Hypoxanthine phosphoribosyltransferase

Overview
NameHypoxanthine phosphoribosyltransferase
Smed IDSMED30004975
Length (bp)899
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Hypoxanthine phosphoribosyltransferase (SMED30004975) t-SNE clustered cells

Violin plots show distribution of expression levels for Hypoxanthine phosphoribosyltransferase (SMED30004975) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Hypoxanthine phosphoribosyltransferase (SMED30004975) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Hypoxanthine phosphoribosyltransferase (SMED30004975) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004975

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30004975SMESG000007399.1 dd_Smed_v4_7763_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004975SMESG000007399.1 dd_Smed_v4_7763_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004975SMESG000007399.1 dd_Smed_v4_7763_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30004975SMESG000007399.1 dd_Smed_v4_7763_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30004975SMESG000007399.1 dd_Smed_v6_7763_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Hypoxanthine phosphoribosyltransferase vs. Ensembl Human
Match: HPRT1 (hypoxanthine phosphoribosyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:5157])

HSP 1 Score: 261.922 bits (668), Expect = 2.180e-87
Identity = 125/214 (58.41%), Postives = 166/214 (77.57%), Query Frame = 1
Query:   79 SNCIIISDEIEGYNSSQFCIVSHYENVLDSVLIPHGLIKDRIEKLAVDIATDEDFSENGIAALCVLKGGFKFFADLTEAIDRNNRSKGKSIPLSIDFIKVKSYVDDHSINEVTVSGIDNLSSLTGKSVLIVEDIVDTGKTMMKLLNHLKNFNPASVKVASLLVKRTPLSIGYIPDYVGFEIPNKFLVGYALDYNDYFRDLNHICIINEEGKMRF 720
            S  ++ISD+  GY+   FCI +HY   L+ V IPHGLI DR E+LA D+   ++   + I ALCVLKGG+KFFADL + I   NR+  +SIP+++DFI++KSY +D S  ++ V G D+LS+LTGK+VLIVEDI+DTGKTM  LL+ ++ +NP  VKVASLLVKRTP S+GY PD+VGFEIP+KF+VGYALDYN+YFRDLNH+C+I+E GK ++
Sbjct:    5 SPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVM--KEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKY 216          
BLAST of Hypoxanthine phosphoribosyltransferase vs. Ensembl Human
Match: PRTFDC1 (phosphoribosyl transferase domain containing 1 [Source:HGNC Symbol;Acc:HGNC:23333])

HSP 1 Score: 231.876 bits (590), Expect = 1.619e-75
Identity = 114/211 (54.03%), Postives = 155/211 (73.46%), Query Frame = 1
Query:   88 IIISDEIEGYNSSQFCIVSHYENVLDSVLIPHGLIKDRIEKLAVDIATDEDFSENGIAALCVLKGGFKFFADLTEAIDRNNRSKGKSIPLSIDFIKVKSYVDDHSINEVTVSGIDNLSSLTGKSVLIVEDIVDTGKTMMKLLNHLKNFNPASVKVASLLVKRTPLSIGYIPDYVGFEIPNKFLVGYALDYNDYFRDLNHICIINEEGKMRF 720
            ++I D+  GY+ + F    HY   L+ VLIPHG+I DRIE+LA DI  D  +S+  I  LCVLKGG+KF ADL E +   +R+  + + + +DFI++KSY +D S+ E+ + G D+LS+L GK+VLIVED+V TG+TM  LL++++ + P  +KVASLLVKRT  S G+ PDY GFEIPN F+VGYALDYN+YFRDLNHIC+INE GK ++
Sbjct:   15 VVIMDDWPGYDLNLFTYPQHYYGDLEYVLIPHGIIVDRIERLAKDIMKDIGYSD--IMVLCVLKGGYKFCADLVEHLKNISRNSDRFVSMKVDFIRLKSYRNDQSMGEMQIIGGDDLSTLAGKNVLIVEDVVGTGRTMKALLSNIEKYKPNMIKVASLLVKRTSRSDGFRPDYAGFEIPNLFVVGYALDYNEYFRDLNHICVINEHGKEKY 223          
BLAST of Hypoxanthine phosphoribosyltransferase vs. Ensembl Human
Match: PRTFDC1 (phosphoribosyl transferase domain containing 1 [Source:HGNC Symbol;Acc:HGNC:23333])

HSP 1 Score: 163.696 bits (413), Expect = 2.684e-49
Identity = 84/172 (48.84%), Postives = 120/172 (69.77%), Query Frame = 1
Query:   88 IIISDEIEGYNSSQFCIVSHYENVLDSVLIPHGLIKDRIEKLAVDIATDEDFSENGIAALCVLKGGFKFFADLTEAIDRNNRSKGKSIPLSIDFIKVKSYVDDHSINEVTVSGIDNLSSLTGKSVLIVEDIVDTGKTMMKLLNHLKNFNPASVKVASLLVKRTPLSIGYIPD 603
            ++I D+  GY+ + F    HY   L+ VLIPHG+I DRIE+LA DI  D  +S+  I  LCVLKGG+KF ADL E +   +R+  + + + +DFI++KSY +D S+ E+ + G D+LS+L GK+VLIVED+V TG+TM  LL++++ + P  +KVASLLVKRT  S G+ PD
Sbjct:   15 VVIMDDWPGYDLNLFTYPQHYYGDLEYVLIPHGIIVDRIERLAKDIMKDIGYSD--IMVLCVLKGGYKFCADLVEHLKNISRNSDRFVSMKVDFIRLKSYRNDQSMGEMQIIGGDDLSTLAGKNVLIVEDVVGTGRTMKALLSNIEKYKPNMIKVASLLVKRTSRSDGFRPD 184          
BLAST of Hypoxanthine phosphoribosyltransferase vs. Ensembl Human
Match: PRTFDC1 (phosphoribosyl transferase domain containing 1 [Source:HGNC Symbol;Acc:HGNC:23333])

HSP 1 Score: 91.6633 bits (226), Expect = 7.497e-22
Identity = 49/122 (40.16%), Postives = 72/122 (59.02%), Query Frame = 1
Query:   88 IIISDEIEGYNSSQFCIVSHYENVLDSVLIPHGLIKDRIEKLAVDIATDEDFSENGIAALCVLKGGFKFFADLTEAIDRNNRSKGKSIPLSIDFIKVKSYVDDHSINEVTVSGIDNLSSLTG 453
            ++I D+  GY+ + F    HY   L+ VLIPHG+I DRIE+LA DI  D  +S+  I  LCVLKGG+KF ADL E +   +R+  + + + +DFI++KSY     +   T+     L+   G
Sbjct:   15 VVIMDDWPGYDLNLFTYPQHYYGDLEYVLIPHGIIVDRIERLAKDIMKDIGYSD--IMVLCVLKGGYKFCADLVEHLKNISRNSDRFVSMKVDFIRLKSYRLRARLKRTTICDRGGLAFSQG 134          
BLAST of Hypoxanthine phosphoribosyltransferase vs. Ensembl Celegans
Match: hprt-1 (Hypoxanthine phosphoribosyltransferase [Source:UniProtKB/TrEMBL;Acc:Q9NF11])

HSP 1 Score: 166.007 bits (419), Expect = 2.470e-50
Identity = 92/206 (44.66%), Postives = 123/206 (59.71%), Query Frame = 1
Query:   91 IISDEIEGYNSSQFCIVSHYENVLDSVLIPHGLIKDRIEKLAVDIATDEDFSENGIAALCVLKGGFKFFADLTEAIDRNNRSKGKSIPLSIDFIKVKSYVDDHSINEVTVSGIDNLSSLTGKSVLIVEDIVDTGKTMMKLLNHLKNFNPASVKVASLLVKRTPLSIGYIPDYVGFEIPNKFLVGYALDYNDYFRDLNHICIINEEG 708
            +I D+ E      F I   Y+  L  V+IP GL++DR+ +LA DI  +       IA LCVLKG +KFF  L E +  N RS     P+++DFI+VKSY D  S  ++ + G+ NL  L GKSVL+V+DI DTG+T+ KLL+ L          A LL KR    +    D+V FEIP+KF+VGY LDYN  FRDL HIC+++  G
Sbjct:    7 VIPDDFE-LPVDAFDIPICYDGDLSGVVIPEGLVRDRVRRLAKDIHAE--IGNKPIALLCVLKGSYKFFTALVEEL-TNARSSCPE-PMTVDFIRVKSYEDQMSTGQIQIMGLSNLDELKGKSVLVVDDISDTGRTLAKLLSTLHETGVEKTWTALLLSKRVKRVVDVPEDFVAFEIPDKFIVGYGLDYNQKFRDLGHICVMSPAG 207          
BLAST of Hypoxanthine phosphoribosyltransferase vs. Ensembl Zebrafish
Match: hprt1 (hypoxanthine phosphoribosyltransferase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1918])

