LF  L      +  +KP     +  L       EI S K+   R+        D D   Y    N+++   FE +  D              +V+VS  EIY   I DLF+    K +  + + + +D +   ++ +++ ++V    EA    + G +++ +A T LNN SSRSH IF ++++++  D      + V++LSL DLAGSER  +T   G +L+E G+IN SL+ L   +N L+   K+  +  + +R +KLTH  ++ F    K+ MIV + Q    Y+ETLNVL F+
Sbjct:  112 KFSFSKVFGPATTQKEFFQGCIMQPVKDLLKGQSRLIFTYGLTNSGKTYTFQGTEENIGILPRTLNVLFDSLQERLYTKMNLKPHRSREYLRLSSEQEKEEIAS-KSALLRQIKEVTVHNDSDDTLYGSLTNSLNISEFEESIKDYEQANLNMANSIKFSVWVSFFEIYNEYIYDLFVPVSSKFQKRKMLRLSQDVKGYSFIKDLQWIQVSDSKEAYRLLKLGIKHQSVAFTKLNNASSRSHSIFTVKILQI-EDSEMSRVIRVSELSLCDLAGSERTMKTQNEGERLRETGNINTSLLTLGKCINVLKNSEKSKFQQHVPFRESKLTHYFQSFFNGKGKICMIVNISQCYLAYDETLNVLKFS 473          
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Match: sp|Q02224|CENPE_HUMAN (Centromere-associated protein E OS=Homo sapiens OX=9606 GN=CENPE PE=1 SV=2)

HSP 1 Score: 175.637 bits (444), Expect = 5.116e-44
Identity = 117/345 (33.91%), Postives = 175/345 (50.72%), Query Frame = 3
Query:  213 YTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNFIKRFLIKPDERNGFKVLGETDALFEIVSNKNNYSRRSGDHDCVAYMNAISDDPFEVNKVDNCTVFVSMVEIYGNNIKDLFIGKREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDK---SNGE-CLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSK 1235
            + F +VF+GN +   V+ ++A P++   +   NG +FAYG T SGKTY+M G  ++ GVI R I  +F++   IK+F   PD     +                           V+YM                       EIY   I DL  G ++  + + ++ED   N+Y+ ++ E  V +   A+ W  KGE++R   ET +N  SSRSH IF  R++  +R+K   SN E  + V+ L+L+DLAGSERA +TGA+G +LKE  +IN SL  L  ++ KL      G    I+YR +KLT +L+ S   N K R+I  +   P  ++ETL  L FA  +K
Sbjct:   47 FNFDRVFHGNETTKNVYEEIAAPIIDSAIQGYNGTIFAYGQTASGKTYTMMGSEDHLGVIPRAIHDIFQK---IKKF---PDREFLLR---------------------------VSYM-----------------------EIYNETITDLLCGTQKM-KPLIIREDVNRNVYVADLTEEVVYTSEMALKWITKGEKSRHYGETKMNQRSSRSHTIF--RMILESREKGEPSNCEGSVKVSHLNLVDLAGSERAAQTGAAGVRLKEGCNINRSLFILGQVIKKLSDGQVGG---FINYRDSKLTRILQNSLGGNAKTRIICTI--TPVSFDETLTALQFASTAK 327          
BLAST of Kinesin-like protein vs. TrEMBL
Match: A0A2C9JIG8 (Kinesin-like protein OS=Biomphalaria glabrata OX=6526 GN=106056579 PE=3 SV=1)

HSP 1 Score: 313.153 bits (801), Expect = 4.104e-92
Identity = 178/427 (41.69%), Postives = 259/427 (60.66%), Query Frame = 3
Query:   78 EGVCVFCRLKPLNDENIKSCIQYENEFTISAVPPEINRKN---TKEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLN--FIKRFLIKPDERNGFKVLGETDALFE-----IVSNKNNYSR------RSGDHDCVAYMNAISDDPFEVNKVD---NCTVFVSMVEIYGNNIKDLF-------IGKREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDK------SNGECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRIITRNE 1262
            E V V+CR++P++D     C++   +  +  +PPEI+      TKE +YTF +VF+  ASQ  VF+  A PLV+DL+  +NGLLF YGVTGSGKTY+M G  ++ G++ R +  LF  ++    K+++ +PD  N F+V  E DA+ E     I+ N    S+       SG+  C         DP +V+ V+   N  VFVS +EIY N + DL        I   +  +   ++ D   NMY+HN  EVEV+   +AI  F KG+R R++A T LN  SSRSH +FNIRLV+   D+       + E + V+QLSL+DLAGSER+ RT  SG +LKEAG+IN SLM L++ +  LR   KTG+  ++ YR ++LTHL K  F+ + KVRMIVCV  K  EY+ET++V+ FAE ++E+ +IT+++
Sbjct:   20 EPVEVYCRIRPIDDPGDTVCVKPIGDSLVQLIPPEISSLRNGVTKEYQYTFRQVFDETASQKAVFDQTALPLVEDLVAGKNGLLFTYGVTGSGKTYTMTGEPQDQGILPRCLDVLFNSIDNYQAKKYVFRPDRMNRFEVQTEADAMMERQRREIMPNLTTPSKASLKRPESGERIC---------DPTKVDTVEEDNNYAVFVSYIEIYNNYVYDLLEELPYNSITGYKPPQTKILRTDSGDNMYVHNCTEVEVKQSQDAIDVFYKGQRRRKVAHTALNAESSRSHSVFNIRLVQAPLDERGEEVVQDSEKICVSQLSLVDLAGSERSNRTKNSGDRLKEAGNINQSLMVLRNCLEVLRENQKTGASKMVPYRDSRLTHLFKNFFDGDGKVRMIVCVNPKMTEYDETIHVMKFAEMTQEV-LITKSQ 436          
BLAST of Kinesin-like protein vs. TrEMBL
Match: A0A0C9QSZ0 (Kinesin-like protein OS=Fopius arisanus OX=64838 GN=KIF23_1 PE=3 SV=1)

HSP 1 Score: 312.768 bits (800), Expect = 5.190e-91
Identity = 174/416 (41.83%), Postives = 252/416 (60.58%), Query Frame = 3
Query:   84 VCVFCRLKPLNDENIKSCIQYENEFTISAVPPEIN---RKNTKEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNF--IKRFLIKPDERNGFKVLGETDALFEIVS-----------NKNNYSRRSGDHDCVAYMNAISDDP--FEVNKVDNCTVFVSMVEIYGNNIKDLFIGKREASREV---TVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGE-------CLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRI 1247
            V V+CR++P+   +  SC+   +  TI   PPE +   R  TKEI+  FTKVF  + SQ E+F+DVA PLV++L+ ++N LLF YGVTGSGKT++M G   N G++ R +  LF  ++    K+F+ KPD  N F+V  ETDA+ +  S            K  Y R+  D D    +    D+     V++     VF+S VEIY N++ DL   +    + +    ++ED   NMY+H V ++EV+S  +A   FR+G+R RR+A T LN  SSRSH +F IRLV+   D S GE        +S++QLSL+DLAGSER  RT  +G +L+EAG+INNSLM L+S +  LR    +GS  I+ YR +KLTHL K  F+   +VRMIVCV  + ++Y+ET+ V+ FAE ++E+++
Sbjct:   29 VQVYCRVRPVQSPSDISCMNVISPTTILITPPESSTNFRSTTKEIQTVFTKVFTPDISQQEIFSDVALPLVENLIASKNALLFTYGVTGSGKTFTMTGENGNSGIMPRCLDVLFNSISSYQAKKFVFKPDPFNSFEVQSETDAMLDRQSELHAGLTTPRPQKTKYRRQDSDTDSNPPLPRSPDESHSLPVDEDSVYAVFISYVEIYNNSVYDLLDEEEPKGKTLQSKILREDGNKNMYVHMVTQIEVKSSEDAFEAFRRGQRKRRVAHTALNAESSRSHSVFTIRLVQGPLD-SQGENVVDDKRLISISQLSLVDLAGSERTNRTKNTGQRLREAGNINNSLMTLRSCLEILRENQTSGSNKIVPYRDSKLTHLFKNYFDGEGRVRMIVCVNPRSDDYDETIQVMKFAEMTQEVQV 443          
BLAST of Kinesin-like protein vs. TrEMBL
Match: E0VXW0 (Kinesin-like protein OS=Pediculus humanus subsp. corporis OX=121224 GN=8232936 PE=3 SV=1)

HSP 1 Score: 312.383 bits (799), Expect = 1.209e-90
Identity = 185/437 (42.33%), Postives = 268/437 (61.33%), Query Frame = 3
Query:   78 EGVCVFCRLKPLNDENIKSCIQYENEFTISAVPPEI-----NRKNTKEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNF--IKRFLIKPDERNGFKVLGETDALFEIVSNKNNY-------SRRSGDHDCVAYMNAISDDPFEVNKVDNC------TVFVSMVEIYGNNIKDLF-------IGKREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRD--KSNGECLS----VNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEI---RIIT-RNEYLPTP 1277
            E V V+CR+KP+ +  ++SC++  +  T+    PE      N  N KEI+YTF +VF+ + SQ E+F+ VAFPLV  L+N +NGLLF YGVTGSGKTY+M G   + G++ R I  +F  ++    K+F+ KPD+ NGF++  E++AL     N+  Y        +     DC    +A+ +   + NKV++        VFV+ +EIY NN+ DL        I K+  ++   ++ED   NMY+H V E+EV+S  EA   F KG+R +R+A TNLN  SSRSH IF IRLV+   +  +  G  L     V+QLSL+DLAGSER  RT  +G +L+EAG+INNSLM L++ +  LR   + GS  I+ YR +KLTHL K  F+ + +VRMIVCV  K E+Y+ET++VL FAE ++E+   R++T R ++  TP
Sbjct:   24 EPVEVYCRIKPIPN-TLESCLKLISSKTVQLFAPEGFSGYRNGLNGKEIQYTFKQVFDDSYSQKEIFDTVAFPLVHQLVNGKNGLLFTYGVTGSGKTYTMNGEHHDGGIMPRCIDVIFNSISHYQAKKFVFKPDKMNGFEIQDESEALL-CCQNELGYLTPGPKNPKTPKRKDCYGDGDALQNRTPDDNKVESLDEENMYAVFVTYIEIYNNNVHDLLDDSVEDLITKKLQNK--VIREDGNRNMYVHGVTEIEVKSPDEAFEVFYKGQRRKRMAHTNLNEESSRSHSIFTIRLVQAPTEALEEQGSVLKKYLVVSQLSLVDLAGSERTNRTKNTGQRLREAGNINNSLMCLRTCLEILRENQQNGSNKIVPYRDSKLTHLFKNYFDGDGQVRMIVCVNPKVEDYDETIHVLKFAEMTQEVQVPRLVTPRQDFCVTP 456          
BLAST of Kinesin-like protein vs. TrEMBL
Match: A0A0C9RES6 (Kinesin-like protein (Fragment) OS=Fopius arisanus OX=64838 GN=KIF23_0 PE=3 SV=1)

HSP 1 Score: 312.383 bits (799), Expect = 2.935e-90
Identity = 174/418 (41.63%), Postives = 253/418 (60.53%), Query Frame = 3
Query:   78 EGVCVFCRLKPLNDENIKSCIQYENEFTISAVPPEIN---RKNTKEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNF--IKRFLIKPDERNGFKVLGETDALFEIVS-----------NKNNYSRRSGDHDCVAYMNAISDDP--FEVNKVDNCTVFVSMVEIYGNNIKDLFIGKREASREV---TVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGE-------CLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRI 1247
            + V V+CR++P+   +  SC+   +  TI   PPE +   R  TKEI+  FTKVF  + SQ E+F+DVA PLV++L+ ++N LLF YGVTGSGKT++M G   N G++ R +  LF  ++    K+F+ KPD  N F+V  ETDA+ +  S            K  Y R+  D D    +    D+     V++     VF+S VEIY N++ DL   +    + +    ++ED   NMY+H V ++EV+S  +A   FR+G+R RR+A T LN  SSRSH +F IRLV+   D S GE        +S++QLSL+DLAGSER  RT  +G +L+EAG+INNSLM L+S +  LR    +GS  I+ YR +KLTHL K  F+   +VRMIVCV  + ++Y+ET+ V+ FAE ++E+++
Sbjct:   99 DPVQVYCRVRPVQSPSDISCMNVISPTTILITPPESSTNFRSTTKEIQTVFTKVFTPDISQQEIFSDVALPLVENLIASKNALLFTYGVTGSGKTFTMTGENGNSGIMPRCLDVLFNSISSYQAKKFVFKPDPFNSFEVQSETDAMLDRQSELHAGLTTPRPQKTKYRRQDSDTDSNPPLPRSPDESHSLPVDEDSVYAVFISYVEIYNNSVYDLLDEEEPKGKTLQSKILREDGNKNMYVHMVTQIEVKSSEDAFEAFRRGQRKRRVAHTALNAESSRSHSVFTIRLVQGPLD-SQGENVVDDKRLISISQLSLVDLAGSERTNRTKNTGQRLREAGNINNSLMTLRSCLEILRENQTSGSNKIVPYRDSKLTHLFKNYFDGEGRVRMIVCVNPRSDDYDETIQVMKFAEMTQEVQV 515          
BLAST of Kinesin-like protein vs. TrEMBL
Match: Q17HE6 (Kinesin-like protein OS=Aedes aegypti OX=7159 GN=AAEL002714 PE=3 SV=1)