HSP 1 Score: 270.781 bits (691), Expect = 3.441e-91
Identity = 131/214 (61.21%), Postives = 166/214 (77.57%), Query Frame = 1
Query:   79 SNCIIISDEIEGYNSSQFCIVSHYENVLDSVLIPHGLIKDRIEKLAVDIATDEDFSENGIAALCVLKGGFKFFADLTEAIDRNNRSKGKSIPLSIDFIKVKSYVDDHSINEVTVSGIDNLSSLTGKSVLIVEDIVDTGKTMMKLLNHLKNFNPASVKVASLLVKRTPLSIGYIPDYVGFEIPNKFLVGYALDYNDYFRDLNHICIINEEGKMRF 720
            S C++ISDE +GY+   FCI  HY   L+ V IPHGLI DR E+LA DI   +D   + I ALCVLKGG+KFFADL + I   NR+  +SIP+++DFI++KSY +D S  ++ V G D+LS+LTGK+VLIVEDI+DTGKTM  LL  LK +NP  VKVASLLVKRTP S+GY PD+VGFE+P+KF+VGYALDYN+YFRDLNHIC+I+E GK ++
Sbjct:    5 SPCVVISDEEQGYDLDLFCIPKHYAADLERVYIPHGLIMDRTERLARDIM--KDMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYQNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMKTLLELLKQYNPKMVKVASLLVKRTPRSVGYRPDFVGFEVPDKFVVGYALDYNEYFRDLNHICVISETGKEKY 216          
BLAST of Hypoxanthine phosphoribosyltransferase vs. Ensembl Zebrafish
Match: hprt1 (hypoxanthine phosphoribosyltransferase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1918])

HSP 1 Score: 270.781 bits (691), Expect = 3.441e-91
Identity = 131/214 (61.21%), Postives = 166/214 (77.57%), Query Frame = 1
Query:   79 SNCIIISDEIEGYNSSQFCIVSHYENVLDSVLIPHGLIKDRIEKLAVDIATDEDFSENGIAALCVLKGGFKFFADLTEAIDRNNRSKGKSIPLSIDFIKVKSYVDDHSINEVTVSGIDNLSSLTGKSVLIVEDIVDTGKTMMKLLNHLKNFNPASVKVASLLVKRTPLSIGYIPDYVGFEIPNKFLVGYALDYNDYFRDLNHICIINEEGKMRF 720
            S C++ISDE +GY+   FCI  HY   L+ V IPHGLI DR E+LA DI   +D   + I ALCVLKGG+KFFADL + I   NR+  +SIP+++DFI++KSY +D S  ++ V G D+LS+LTGK+VLIVEDI+DTGKTM  LL  LK +NP  VKVASLLVKRTP S+GY PD+VGFE+P+KF+VGYALDYN+YFRDLNHIC+I+E GK ++
Sbjct:    5 SPCVVISDEEQGYDLDLFCIPKHYAADLERVYIPHGLIMDRTERLARDIM--KDMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYQNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMKTLLELLKQYNPKMVKVASLLVKRTPRSVGYRPDFVGFEVPDKFVVGYALDYNEYFRDLNHICVISETGKEKY 216          
BLAST of Hypoxanthine phosphoribosyltransferase vs. Ensembl Zebrafish
Match: hprt1 (hypoxanthine phosphoribosyltransferase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1918])

HSP 1 Score: 265.388 bits (677), Expect = 4.881e-89
Identity = 131/216 (60.65%), Postives = 166/216 (76.85%), Query Frame = 1
Query:   79 SNCIIISDEIEGYNSSQFCIVSHYENVLDSVLIPHGLIKDRIEKLAVDIATDEDFSENGIAALCVLKGGFKFFADLTEAIDRNNRSKGKSIPLSIDFIKVKSYVDDHSINEVTVSGIDNLSSLTGKSVLIVE--DIVDTGKTMMKLLNHLKNFNPASVKVASLLVKRTPLSIGYIPDYVGFEIPNKFLVGYALDYNDYFRDLNHICIINEEGKMRF 720
            S C++ISDE +GY+   FCI  HY   L+ V IPHGLI DR E+LA DI   +D   + I ALCVLKGG+KFFADL + I   NR+  +SIP+++DFI++KSY +D S  ++ V G D+LS+LTGK+VLIVE  DI+DTGKTM  LL  LK +NP  VKVASLLVKRTP S+GY PD+VGFE+P+KF+VGYALDYN+YFRDLNHIC+I+E GK ++
Sbjct:    5 SPCVVISDEEQGYDLDLFCIPKHYAADLERVYIPHGLIMDRTERLARDIM--KDMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYQNDQSTGDIKVIGGDDLSTLTGKNVLIVEVFDIIDTGKTMKTLLELLKQYNPKMVKVASLLVKRTPRSVGYRPDFVGFEVPDKFVVGYALDYNEYFRDLNHICVISETGKEKY 218          
BLAST of Hypoxanthine phosphoribosyltransferase vs. Ensembl Zebrafish
Match: hprt1l (hypoxanthine phosphoribosyltransferase 1, like [Source:ZFIN;Acc:ZDB-GENE-040625-17])

HSP 1 Score: 249.595 bits (636), Expect = 6.961e-83
Identity = 125/209 (59.81%), Postives = 158/209 (75.60%), Query Frame = 1
Query:   94 ISDEIEGYNSSQFCIVSHYENVLDSVLIPHGLIKDRIEKLAVDIATDEDFSENGIAALCVLKGGFKFFADLTEAIDRNNRSKGKSIPLSIDFIKVKSYVDDHSINEVTVSGIDNLSSLTGKSVLIVEDIVDTGKTMMKLLNHLKNFNPASVKVASLLVKRTPLSIGYIPDYVGFEIPNKFLVGYALDYNDYFRDLNHICIINEEGKMRF 720
            ISD+ +G+  S FC+  HYE+ LDSV+IP+GLIKDR E+LA DI    D   + I ALCVLKGG+KFFADL + I   N+   KS+PL++DFI++KSY +D S N V V G D LS+L GK+VLIVEDIV+TGKTM  LL  L   +P  VKV SLLVKRTP S GY PDY+GFE+P+KFLVGYALDYN+YFRDL+HICI+++  + ++
Sbjct:    7 ISDDSKGHELSLFCVPKHYEDDLDSVIIPNGLIKDRTERLARDIV--RDMGGHHIVALCVLKGGYKFFADLMDFIKTLNQHSDKSVPLTVDFIRLKSYCNDQSTNCVKVIGGDELSALAGKNVLIVEDIVETGKTMETLLKLLHECHPKMVKVVSLLVKRTPRSSGYRPDYIGFEVPDKFLVGYALDYNEYFRDLSHICILSDRAREKY 213          
BLAST of Hypoxanthine phosphoribosyltransferase vs. Ensembl Zebrafish
Match: prtfdc1 (phosphoribosyl transferase domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-980526-324])

HSP 1 Score: 232.646 bits (592), Expect = 5.980e-76
Identity = 112/212 (52.83%), Postives = 152/212 (71.70%), Query Frame = 1
Query:   88 IIISDEIEGYNSSQFCIVSHYENVLDSVLIPHGLIKDRIEKLAVDIATDEDFSENGIAALCVLKGGFKFFADLTEAIDRNNRSKGKSIPLSIDFIKVKSYVDDHSINEVTVSGIDNLSSLTGKSVLIVEDIVDTGKTMMKLLNHLKNFNPASVKVASLLVKRTPLSIGYIPDYVGFEIPNKFLVGYALDYNDYFRDLNHICIINEEGKMRFS 723
            I+I D+  GY    F    HY   LD V IPHG+I DRIE+LA +I   +D  ++ I  LCVLKGG++F ADL + I     +  K++P+ +DFI++KSY++D S  ++ + G +NLS+L+GK+VLIVE IVDTGKTM  LL+H++ F P  +KVA LLVKR     GY+PDYVGFEI N+F+VGYALDYN+YFRDLNHIC+I++ GK ++ 
Sbjct:   15 IVIPDDWPGYPLDLFTFPEHYSEDLDCVYIPHGVIMDRIERLARNIM--DDLGDHDIVVLCVLKGGYQFCADLVDCIKVLCCNSNKTLPMRVDFIRLKSYLNDQSTEDLHIEGAENLSALSGKNVLIVEAIVDTGKTMKALLDHVEAFKPKMIKVAGLLVKRVASKTGYLPDYVGFEISNRFVVGYALDYNEYFRDLNHICVISDSGKQKYK 224          
BLAST of Hypoxanthine phosphoribosyltransferase vs. Ensembl Xenopus
Match: btbd11 (BTB (POZ) domain containing 11 [Source:Xenbase;Acc:XB-GENE-991957])