HSP 1 Score: 310.457 bits (794), Expect = 7.724e-90
Identity = 183/421 (43.47%), Postives = 265/421 (62.95%), Query Frame = 3
Query:   84 VCVFCRLKPLNDENIKSCIQYENEFTISAVPPEI--NRK--NTKEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRL-NF-IKRFLIKPDERNGFKVLGETDALFEI---VSNKNNYSRRSGDHDCVAYMNAISDDPFEVNKVDN---CTVFVSMVEIYGNNIKDLF----IGKREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGE-------CLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRIITRNEYLPTP 1277
            V V+CR++PL  E+  SC++     T+   PPEI  N K  N KE +Y F  VF  +ASQ EV++ VA PLV+ L+  RNGLLF YGVTGSGKTY+M G   + G++ R + +LFR + +F  K+F+ KPD  NGF +L E DA+ E    + +K N ++R+ + D      A S +P E++ +D     +VF++ VE+Y N + DL     I K   S+   V+ED   NM++H V EVEV++  EA+  F+ G++ +R+  T LN  SSRSH +F IRLV+   D ++GE        ++++QLSL+DLAGSER  RTG +G +L+EAG+INNSLM L++ +  LR    TGS   + YR +K+THL K  F+   +VRMIVCV  + E+Y+ET  V+ FAE +++++ ITR    PTP
Sbjct:   34 VHVYCRVRPLPCESDLSCLRVTAHNTVVLTPPEIAINYKITNLKETQYIFKHVFEASASQHEVYSSVAQPLVEGLVRGRNGLLFTYGVTGSGKTYTMTGDIHHRGIMPRCLDALFRTIADFQAKKFVFKPDRLNGFDILSEADAMLERQAEMHSKMNKAKRNKELDPEIASKA-SVEPSELSGIDEDNIYSVFITYVEVYNNCVYDLLEETTIQKTLQSK--MVREDANRNMFVHGVTEVEVKTMDEALEVFQFGQKRKRVGHTILNAESSRSHSVFTIRLVQAPVD-NHGEHAVQDRNAVTISQLSLVDLAGSERTSRTGNTGQRLREAGNINNSLMTLRTCLEILRENQMTGSSKKVPYRDSKITHLFKNYFDGEGQVRMIVCVNPRAEDYDETAQVMKFAEMTQDVQ-ITR----PTP 445          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: kif23 (kinesin family member 23 [Source:NCBI gene;Acc:103039134])

HSP 1 Score: 283.108 bits (723), Expect = 2.824e-83
Identity = 167/422 (39.57%), Postives = 245/422 (58.06%), Query Frame = 3
Query:   69 NTVEGVCVFCRLKPLNDENIKSCIQYENEFTISAVPPEINRKNT----KEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNF--IKRFLIKPDERNGFKVLGETDALFEIVSN-------KNNYSRRSGDHDCVAYMNAIS-DDPFEVNKVD---NCTVFVSMVEIYGNNIKDLFIG------KREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECLS------VNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRI 1247
            N  + V V+CR++PL  ++ + C++  +  TI    P+  + N     KE +Y+F KVF    +Q E+F DVA PLV DL++ +NGLLF YGVTGSGKT++M G     G++ R++  +F  +     KRF+ KPDE+NG +V  + DAL E           K   SR+  D +   + + IS +D  +   VD   + +VFVS +EIY N I DL         K +A +   ++ED+  NMY+    E+EV+S  EA   F +G++ RRIA T LN  SSRSH +F I+L +   D      L       V+QL L+DLAGSER  RT A G++L+EAG+IN SLM L++ +  LR     G+  ++ YR +K+THL K  F+   KVRM+VCV  K ++Y ET+ V+ FAE ++E+ +
Sbjct:   20 NQKDPVGVYCRVRPLGADDEECCVEVISSTTIQLHAPDGLKANRNGEFKETQYSFKKVFGIKTTQRELFEDVAKPLVDDLIHCKNGLLFTYGVTGSGKTHTMTGSPGQGGLLPRSLDMIFNSIGPYQAKRFVFKPDEKNGMEVQNQVDALLERQKRESQQSVPKTPSSRQKVDPE---FADMISPEDACKCEGVDEDSSYSVFVSYIEIYNNYIYDLLEEAPFDPIKPKAPQSKILREDQNHNMYVAGCTELEVKSTEEAFEVFWRGQKKRRIANTQLNRESSRSHSVFIIKLAQAPLDADGDNVLQDKNQVNVSQLCLVDLAGSERTSRTRAEGSRLREAGNINQSLMTLRTCIEVLRENQMCGTNKMVPYRDSKVTHLFKNYFDGEGKVRMVVCVNPKADDYEETMLVMRFAEMTQEVEV 438          

HSP 2 Score: 57.3806 bits (137), Expect = 4.624e-8
Identity = 41/141 (29.08%), Postives = 68/141 (48.23%), Query Frame = 3
Query: 1764 KSANKPDITKTWPSNKAHYNPRYNHQK--ENYLLHKDKHEIPTGTLNKFHVKNSIVSKNIKMKELGKASKYLLQRQSGANN-QFQTDYIEGNVTPTSGGGFAVELTGVETVKQSSYNNPRKRISSNSESPEYKKTKQEFSD 2177
            +SA+   +  T P    H   R +H    E ++ HK    +   T+ + +V  +I       K L K  KY+L  Q  A++ + QT  I+G+V  T GGG AV+ T +ET+KQ +   P ++  S+   P       +++D
Sbjct:  688 RSASPSPVPTTQPVRPMH---RRSHSAGAERWVDHKPSTNVELDTVMQPNVPKAIKVTAPSEKALSKCDKYMLTHQEVASDGEIQTKLIKGDVIKTRGGGQAVQFTDIETLKQETPVAPSRKRRSSETGPNQDDKDGDWTD 825          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: kif23 (kinesin family member 23 [Source:NCBI gene;Acc:103039134])

HSP 1 Score: 283.108 bits (723), Expect = 1.136e-82
Identity = 167/422 (39.57%), Postives = 245/422 (58.06%), Query Frame = 3
Query:   69 NTVEGVCVFCRLKPLNDENIKSCIQYENEFTISAVPPEINRKNT----KEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNF--IKRFLIKPDERNGFKVLGETDALFEIVSN-------KNNYSRRSGDHDCVAYMNAIS-DDPFEVNKVD---NCTVFVSMVEIYGNNIKDLFIG------KREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECLS------VNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRI 1247
            N  + V V+CR++PL  ++ + C++  +  TI    P+  + N     KE +Y+F KVF    +Q E+F DVA PLV DL++ +NGLLF YGVTGSGKT++M G     G++ R++  +F  +     KRF+ KPDE+NG +V  + DAL E           K   SR+  D +   + + IS +D  +   VD   + +VFVS +EIY N I DL         K +A +   ++ED+  NMY+    E+EV+S  EA   F +G++ RRIA T LN  SSRSH +F I+L +   D      L       V+QL L+DLAGSER  RT A G++L+EAG+IN SLM L++ +  LR     G+  ++ YR +K+THL K  F+   KVRM+VCV  K ++Y ET+ V+ FAE ++E+ +
Sbjct:   21 NQKDPVGVYCRVRPLGADDEECCVEVISSTTIQLHAPDGLKANRNGEFKETQYSFKKVFGIKTTQRELFEDVAKPLVDDLIHCKNGLLFTYGVTGSGKTHTMTGSPGQGGLLPRSLDMIFNSIGPYQAKRFVFKPDEKNGMEVQNQVDALLERQKRESQQSVPKTPSSRQKVDPE---FADMISPEDACKCEGVDEDSSYSVFVSYIEIYNNYIYDLLEEAPFDPIKPKAPQSKILREDQNHNMYVAGCTELEVKSTEEAFEVFWRGQKKRRIANTQLNRESSRSHSVFIIKLAQAPLDADGDNVLQDKNQVNVSQLCLVDLAGSERTSRTRAEGSRLREAGNINQSLMTLRTCIEVLRENQMCGTNKMVPYRDSKVTHLFKNYFDGEGKVRMVVCVNPKADDYEETMLVMRFAEMTQEVEV 439          

HSP 2 Score: 54.6842 bits (130), Expect = 3.414e-7
Identity = 36/99 (36.36%), Postives = 54/99 (54.55%), Query Frame = 3
Query: 1845 ENYLLHKDKHEIPTGTLNKFHVKNSIVSKNIKMKELGKASKYLLQRQSGANN-QFQTDYIEGNVTPTSGGGFAVELTGVETVKQSSYNNP-RKRISSNS 2135
            E ++ HK    +   T+ + +V  +I       K L K  KY+L  Q  A++ + QT  I+G+V  T GGG AV+ T +ET+KQ +   P RKR SS +
Sbjct:  813 ERWVDHKPSTNVELDTVMQPNVPKAIKVTAPSEKALSKCDKYMLTHQEVASDGEIQTKLIKGDVIKTRGGGQAVQFTDIETLKQETPVAPSRKRRSSET 911          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: kif23 (kinesin family member 23 [Source:NCBI gene;Acc:103039134])

HSP 1 Score: 275.404 bits (703), Expect = 2.515e-80
Identity = 168/441 (38.10%), Postives = 245/441 (55.56%), Query Frame = 3
Query:   69 NTVEGVCVFCRLKPLNDENIKSCIQYENEFTISAVPPEINRKNT----KEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNF--IKRFLIKPDERNGFKVLGETDALFEIVSN-------KNNYSRRSGDHDCVAYMNAIS-DDPFEVNKVD---NCTVFVSMVEIYGNNIKDL-------------------------FIGKREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECLS------VNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRI 1247
            N  + V V+CR++PL  ++ + C++  +  TI    P+  + N     KE +Y+F KVF    +Q E+F DVA PLV DL++ +NGLLF YGVTGSGKT++M G     G++ R++  +F  +     KRF+ KPDE+NG +V  + DAL E           K   SR+  D +   + + IS +D  +   VD   + +VFVS +EIY N I DL                         FI    A +   ++ED+  NMY+    E+EV+S  EA   F +G++ RRIA T LN  SSRSH +F I+L +   D      L       V+QL L+DLAGSER  RT A G++L+EAG+IN SLM L++ +  LR     G+  ++ YR +K+THL K  F+   KVRM+VCV  K ++Y ET+ V+ FAE ++E+ +
Sbjct:   21 NQKDPVGVYCRVRPLGADDEECCVEVISSTTIQLHAPDGLKANRNGEFKETQYSFKKVFGIKTTQRELFEDVAKPLVDDLIHCKNGLLFTYGVTGSGKTHTMTGSPGQGGLLPRSLDMIFNSIGPYQAKRFVFKPDEKNGMEVQNQVDALLERQKRESQQSVPKTPSSRQKVDPE---FADMISPEDACKCEGVDEDSSYSVFVSYIEIYNNYIYDLLEEAPFDPIKPKWNGGGTPLRTNTEFI----APQSKILREDQNHNMYVAGCTELEVKSTEEAFEVFWRGQKKRRIANTQLNRESSRSHSVFIIKLAQAPLDADGDNVLQDKNQVNVSQLCLVDLAGSERTSRTRAEGSRLREAGNINQSLMTLRTCIEVLRENQMCGTNKMVPYRDSKVTHLFKNYFDGEGKVRMVVCVNPKADDYEETMLVMRFAEMTQEVEV 454          

HSP 2 Score: 57.3806 bits (137), Expect = 4.472e-8
Identity = 41/141 (29.08%), Postives = 68/141 (48.23%), Query Frame = 3
Query: 1764 KSANKPDITKTWPSNKAHYNPRYNHQK--ENYLLHKDKHEIPTGTLNKFHVKNSIVSKNIKMKELGKASKYLLQRQSGANN-QFQTDYIEGNVTPTSGGGFAVELTGVETVKQSSYNNPRKRISSNSESPEYKKTKQEFSD 2177
            +SA+   +  T P    H   R +H    E ++ HK    +   T+ + +V  +I       K L K  KY+L  Q  A++ + QT  I+G+V  T GGG AV+ T +ET+KQ +   P ++  S+   P       +++D
Sbjct:  715 RSASPSPVPTTQPVRPMH---RRSHSAGAERWVDHKPSTNVELDTVMQPNVPKAIKVTAPSEKALSKCDKYMLTHQEVASDGEIQTKLIKGDVIKTRGGGQAVQFTDIETLKQETPVAPSRKRRSSETGPNQDDKDGDWTD 852          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: kif23 (kinesin family member 23 [Source:NCBI gene;Acc:103039134])

HSP 1 Score: 275.789 bits (704), Expect = 6.778e-80
Identity = 168/442 (38.01%), Postives = 246/442 (55.66%), Query Frame = 3
Query:   66 DNTVEGVCVFCRLKPLNDENIKSCIQYENEFTISAVPPEINRKNT----KEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNF--IKRFLIKPDERNGFKVLGETDALFEIVSN-------KNNYSRRSGDHDCVAYMNAIS-DDPFEVNKVD---NCTVFVSMVEIYGNNIKDL-------------------------FIGKREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECLS------VNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRI 1247
            +N  + V V+CR++PL  ++ + C++  +  TI    P+  + N     KE +Y+F KVF    +Q E+F DVA PLV DL++ +NGLLF YGVTGSGKT++M G     G++ R++  +F  +     KRF+ KPDE+NG +V  + DAL E           K   SR+  D +   + + IS +D  +   VD   + +VFVS +EIY N I DL                         FI    A +   ++ED+  NMY+    E+EV+S  EA   F +G++ RRIA T LN  SSRSH +F I+L +   D      L       V+QL L+DLAGSER  RT A G++L+EAG+IN SLM L++ +  LR     G+  ++ YR +K+THL K  F+   KVRM+VCV  K ++Y ET+ V+ FAE ++E+ +
Sbjct:   20 NNQKDPVGVYCRVRPLGADDEECCVEVISSTTIQLHAPDGLKANRNGEFKETQYSFKKVFGIKTTQRELFEDVAKPLVDDLIHCKNGLLFTYGVTGSGKTHTMTGSPGQGGLLPRSLDMIFNSIGPYQAKRFVFKPDEKNGMEVQNQVDALLERQKRESQQSVPKTPSSRQKVDPE---FADMISPEDACKCEGVDEDSSYSVFVSYIEIYNNYIYDLLEEAPFDPIKPKWNGGGTPLRTNTEFI----APQSKILREDQNHNMYVAGCTELEVKSTEEAFEVFWRGQKKRRIANTQLNRESSRSHSVFIIKLAQAPLDADGDNVLQDKNQVNVSQLCLVDLAGSERTSRTRAEGSRLREAGNINQSLMTLRTCIEVLRENQMCGTNKMVPYRDSKVTHLFKNYFDGEGKVRMVVCVNPKADDYEETMLVMRFAEMTQEVEV 454          

HSP 2 Score: 54.6842 bits (130), Expect = 3.429e-7
Identity = 34/112 (30.36%), Postives = 57/112 (50.89%), Query Frame = 3
Query: 1845 ENYLLHKDKHEIPTGTLNKFHVKNSIVSKNIKMKELGKASKYLLQRQSGANN-QFQTDYIEGNVTPTSGGGFAVELTGVETVKQSSYNNPRKRISSNSESPEYKKTKQEFSD 2177
            E ++ HK    +   T+ + +V  +I       K L K  KY+L  Q  A++ + QT  I+G+V  T GGG AV+ T +ET+KQ +   P ++  S+   P       +++D
Sbjct:  828 ERWVDHKPSTNVELDTVMQPNVPKAIKVTAPSEKALSKCDKYMLTHQEVASDGEIQTKLIKGDVIKTRGGGQAVQFTDIETLKQETPVAPSRKRRSSETGPNQDDKDGDWTD 939          
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Match: zgc:56231 (zgc:56231 [Source:ZFIN;Acc:ZDB-GENE-040426-1914])

HSP 1 Score: 187.963 bits (476), Expect = 1.145e-49
Identity = 134/437 (30.66%), Postives = 224/437 (51.26%), Query Frame = 3
Query:   63 MDNTVEGVCVFCRLKPLNDENI-----KSCIQYENEFTISAVPPE---INRKNTKEI-----KYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNF-------IKRFL------IKPDERNGFKVLGETDALFEIVSNKNNYSRRSGDHDC---------VAYMNAISDDPFEVNKVDNC--TVFVSMVEIYGNNIKDLF-------IGKREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEI 1241
            +D + + + V+ R++P + E +     + C+  EN  T +   P+     + + K I     K++FTK+F   ++Q+E F+      V+D L  RN L+F+YGVT +GKT++++G  ++PG++ R ++ +FR +N        ++ +L      + PD+    +      ALF ++   +   R                V+Y   +      V+ V  C  +++V+  EIY   + DL          +R A R   V ED   N Y+ +++ V +Q+  EA    R G +NR  A T +N +SSRSH IF I+L++++    NG    +++LSL DLAGSER  +T   G +LKEAG+INNSL+ L   +  LR ++       I +R +KLT L +  F    K  MIV + Q    Y+ETL+V+ F+  +KE+
Sbjct:   45 VDGSEQQLRVYLRVRPFSKEELNNNEDQGCVVLENTETAALHAPKGSATMKSSEKGIGQQLHKFSFTKIFGSESTQAEFFDGTIRLQVQDFLQGRNALVFSYGVTNAGKTHTIQGSPKDPGILPRALEVVFRHINGRMYEHMDLRPYLSSDVQQLDPDQIRAERCAKA--ALFSLLKESSRNCRSRSSSSSSINSLSFSGVSYDQTVDSVEVAVDDV-QCVYSLWVAYYEIYNEQVYDLLQPSLTNKTKRRPALR---VCEDSAGNSYVRDLRWVNIQAAEEANKVLRVGNKNRSAAATKMNQSSSRSHSIFTIKLMRIDGGNVNG----ISELSLCDLAGSERCNKTKTFGERLKEAGNINNSLLILGKCIAALRNQNDRVKSSYIPFRESKLTRLFQGVFCGRGKASMIVNINQCASTYDETLHVMKFSAVAKEV 471          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: kif23 (kinesin family member 23 [Source:ZFIN;Acc:ZDB-GENE-991019-4])

HSP 1 Score: 276.944 bits (707), Expect = 5.932e-81
Identity = 161/416 (38.70%), Postives = 243/416 (58.41%), Query Frame = 3
Query:   84 VCVFCRLKPLNDENIKSCIQYENEFTISAVPPEINRK----NTKEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNFI--KRFLIKPDERNGFKVLGETDALFE--------IVSNKNNYSRRSGDHDCVAYMNAISDDPFE-VNKVDNCTVFVSMVEIYGNNIKDLFIG------KREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECL-------SVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRI 1247
            V V+CR++PL +++ + C++  ++  +   PPE  R       KE +Y+F +VF  N +Q E+F+ VA  LV DL+  +NGLLF YGVTGSGKT++M G    PG++ R++  LF  ++    KR++ K D++N  +V  E DAL E          + K+  SR   D +    +        E V++    +VFVS +EIY N I DL         + +  +   ++ED   NMY+    EVEV+S  EA   F +G++ RR+A T LN  SSRSH +F ++LV+   D S+GE +       +V+QL+L+DLAGSER  RT A G +L+EAG+IN SLM L++ +  LR     G+  ++ YR +KLT L K  F+   KVRMIVCV  K +++ ETL+V+ FAE ++E+ +
Sbjct:   26 VGVYCRVRPLGEDDKECCVEVISDTMVQLHPPEGARAFRNGEYKETQYSFKRVFGVNTTQKELFDIVAKTLVDDLVQGKNGLLFTYGVTGSGKTFNMTGAPGQPGLLPRSLDMLFNTISKFQAKRYVFKLDDKNSLEVQSEVDALLERQKRDILPPATPKSTTSRSKVDTEFAEIITVEEHCKAEGVDEDSAYSVFVSYIEIYNNYIFDLLEDVVVDPIRPKPPQSKMLREDSNHNMYVVGCTEVEVKSTEEAFEMFWRGQKRRRVANTTLNRESSRSHSVFIVKLVQAPLD-SDGETILQDREQITVSQLALVDLAGSERTNRTKAEGNRLREAGNINQSLMTLRTCIEVLRENQMLGTNKMVPYRDSKLTLLFKNYFDGEGKVRMIVCVNPKADDHEETLHVMRFAEMTQEVEV 440          

HSP 2 Score: 54.299 bits (129), Expect = 9.334e-8
Identity = 31/102 (30.39%), Postives = 53/102 (51.96%), Query Frame = 3
Query: 1791 KTWPSNKAHYNPRYNHQKENYLLHKDKHEIPTGTLNKFHVKNSIVSKNIKMKELGKASKYLLQRQS-GANNQFQTDYIEGNVTPTSGGGFAVELTGVETVKQ 2093
            +T P     +   ++   E ++ HK    + TGT+ +  V N++       + L KA KY+L  Q   ++ + +T  I+G V  T GGG +V+ T +ET+KQ
Sbjct:  823 QTAPPVPLRHRRSHSAGPERWIDHKPATSVDTGTVMQPSVTNAVTVLMPTERALSKADKYMLTHQELASDGEIETRLIKGQVYKTRGGGQSVQFTDIETLKQ 924          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: kif3ca (kinesin family member 3Ca [Source:ZFIN;Acc:ZDB-GENE-111214-2])

HSP 1 Score: 157.918 bits (398), Expect = 3.848e-41
Identity = 121/397 (30.48%), Postives = 187/397 (47.10%), Query Frame = 3
Query:   72 TVEGVCVFCRLKPLNDENIKSCIQYENEFTISAVPPEINRKNTKE-----IKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNFIKRFLIKPDERNGFKVLGETDALFEIVSNKNNYSRRSGDHDCVAYMNAISDDPFEVNKVDNCTVFVSMVEIYGNNIKDLFIGKREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGEC-LSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIR 1244
            + E V V  R +P+N    +S   YE+  TI     ++  +N +        +TF  V+ G+A Q +++ +   PLV  +L   NG +FAYG TG+GKTY+MEGV  +P                         ER G  +    + +F  +S   N                    P          V  S +EIY   I+DL    R+ SR + ++E   + +++ ++     +S  E  +    G +NR +  TN+N +SSRSH IF I  V+ +   ++GE  + V +L+L+DLAGSER  +TGA G +LKEA  IN SL  L ++++ L      G    + YR +KLT LL+ S   N +  M+  V      Y+E+L  L +A  +K IR
Sbjct:   16 SAETVRVVVRCRPMNPR--ESAASYESVITIDVRAGQVAIRNPRANADPARTFTFDAVYGGDAKQLDIYEESFRPLVDSVLCGFNGTIFAYGQTGTGKTYTMEGVRSDP-------------------------ERRGV-IPNSFEHIFTHISRSQN-------------------QPV-------PEVRASYLEIYQEEIRDLL--SRDQSRRLELRERPDTGIHVKDLSSFVTKSAREIEHVMGIGNQNRSVGATNMNEHSSRSHAIFVI-TVECSELGADGESHIRVGKLNLVDLAGSERQAKTGAQGERLKEATKINLSLSALGNVISAL----VDGKSTHVPYRDSKLTRLLQDSLGGNARTVMVANVGPASYNYDESLTTLRYANRAKNIR 351          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: kif15 (kinesin family member 15 [Source:ZFIN;Acc:ZDB-GENE-050622-16])

HSP 1 Score: 157.532 bits (397), Expect = 6.166e-40
Identity = 110/347 (31.70%), Postives = 176/347 (50.72%), Query Frame = 3
Query:  213 YTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLF-RRLNFIKRFLIKPDERNGFKVLGETDALFEIVSNKNNYSRRSGDHDCVAYMNAISDDPFEVNKVDNCTVFVSMVEIYGNNIKDLFIGKREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGEC-LSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKL-RMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIR 1244
            +TF  V + +A+Q E+F+ VA  +++  +N  NG +FAYG TGSGKT++M G  ++  +    ++ +  R L FI                      F ++S +   +  + +  C                   C    S +EIY   + DL      AS  + ++E+ +  +++  V E+ + S +EA      G RNRR+A T++N  SSRSH +F + +   +++K NG   +  +QL+L+DLAGSER + T + G +LKEAG IN SL  L +++N L  + H  G    + YR +KLT LL+ S   N K  +IV V      + ETL+ L FA  +K I+
Sbjct:   49 FTFDYVASISATQEEIFSVVAKNIIESCMNGYNGTIFAYGQTGSGKTFTMLGAMDHVDIFNHNLRGVIPRSLEFI----------------------FSLISREKQMTGDAKEFLC------------------KC----SFLEIYNEQVFDLL---DPASTSLFIRENIQKGVFVEGVMEMSLSSAAEAYQVLSLGWRNRRVASTSMNRESSRSHAVFTLTIQ--SKEKRNGMVNIRSSQLNLVDLAGSERQRDTQSDGMRLKEAGSINRSLSSLGNVINALAEIAHGKGR--FVPYRDSKLTFLLRDSLGGNAKTAVIVNVHPGGRYFGETLSTLQFARRTKLIK 344          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: kif3a (kinesin family member 3A [Source:ZFIN;Acc:ZDB-GENE-050417-71])