HSP 1 Score: 270.011 bits (689), Expect = 1.073e-90
Identity = 131/215 (60.93%), Postives = 166/215 (77.21%), Query Frame = 1
Query:   79 SNCIIISDEIEGYNSSQFCIVSHYENVLDSVLIPHGLIKDRIEKLAVDIATDEDFSENGIAALCVLKGGFKFFADLTEAIDRNNRSKGKSIPLSIDFIKVKSYVDDHSINEVTVSGIDNLSSLTGKSVLIVEDIVDTGKTMMKLLNHLKNFNPASVKVASLLVKRTPLSIGYIPDYVGFEIPNKFLVGYALDYNDYFRDLNHICIINEEGKMRFS 723
            S CI+I D+ +GY+   FCI  HY   L+ V IPHGLI DR E+LA DI   +D   + I ALCVLKGG+KFFADL + I   NR+  KSIP+++DFI++KSY +D S  ++ V G D+LS+LTGK+VLIVEDI+DTGKTM  LL  LK +NP  VKVASLLVKRTP S+GY PD+VGFE+P+KF+VGYALDYN+YFRDLNHIC+I+E+GK ++ 
Sbjct:    3 SPCIVIQDDEQGYDLDLFCIPKHYAADLEKVYIPHGLIMDRTERLARDIM--KDMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDKSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMKTLLAMLKKYNPKMVKVASLLVKRTPRSVGYRPDFVGFEVPDKFVVGYALDYNEYFRDLNHICVISEDGKEKYK 215          
BLAST of Hypoxanthine phosphoribosyltransferase vs. Ensembl Xenopus
Match: btbd11 (BTB (POZ) domain containing 11 [Source:Xenbase;Acc:XB-GENE-991957])

HSP 1 Score: 255.373 bits (651), Expect = 4.734e-85
Identity = 126/215 (58.60%), Postives = 160/215 (74.42%), Query Frame = 1
Query:   79 SNCIIISDEIEGYNSSQFCIVSHYENVLDSVLIPHGLIKDRIEKLAVDIATDEDFSENGIAALCVLKGGFKFFADLTEAIDRNNRSKGKSIPLSIDFIKVKSYVDDHSINEVTVSGIDNLSSLTGKSVLIVEDIVDTGKTMMKLLNHLKNFNPASVKVASLLVKRTPLSIGYIPDYVGFEIPNKFLVGYALDYNDYFRDLNHICIINEEGKMRFS 723
            S CI+I D+ +GY+   FCI  HY   L+ V IPHGLI DR E+LA DI   +D   + I ALCVLKGG+KFFADL + I   NR+  KSIP+++DFI++KSY +D S  ++ V G D+LS+LTGK      DI+DTGKTM  LL  LK +NP  VKVASLLVKRTP S+GY PD+VGFE+P+KF+VGYALDYN+YFRDLNHIC+I+E+GK ++ 
Sbjct:    3 SPCIVIQDDEQGYDLDLFCIPKHYAADLEKVYIPHGLIMDRTERLARDIM--KDMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDKSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGK------DIIDTGKTMKTLLAMLKKYNPKMVKVASLLVKRTPRSVGYRPDFVGFEVPDKFVVGYALDYNEYFRDLNHICVISEDGKEKYK 209          
BLAST of Hypoxanthine phosphoribosyltransferase vs. Ensembl Xenopus
Match: btbd11 (BTB (POZ) domain containing 11 [Source:Xenbase;Acc:XB-GENE-991957])

HSP 1 Score: 233.802 bits (595), Expect = 1.816e-76
Identity = 122/203 (60.10%), Postives = 151/203 (74.38%), Query Frame = 1
Query:   85 CIIISDEIEGYNSSQFCIVSHYENVLDSVLIPHGLIKDRIEKLAVDIATDEDFSENGIAALCVLKGGFKFFADLTEAIDRNNRSKGKSIPLSIDFIKVKSYVDDHSINEVTVSGIDNLSSLTGKSVLIVEDIVDTGKTMMKLLNHLKNFNPASVKVASLLVKRTPLSIGYIPDY--VGFEIPNKFLVGYALDYNDYFRDLNHI 687
            C+I  DE +GY+   FCI  HY   L+ V IPHGLI DR E+LA DI   +D   + I ALCVLKGG+KFFADL + I   NR+  KSIP+++DFI++KSY +D S  ++ V G D+LS+LTGK+VLIVEDI+DTGKTM  LL  LK +NP  VKVASLLVKRTP S+GY   +  VGFE+P+KF+VGYALDYN+YFRDLN I
Sbjct:    7 CVIQDDE-QGYDLDLFCIPKHYAADLEKVYIPHGLIMDRTERLARDIM--KDMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDKSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMKTLLAMLKKYNPKMVKVASLLVKRTPRSVGYRQLFLLVGFEVPDKFVVGYALDYNEYFRDLNVI 206          
BLAST of Hypoxanthine phosphoribosyltransferase vs. Ensembl Xenopus
Match: btbd11 (BTB (POZ) domain containing 11 [Source:Xenbase;Acc:XB-GENE-991957])

HSP 1 Score: 233.417 bits (594), Expect = 2.659e-76
Identity = 120/203 (59.11%), Postives = 150/203 (73.89%), Query Frame = 1
Query:   79 SNCIIISDEIEGYNSSQFCIVSHYENVLDSVLIPHGLIKDRIEKLAVDIATDEDFSENGIAALCVLKGGFKFFADLTEAIDRNNRSKGKSIPLSIDFIKVKSYVDDHSINEVTVSGIDNLSSLTGKSVLIVEDIVDTGKTMMKLLNHLKNFNPASVKVASLLVKRTPLSIGYIPDY--VGFEIPNKFLVGYALDYNDYFRDLN 681
            S  + I D+ +GY+   FCI  HY   L+ V IPHGLI DR E+LA DI   +D   + I ALCVLKGG+KFFADL + I   NR+  KSIP+++DFI++KSY +D S  ++ V G D+LS+LTGK+VLIVEDI+DTGKTM  LL  LK +NP  VKVASLLVKRTP S+GY   +  VGFE+P+KF+VGYALDYN+YFRDLN
Sbjct:    5 SGSVPIQDDEQGYDLDLFCIPKHYAADLEKVYIPHGLIMDRTERLARDIM--KDMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDKSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMKTLLAMLKKYNPKMVKVASLLVKRTPRSVGYRQLFLLVGFEVPDKFVVGYALDYNEYFRDLN 205          
BLAST of Hypoxanthine phosphoribosyltransferase vs. Ensembl Xenopus
Match: btbd11 (BTB (POZ) domain containing 11 [Source:Xenbase;Acc:XB-GENE-991957])

HSP 1 Score: 233.417 bits (594), Expect = 3.492e-76
Identity = 122/212 (57.55%), Postives = 153/212 (72.17%), Query Frame = 1
Query:   79 SNCIIISDEIEGYNSSQFCIVSHYENVLDSVLIPHGLIKDRIEKLAVDIATDEDFSENGIAALCVLKGGFKFFADLTEAIDRNNRSKGKSIPLSIDFIKVKSYVDDHSINEVTVSGIDNLSSLTGKSVLIVEDIVDTGKTMMKLLNHLKNFNPASVKVASLLVKRTPLSIGYIPDY--VGFEIPNKFLVGYALDYNDYFRDLN----HICII 696
            S  + I D+ +GY+   FCI  HY   L+ V IPHGLI DR E+LA DI   +D   + I ALCVLKGG+KFFADL + I   NR+  KSIP+++DFI++KSY +D S  ++ V G D+LS+LTGK+VLIVEDI+DTGKTM  LL  LK +NP  VKVASLLVKRTP S+GY   +  VGFE+P+KF+VGYALDYN+YFRDLN     IC +
Sbjct:    5 SGSVPIQDDEQGYDLDLFCIPKHYAADLEKVYIPHGLIMDRTERLARDIM--KDMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDKSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMKTLLAMLKKYNPKMVKVASLLVKRTPRSVGYRQLFLLVGFEVPDKFVVGYALDYNEYFRDLNVSNYRICTV 214          
BLAST of Hypoxanthine phosphoribosyltransferase vs. Ensembl Mouse
Match: Hprt (hypoxanthine guanine phosphoribosyl transferase [Source:MGI Symbol;Acc:MGI:96217])

HSP 1 Score: 258.07 bits (658), Expect = 4.644e-86
Identity = 124/214 (57.94%), Postives = 165/214 (77.10%), Query Frame = 1
Query:   79 SNCIIISDEIEGYNSSQFCIVSHYENVLDSVLIPHGLIKDRIEKLAVDIATDEDFSENGIAALCVLKGGFKFFADLTEAIDRNNRSKGKSIPLSIDFIKVKSYVDDHSINEVTVSGIDNLSSLTGKSVLIVEDIVDTGKTMMKLLNHLKNFNPASVKVASLLVKRTPLSIGYIPDYVGFEIPNKFLVGYALDYNDYFRDLNHICIINEEGKMRF 720
            S  ++ISD+  GY+   FCI +HY   L+ V IPHGLI DR E+LA D+   ++   + I ALCVLKGG+KFFADL + I   NR+  +SIP+++DFI++KSY +D S  ++ V G D+LS+LTGK+VLIVEDI+DTGKTM  LL+ +K ++P  VKVASLLVKRT  S+GY PD+VGFEIP+KF+VGYALDYN+YFRDLNH+C+I+E GK ++
Sbjct:    5 SPSVVISDDEPGYDLDLFCIPNHYAEDLEKVFIPHGLIMDRTERLARDVM--KEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVKQYSPKMVKVASLLVKRTSRSVGYRPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKY 216          
BLAST of Hypoxanthine phosphoribosyltransferase vs. UniProt/SwissProt
Match: sp|Q9W719|HPRT_CHICK (Hypoxanthine-guanine phosphoribosyltransferase OS=Gallus gallus OX=9031 GN=HPRT1 PE=2 SV=1)