HSP 1 Score: 147.132 bits (370), Expect = 4.158e-37
Identity = 120/403 (29.78%), Postives = 181/403 (44.91%), Query Frame = 3
Query:   66 DNTVEGVCVFCRLKPLNDENIKS-----CIQYENEFTISAVPPEINRKNTKEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENP---GVIGRTIKSLFRRLNFIKRFLIKPDERNGFKVLGETDALFEIVSNKNNYSRRSGDHDCVAYMNAISDDPFEVNKVDNCTVFVSMVEIYGNNIKDLFIGKREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYN--ETLNVLSFAEDSKEIR 1244
            D+  + V V  R +P+N +   +      +  E    I+   P+ N +  K   +TF  VF   + Q +V+N  A P+V  +L   NG +FAYG TG+GKT++MEG+   P   G+I  +   +F                 G     E D  F                                       V VS +EIY   +KDL +GK +  R + VKE     +Y+ ++    V +  +       G +NR +  TN+N +SSRSH IF I +    +       + + +L L+DLAGSER  +TGA+G +LKEA  IN SL  L ++++ L      G    + YR +KLT LL+ S   N K  M  C    P +YN  ET++ L +A  +K I+
Sbjct:   10 DSGGDNVKVVVRCRPINGKETGAGHRMAVLVDEMRGQIAVQRPDCNDEPPK--TFTFDTVFGTESKQVDVYNLTARPIVDSVLEGYNGTIFAYGQTGTGKTFTMEGIRAVPELRGIIPNSFAHIF-----------------GHIAKAEGDTRF--------------------------------------LVRVSYLEIYNEEVKDL-LGKDQTQR-LEVKERPDVGVYVKDLSAFVVNNADDMDRIMTLGHKNRSVGSTNMNEHSSRSHAIFTITIECSEKGVDGNMHVRMGKLHLVDLAGSERQTKTGATGQRLKEATKINLSLSTLGNVISAL----VDGKSTHVPYRNSKLTRLLQDSLGGNSKTMM--CANIGPADYNYDETISTLRYANRAKNIK 347          
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001102.1 (pep scaffold:Pmarinus_7.0:GL476652:232474:299869:1 gene:ENSPMAG00000000949.1 transcript:ENSPMAT00000001102.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 145.206 bits (365), Expect = 3.711e-36
Identity = 113/380 (29.74%), Postives = 172/380 (45.26%), Query Frame = 3
Query:   84 VCVFCRLKPLNDENIKSCIQY------ENEFTISAVPPEINRKNTKEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNFIKRFLIKPDERNGFKVLGETDALFEIVSNKNNYSRRSGDHDCVAYMNAISDDPFEVNKVDNCTVFVSMVEIYGNNIKDLF-IGKREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNET 1202
            + V CR +PL+D       ++      E+   +   P            Y F +VF  N +Q +V+N  A  +VKD+L   NG +FAYG T SGKT++MEG   +   +G            I R +                                   D   Y+ ++ D+  E +      + VS  EIY + I+DL  I K      + V EDK    Y+    E  V S  E +    +G+ NR +A TN+N +SSRSH IF   L+ + ++    E     +L L+DLAGSE+  +TGA G+ L EA +IN SL  L ++++ L      G+K  + YR +K+T +L+ S   NC+  +++C    P  YNE 
Sbjct:    9 IKVMCRFRPLSDAEQGRGDKFLPKFSGEDNVVMGGKP------------YIFDRVFPTNTTQEQVYNCCARQIVKDVLEGYNGTIFAYGQTASGKTHTMEGKLHDSEYMG-----------IIPRII----------------------------------QDIFNYIYSM-DENLEFH------IKVSYFEIYLDKIRDLLDISKTN----LAVHEDKNKVPYVKGCTERFVSSPDEVMDVIDEGKSNRHVAVTNMNEHSSRSHSIF---LINVKQENVETEQKLSGKLYLVDLAGSEKVSKTGAEGSVLDEAKNINKSLSALGNVISAL----AEGTKSHVPYRDSKMTRILQDSLGGNCRTTIVICC--SPSSYNEA 311          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: KIP3 (Kinesin-related antiparallel sliding motor protein; involved in mitotic spindle positioning; sliding activity promotes bipolar spindle assembly and maintenance of genome stability; inhibits spindle elongation, destabilizing late anaphase spindle microtubules that polymerize beyond the midzone [Source:SGD;Acc:S000003184])

HSP 1 Score: 165.236 bits (417), Expect = 5.607e-43
Identity = 112/360 (31.11%), Postives = 177/360 (49.17%), Query Frame = 3
Query:  189 RKNTKEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNFIKRFLIKPDERNGFKVLGETDALFEIVSNKNNYSRRSGDHDCVAYMNAISDDPFEVNKVDNCTVFVSMVEIYGNNIKDLFIGKREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDI-IHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRI-ITRNE 1262
            R++  EIK+ F K+F+  +SQ+ V+ +   PL+  +L+  N  +FAYG TG GKTY++ G    PG+I   ++ LF ++  +K      DE++                                         FE++        +S +EIY   I+DL +     S+ + ++ED ++++ + N+      +  + +    +G  NR  + T  N  SSRSH +  I +++ N+        +   LS+IDLAGSERA  T   G +L E  +IN SL+ L + +N L +    GS+   I YR +KLT LLK S   NCK  MIVC+      Y+ETLN L +A  +KEI+  I RN+
Sbjct:  145 RRHGGEIKFVFDKLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGTPSQPGIIFLAMEELFNKITDLK------DEKD-----------------------------------------FEIS--------LSYLEIYNERIRDL-LKPETPSKRLVIREDTQNHIKVANLSYHHPNTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNKLVDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLND--GSRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTKIIRNQ 446          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: KIP2 (Kinesin-related motor protein involved in mitotic spindle positioning; stabilizes microtubules by targeting Bik1p to the plus end; functions as a microtubule polymerase and catastrophe inhibitor in vitro; Kip2p levels are controlled during the cell cycle [Source:SGD;Acc:S000006076])

HSP 1 Score: 115.931 bits (289), Expect = 2.664e-27
Identity = 103/378 (27.25%), Postives = 174/378 (46.03%), Query Frame = 3
Query:  210 KYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNFIKRFLIKPDERNGFKVLGETDALFEIVSNKNNYSRRSGDHDCVAYMNAISDDPFEVNKVDNCTVFVSMVEIYGNNIKD---LFIGKREASR---EVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMK--------------------------HKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRI 1247
            ++ F  VF  + +  EV+   + P++  LL   N  +FAYG+TGSGKT++M G  +  G+I  ++  LF   N +++ +      NG       D  F+++               ++Y+   ++  +++          S +E  G+ I     L++ K  ++    E+ +++D +  + +  + E   +S  E + W   G+++R+I ET+ N  SSRSH I  IRL   N    NG   S + LSL DLAGSERA  TG    + KE   IN SL+ L ++++KL                             + T   + I YR +KLT LL+ +   +  V  I  V  + +   ET+N L FA  +K + +
Sbjct:  162 EFKFDHVFASHCTNLEVYERTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQELGLIPLSVSYLF--TNIMEQSM------NG-------DKKFDVI---------------ISYLEIYNERIYDL--------LESGLEESGSRISTPSRLYMSKSNSNGLGVELKIRDDSQYGVKVIGLTERRCESSEELLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTSTN--VKNGTSRS-STLSLCDLAGSERA--TGQQ-ERRKEGSFINKSLLALGTVISKLSADKMNSVGSNIPSPSASGSSSSSGNATNNGTSPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRNDAAAETMNTLRFASRAKNVAL 495          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: KIP1 (Kinesin-related motor protein; required for mitotic spindle assembly, chromosome segregation, and 2 micron plasmid partitioning; functionally redundant with Cin8p for chromosomal but not plasmid functions [Source:SGD;Acc:S000000159])

HSP 1 Score: 116.316 bits (290), Expect = 3.972e-27
Identity = 102/358 (28.49%), Postives = 161/358 (44.97%), Query Frame = 3
Query:  213 YTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLF-RRLNFIKRFLIKPDERNGFKVLGETDALFEIVSNKNNYSRRSGDHDCVAYMNAISDDPFEVNKVDNCTVFVSMVEIYGNNIKDLFI-------GKREASREVTVKEDKRSN--MYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRD-KSNGE---CLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIR 1244
            Y F +VF   + Q  VFN  A   +K++L+  N  +FAYG TG+GKTY+M G     G +  T   L       I R L+              D   E+ S    YS                             V +S +E+Y  N+KDL            +  R++ + ++  +N  + +  ++E+ + S  E +    +G   R++A T  N+ SSRSH +F I    + +D K +G+    + + +L+L+DLAGSE   R+GA   + +EAG IN SL+ L  ++N L + H       I YR +KLT LL+ S     K  +I  +        ET + L +A  +K I+
Sbjct:  102 YQFDQVFGAESDQETVFNATAKNYIKEMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDNLLLGEHAGIIPRVLV--------------DLFKELSSLNKEYS-----------------------------VKISFLELYNENLKDLLSDSEDDDPAVNDPKRQIRIFDNNNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINAL-VDHSNH----IPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIK 411          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: KAR3 (Minus-end-directed microtubule motor; functions in mitosis and meiosis, localizes to the spindle pole body and localization is dependent on functional Cik1p, required for nuclear fusion during mating; potential Cdc28p substrate [Source:SGD;Acc:S000006345])

HSP 1 Score: 108.997 bits (271), Expect = 5.004e-25
Identity = 113/404 (27.97%), Postives = 179/404 (44.31%), Query Frame = 3
Query:   84 VCVFCRLKPL--NDENIKSCIQYENEFTI-SAVPP-EINR-KNTKEI-KYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNFIKRFLIKPDERNGFKVLGETDALFEIVSNKNNYSRRSGDHDCVAYMNAISDDPFEVNKVDNCTVFVSMVEIYGNNIKDLFIGKREASREVTV-------KEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRIITR 1256
            + V+CR++P   N EN  + +   NEF   S V   E+ + +NT ++ ++ F K+F+   +  +VF +V   LV+  L+  N  +FAYG TGSGKT++M  +    G+I  TI  +F   N+I +   K  +   +KV                                            NC      +EIY  NI DL         + ++        + +     + NV   +++S+       +K  + R  A T  N +SSRSH IF   ++ L+   +     S   L+L+DLAGSER   +   G +L+E  +IN SL  L  +++ L     T  K  I +R +KLT+LL+ S   + K  M V +       NETLN L FA      R+++R
Sbjct:  387 IRVYCRIRPALKNLENSDTSLINVNEFDDNSGVQSMEVTKIQNTAQVHEFKFDKIFDQQDTNVDVFKEVG-QLVQSSLDGYNVCIFAYGQTGSGKTFTM--LNPGDGIIPSTISHIF---NWINKLKTKGWD---YKV--------------------------------------------NC----EFIEIYNENIVDLLRSDNNNKEDTSIGLKHEIRHDQETKTTTITNVTSCKLESEEMVEIILKKANKLRSTASTASNEHSSRSHSIF---IIHLSGSNAKTGAHSYGTLNLVDLAGSERINVSQVVGDRLRETQNINKSLSCLGDVIHALGQPDST--KRHIPFRNSKLTYLLQYSLTGDSKTLMFVNISPSSSHINETLNSLRFASKVNSTRLVSR 728          
BLAST of Kinesin-like protein vs. Ensembl Yeast
Match: CIN8 (Kinesin motor protein; involved in mitotic spindle assembly and chromosome segregation [Source:SGD;Acc:S000000787])

HSP 1 Score: 106.301 bits (264), Expect = 4.621e-24
Identity = 64/186 (34.41%), Postives = 103/186 (55.38%), Query Frame = 3
Query:  687 ASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIR 1244
              R      D+ + +Y+ N++E  + +  E +   +KG ++R++A T +N+ SSRSH IF I L K ++D    E   +++++L+DLAGSE   R+GA   + KEAG IN SL+ L  ++N L    K+G    I +R +KLT LL+ S   N K  +I  +        ET + L +A  +K I+
Sbjct:  302 GQRSSMAPNDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQD----ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV--DKSGH---IPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 478          

HSP 2 Score: 62.003 bits (149), Expect = 2.537e-10
Identity = 32/95 (33.68%), Postives = 51/95 (53.68%), Query Frame = 3
Query:  165 SAVPPEINRKNTKEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEG--------VAENPGVIGRTIKSLFRRL 425
            + +  ++N K     +YT  KVF   ASQ  +F++VA PL +D +   N  +  YG+T +GKTY+M G        +++  G+I R +  LF  L
Sbjct:   78 TGITAQMNAK-----RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTL 167          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO32926 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STS0])

HSP 1 Score: 258.84 bits (660), Expect = 8.986e-75
Identity = 158/428 (36.92%), Postives = 245/428 (57.24%), Query Frame = 3
Query:   84 VCVFCRLKPLNDENIKSCIQYEN------EFTISAVPPEINRKNTKEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNFIK--RFLIKPDERNGFKVLGETDALFE--------IVSNKNNYSRRSGDHDCVAYMNAISDDPFEVNKVDNC------TVFVSMVEIYGNNIKDLF--------IGKREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECL------SVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLR---MKHKTG-SKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRI 1247
            V V+CR+KPL +   +SC++  +      + T           +  E ++TF  V++ N +Q  +F+ VA PLV D+L+ +NGL+FAYG+TGSGKT++M G   + G++ R +  +F  +   +   F+ KPD+ NG++V  E +A  +        ++      SRR+G+     + +AI     E  ++DN        VFVS +EIY N + DL           K   S+   ++ED   NMY+  V E+EV++  EA   F KG++ RR+A+T LN  SSRSH +F I++V+   D    + L      +V+ LSL DLAGSER KRT A G +L+EAG+IN+SLM L++ +  LR     ++ G S  I+ YR +KLTHL K  F+   KVRM+VC+ Q  EEY+E+++V+ FAE ++E+ +
Sbjct:   29 VEVYCRIKPLGENEEESCVKIIDNDSKLLQLTAPKFSQAFKSGHRIETQHTFKHVYDENTTQKHLFDQVALPLVDDVLHGKNGLIFAYGITGSGKTHTMTGTPSDSGLLPRCLDVIFNSIAEYQTDTFIFKPDKNNGWEVQTEDEAKLDREMKHKEALLQAAATPSRRNGNI-SPEFSDAIRIP--EERRIDNIDEDNGYAVFVSYIEIYNNFVYDLLDESPVDPICPKPPVSK--NLREDGSHNMYISGVTEIEVKTTEEAYGVFLKGQKGRRVAQTVLNQESSRSHSVFAIKVVQAPLDPDGEQILQDCDQVAVSTLSLCDLAGSERTKRTNAGGDRLREAGNINSSLMALRTCIEILRENQSNYENGVSPKIVPYRDSKLTHLFKNFFDGEGKVRMVVCLNQSAEEYDESIHVMKFAELTQEVVV 451          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO27285 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9N9])