HSP 1 Score: 266.929 bits (681), Expect = 1.026e-88
Identity = 129/215 (60.00%), Postives = 166/215 (77.21%), Query Frame = 1
Query:   79 SNCIIISDEIEGYNSSQFCIVSHYENVLDSVLIPHGLIKDRIEKLAVDIATDEDFSENGIAALCVLKGGFKFFADLTEAIDRNNRSKGKSIPLSIDFIKVKSYVDDHSINEVTVSGIDNLSSLTGKSVLIVEDIVDTGKTMMKLLNHLKNFNPASVKVASLLVKRTPLSIGYIPDYVGFEIPNKFLVGYALDYNDYFRDLNHICIINEEGKMRFS 723
            S CI+I D+ +GY+   FCI  HY + L+ V IPHGLI DR E+LA +I   +    + I ALCVLKGG+KFFADL + I   NR+  KSIP+++DFI++KSY +D S  ++ V G D+LS+LTGK+VLIVEDI+DTGKTM  LL+ LK +NP  VKVASLLVKRTP S+GY PD+VGFE+P+KF+VGYALDYN+YFRDLNHIC+I+E GK ++ 
Sbjct:    5 SPCIVIGDDEQGYDLDLFCIPKHYADDLEKVYIPHGLIMDRTERLAREIM--KGMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDKSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMKTLLSLLKQYNPKMVKVASLLVKRTPRSVGYRPDFVGFEVPDKFVVGYALDYNEYFRDLNHICVISETGKQKYK 217          
BLAST of Hypoxanthine phosphoribosyltransferase vs. UniProt/SwissProt
Match: sp|Q6LDD9|HPRT_MACFA (Hypoxanthine-guanine phosphoribosyltransferase OS=Macaca fascicularis OX=9541 GN=HPRT1 PE=2 SV=3)

HSP 1 Score: 261.922 bits (668), Expect = 1.047e-86
Identity = 125/214 (58.41%), Postives = 166/214 (77.57%), Query Frame = 1
Query:   79 SNCIIISDEIEGYNSSQFCIVSHYENVLDSVLIPHGLIKDRIEKLAVDIATDEDFSENGIAALCVLKGGFKFFADLTEAIDRNNRSKGKSIPLSIDFIKVKSYVDDHSINEVTVSGIDNLSSLTGKSVLIVEDIVDTGKTMMKLLNHLKNFNPASVKVASLLVKRTPLSIGYIPDYVGFEIPNKFLVGYALDYNDYFRDLNHICIINEEGKMRF 720
            S  ++ISD+  GY+   FCI +HY   L+ V IPHGLI DR E+LA D+   ++   + I ALCVLKGG+KFFADL + I   NR+  +SIP+++DFI++KSY +D S  ++ V G D+LS+LTGK+VLIVEDI+DTGKTM  LL+ ++ +NP  VKVASLLVKRTP S+GY PD+VGFEIP+KF+VGYALDYN+YFRDLNH+C+I+E GK ++
Sbjct:    5 SPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVM--KEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKY 216          
BLAST of Hypoxanthine phosphoribosyltransferase vs. UniProt/SwissProt
Match: sp|P00492|HPRT_HUMAN (Hypoxanthine-guanine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=HPRT1 PE=1 SV=2)

HSP 1 Score: 261.922 bits (668), Expect = 1.047e-86
Identity = 125/214 (58.41%), Postives = 166/214 (77.57%), Query Frame = 1
Query:   79 SNCIIISDEIEGYNSSQFCIVSHYENVLDSVLIPHGLIKDRIEKLAVDIATDEDFSENGIAALCVLKGGFKFFADLTEAIDRNNRSKGKSIPLSIDFIKVKSYVDDHSINEVTVSGIDNLSSLTGKSVLIVEDIVDTGKTMMKLLNHLKNFNPASVKVASLLVKRTPLSIGYIPDYVGFEIPNKFLVGYALDYNDYFRDLNHICIINEEGKMRF 720
            S  ++ISD+  GY+   FCI +HY   L+ V IPHGLI DR E+LA D+   ++   + I ALCVLKGG+KFFADL + I   NR+  +SIP+++DFI++KSY +D S  ++ V G D+LS+LTGK+VLIVEDI+DTGKTM  LL+ ++ +NP  VKVASLLVKRTP S+GY PD+VGFEIP+KF+VGYALDYN+YFRDLNH+C+I+E GK ++
Sbjct:    5 SPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVM--KEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKY 216          
BLAST of Hypoxanthine phosphoribosyltransferase vs. UniProt/SwissProt
Match: sp|Q45FY6|HPRT_PIG (Hypoxanthine-guanine phosphoribosyltransferase OS=Sus scrofa OX=9823 GN=HPRT1 PE=2 SV=3)

HSP 1 Score: 261.536 bits (667), Expect = 1.375e-86
Identity = 126/214 (58.88%), Postives = 165/214 (77.10%), Query Frame = 1
Query:   79 SNCIIISDEIEGYNSSQFCIVSHYENVLDSVLIPHGLIKDRIEKLAVDIATDEDFSENGIAALCVLKGGFKFFADLTEAIDRNNRSKGKSIPLSIDFIKVKSYVDDHSINEVTVSGIDNLSSLTGKSVLIVEDIVDTGKTMMKLLNHLKNFNPASVKVASLLVKRTPLSIGYIPDYVGFEIPNKFLVGYALDYNDYFRDLNHICIINEEGKMRF 720
            S  ++ISD+  GY+   FCI +HY   L+ V IPHGLI DR E+LA D+   ++   + I ALCVLKGG+KFFADL + I   NR+  +SIP+++DFI++KSY +D S  ++ V G D+LS+LTGK+VLIVEDI+DTGKTM  LL+ +K  NP  VKVASLLVKRTP S+GY PD+VGFEIP+KF+VGYALDYN+YFRDLNH+C+I+E GK ++
Sbjct:    5 SPSVVISDDEPGYDLDLFCIPNHYAEDLEKVFIPHGLIMDRTERLARDVM--KEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVKQHNPKMVKVASLLVKRTPRSVGYRPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKY 216          
BLAST of Hypoxanthine phosphoribosyltransferase vs. UniProt/SwissProt
Match: sp|A5A6I1|HPRT_PANTR (Hypoxanthine-guanine phosphoribosyltransferase OS=Pan troglodytes OX=9598 GN=HPRT1 PE=2 SV=1)

HSP 1 Score: 261.151 bits (666), Expect = 1.637e-86
Identity = 125/214 (58.41%), Postives = 165/214 (77.10%), Query Frame = 1
Query:   79 SNCIIISDEIEGYNSSQFCIVSHYENVLDSVLIPHGLIKDRIEKLAVDIATDEDFSENGIAALCVLKGGFKFFADLTEAIDRNNRSKGKSIPLSIDFIKVKSYVDDHSINEVTVSGIDNLSSLTGKSVLIVEDIVDTGKTMMKLLNHLKNFNPASVKVASLLVKRTPLSIGYIPDYVGFEIPNKFLVGYALDYNDYFRDLNHICIINEEGKMRF 720
            S  ++ISD+  GY+   FCI +HY   L+ V IPHGLI DR E+LA D+   ++   + I ALCVLKGG+KFFADL + I   NR+  +SIP+++DFI++KSY +D S  +  V G D+LS+LTGK+VLIVEDI+DTGKTM  LL+ ++ +NP  VKVASLLVKRTP S+GY PD+VGFEIP+KF+VGYALDYN+YFRDLNH+C+I+E GK ++
Sbjct:    5 SPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVM--KEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDTKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKY 216          
BLAST of Hypoxanthine phosphoribosyltransferase vs. TrEMBL
Match: B5DFU2 (Hypoxanthine phosphoribosyltransferase OS=Salmo salar OX=8030 GN=hprt1 PE=2 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 8.776e-89
Identity = 131/214 (61.21%), Postives = 168/214 (78.50%), Query Frame = 1
Query:   79 SNCIIISDEIEGYNSSQFCIVSHYENVLDSVLIPHGLIKDRIEKLAVDIATDEDFSENGIAALCVLKGGFKFFADLTEAIDRNNRSKGKSIPLSIDFIKVKSYVDDHSINEVTVSGIDNLSSLTGKSVLIVEDIVDTGKTMMKLLNHLKNFNPASVKVASLLVKRTPLSIGYIPDYVGFEIPNKFLVGYALDYNDYFRDLNHICIINEEGKMRF 720
            S C++ISD+ +GY+   FCI  HY + LD V IPHGLI DR E+LA +I   +D   + I ALCVLKGG+KFFADL + I   NR+  +SIP+++DFI++KSY +D S  E+ V G D+LS+LTGK+VLIVEDI+DTGKTM  LL  LK +NP  VKVASLLVKRTP S+GYIPD++GFE+P+KF+VGYALDYN+YFRDLNHIC+I+E GK ++
Sbjct:    5 SPCVVISDDEQGYDLDLFCIPKHYADDLDRVYIPHGLILDRTERLAREIM--KDMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGEIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMKTLLQLLKQYNPKMVKVASLLVKRTPRSVGYIPDFIGFEVPDKFVVGYALDYNEYFRDLNHICVISETGKEKY 216          
BLAST of Hypoxanthine phosphoribosyltransferase vs. TrEMBL
Match: A0A3B3HF46 (Hypoxanthine phosphoribosyltransferase OS=Oryzias latipes OX=8090 GN=hprt1 PE=3 SV=1)