HSP 1 Score: 214.542 bits (545), Expect = 1.131e-62
Identity = 134/400 (33.50%), Postives = 215/400 (53.75%), Query Frame = 3
Query:   90 VFCRLKPLNDENIKSCIQYEN------EFTISAVPPEINRKNTKEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNFIK--RFLIKPDERNGFKVLGETDALFE--------IVSNKNNYSRRSGDHDCVAYMNAISDDPFEVNKVD---NCTVFVSMVEIYGNNIKDLF--------IGKREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECLSVN-QLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETL 1205
            V+CR+KPL +   +SC++  +      + T           +  E ++TF  V++ N +Q  +F+ VA PLV D+L+ +NGL+FAYG+TGSGKT++M G   + G++ R +  +F  +   +   F+ KPD+ NG++V  E +A  +        ++      SRR    + +  M+ I     ++N++D      VFVS +EIY N + DL           K   S+   ++ED   NMY+  V E+EV++  EA   F KG++ RR+A+T LN  SSRSH +F I++V+   D    + L  N  +SLI     ++      S   L+ + +IN+SLM L++ +  LR         I+ YR +KLTHL K  F+   KVRM+VC+ Q  EEY+E++
Sbjct:    1 VYCRIKPLGENEEESCVKIIDNDSKLLQLTAPKFSQAFKSGHRIETQHTFKHVYDENTTQKHLFDQVALPLVDDVLHGKNGLIFAYGITGSGKTHTMTGTPSDSGLLPRCLDVIFNSIAEYQTGTFIFKPDKNNGWEVQTEDEAKLDREMKHKEALLQAAATPSRRLSS-NVLFSMSRIQCKYMQMNQIDEDNGYAVFVSYIEIYNNFVYDLLDESPVDPICPKPPVSK--NLREDGSHNMYISGVTEIEVKTTEEAYGVFLKGQKGRRVAQTVLNQESSRSHSVFAIKVVQAPLDPDGEQILQENITISLILQTQGQK-----QSAITLRTSRNINSSLMALRTCIEILRENQSNYENGIVPYRDSKLTHLFKNFFDGEGKVRMVVCLNQSAEEYDESI 392          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO37529 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFN7])

HSP 1 Score: 160.999 bits (406), Expect = 1.591e-43
Identity = 120/400 (30.00%), Postives = 188/400 (47.00%), Query Frame = 3
Query:   75 VEGVCVFCRLKPLN----DENIKSCIQYENEFTISAVPPEINRKNTKEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENP---GVIGRTIKSLFRRLNFIKRFLIKPDERNGFKVLGETDALFEIVSNKNNYSRRSGDHDCVAYMNAISDDPFEVNKVDNCTVFVSMVEIYGNNIKDLFIGKREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKL---RMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIR 1244
             E V V  R +PLN    D   ++ ++ +++ T      +   K      +TF   +  +++   ++ND+ FPLV+ +L   NG +FAYG TG GK++SM G+ + P   G+I R  + +                             FE +                   N   D  F         V  S +EIY   I+DL +GK   ++ + +KE     +Y+ ++  + V   SE  +    G +NR +  T +N +SSRSH IF+I L  L+ D    E +   +L+L+DLAGSER  +TGA+G +LKEA  IN SL  L ++++ L   + KH       I YR +KLT LL+ S   N K  M+ C+      Y+ETL+ L +A  +K I+
Sbjct:    2 AEAVRVIVRCRPLNKREKDLKCETVLEMDSD-TGQCRLHKPGDKTQPPKAFTFDGAYFIDSTTENIYNDICFPLVEGVLEGYNGTVFAYGQTGCGKSFSMMGITDPPTQRGIIPRAFEHI-----------------------------FESI-------------------NVADDSKF--------LVHASYLEIYNEEIRDL-LGKDHKAK-LDLKEHPDKGVYVKDLTMIPVNCVSEIEHVMDLGSKNRSVGATLMNADSSRSHSIFSINLEILDDDSEGNEHIRAGKLNLVDLAGSERQSKTGATGGRLKEATKINLSLSALGNVISALVDGKAKH-------IPYRDSKLTRLLQDSLGGNTKTLMVACLSPADNNYDETLSTLRYANRAKNIK 335          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO49131 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGY3])

HSP 1 Score: 145.591 bits (366), Expect = 4.735e-38
Identity = 106/382 (27.75%), Postives = 174/382 (45.55%), Query Frame = 3
Query:  183 INRKNTKEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNFIKRFLIKPDERNGFKVLGETDALFEIVSNKNNYSRRSGDHDCVAYMNAISDDPFEVNKVDNCTVFVSMVEIYGNNIKDLFIGKREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMK-HKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRIITRNEYLPTPRDQKIPMKVFDPLKSE 1325
            +  +  +++++ F +VFN  A+ ++VF +    ++  +L+  N  +FAYG TG+GKT++M G   NPGV+  T+      ++  +R     DE+                                                  C V VS +E+Y   I+DL +        + V+ED +  + +  +   +  S  E +     G  NR    T+ N  SSRSH +F + + + +R       + + ++SLIDLAGSERA  T   GA+ +E  +IN SL+ L + +N L  K +K+G    I YR +KLT LLK S   NCK  MI  V      Y +T N L +A+ +K I++  +   +          K+ D L++E
Sbjct:   57 VTGRRARDLRFIFDRVFNEEANNTDVFENTTKDIIDGVLDGFNCTVFAYGATGAGKTHTMLGSNNNPGVMFLTM------MDLYRRIHEMKDEKT-------------------------------------------------CDVAVSYLEVYNETIRDLLL----PGPALAVREDPQRGVCVSGLTLHKPHSAEELLSMLEFGNNNRTQHPTDANAQSSRSHAVFQVFVRQKDRTAGLKANVRLAKMSLIDLAGSERATVTTNRGARFREGANINKSLLALGNCINALADKENKSGH---IPYRNSKLTRLLKDSLGGNCKTVMIAAVSPSMLSYEDTYNTLKYADRAKSIKVSLKRNVVSVDFHVSRYAKIVDELRTE 376          
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Match: EDO32880 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STU5])

HSP 1 Score: 147.132 bits (370), Expect = 7.531e-38
Identity = 119/402 (29.60%), Postives = 185/402 (46.02%), Query Frame = 3
Query:   78 EGVCVFCRLKP----------LNDENIKSCIQYENEFTISAVPPEINRK---NTKEI-KYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNFIKRFLIKPDERNGFKVLGETDALFEIVSNKNNYSRRSGDHDCVAYMNAISDDPFEVNKVDNCTVFVSMVEIYGNNIKDLFIGKREASR-----EVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAE 1226
            +G+ ++ R+KP          + D++  S I+Y        +P E++     N +E+ K+ F KVF+   SQ EVF  VA  +  ++L+  NG +FAYG TGSGKT                                                 F I      Y  R      ++Y+     D FE +  +  TV +S +EIY     DL   K EAS+     +V++ ED  +N++L N+   +  ++ EA+     G+ NR IAET +N  S+RSHCIF I    ++  +S    +   +L L+DLAGSER  +TG +G QL EA  IN SL  L+ ++  L  K    S+  I YR + +T +L+ S   NC   MI     + +  +E+++   FA+
Sbjct:    4 QGIQIYARVKPTKAKTGTYEIVEDDSGSSVIEY-------TIPKELSDGYINNKREVYKFRFNKVFDQKCSQDEVFESVAQGVADNVLSGYNGTIFAYGQTGSGKT-------------------------------------------------FTITGGAERYQDRGLIPRTLSYIF----DYFEKHPDNVYTVHISYLEIYNEKGYDLLDPKHEASKLEDLPKVSLLEDADNNIHLKNLSLHQANNEEEALNCLFLGDTNRMIAETPMNQASTRSHCIFTIH---VSTRESGKATIRRAKLHLVDLAGSERIAKTGVAGIQLAEAKYINVSLHFLEQVIVALSEK----SRSHIPYRNSMMTSVLRDSLGGNCMTTMIATCSVEKKNIDESISTCRFAQ 338          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: KIF23 (kinesin family member 23 [Source:NCBI gene;Acc:101168442])

HSP 1 Score: 288.115 bits (736), Expect = 6.334e-85
Identity = 175/435 (40.23%), Postives = 250/435 (57.47%), Query Frame = 3
Query:   84 VCVFCRLKPLNDENIKSCIQYENEFTISAVPPEINRKNT----KEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNFI--KRFLIKPDERNGFKVLGETDALFEIVSN-------KNNYSRRSGDHDCVAYMNAIS-DDPFEVNKVD-NC--TVFVSMVEIYGNNIKDLFIG------KREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECLS------VNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEI---RIITRNEY-LPTPRDQK 1289
            V V+CR++PL  E+ + CI+  +  TI    P+  + N     KE +Y+F KVF  N +Q E+F DVA PLV DL++ +NGLLF YGVTGSGKT++M G     G++ R++  LF  +     KR++ KPD++NG ++  + DAL E           K   SR+  D +   + + IS D+  +   VD +C  +VFVS +EIY N I DL         + +  +   ++ED+  NMY+    EVEV+S  EA   F KG++ RRIA T LN  SSRSH +F ++LV+   D      L       V+QL L+DLAGSER  RT A G++L+EAG+IN SLM L++ M  LR     G+  ++ YR +K+THL K  F+   KVRMIVCV    ++Y E+  V+ FAE ++E+   R + R  Y LP  R  K
Sbjct:   26 VGVYCRIRPLISEDEECCIEMISSTTIQLHAPDGLKANRNGEYKETQYSFKKVFGVNTTQMELFQDVAKPLVNDLIHCKNGLLFTYGVTGSGKTFTMTGSPGEGGLLPRSLDMLFNSIGPFQAKRYVFKPDDKNGMEIQSQVDALLERQKRDSQQSVPKTPSSRQKADPE---FADMISPDEACKSESVDEDCCFSVFVSYIEIYNNYIYDLLEDAPFDPIRPKPPQSKVLREDQNHNMYVAGCTEVEVKSTEEAFEIFWKGQKKRRIANTQLNRESSRSHSVFTVKLVQAPLDADGDHILQDKNQVNVSQLCLVDLAGSERTSRTRAEGSRLREAGNINQSLMTLRTCMEVLRENQMCGTNKMVPYRDSKVTHLFKNYFDGEGKVRMIVCVNPNADDYEESALVMRFAEMTQEVEVARPVDRAIYSLPAGRRHK 457          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: KIF23 (kinesin family member 23 [Source:NCBI gene;Acc:101168442])

HSP 1 Score: 288.886 bits (738), Expect = 1.044e-84
Identity = 175/435 (40.23%), Postives = 250/435 (57.47%), Query Frame = 3
Query:   84 VCVFCRLKPLNDENIKSCIQYENEFTISAVPPEINRKNT----KEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNFI--KRFLIKPDERNGFKVLGETDALFEIVSN-------KNNYSRRSGDHDCVAYMNAIS-DDPFEVNKVD-NC--TVFVSMVEIYGNNIKDLFIG------KREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECLS------VNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEI---RIITRNEY-LPTPRDQK 1289
            V V+CR++PL  E+ + CI+  +  TI    P+  + N     KE +Y+F KVF  N +Q E+F DVA PLV DL++ +NGLLF YGVTGSGKT++M G     G++ R++  LF  +     KR++ KPD++NG ++  + DAL E           K   SR+  D +   + + IS D+  +   VD +C  +VFVS +EIY N I DL         + +  +   ++ED+  NMY+    EVEV+S  EA   F KG++ RRIA T LN  SSRSH +F ++LV+   D      L       V+QL L+DLAGSER  RT A G++L+EAG+IN SLM L++ M  LR     G+  ++ YR +K+THL K  F+   KVRMIVCV    ++Y E+  V+ FAE ++E+   R + R  Y LP  R  K
Sbjct:   26 VGVYCRIRPLISEDEECCIEMISSTTIQLHAPDGLKANRNGEYKETQYSFKKVFGVNTTQMELFQDVAKPLVNDLIHCKNGLLFTYGVTGSGKTFTMTGSPGEGGLLPRSLDMLFNSIGPFQAKRYVFKPDDKNGMEIQSQVDALLERQKRDSQQSVPKTPSSRQKADPE---FADMISPDEACKSESVDEDCCFSVFVSYIEIYNNYIYDLLEDAPFDPIRPKPPQSKVLREDQNHNMYVAGCTEVEVKSTEEAFEIFWKGQKKRRIANTQLNRESSRSHSVFTVKLVQAPLDADGDHILQDKNQVNVSQLCLVDLAGSERTSRTRAEGSRLREAGNINQSLMTLRTCMEVLRENQMCGTNKMVPYRDSKVTHLFKNYFDGEGKVRMIVCVNPNADDYEESALVMRFAEMTQEVEVARPVDRAIYSLPAGRRHK 457          

HSP 2 Score: 62.3882 bits (150), Expect = 1.364e-9
Identity = 44/152 (28.95%), Postives = 73/152 (48.03%), Query Frame = 3
Query: 1695 GIRKSLRANPKSTVKNLANHFELKSANKPDITKTWPSNKAHYNPRYNHQKENYLLHKDKHEIPTGTLNKFHVKNSIVSKNIKMKELGKASKYLLQRQS-GANNQFQTDYIEGNVTPTSGGGFAVELTGVETVKQSSYNNP-RKRISSNSESP 2144
            G R+  R  P +    +    ++++      T+T P     +   ++   E ++ HK    +   T+ +  + NSI       K L K  KY+L+ Q   ++ + +T  I+GNV  T GGG AV+ T +ET+KQ     P RKR S ++E P
Sbjct:  785 GRRRGQRWAPDTPATPIVYGLDIEAG-----TRTVPPVHPMHRRSHSAGGEKWVDHKPSSNLDLDTVMQPIIPNSIKVSTPNEKALSKCHKYVLRHQELASDGEIETKLIKGNVFKTRGGGQAVQFTDIETLKQECPTAPSRKRRSGSAEGP 931          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: KIF23 (kinesin family member 23 [Source:NCBI gene;Acc:101168442])

HSP 1 Score: 288.886 bits (738), Expect = 1.044e-84
Identity = 175/435 (40.23%), Postives = 250/435 (57.47%), Query Frame = 3
Query:   84 VCVFCRLKPLNDENIKSCIQYENEFTISAVPPEINRKNT----KEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNFI--KRFLIKPDERNGFKVLGETDALFEIVSN-------KNNYSRRSGDHDCVAYMNAIS-DDPFEVNKVD-NC--TVFVSMVEIYGNNIKDLFIG------KREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECLS------VNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEI---RIITRNEY-LPTPRDQK 1289
            V V+CR++PL  E+ + CI+  +  TI    P+  + N     KE +Y+F KVF  N +Q E+F DVA PLV DL++ +NGLLF YGVTGSGKT++M G     G++ R++  LF  +     KR++ KPD++NG ++  + DAL E           K   SR+  D +   + + IS D+  +   VD +C  +VFVS +EIY N I DL         + +  +   ++ED+  NMY+    EVEV+S  EA   F KG++ RRIA T LN  SSRSH +F ++LV+   D      L       V+QL L+DLAGSER  RT A G++L+EAG+IN SLM L++ M  LR     G+  ++ YR +K+THL K  F+   KVRMIVCV    ++Y E+  V+ FAE ++E+   R + R  Y LP  R  K
Sbjct:   26 VGVYCRIRPLISEDEECCIEMISSTTIQLHAPDGLKANRNGEYKETQYSFKKVFGVNTTQMELFQDVAKPLVNDLIHCKNGLLFTYGVTGSGKTFTMTGSPGEGGLLPRSLDMLFNSIGPFQAKRYVFKPDDKNGMEIQSQVDALLERQKRDSQQSVPKTPSSRQKADPE---FADMISPDEACKSESVDEDCCFSVFVSYIEIYNNYIYDLLEDAPFDPIRPKPPQSKVLREDQNHNMYVAGCTEVEVKSTEEAFEIFWKGQKKRRIANTQLNRESSRSHSVFTVKLVQAPLDADGDHILQDKNQVNVSQLCLVDLAGSERTSRTRAEGSRLREAGNINQSLMTLRTCMEVLRENQMCGTNKMVPYRDSKVTHLFKNYFDGEGKVRMIVCVNPNADDYEESALVMRFAEMTQEVEVARPVDRAIYSLPAGRRHK 457          

HSP 2 Score: 62.3882 bits (150), Expect = 1.364e-9
Identity = 44/152 (28.95%), Postives = 73/152 (48.03%), Query Frame = 3
Query: 1695 GIRKSLRANPKSTVKNLANHFELKSANKPDITKTWPSNKAHYNPRYNHQKENYLLHKDKHEIPTGTLNKFHVKNSIVSKNIKMKELGKASKYLLQRQS-GANNQFQTDYIEGNVTPTSGGGFAVELTGVETVKQSSYNNP-RKRISSNSESP 2144
            G R+  R  P +    +    ++++      T+T P     +   ++   E ++ HK    +   T+ +  + NSI       K L K  KY+L+ Q   ++ + +T  I+GNV  T GGG AV+ T +ET+KQ     P RKR S ++E P
Sbjct:  785 GRRRGQRWAPDTPATPIVYGLDIEAG-----TRTVPPVHPMHRRSHSAGGEKWVDHKPSSNLDLDTVMQPIIPNSIKVSTPNEKALSKCHKYVLRHQELASDGEIETKLIKGNVFKTRGGGQAVQFTDIETLKQECPTAPSRKRRSGSAEGP 931          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: KIF23 (kinesin family member 23 [Source:NCBI gene;Acc:101168442])

HSP 1 Score: 283.493 bits (724), Expect = 2.522e-83
Identity = 178/449 (39.64%), Postives = 252/449 (56.12%), Query Frame = 3
Query:   84 VCVFCRLKPLNDENIKSCIQYENEFTISAVPPEINRKNT----KEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNFI--KRFLIKPDERNGFKVLGETDALFEIVSN-------KNNYSRRSGDHDCVAYMNAIS-DDPFEVNKVD-NC--TVFVSMVEIYGNNIKDLFI--------------GKREASREVT------VKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECLS------VNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEI---RIITRNEY-LPTPRDQK 1289
            V V+CR++PL  E+ + CI+  +  TI    P+  + N     KE +Y+F KVF  N +Q E+F DVA PLV DL++ +NGLLF YGVTGSGKT++M G     G++ R++  LF  +     KR++ KPD++NG ++  + DAL E           K   SR+  D +   + + IS D+  +   VD +C  +VFVS +EIY N I DL                G    ++E T      ++ED+  NMY+    EVEV+S  EA   F KG++ RRIA T LN  SSRSH +F ++LV+   D      L       V+QL L+DLAGSER  RT A G++L+EAG+IN SLM L++ M  LR     G+  ++ YR +K+THL K  F+   KVRMIVCV    ++Y E+  V+ FAE ++E+   R + R  Y LP  R  K
Sbjct:   26 VGVYCRIRPLISEDEECCIEMISSTTIQLHAPDGLKANRNGEYKETQYSFKKVFGVNTTQMELFQDVAKPLVNDLIHCKNGLLFTYGVTGSGKTFTMTGSPGEGGLLPRSLDMLFNSIGPFQAKRYVFKPDDKNGMEIQSQVDALLERQKRDSQQSVPKTPSSRQKADPE---FADMISPDEACKSESVDEDCCFSVFVSYIEIYNNYIYDLLEDAPFDPIRPKWLDGGTPIRNKEFTPPQSKVLREDQNHNMYVAGCTEVEVKSTEEAFEIFWKGQKKRRIANTQLNRESSRSHSVFTVKLVQAPLDADGDHILQDKNQVNVSQLCLVDLAGSERTSRTRAEGSRLREAGNINQSLMTLRTCMEVLRENQMCGTNKMVPYRDSKVTHLFKNYFDGEGKVRMIVCVNPNADDYEESALVMRFAEMTQEVEVARPVDRAIYSLPAGRRHK 471          

HSP 2 Score: 64.3142 bits (155), Expect = 3.974e-10
Identity = 45/136 (33.09%), Postives = 69/136 (50.74%), Query Frame = 3
Query: 1749 NHFELKSANKPDITKTWPSNKAHYNPRYNHQK--ENYLLHKDKHEIPTGTLNKFHVKNSIVSKNIKMKELGKASKYLLQRQS-GANNQFQTDYIEGNVTPTSGGGFAVELTGVETVKQSSYNNP-RKRISSNSESP 2144
            NH + +SA+   +    P +  H   R +H    E ++ HK    +   T+ +  + NSI       K L K  KY+L+ Q   ++ + +T  I+GNV  T GGG AV+ T +ET+KQ     P RKR S ++E P
Sbjct:  713 NHAQKRSASPSPLPTVPPVHPMH---RRSHSAGGEKWVDHKPSSNLDLDTVMQPIIPNSIKVSTPNEKALSKCHKYVLRHQELASDGEIETKLIKGNVFKTRGGGQAVQFTDIETLKQECPTAPSRKRRSGSAEGP 845          
BLAST of Kinesin-like protein vs. Ensembl Medaka
Match: KIF23 (kinesin family member 23 [Source:NCBI gene;Acc:101168442])

HSP 1 Score: 283.493 bits (724), Expect = 1.229e-82
Identity = 178/449 (39.64%), Postives = 252/449 (56.12%), Query Frame = 3
Query:   84 VCVFCRLKPLNDENIKSCIQYENEFTISAVPPEINRKNT----KEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNFI--KRFLIKPDERNGFKVLGETDALFEIVSN-------KNNYSRRSGDHDCVAYMNAIS-DDPFEVNKVD-NC--TVFVSMVEIYGNNIKDLFI--------------GKREASREVT------VKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECLS------VNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEI---RIITRNEY-LPTPRDQK 1289
            V V+CR++PL  E+ + CI+  +  TI    P+  + N     KE +Y+F KVF  N +Q E+F DVA PLV DL++ +NGLLF YGVTGSGKT++M G     G++ R++  LF  +     KR++ KPD++NG ++  + DAL E           K   SR+  D +   + + IS D+  +   VD +C  +VFVS +EIY N I DL                G    ++E T      ++ED+  NMY+    EVEV+S  EA   F KG++ RRIA T LN  SSRSH +F ++LV+   D      L       V+QL L+DLAGSER  RT A G++L+EAG+IN SLM L++ M  LR     G+  ++ YR +K+THL K  F+   KVRMIVCV    ++Y E+  V+ FAE ++E+   R + R  Y LP  R  K
Sbjct:   26 VGVYCRIRPLISEDEECCIEMISSTTIQLHAPDGLKANRNGEYKETQYSFKKVFGVNTTQMELFQDVAKPLVNDLIHCKNGLLFTYGVTGSGKTFTMTGSPGEGGLLPRSLDMLFNSIGPFQAKRYVFKPDDKNGMEIQSQVDALLERQKRDSQQSVPKTPSSRQKADPE---FADMISPDEACKSESVDEDCCFSVFVSYIEIYNNYIYDLLEDAPFDPIRPKWLDGGTPIRNKEFTPPQSKVLREDQNHNMYVAGCTEVEVKSTEEAFEIFWKGQKKRRIANTQLNRESSRSHSVFTVKLVQAPLDADGDHILQDKNQVNVSQLCLVDLAGSERTSRTRAEGSRLREAGNINQSLMTLRTCMEVLRENQMCGTNKMVPYRDSKVTHLFKNYFDGEGKVRMIVCVNPNADDYEESALVMRFAEMTQEVEVARPVDRAIYSLPAGRRHK 471          

HSP 2 Score: 62.3882 bits (150), Expect = 1.532e-9
Identity = 44/152 (28.95%), Postives = 73/152 (48.03%), Query Frame = 3
Query: 1695 GIRKSLRANPKSTVKNLANHFELKSANKPDITKTWPSNKAHYNPRYNHQKENYLLHKDKHEIPTGTLNKFHVKNSIVSKNIKMKELGKASKYLLQRQS-GANNQFQTDYIEGNVTPTSGGGFAVELTGVETVKQSSYNNP-RKRISSNSESP 2144
            G R+  R  P +    +    ++++      T+T P     +   ++   E ++ HK    +   T+ +  + NSI       K L K  KY+L+ Q   ++ + +T  I+GNV  T GGG AV+ T +ET+KQ     P RKR S ++E P
Sbjct:  799 GRRRGQRWAPDTPATPIVYGLDIEAG-----TRTVPPVHPMHRRSHSAGGEKWVDHKPSSNLDLDTVMQPIIPNSIKVSTPNEKALSKCHKYVLRHQELASDGEIETKLIKGNVFKTRGGGQAVQFTDIETLKQECPTAPSRKRRSGSAEGP 945          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000078501.1 (SMESG000078501.1)

HSP 1 Score: 1403.65 bits (3632), Expect = 0.000e+0
Identity = 704/708 (99.44%), Postives = 707/708 (99.86%), Query Frame = 3
Query:   63 MDNTVEGVCVFCRLKPLNDENIKSCIQYENEFTISAVPPEINRKNTKEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNFIKRFLIKPDERNGFKVLGETDALFEIVSNKNNYSRRSGDHDCVAYMNAISDDPFEVNKVDNCTVFVSMVEIYGNNIKDLFIGKREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRIITRNEYLPTPRDQKIPMKVFDPLKSETNPICLETEYQRISDEVTRNLTAVKRYRTLEENPHDMINSIYEIWRIMANVEALQRAYXXXXXXXXXXXXXXXXXXXXXXIKELREKLQEKDQEIAKLRQQEAAESEIKSVYNGKLLTNYMGNGIRKSLRANPKSTVKNLANHFELKSANKPDITKTWPSNKAHYNPRYNHQKENYLLHKDKHEIPTGTLNKFHVKNSIVSKNIKMKELGKASKYLLQRQSGANNQFQTDYIEGNVTPTSGGGFAVELTGVETVKQSSYNNPRKRISSNSESPEYKKTKQEFSDKKF 2186
            MDNTVEGVCVFCRLKPLNDENIKSCIQYENEFTISAVPPEINRKNTKEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNFIKRFLIKPDERNGFKVLGETDALFEIVSNKNNYSRRSGDHDCVAYMNAISDDPFEVNKVDNCTVFVSMVEIYGNNIKDLFIGKREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRIITRNEYLPTPRDQKIPMKVFDPLKSETNP+CLETEYQRISDEVTRNLTAVKRYRTLEENPHDMINSIYEIWRIMANVEALQRAYSKYEKELFEECEFEEDSDNENEIKELREKLQE+D+EIAKLRQQEAAESEIKSVYNGKLLTNYMGNGIRKSLRANPKSTVKNLANHFELKSANKPDITKTWPSNKAHYNPRYNHQKENYLLHKDKHE PTGTLNKFHVKNSIVSKNIKMKELGKASKYLLQRQSGANNQFQTDYIEGNVTPTSGGGFAVELTGVETVKQSSYNNPRKRISSNSESPEYKKTKQEFSDKKF
Sbjct:    1 MDNTVEGVCVFCRLKPLNDENIKSCIQYENEFTISAVPPEINRKNTKEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNFIKRFLIKPDERNGFKVLGETDALFEIVSNKNNYSRRSGDHDCVAYMNAISDDPFEVNKVDNCTVFVSMVEIYGNNIKDLFIGKREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRIITRNEYLPTPRDQKIPMKVFDPLKSETNPVCLETEYQRISDEVTRNLTAVKRYRTLEENPHDMINSIYEIWRIMANVEALQRAYSKYEKELFEECEFEEDSDNENEIKELREKLQERDEEIAKLRQQEAAESEIKSVYNGKLLTNYMGNGIRKSLRANPKSTVKNLANHFELKSANKPDITKTWPSNKAHYNPRYNHQKENYLLHKDKHEFPTGTLNKFHVKNSIVSKNIKMKELGKASKYLLQRQSGANNQFQTDYIEGNVTPTSGGGFAVELTGVETVKQSSYNNPRKRISSNSESPEYKKTKQEFSDKKF 708          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000078501.1 (SMESG000078501.1)