HSP 1 Score: 273.092 bits (697), Expect = 1.178e-88
Identity = 131/214 (61.21%), Postives = 168/214 (78.50%), Query Frame = 1
Query:   79 SNCIIISDEIEGYNSSQFCIVSHYENVLDSVLIPHGLIKDRIEKLAVDIATDEDFSENGIAALCVLKGGFKFFADLTEAIDRNNRSKGKSIPLSIDFIKVKSYVDDHSINEVTVSGIDNLSSLTGKSVLIVEDIVDTGKTMMKLLNHLKNFNPASVKVASLLVKRTPLSIGYIPDYVGFEIPNKFLVGYALDYNDYFRDLNHICIINEEGKMRF 720
            S+C++ISDE +GY+   FCI  HY + L+ V IPHGLI DR E+LA +I   ++   + I ALCVLKGG+KFFADL + I   NR+  +SIP+++DFI++KSY +D S  E+ V G D+LS+LTGK+VLIVEDI+DTGKTM  LL  LK +NP  VKVASLLVKRTP S+GY PDYVGFE+P+KF+VGYALDYN+YFRDLNHIC+I+E GK ++
Sbjct:    5 SSCVVISDEEQGYDLDLFCIPRHYASDLERVYIPHGLILDRTERLAREIM--KEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYYNDQSTGEIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLELLKQYNPKMVKVASLLVKRTPRSVGYRPDYVGFEVPDKFVVGYALDYNEYFRDLNHICVISETGKEKY 216          
BLAST of Hypoxanthine phosphoribosyltransferase vs. TrEMBL
Match: A0A3P9HZJ0 (Hypoxanthine phosphoribosyltransferase OS=Oryzias latipes OX=8090 PE=3 SV=1)

HSP 1 Score: 273.092 bits (697), Expect = 1.178e-88
Identity = 131/214 (61.21%), Postives = 168/214 (78.50%), Query Frame = 1
Query:   79 SNCIIISDEIEGYNSSQFCIVSHYENVLDSVLIPHGLIKDRIEKLAVDIATDEDFSENGIAALCVLKGGFKFFADLTEAIDRNNRSKGKSIPLSIDFIKVKSYVDDHSINEVTVSGIDNLSSLTGKSVLIVEDIVDTGKTMMKLLNHLKNFNPASVKVASLLVKRTPLSIGYIPDYVGFEIPNKFLVGYALDYNDYFRDLNHICIINEEGKMRF 720
            S+C++ISDE +GY+   FCI  HY + L+ V IPHGLI DR E+LA +I   ++   + I ALCVLKGG+KFFADL + I   NR+  +SIP+++DFI++KSY +D S  E+ V G D+LS+LTGK+VLIVEDI+DTGKTM  LL  LK +NP  VKVASLLVKRTP S+GY PDYVGFE+P+KF+VGYALDYN+YFRDLNHIC+I+E GK ++
Sbjct:    5 SSCVVISDEEQGYDLDLFCIPRHYASDLERVYIPHGLILDRTERLAREIM--KEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYYNDQSTGEIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLELLKQYNPKMVKVASLLVKRTPRSVGYRPDYVGFEVPDKFVVGYALDYNEYFRDLNHICVISETGKEKY 216          
BLAST of Hypoxanthine phosphoribosyltransferase vs. TrEMBL
Match: A0A141GF45 (Hypoxanthine phosphoribosyltransferase OS=Acanthogobius hasta OX=267130 GN=HPRT PE=2 SV=1)

HSP 1 Score: 272.707 bits (696), Expect = 1.671e-88
Identity = 131/214 (61.21%), Postives = 167/214 (78.04%), Query Frame = 1
Query:   79 SNCIIISDEIEGYNSSQFCIVSHYENVLDSVLIPHGLIKDRIEKLAVDIATDEDFSENGIAALCVLKGGFKFFADLTEAIDRNNRSKGKSIPLSIDFIKVKSYVDDHSINEVTVSGIDNLSSLTGKSVLIVEDIVDTGKTMMKLLNHLKNFNPASVKVASLLVKRTPLSIGYIPDYVGFEIPNKFLVGYALDYNDYFRDLNHICIINEEGKMRF 720
            S+C++ISDE +GY+   FCI  HY   L+ V IPHGLI DR E+LA +I   ++   + I ALCVLKGG+KFFADL + I   NR+  +SIP+++DFI++KSY +D S  E+ V G D+LS+LTGK+VLIVEDI+DTGKTM  LL  LK +NP  VKVASLLVKRTP S+GY PDYVGFE+P+KF+VGYALDYN+YFRDLNHIC+I+E GK ++
Sbjct:    5 SSCVVISDEEQGYDLDLFCIPKHYATDLERVYIPHGLILDRTERLAREIM--KEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYYNDQSTGEIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMKTLLQLLKQYNPKMVKVASLLVKRTPRSVGYRPDYVGFEVPDKFVVGYALDYNEYFRDLNHICVISETGKEKY 216          
BLAST of Hypoxanthine phosphoribosyltransferase vs. TrEMBL
Match: A0A0S7HKN1 (Hypoxanthine phosphoribosyltransferase OS=Poeciliopsis prolifica OX=188132 GN=HPRT PE=3 SV=1)

HSP 1 Score: 272.707 bits (696), Expect = 1.863e-88
Identity = 131/214 (61.21%), Postives = 167/214 (78.04%), Query Frame = 1
Query:   79 SNCIIISDEIEGYNSSQFCIVSHYENVLDSVLIPHGLIKDRIEKLAVDIATDEDFSENGIAALCVLKGGFKFFADLTEAIDRNNRSKGKSIPLSIDFIKVKSYVDDHSINEVTVSGIDNLSSLTGKSVLIVEDIVDTGKTMMKLLNHLKNFNPASVKVASLLVKRTPLSIGYIPDYVGFEIPNKFLVGYALDYNDYFRDLNHICIINEEGKMRF 720
            S+C++ISDE +GY+   FCI  HY   L+ V IPHGLI DR E+LA +I   ++   + I ALCVLKGG+KFFADL + I   NR+  +SIP+++DFI++KSY +D S  E+ V G D+LS+LTGK+VLIVEDI+DTGKTM  LL  LK +NP  VKVASLLVKRTP S+GY PD+VGFEIP+KF+VGYALDYN+YFRDLNHIC+I+E GK ++
Sbjct:    5 SSCVVISDEEQGYDLDLFCIPKHYAAALERVYIPHGLILDRTERLAREIM--KEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGEIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMKTLLQLLKQYNPKMVKVASLLVKRTPRSVGYRPDFVGFEIPDKFVVGYALDYNEYFRDLNHICVISETGKEKY 216          
BLAST of Hypoxanthine phosphoribosyltransferase vs. Ensembl Cavefish
Match: prtfdc1 (hypoxanthine-guanine phosphoribosyltransferase-like [Source:NCBI gene;Acc:103039916])

HSP 1 Score: 228.024 bits (580), Expect = 2.685e-74
Identity = 111/211 (52.61%), Postives = 149/211 (70.62%), Query Frame = 1
Query:   88 IIISDEIEGYNSSQFCIVSHYENVLDSVLIPHGLIKDRIEKLAVDIATDEDFSENGIAALCVLKGGFKFFADLTEAIDRNNRSKGKSIPLSIDFIKVKSYVDDHSINEVTVSGIDNLSSLTGKSVLIVEDIVDTGKTMMKLLNHLKNFNPASVKVASLLVKRTPLSIGYIPDYVGFEIPNKFLVGYALDYNDYFRDLNHICIINEEGKMRF 720
            ++I D   GY    F    HY   LD V IPHG+I DR E+LA +I   +D  +  I  LCVLKGG++F +DL E I   + +  KS+ + +DFI++KSY++D S  ++ + G ++LS L+GK+VLIVE IVDTGKTM  LL H++ F P  ++VA LLVKR P S G +PDYVGFEIPN+F+VGYALDYN+YFRDLNHIC+I+E GK ++
Sbjct:   17 VVIPDNWPGYPLDLFTFPEHYSGDLDCVYIPHGVIMDRTERLARNIM--DDLGDRDIVVLCVLKGGYQFCSDLVERIKVLSCNSSKSLLMRVDFIRLKSYLNDRSTQDLQIIGAESLSVLSGKNVLIVEAIVDTGKTMKTLLTHVRAFKPNMIRVAGLLVKRVPNSSGCLPDYVGFEIPNRFVVGYALDYNEYFRDLNHICVISESGKQKY 225          
BLAST of Hypoxanthine phosphoribosyltransferase vs. Ensembl Cavefish
Match: unm_sa821 (phosphoribosyltransferase domain-containing protein 1-like [Source:NCBI gene;Acc:103035688])