HSP 1 Score: 1403.27 bits (3631), Expect = 0.000e+0
Identity = 704/708 (99.44%), Postives = 707/708 (99.86%), Query Frame = 3
Query:   63 MDNTVEGVCVFCRLKPLNDENIKSCIQYENEFTISAVPPEINRKNTKEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNFIKRFLIKPDERNGFKVLGETDALFEIVSNKNNYSRRSGDHDCVAYMNAISDDPFEVNKVDNCTVFVSMVEIYGNNIKDLFIGKREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRIITRNEYLPTPRDQKIPMKVFDPLKSETNPICLETEYQRISDEVTRNLTAVKRYRTLEENPHDMINSIYEIWRIMANVEALQRAYXXXXXXXXXXXXXXXXXXXXXXIKELREKLQEKDQEIAKLRQQEAAESEIKSVYNGKLLTNYMGNGIRKSLRANPKSTVKNLANHFELKSANKPDITKTWPSNKAHYNPRYNHQKENYLLHKDKHEIPTGTLNKFHVKNSIVSKNIKMKELGKASKYLLQRQSGANNQFQTDYIEGNVTPTSGGGFAVELTGVETVKQSSYNNPRKRISSNSESPEYKKTKQEFSDKKF 2186
            MDNTVEGVCVFCRLKPLNDENIKSCIQYENEFTISAVPPEINRKNTKEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNFIKRFLIKPDERNGFKVLGETDALFEIVSNKNNYSRRSGDHDCVAYMNAISDDPFEVNKVDNCTVFVSMVEIYGNNIKDLFIGKREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRIITRNEYLPTPRDQKIPMKVFDPLKSETNP+CLETEYQRISDEVTRNLTAVKRYRTLEENPHDMINSIYEIWRIMANVEALQRAYSKYEKELFEECEFEEDSDNENEIKELREKLQE+D+EIAKLRQQEAAESEIKSVYNGKLLTNYMGNGIRKSLRANPKSTVKNLANHFELKSANKPDITKTWPSNKAHYNPRYNHQKENYLLHKDKHE PTGTLNKFHVKNSIVSKNIKMKELGKASKYLLQRQSGANNQFQTDYIEGNVTPTSGGGFAVELTGVETVKQSSYNNPRKRISSNSESPEYKKTKQEFSDKKF
Sbjct:    2 MDNTVEGVCVFCRLKPLNDENIKSCIQYENEFTISAVPPEINRKNTKEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNFIKRFLIKPDERNGFKVLGETDALFEIVSNKNNYSRRSGDHDCVAYMNAISDDPFEVNKVDNCTVFVSMVEIYGNNIKDLFIGKREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRIITRNEYLPTPRDQKIPMKVFDPLKSETNPVCLETEYQRISDEVTRNLTAVKRYRTLEENPHDMINSIYEIWRIMANVEALQRAYSKYEKELFEECEFEEDSDNENEIKELREKLQERDEEIAKLRQQEAAESEIKSVYNGKLLTNYMGNGIRKSLRANPKSTVKNLANHFELKSANKPDITKTWPSNKAHYNPRYNHQKENYLLHKDKHEFPTGTLNKFHVKNSIVSKNIKMKELGKASKYLLQRQSGANNQFQTDYIEGNVTPTSGGGFAVELTGVETVKQSSYNNPRKRISSNSESPEYKKTKQEFSDKKF 709          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000018967.1 (SMESG000018967.1)

HSP 1 Score: 1353.96 bits (3503), Expect = 0.000e+0
Identity = 684/705 (97.02%), Postives = 693/705 (98.30%), Query Frame = 3
Query:   63 MDNTVEGVCVFCRLKPLNDENIKSCIQYENEFTISAVPPEINRKNTKEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNFIKRFLIKPDERNGFKVLGETDALFEIVSNKNNYSRRSGDHDCVAYMNAISDDPFEVNKVDNCTVFVSMVEIYGNNIKDLFIGKREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRIITRNEYLPTPRDQKIPMKVFDPLKSETNPICLETEYQRISDEVTRNLTAVKRYRTLEENPHDMINSIYEIWRIMANVEALQRAYXXXXXXXXXXXXXXXXXXXXXXIKELREKLQEKDQEIAKLRQQEAAESEIKSVYNGKLLTNYMGNGIRKSLRANPKSTVKNLANHFELKSANKPDITKTWPSNKAHYNPRYNHQKENYLLHKDKHEIPTGTLNKFHVKNSIVSKNIKMKELGKASKYLLQRQSGANNQFQTDYIEGNVTPTSGGGFAVELTGVETVKQSSYNNPRKRISSNSESPEYKKTKQEFSD 2177
            MDNT EGVCVFCRLKPLNDENIKSCIQYENEFT+SAVPPEINRKNTKEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNN+NGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNFIKRF+IKPDERNGF VL      ++IV NKNNYS  SGDHDCVAYMNAISDDPFEVNKVDNCTVFVSMVEIYGNNIKDLFIGKREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNR+KSNGECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRIITRNEYLPTPRDQKIPMKVFDPLKSETNP+CLETEYQRISDEVTRNLTAVKRYRTLEENPHDMINSIYEIWRIMANVEALQRAYSKYEKELFEECEFEEDSDNENEIKELREKLQE+D+EIAKLRQQEAAESEIKSVYNGKLLTNYMGNGIRKSLRANPKSTVKNLANHFELKSANK DITKTWPSNKAHYNPRYNHQKENYLLHKDKHEIPTGTLNKFHVKNSIVSKNIKMKELGKASKYLLQRQSGANNQFQTDYIEGNVTPTSGGGFAVELTGVETVKQSSYNNPRKRISSNSESPEYKKTKQEFSD
Sbjct:    1 MDNTAEGVCVFCRLKPLNDENIKSCIQYENEFTVSAVPPEINRKNTKEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNKNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNFIKRFVIKPDERNGFTVL------YDIVCNKNNYST-SGDHDCVAYMNAISDDPFEVNKVDNCTVFVSMVEIYGNNIKDLFIGKREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRNKSNGECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRIITRNEYLPTPRDQKIPMKVFDPLKSETNPMCLETEYQRISDEVTRNLTAVKRYRTLEENPHDMINSIYEIWRIMANVEALQRAYSKYEKELFEECEFEEDSDNENEIKELREKLQERDEEIAKLRQQEAAESEIKSVYNGKLLTNYMGNGIRKSLRANPKSTVKNLANHFELKSANKLDITKTWPSNKAHYNPRYNHQKENYLLHKDKHEIPTGTLNKFHVKNSIVSKNIKMKELGKASKYLLQRQSGANNQFQTDYIEGNVTPTSGGGFAVELTGVETVKQSSYNNPRKRISSNSESPEYKKTKQEFSD 698          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000030852.1 (SMESG000030852.1)

HSP 1 Score: 174.481 bits (441), Expect = 4.960e-45
Identity = 139/426 (32.63%), Postives = 206/426 (48.36%), Query Frame = 3
Query:   63 MDNTVEGVCVFCRLKPLNDENIKSCIQYENEFTISAVPPE--INRKNTKE------IKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNFIKRFLIKP---------DERNGFKVLGETDALFEIVSNKNN-----YSRRSGDHDCVAYMNAISDDPFEVNKVDNCTVFVSMVEIYGNNIKDLF--------IGKREASREVT-VKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECLS-VNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKH-KTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEI 1241
            +D+T++   +F R +PLN    +S     + FTISA PPE  ++ KN          K++F+KVF   + Q  VFND +  L++D +   + LLF YG T SGKT++M G   N G+I R + +LF+        L+ P          + +  K+L E   L ++   +++     +S      + V   N +SD    +N     T ++S  EIY   I DL          G  +  R +  ++  +    Y+  +K   V S  EA      G R++ I  T LN NSSRSH I  IR V   R     E LS V   S  DLAGSER  +   SG   KEA +IN+SL+ L   ++ L+       +  I+ YR +KLT L +T    N K  MIVCV Q P  ++ET+ VL F+  +K++
Sbjct:   42 VDDTMK---IFLRFRPLNINQAESPFVICDPFTISATPPEQSVSYKNLLHGNGKGFQKFSFSKVFIPESDQELVFNDTSKTLLQDFIKGNDRLLFTYGTTSSGKTHTMNGNKSNLGIIPRALFNLFKFSKLSNNPLLMPVDFAEVCQIKKTDSQKLLKEKSILLKLSEKESSDVLHMFSNGEFVDENVLSNNELSD----INNNYETTFWISYTEIYNELIYDLLDPVSISSISGNNKLKRPILDIRIARNGGSYVKGLKSYPVYSAEEAYRLLLVGRRSQIIGSTKLNQNSSRSHTILTIRAV---RTYPGSEYLSKVCNFSFCDLAGSERTDKAQTSGLMQKEASNINSSLLALGRCIDVLKYNQLNPNNLRIVPYRDSKLTRLFQTYLGGNGKASMIVCVNQDPRLFDETMQVLKFSALAKKV 457          
BLAST of Kinesin-like protein vs. Planmine SMEST
Match: SMESG000017021.1 (SMESG000017021.1)