HSP 1 Score: 224.942 bits (572), Expect = 3.897e-73
Identity = 110/212 (51.89%), Postives = 149/212 (70.28%), Query Frame = 1
Query:   88 IIISDEIEGYNSSQFCIVSHYENVLDSVLIPHGLIKDRIEKLAVDIATDEDFSENGIAALCVLKGGFKFFADLTEAIDRNNRSKGKSIPLSIDFIKVKSYVDDHSINEVTVSGIDNLSSLTGKSVLIVEDIVDTGKTMMKLLNHLKNFNPASVKVASLLVKRTPLSIGYIPDYVGFEIPNKFLVGYALDYNDYFRDLNHICIINEEGKMRFS 723
            ++I D+  GYN   F    HY   ++SVLIPHG+I +RIE LA DI   E+   + +  LCVLKGG+KF +DL ++I   +RS  + +   ++FI++KSY++D S  ++ + G ++LS   GK+VLIVE IVDTGKTM  LL H+K F P +VKVA LLVKR P     +PDYVGF IPN+F+VGYALDYN+YFRDLNHIC+I+E GK ++ 
Sbjct:   15 LVIPDDWPGYNLELFNYPEHYRGDIESVLIPHGVIMNRIECLARDIL--EEIGHHTLMVLCVLKGGYKFCSDLVDSIKSQSRSTNRQLTTRVEFIRLKSYLNDRSTEDLHIIGPEDLSIFKGKNVLIVEAIVDTGKTMKALLQHVKMFQPKAVKVAGLLVKRIPKGSETLPDYVGFVIPNRFVVGYALDYNEYFRDLNHICVISETGKQKYK 224          
BLAST of Hypoxanthine phosphoribosyltransferase vs. Ensembl Cavefish
Match: prtfdc1 (hypoxanthine-guanine phosphoribosyltransferase-like [Source:NCBI gene;Acc:103039916])

HSP 1 Score: 212.616 bits (540), Expect = 2.239e-68
Identity = 106/211 (50.24%), Postives = 143/211 (67.77%), Query Frame = 1
Query:   88 IIISDEIEGYNSSQFCIVSHYENVLDSVLIPHGLIKDRIEKLAVDIATDEDFSENGIAALCVLKGGFKFFADLTEAIDRNNRSKGKSIPLSIDFIKVKSYVDDHSINEVTVSGIDNLSSLTGKSVLIVEDIVDTGKTMMKLLNHLKNFNPASVKVASLLVKRTPLSIGYIPDYVGFEIPNKFLVGYALDYNDYFRDLNHICIINEEGKMRF 720
            + I D   GY    F    HY   LD V IPHG+I DR E+LA +I   +D  +  I  LCVLKGG++F +DL E I   + +  KS+ + +DFI++KSY++D S  ++ + G ++LS L+GK+      IVDTGKTM  LL H++ F P  ++VA LLVKR P S G +PDYVGFEIPN+F+VGYALDYN+YFRDLNHIC+I+E GK ++
Sbjct:    9 LFIPDNWPGYPLDLFTFPEHYSGDLDCVYIPHGVIMDRTERLARNIM--DDLGDRDIVVLCVLKGGYQFCSDLVERIKVLSCNSSKSLLMRVDFIRLKSYLNDRSTQDLQIIGAESLSVLSGKA------IVDTGKTMKTLLTHVRAFKPNMIRVAGLLVKRVPNSSGCLPDYVGFEIPNRFVVGYALDYNEYFRDLNHICVISESGKQKY 211          
BLAST of Hypoxanthine phosphoribosyltransferase vs. Ensembl Cavefish
Match: hprt1l (hypoxanthine phosphoribosyltransferase 1, like [Source:ZFIN;Acc:ZDB-GENE-040625-17])

HSP 1 Score: 183.341 bits (464), Expect = 1.901e-57
Identity = 99/209 (47.37%), Postives = 127/209 (60.77%), Query Frame = 1
Query:   94 ISDEIEGYNSSQFCIVSHYENVLDSVLIPHGLIKDRIEKLAVDIATDEDFSENGIAALCVLKGGFKFFADLTEAIDRNNRSKGKSIPLSIDFIKVKSYVDDHSINEVTVSGIDNLSSLTGKSVLIVEDIVDTGKTMMKLLNHLKNFNPASVKVASLLVKRTPLSIGYIPDYVGFEIPNKFLVGYALDYNDYFRDLNHICIINEEGKMRF 720
            I D+ +G+  S FC+  HYE  LDSV+IP+GLIKDR E+LA DI    D   + I ALCVLKGG+KFFADL + I   N++  KS+PL++DFI++KSY +D S N V V G D                                          LLVKRTP S GY PDY+GFE+P+KFLVGYALDYN+YFRDL+HICI+++  K ++
Sbjct:    7 ILDDDQGHELSLFCVPKHYEEDLDSVIIPNGLIKDRTERLARDIV--RDMGGHHIVALCVLKGGYKFFADLMDYIKALNQNSDKSVPLTVDFIRLKSYSNDQSTNCVKVIGGDEF----------------------------------------LLVKRTPRSSGYRPDYIGFEVPDKFLVGYALDYNEYFRDLSHICILSDRAKEKY 173          
BLAST of Hypoxanthine phosphoribosyltransferase vs. Ensembl Cavefish
Match: hprt1l (hypoxanthine phosphoribosyltransferase 1, like [Source:ZFIN;Acc:ZDB-GENE-040625-17])

HSP 1 Score: 183.341 bits (464), Expect = 1.985e-57
Identity = 99/209 (47.37%), Postives = 127/209 (60.77%), Query Frame = 1
Query:   94 ISDEIEGYNSSQFCIVSHYENVLDSVLIPHGLIKDRIEKLAVDIATDEDFSENGIAALCVLKGGFKFFADLTEAIDRNNRSKGKSIPLSIDFIKVKSYVDDHSINEVTVSGIDNLSSLTGKSVLIVEDIVDTGKTMMKLLNHLKNFNPASVKVASLLVKRTPLSIGYIPDYVGFEIPNKFLVGYALDYNDYFRDLNHICIINEEGKMRF 720
            I D+ +G+  S FC+  HYE  LDSV+IP+GLIKDR E+LA DI    D   + I ALCVLKGG+KFFADL + I   N++  KS+PL++DFI++KSY +D S N V V G D                                          LLVKRTP S GY PDY+GFE+P+KFLVGYALDYN+YFRDL+HICI+++  K ++
Sbjct:    7 ILDDDQGHELSLFCVPKHYEEDLDSVIIPNGLIKDRTERLARDIV--RDMGGHHIVALCVLKGGYKFFADLMDYIKALNQNSDKSVPLTVDFIRLKSYSNDQSTNCVKVIGGDEF----------------------------------------LLVKRTPRSSGYRPDYIGFEVPDKFLVGYALDYNEYFRDLSHICILSDRAKEKY 173          
BLAST of Hypoxanthine phosphoribosyltransferase vs. Ensembl Nematostella
Match: EDO32938 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STM7])

HSP 1 Score: 246.514 bits (628), Expect = 2.873e-82
Identity = 117/210 (55.71%), Postives = 155/210 (73.81%), Query Frame = 1
Query:   94 ISDEIEGYNSSQFCIVSHYENVLDSVLIPHGLIKDRIEKLAVDIATDEDFSENGIAALCVLKGGFKFFADLTEAIDRNNRSKGKSIPLSIDFIKVKSYVDDHSINEVTVSGIDNLSSLTGKSVLIVEDIVDTGKTMMKLLNHLKNFNPASVKVASLLVKRTPLSIGYIPDYVGFEIPNKFLVGYALDYNDYFRDLNHICIINEEGKMRFS 723
            + D+ +GY  + FCI  HYE  L+ V+IP GLI+DR E++A +I  +       +  LCVLKGG++FFADL E I   N    +S+ +S+DF+++KSY DD S  EV + G DNL SLTGK+VLIVEDI+DTG TM+KLL  +K +NPASVKV SLL+KR   S+GY PDY GFE+P++F+VGYALDYN+YFRDLNHIC+IN  GK +++
Sbjct:    1 MPDDYQGYPLNMFCIPKHYEGDLEHVMIPKGLIQDRTERIARNICRE---MSGPLVGLCVLKGGYQFFADLMEFIRTMNAKSAESMQMSVDFVRLKSYEDDKSSGEVRIIGGDNLESLTGKNVLIVEDIIDTGATMVKLLKTIKQYNPASVKVVSLLIKRNVNSVGYKPDYAGFEVPDRFVVGYALDYNEYFRDLNHICVINNSGKTKYA 207          
BLAST of Hypoxanthine phosphoribosyltransferase vs. Ensembl Medaka
Match: hprt1 (hypoxanthine phosphoribosyltransferase 1 [Source:NCBI gene;Acc:101163340])

HSP 1 Score: 273.092 bits (697), Expect = 4.435e-92
Identity = 131/214 (61.21%), Postives = 168/214 (78.50%), Query Frame = 1
Query:   79 SNCIIISDEIEGYNSSQFCIVSHYENVLDSVLIPHGLIKDRIEKLAVDIATDEDFSENGIAALCVLKGGFKFFADLTEAIDRNNRSKGKSIPLSIDFIKVKSYVDDHSINEVTVSGIDNLSSLTGKSVLIVEDIVDTGKTMMKLLNHLKNFNPASVKVASLLVKRTPLSIGYIPDYVGFEIPNKFLVGYALDYNDYFRDLNHICIINEEGKMRF 720
            S+C++ISDE +GY+   FCI  HY + L+ V IPHGLI DR E+LA +I   ++   + I ALCVLKGG+KFFADL + I   NR+  +SIP+++DFI++KSY +D S  E+ V G D+LS+LTGK+VLIVEDI+DTGKTM  LL  LK +NP  VKVASLLVKRTP S+GY PDYVGFE+P+KF+VGYALDYN+YFRDLNHIC+I+E GK ++
Sbjct:    5 SSCVVISDEEQGYDLDLFCIPRHYASDLERVYIPHGLILDRTERLAREIM--KEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYYNDQSTGEIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLELLKQYNPKMVKVASLLVKRTPRSVGYRPDYVGFEVPDKFVVGYALDYNEYFRDLNHICVISETGKEKY 216          
BLAST of Hypoxanthine phosphoribosyltransferase vs. Ensembl Medaka
Match: hprt1 (hypoxanthine phosphoribosyltransferase 1 [Source:NCBI gene;Acc:101163340])

HSP 1 Score: 251.136 bits (640), Expect = 6.533e-83
Identity = 124/209 (59.33%), Postives = 157/209 (75.12%), Query Frame = 1
Query:   94 ISDEIEGYNSSQFCIVSHYENVLDSVLIPHGLIKDRIEKLAVDIATDEDFSENGIAALCVLKGGFKFFADLTEAIDRNNRSKGKSIPLSIDFIKVKSYVDDHSINEVTVSGIDNLSSLTGKSVLIVEDIVDTGKTMMKLLNHLKNFNPASVKVASLLVKRTPLSIGYIPDYVGFEIPNKFLVGYALDYNDYFRDLNHICIINEEGKMRF 720
            ISDE +GY+   FCI  HY + L+ V IPHGLI DR E+LA +I   ++   + I ALCVLKGG+KFFADL + I   NR+  +SIP+++DFI++KSY +D S  E+ V G D+LS+LTGK      DI+DTGKTM  LL  LK +NP  VKVASLLVKRTP S+GY PDYVGFE+P+KF+VGYALDYN+YFRDLNHIC+I+E GK ++
Sbjct:   55 ISDEEQGYDLDLFCIPRHYASDLERVYIPHGLILDRTERLAREIM--KEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYYNDQSTGEIKVIGGDDLSTLTGK------DIIDTGKTMQTLLELLKQYNPKMVKVASLLVKRTPRSVGYRPDYVGFEVPDKFVVGYALDYNEYFRDLNHICVISETGKEKY 255          
BLAST of Hypoxanthine phosphoribosyltransferase vs. Ensembl Medaka
Match: hprt1l (hypoxanthine-guanine phosphoribosyltransferase [Source:NCBI gene;Acc:101161553])

HSP 1 Score: 249.98 bits (637), Expect = 1.031e-82
Identity = 125/209 (59.81%), Postives = 157/209 (75.12%), Query Frame = 1
Query:   94 ISDEIEGYNSSQFCIVSHYENVLDSVLIPHGLIKDRIEKLAVDIATDEDFSENGIAALCVLKGGFKFFADLTEAIDRNNRSKGKSIPLSIDFIKVKSYVDDHSINEVTVSGIDNLSSLTGKSVLIVEDIVDTGKTMMKLLNHLKNFNPASVKVASLLVKRTPLSIGYIPDYVGFEIPNKFLVGYALDYNDYFRDLNHICIINEEGKMRF 720
            I+D+ +G+    FCI  HYEN LD V+IPHGLI DR E+LA DI   +D   + I ALCVLKGG+KFFADL + I   N++  KS+PL++DFI+VKSY +D S N V V G D LS+L GK+VLIVEDIV+TG+TM  LL+ L   +P  VKV SLLVKRTP S GY PDY+GFE+P+ FLVGYALDYN+YFRDL+HICI+N+  K ++
Sbjct:    7 IADDEKGHELDLFCIPRHYENDLDKVIIPHGLIMDRTERLARDII--QDMGGHHIVALCVLKGGYKFFADLLDYIKALNQNSDKSVPLTVDFIRVKSYCNDESTNSVKVIGGDELSNLRGKNVLIVEDIVETGRTMQTLLSLLGECHPKMVKVVSLLVKRTPRSSGYRPDYIGFEVPDAFLVGYALDYNEYFRDLSHICILNDRAKEKY 213          
BLAST of Hypoxanthine phosphoribosyltransferase vs. Ensembl Medaka
Match: hprt1l (hypoxanthine-guanine phosphoribosyltransferase [Source:NCBI gene;Acc:101161553])

HSP 1 Score: 234.572 bits (597), Expect = 8.362e-77
Identity = 118/198 (59.60%), Postives = 147/198 (74.24%), Query Frame = 1
Query:  130 FCIVSHYENVLDSVLIPHGLIKDRIEKLAVDIATDEDFSENGIAALCVLKGGFKFFADLTEAIDRNNRSKGKSIPLSIDFIKVKSYVDDHSINEVTVSGIDNLSSLTGKSVLI-VEDIVDTGKTMMKLLNHLKNFNPASVKVASLLVKRTPLSIGYIPDYVGFEIPNKFLVGYALDYNDYFRDLNHICIINEEGKMRF 720
            FCI  HYEN LD V+IPHGLI DR E+LA DI   +D   + I ALCVLKGG+KFFADL + I   N++  KS+PL++DFI+VKSY +D S N V V G D LS+L GK  L  ++DIV+TG+TM  LL+ L   +P  VKV SLLVKRTP S GY PDY+GFE+P+ FLVGYALDYN+YFRDL+HICI+N+  K ++
Sbjct:   34 FCIPRHYENDLDKVIIPHGLIMDRTERLARDII--QDMGGHHIVALCVLKGGYKFFADLLDYIKALNQNSDKSVPLTVDFIRVKSYCNDESTNSVKVIGGDELSNLRGKHFLFGLQDIVETGRTMQTLLSLLGECHPKMVKVVSLLVKRTPRSSGYRPDYIGFEVPDAFLVGYALDYNEYFRDLSHICILNDRAKEKY 229          
BLAST of Hypoxanthine phosphoribosyltransferase vs. Ensembl Medaka
Match: prtfdc1 (phosphoribosyltransferase domain-containing protein 1 [Source:NCBI gene;Acc:101160352])

HSP 1 Score: 224.172 bits (570), Expect = 8.111e-73
Identity = 110/214 (51.40%), Postives = 153/214 (71.50%), Query Frame = 1
Query:   79 SNCIIISDEIEGYNSSQFCIVSHYENVLDSVLIPHGLIKDRIEKLAVDIATDEDFSENGIAALCVLKGGFKFFADLTEAIDRNNRSKGKSIPLSIDFIKVKSYVDDHSINEVTVSGIDNLSSLTGKSVLIVEDIVDTGKTMMKLLNHLKNFNPASVKVASLLVKRTPLSIGYIPDYVGFEIPNKFLVGYALDYNDYFRDLNHICIINEEGKMRF 720
            S  I+I D+  GY+   F   +HY   LD V+IPHG+I DR E+LA +I   +D  ++ I  LCVLKGG++F ADL + I   + +   +IP+ + FI++KSY++D S  ++ + G ++LS L+GK+VLIVE IV TGKTM  LL H+++F P  +K+A LLVKR  LS   +PDYVGFEIPN+F+VGYALDYN+YFRDLNHIC+I+E GK ++
Sbjct:   12 SEGIVIHDDWPGYSLDLFSYPAHYYGDLDCVIIPHGVIMDRTERLARNIM--DDLGDHDIVVLCVLKGGYQFCADLVDRIKALSCNSDHTIPMRVHFIRLKSYLNDQSTEDLHILGAEDLSFLSGKNVLIVEGIVGTGKTMKTLLKHVESFRPKMIKIAGLLVKRVQLSPTCVPDYVGFEIPNRFVVGYALDYNEYFRDLNHICVISESGKKKY 223          
BLAST of Hypoxanthine phosphoribosyltransferase vs. Planmine SMEST
Match: SMESG000007399.1 (SMESG000007399.1)

HSP 1 Score: 424.861 bits (1091), Expect = 1.232e-151
Identity = 213/217 (98.16%), Postives = 213/217 (98.16%), Query Frame = 1
Query:   79 SNCIIISDEIEGYNSSQFCIVSHYENVLDSVLIPHGLIKDRIEKLAVDIATDEDFSENGIAALCVLKGGFKFFADLTEAIDRNNRSKGKSIPLSIDFIKVKSYVDDHSINEVTVSGIDNLSSLTGKSVLIVEDIVDTGKTMMKLLNHLKNFNPASVKVASLLVKRTPLSIGYIPDYVGFEIPNKFLVGYALDYNDYFRDLNHICIINEEGKMRFSKK 729
            SNCIIISDEIEGYNSSQFCIVSHYENVLDSVLIPHGLIKDRIEKLAVDIATDEDFSENGIAALCVLKGGFKFFADLTEAIDRNNRSKGKSIPLSIDFIKVKSYVDDHSINEVTVSGIDNLSSLTGKSVLIVEDIVDTGKTMMKLLNHLKNFNPASVKVASLLVKRTPLSIGYIPDYVGFEIPNKFLVGYALDYNDYFRDLNHICIINEEGK    KK
Sbjct:    5 SNCIIISDEIEGYNSSQFCIVSHYENVLDSVLIPHGLIKDRIEKLAVDIATDEDFSENGIAALCVLKGGFKFFADLTEAIDRNNRSKGKSIPLSIDFIKVKSYVDDHSINEVTVSGIDNLSSLTGKSVLIVEDIVDTGKTMMKLLNHLKNFNPASVKVASLLVKRTPLSIGYIPDYVGFEIPNKFLVGYALDYNDYFRDLNHICIINEEGKCGSVKK 221          