HSP 1 Score: 153.295 bits (386), Expect = 3.206e-38
Identity = 104/366 (28.42%), Postives = 176/366 (48.09%), Query Frame = 3
Query:  174 PPEINRKN-TKEIKYTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSMEGVAENPGVIGRTIKSLFRRLNFIKRFLIKPDERNGFKVLGETDALFEIVSNKNNYSRRSGDHDCVAYMNAISDDPFEVNKVDNCTVFVSMVEIYGNNIKDLFIGKREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNRRIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECLSVNQLSLIDLAGSERAKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKLTHLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRI-ITRNEY 1265
            P +I R N ++E  + F  VFN + SQ EVF     PL+  +L+     +FAYG TG+GKTY+M G+ E PG++ + ++S+F++++ +                 E D +F++                                       +S +E+Y   I+DL       S  + ++ED+ + + +  + E+EV + +E +    +G   R +  T  N +SSRSH +  + ++  +R ++  E +   +L LIDLAGSERA  T   G ++ E   IN SL+ L + +N L        K  ++YR +KLT LLK +   NC+  MI  +      + ++ N L +A+ +K IR  I +N Y
Sbjct:   39 PDDILRANRSRERHFVFDHVFNSSCSQEEVFKLSTLPLISQVLDGYTATVFAYGATGTGKTYTMLGINERPGIMFKALESMFKQMHMM-----------------EDDYIFKMS--------------------------------------LSYLEVYNEMIRDLLGSN---SVVLDLREDQ-NGVQVAGLTEIEVNTTNEVMDLLNRGNAMRTVEATGANKHSSRSHAVLQVNVISRSRVRNTQEQIMKGKLFLIDLAGSERASNTLNRGKRMTEGAHINRSLLALGNCINALA---DPNGKRYVNYRDSKLTRLLKDALGGNCRTVMIAHIGPSALHFEDSRNTLVYADRAKHIRTKIHKNVY 342          
The following BLAST results are available for this feature:
BLAST of Kinesin-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIF231.542e-8440.86kinesin family member 23 [Source:HGNC Symbol;Acc:H... [more]
KIF238.036e-8440.86kinesin family member 23 [Source:HGNC Symbol;Acc:H... [more]
KIF231.029e-8340.86kinesin family member 23 [Source:HGNC Symbol;Acc:H... [more]
KIF231.029e-8340.86kinesin family member 23 [Source:HGNC Symbol;Acc:H... [more]
KIF234.331e-8239.77kinesin family member 23 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zen-41.275e-8529.26Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc... [more]
zen-43.599e-8329.13Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc... [more]
zen-41.852e-7929.52Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc... [more]
zen-42.253e-7929.18Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc... [more]
zen-42.253e-7929.18Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pav1.573e-8138.35gene:FBgn0011692 transcript:FBtr0073227[more]
sub4.181e-4130.19gene:FBgn0003545 transcript:FBtr0340277[more]
sub4.181e-4130.19gene:FBgn0003545 transcript:FBtr0086881[more]
Khc-733.057e-3829.10gene:FBgn0019968 transcript:FBtr0346265[more]
Khc-733.186e-3829.10gene:FBgn0019968 transcript:FBtr0329955[more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif231.953e-8038.68kinesin family member 23 [Source:ZFIN;Acc:ZDB-GENE... [more]
kif231.953e-8038.68kinesin family member 23 [Source:ZFIN;Acc:ZDB-GENE... [more]
kif238.248e-7937.81kinesin family member 23 [Source:ZFIN;Acc:ZDB-GENE... [more]
kif20ba2.679e-4830.54kinesin family member 20Ba [Source:ZFIN;Acc:ZDB-GE... [more]
kif20ba2.679e-4830.54kinesin family member 20Ba [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cldn348.745e-8439.81claudin 34 [Source:Xenbase;Acc:XB-GENE-6462643][more]
cldn342.486e-8239.03claudin 34 [Source:Xenbase;Acc:XB-GENE-6462643][more]
cldn345.655e-8239.03claudin 34 [Source:Xenbase;Acc:XB-GENE-6462643][more]
cldn341.405e-8139.03claudin 34 [Source:Xenbase;Acc:XB-GENE-6462643][more]
cldn347.169e-8139.76claudin 34 [Source:Xenbase;Acc:XB-GENE-6462643][more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kif231.978e-8539.77kinesin family member 23 [Source:MGI Symbol;Acc:MG... [more]
Kif234.424e-8540.86kinesin family member 23 [Source:MGI Symbol;Acc:MG... [more]
Kif20b8.672e-4931.60kinesin family member 20B [Source:MGI Symbol;Acc:M... [more]
Kif20b9.382e-4931.60kinesin family member 20B [Source:MGI Symbol;Acc:M... [more]
Kif18a1.731e-4229.60kinesin family member 18A [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Kinesin-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|E9Q5G3|KIF23_MOUSE3.094e-8440.86Kinesin-like protein KIF23 OS=Mus musculus OX=1009... [more]
sp|Q02241|KIF23_HUMAN4.943e-8340.86Kinesin-like protein KIF23 OS=Homo sapiens OX=9606... [more]
sp|Q80WE4|KI20B_MOUSE6.066e-4831.60Kinesin-like protein KIF20B OS=Mus musculus OX=100... [more]
sp|Q96Q89|KI20B_HUMAN2.170e-4432.69Kinesin-like protein KIF20B OS=Homo sapiens OX=960... [more]
sp|Q02224|CENPE_HUMAN5.116e-4433.91Centromere-associated protein E OS=Homo sapiens OX... [more]
back to top
BLAST of Kinesin-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9JIG84.104e-9241.69Kinesin-like protein OS=Biomphalaria glabrata OX=6... [more]
A0A0C9QSZ05.190e-9141.83Kinesin-like protein OS=Fopius arisanus OX=64838 G... [more]
E0VXW01.209e-9042.33Kinesin-like protein OS=Pediculus humanus subsp. c... [more]
A0A0C9RES62.935e-9041.63Kinesin-like protein (Fragment) OS=Fopius arisanus... [more]
Q17HE67.724e-9043.47Kinesin-like protein OS=Aedes aegypti OX=7159 GN=A... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif232.824e-8339.57kinesin family member 23 [Source:NCBI gene;Acc:103... [more]
kif231.136e-8239.57kinesin family member 23 [Source:NCBI gene;Acc:103... [more]
kif232.515e-8038.10kinesin family member 23 [Source:NCBI gene;Acc:103... [more]
kif236.778e-8038.01kinesin family member 23 [Source:NCBI gene;Acc:103... [more]
zgc:562311.145e-4930.66zgc:56231 [Source:ZFIN;Acc:ZDB-GENE-040426-1914][more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif235.932e-8138.70kinesin family member 23 [Source:ZFIN;Acc:ZDB-GENE... [more]
kif3ca3.848e-4130.48kinesin family member 3Ca [Source:ZFIN;Acc:ZDB-GEN... [more]
kif156.166e-4031.70kinesin family member 15 [Source:ZFIN;Acc:ZDB-GENE... [more]
kif3a4.158e-3729.78kinesin family member 3A [Source:ZFIN;Acc:ZDB-GENE... [more]
ENSPMAT00000001102.13.711e-3629.74pep scaffold:Pmarinus_7.0:GL476652:232474:299869:1... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
KIP35.607e-4331.11Kinesin-related antiparallel sliding motor protein... [more]
KIP22.664e-2727.25Kinesin-related motor protein involved in mitotic ... [more]
KIP13.972e-2728.49Kinesin-related motor protein; required for mitoti... [more]
KAR35.004e-2527.97Minus-end-directed microtubule motor; functions in... [more]
CIN84.621e-2434.41Kinesin motor protein; involved in mitotic spindle... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO329268.986e-7536.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO272851.131e-6233.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375291.591e-4330.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491314.735e-3827.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328807.531e-3829.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Kinesin-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIF236.334e-8540.23kinesin family member 23 [Source:NCBI gene;Acc:101... [more]
KIF231.044e-8440.23kinesin family member 23 [Source:NCBI gene;Acc:101... [more]
KIF231.044e-8440.23kinesin family member 23 [Source:NCBI gene;Acc:101... [more]
KIF232.522e-8339.64kinesin family member 23 [Source:NCBI gene;Acc:101... [more]
KIF231.229e-8239.64kinesin family member 23 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Kinesin-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078501.10.000e+099.44SMESG000078501.1[more]
SMESG000078501.10.000e+099.44SMESG000078501.1[more]
SMESG000018967.10.000e+097.02SMESG000018967.1[more]
SMESG000030852.14.960e-4532.63SMESG000030852.1[more]
SMESG000017021.13.206e-3828.42SMESG000017021.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004988 ID=SMED30004988|Name=Kinesin-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2211bp
TAAATTTTAGTATTATATATTTTAAATAGATTAAAATTTTAATATTATTA
TAAATTAATTTGATGGACAATACAGTTGAAGGAGTCTGTGTATTTTGCAG
ACTTAAACCATTAAATGATGAGAATATTAAATCATGTATCCAGTATGAAA
ATGAATTTACTATAAGTGCTGTACCTCCTGAAATTAATAGAAAAAACACG
AAAGAAATAAAATACACATTTACCAAAGTTTTTAATGGAAATGCATCACA
ATCTGAAGTATTTAATGATGTTGCATTTCCGTTAGTAAAAGATTTATTGA
ATAACAGAAATGGATTGCTGTTTGCTTATGGTGTTACTGGAAGTGGTAAA
ACTTATAGCATGGAGGGAGTAGCAGAGAATCCAGGAGTAATAGGAAGAAC
AATTAAATCTTTGTTTCGTCGATTGAATTTTATAAAAAGATTCCTCATTA
AGCCAGATGAACGGAATGGATTTAAAGTTTTGGGTGAAACAGATGCATTG
TTCGAAATCGTTTCTAATAAAAATAATTATTCAAGAAGAAGTGGAGATCA
CGATTGCGTTGCGTACATGAATGCAATTTCCGATGACCCGTTCGAGGTAA
ATAAAGTCGATAACTGCACTGTATTTGTTTCCATGGTTGAAATATACGGA
AATAACATCAAAGATTTATTTATCGGGAAAAGAGAAGCAAGCCGGGAAGT
CACAGTGAAAGAAGATAAGAGATCTAATATGTATTTGCACAATGTAAAGG
AGGTCGAAGTGCAATCAGATTCCGAGGCGATTTATTGGTTTCGTAAAGGA
GAGAGAAACAGGCGAATTGCAGAAACGAATTTGAATAATAATTCCAGTCG
AAGTCATTGCATATTCAATATCCGATTGGTGAAATTGAATCGTGATAAAT
CGAATGGGGAATGTCTCTCGGTAAATCAATTGTCATTGATCGATCTTGCT
GGCAGTGAACGAGCCAAGCGAACCGGAGCGAGCGGAGCCCAATTGAAAGA
AGCTGGAGATATCAACAATTCATTAATGGAGCTGCAATCGATAATGAATA
AGTTGCGCATGAAGCACAAAACCGGCTCCAAAGATATCATACATTACCGA
GGCAACAAATTGACTCATCTGTTGAAAACGAGTTTCGAAAGCAATTGTAA
AGTGCGAATGATTGTGTGCGTCCAACAGAAACCGGAGGAATACAATGAAA
CTCTGAACGTATTATCGTTTGCGGAGGATTCAAAGGAGATCCGGATCATC
ACGAGAAATGAGTATTTGCCAACGCCGAGAGATCAAAAAATCCCAATGAA
AGTTTTCGATCCTTTAAAGAGTGAGACGAATCCCATTTGCCTGGAAACAG
AATACCAGAGAATCTCTGATGAAGTAACTCGAAATTTGACCGCAGTGAAG
CGATACAGAACACTGGAGGAAAACCCGCACGATATGATTAATTCTATTTA
TGAAATATGGCGGATTATGGCTAATGTTGAAGCACTTCAAAGGGCTTATT
CCAAATATGAAAAGGAACTGTTCGAGGAATGCGAATTCGAGGAAGATTCG
GACAATGAGAATGAGATAAAGGAATTGCGCGAGAAATTACAAGAGAAAGA
TCAAGAAATAGCTAAGCTCAGACAACAAGAGGCAGCAGAGTCAGAAATCA
AGTCCGTTTACAATGGTAAGCTACTGACGAATTATATGGGCAACGGCATC
AGGAAATCGCTGAGAGCCAATCCCAAATCAACAGTCAAAAATCTGGCCAA
TCATTTCGAACTGAAAAGTGCCAACAAACCCGATATCACTAAAACCTGGC
CATCCAATAAAGCTCACTACAACCCTCGATATAATCATCAGAAAGAAAAT
TACCTGTTGCACAAAGATAAGCATGAGATTCCGACGGGGACGCTGAATAA
GTTCCACGTGAAGAATAGCATCGTGTCAAAGAATATCAAAATGAAAGAAC
TGGGAAAGGCCAGCAAGTATTTATTGCAGCGTCAAAGCGGTGCAAATAAT
CAATTCCAAACCGATTACATTGAAGGAAATGTGACCCCTACATCTGGAGG
AGGATTTGCGGTGGAATTGACCGGTGTCGAGACCGTTAAGCAATCCTCGT
ACAATAATCCACGTAAAAGGATTTCCTCTAACTCCGAATCTCCAGAATAC
AAGAAGACTAAGCAAGAATTCTCCGATAAGAAGTTTTAATAAATAAATAT
TTTGTCTTGTT
back to top

protein sequence of SMED30004988-orf-1

>SMED30004988-orf-1 ID=SMED30004988-orf-1|Name=SMED30004988-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=709bp
MDNTVEGVCVFCRLKPLNDENIKSCIQYENEFTISAVPPEINRKNTKEIK
YTFTKVFNGNASQSEVFNDVAFPLVKDLLNNRNGLLFAYGVTGSGKTYSM
EGVAENPGVIGRTIKSLFRRLNFIKRFLIKPDERNGFKVLGETDALFEIV
SNKNNYSRRSGDHDCVAYMNAISDDPFEVNKVDNCTVFVSMVEIYGNNIK
DLFIGKREASREVTVKEDKRSNMYLHNVKEVEVQSDSEAIYWFRKGERNR
RIAETNLNNNSSRSHCIFNIRLVKLNRDKSNGECLSVNQLSLIDLAGSER
AKRTGASGAQLKEAGDINNSLMELQSIMNKLRMKHKTGSKDIIHYRGNKL
THLLKTSFESNCKVRMIVCVQQKPEEYNETLNVLSFAEDSKEIRIITRNE
YLPTPRDQKIPMKVFDPLKSETNPICLETEYQRISDEVTRNLTAVKRYRT
LEENPHDMINSIYEIWRIMANVEALQRAYSKYEKELFEECEFEEDSDNEN
EIKELREKLQEKDQEIAKLRQQEAAESEIKSVYNGKLLTNYMGNGIRKSL
RANPKSTVKNLANHFELKSANKPDITKTWPSNKAHYNPRYNHQKENYLLH
KDKHEIPTGTLNKFHVKNSIVSKNIKMKELGKASKYLLQRQSGANNQFQT
DYIEGNVTPTSGGGFAVELTGVETVKQSSYNNPRKRISSNSESPEYKKTK
QEFSDKKF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0000014zeta neoblast
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR036961Kinesin_motor_dom_sf
IPR038105Kif23_Arf-bd_sf
IPR027640Kinesin-like_fam
IPR001752Kinesin_motor_dom
IPR032384Kif23_Arf-bd
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0008017microtubule binding
GO:0003777microtubule motor activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0003774motor activity
Vocabulary: biological process
TermDefinition
GO:0007018microtubule-based movement
GO:0000910cytokinesis
GO:0000915actomyosin contractile ring assembly
GO:0072383plus-end-directed vesicle transport along microtubule
Vocabulary: cellular component
TermDefinition
GO:0005874microtubule
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 493..526
NoneNo IPR availableCOILSCoilCoilcoord: 466..486
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 691..709
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 678..709
NoneNo IPR availableCDDcd00106KISccoord: 9..392
e-value: 3.61062E-99
score: 306.104
IPR001752Kinesin motor domainPRINTSPR00380KINESINHEAVYcoord: 82..103
score: 59.77
coord: 290..308
score: 58.11
coord: 344..365
score: 41.02
coord: 256..273
score: 53.19
IPR001752Kinesin motor domainSMARTSM00129kinesin_4coord: 6..402
e-value: 2.7E-94
score: 329.2
IPR001752Kinesin motor domainPFAMPF00225Kinesincoord: 14..394
e-value: 1.4E-90
score: 303.6
IPR001752Kinesin motor domainPROSITEPS50067KINESIN_MOTOR_2coord: 8..394
score: 89.82
IPR036961Kinesin motor domain superfamilyGENE3DG3DSA:3.40.850.10coord: 165..396
e-value: 4.3E-65
score: 222.0
IPR036961Kinesin motor domain superfamilyGENE3DG3DSA:3.40.850.10coord: 1..135
e-value: 5.8E-30
score: 106.2
IPR038105Kinesin-like protein Kif23, Arf6-interacting domain superfamilyGENE3DG3DSA:3.40.50.12000coord: 571..689
e-value: 2.6E-17
score: 64.7
IPR032384Kinesin-like protein Kif23, Arf6-interacting domainPFAMPF16540MKLP1_Arf_bdgcoord: 590..681
e-value: 2.2E-13
score: 50.2
IPR027640Kinesin-like proteinPANTHERPTHR24115FAMILY NOT NAMEDcoord: 13..591
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 9..401