HSP 2 Score: 51.9878 bits (123), Expect = 1.194e-7
Identity = 25/28 (89.29%), Postives = 26/28 (92.86%), Query Frame = 2
Query:  701 KREKCGSVKKVDLFKNNSILKPLLANSV 784
            +  KCGSVKKVDLFKNNSILKPLLANSV
Sbjct:  212 EEGKCGSVKKVDLFKNNSILKPLLANSV 239          
BLAST of Hypoxanthine phosphoribosyltransferase vs. Planmine SMEST
Match: SMESG000025931.1 (SMESG000025931.1)

HSP 1 Score: 283.108 bits (723), Expect = 4.368e-96
Identity = 141/219 (64.38%), Postives = 168/219 (76.71%), Query Frame = 1
Query:   79 SNCIIISDEIEGYNSSQFCIVSHYENVLDSVLIPHGLIKDRIEKLAVDIATDEDFSENGIAALCVLKGGFKFFADLTEAIDRNNRSKGKSIPLSIDFIKVKSYVDDHSINEVTVSGIDNLSSLTGKSVLIVEDIVDTGKTMMKLLNHLKNFNPASVKVASLLVKRTPLSIGYIPDYVGFEIPNKFLVGYALDYNDYFRDLNHICIINEEGKMRFS-KKG 732
            S+CI I D+ +GY+ + FCI SHYE+VL SVLIPHG+IKDRIEKLAVDI         G+  LCVLKGGFKFFADL  AID  NR+K  SI +S+DFI+V+SYV+  S  +V V GIDNL  L  K VLIVED+V++GKTM KLL ++  F P SVKVASLLVKRT     Y PD++GFE+PN FLVGYALDYND+FRDLNHIC+INEEGK R++ KKG
Sbjct:    4 SDCIKIEDDWKGYDLTTFCIASHYEDVLSSVLIPHGVIKDRIEKLAVDITQSWLEDAKGLTTLCVLKGGFKFFADLLNAIDHENRTKPNSIAVSVDFIRVESYVNCESSGKVKVIGIDNLEFLKDKDVLIVEDVVESGKTMTKLLEYVNQFKPNSVKVASLLVKRTATGTHYKPDFIGFEVPNNFLVGYALDYNDHFRDLNHICVINEEGKQRYACKKG 222          
BLAST of Hypoxanthine phosphoribosyltransferase vs. Planmine SMEST
Match: SMESG000025931.1 (SMESG000025931.1)

HSP 1 Score: 283.108 bits (723), Expect = 4.448e-96
Identity = 141/219 (64.38%), Postives = 168/219 (76.71%), Query Frame = 1
Query:   79 SNCIIISDEIEGYNSSQFCIVSHYENVLDSVLIPHGLIKDRIEKLAVDIATDEDFSENGIAALCVLKGGFKFFADLTEAIDRNNRSKGKSIPLSIDFIKVKSYVDDHSINEVTVSGIDNLSSLTGKSVLIVEDIVDTGKTMMKLLNHLKNFNPASVKVASLLVKRTPLSIGYIPDYVGFEIPNKFLVGYALDYNDYFRDLNHICIINEEGKMRFS-KKG 732
            S+CI I D+ +GY+ + FCI SHYE+VL SVLIPHG+IKDRIEKLAVDI         G+  LCVLKGGFKFFADL  AID  NR+K  SI +S+DFI+V+SYV+  S  +V V GIDNL  L  K VLIVED+V++GKTM KLL ++  F P SVKVASLLVKRT     Y PD++GFE+PN FLVGYALDYND+FRDLNHIC+INEEGK R++ KKG
Sbjct:   10 SDCIKIEDDWKGYDLTTFCIASHYEDVLSSVLIPHGVIKDRIEKLAVDITQSWLEDAKGLTTLCVLKGGFKFFADLLNAIDHENRTKPNSIAVSVDFIRVESYVNCESSGKVKVIGIDNLEFLKDKDVLIVEDVVESGKTMTKLLEYVNQFKPNSVKVASLLVKRTATGTHYKPDFIGFEVPNNFLVGYALDYNDHFRDLNHICVINEEGKQRYACKKG 228          
BLAST of Hypoxanthine phosphoribosyltransferase vs. Planmine SMEST
Match: SMESG000034670.1 (SMESG000034670.1)

HSP 1 Score: 147.902 bits (372), Expect = 6.217e-44
Identity = 80/140 (57.14%), Postives = 98/140 (70.00%), Query Frame = 1
Query:  262 ALCVLKGGFKFFADLTEAIDRNNRSKGKSIPLSIDFIKVKSYVDDHSINEVTVSGIDNLSSLTGKSVLIVEDIVDTGKTMMKLLNHLKNFNPASVKVASLLVKRTPLSIGYIPDYVGFEIPNKFLVGYALDYNDYFRDLN 681
             LCVL GGFK FADL  AID  NR+K  SI +S+DFI+V+SYV      +V + GIDNL  L  K +LIV+D V++GKTM KLL ++  F P  VKVASLLVKRT +   Y  D++ FE+P  FLVGYALD  D+FRDLN
Sbjct:    2 TLCVLIGGFKCFADLLNAIDYENRTKRNSIAVSVDFIRVESYVYCEVSGKVKIIGIDNLEFLKDKDILIVKD-VESGKTMTKLLKYINQFKPNYVKVASLLVKRTDIGPHYKLDFIEFEVPYNFLVGYALDCTDHFRDLN 140          
The following BLAST results are available for this feature:
BLAST of Hypoxanthine phosphoribosyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
HPRT12.180e-8758.41hypoxanthine phosphoribosyltransferase 1 [Source:H... [more]
PRTFDC11.619e-7554.03phosphoribosyl transferase domain containing 1 [So... [more]
PRTFDC12.684e-4948.84phosphoribosyl transferase domain containing 1 [So... [more]
PRTFDC17.497e-2240.16phosphoribosyl transferase domain containing 1 [So... [more]
back to top
BLAST of Hypoxanthine phosphoribosyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
hprt-12.470e-5044.66Hypoxanthine phosphoribosyltransferase [Source:Un... [more]
back to top
BLAST of Hypoxanthine phosphoribosyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Hypoxanthine phosphoribosyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hprt13.441e-9161.21hypoxanthine phosphoribosyltransferase 1 [Source:Z... [more]
hprt13.441e-9161.21hypoxanthine phosphoribosyltransferase 1 [Source:Z... [more]
hprt14.881e-8960.65hypoxanthine phosphoribosyltransferase 1 [Source:Z... [more]
hprt1l6.961e-8359.81hypoxanthine phosphoribosyltransferase 1, like [So... [more]
prtfdc15.980e-7652.83phosphoribosyl transferase domain containing 1 [So... [more]
back to top
BLAST of Hypoxanthine phosphoribosyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
btbd111.073e-9060.93BTB (POZ) domain containing 11 [Source:Xenbase;Acc... [more]
btbd114.734e-8558.60BTB (POZ) domain containing 11 [Source:Xenbase;Acc... [more]
btbd111.816e-7660.10BTB (POZ) domain containing 11 [Source:Xenbase;Acc... [more]
btbd112.659e-7659.11BTB (POZ) domain containing 11 [Source:Xenbase;Acc... [more]
btbd113.492e-7657.55BTB (POZ) domain containing 11 [Source:Xenbase;Acc... [more]
back to top
BLAST of Hypoxanthine phosphoribosyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Hprt4.644e-8657.94hypoxanthine guanine phosphoribosyl transferase [S... [more]
back to top
BLAST of Hypoxanthine phosphoribosyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9W719|HPRT_CHICK1.026e-8860.00Hypoxanthine-guanine phosphoribosyltransferase OS=... [more]
sp|Q6LDD9|HPRT_MACFA1.047e-8658.41Hypoxanthine-guanine phosphoribosyltransferase OS=... [more]
sp|P00492|HPRT_HUMAN1.047e-8658.41Hypoxanthine-guanine phosphoribosyltransferase OS=... [more]
sp|Q45FY6|HPRT_PIG1.375e-8658.88Hypoxanthine-guanine phosphoribosyltransferase OS=... [more]
sp|A5A6I1|HPRT_PANTR1.637e-8658.41Hypoxanthine-guanine phosphoribosyltransferase OS=... [more]
back to top
BLAST of Hypoxanthine phosphoribosyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
B5DFU28.776e-8961.21Hypoxanthine phosphoribosyltransferase OS=Salmo sa... [more]
A0A3B3HF461.178e-8861.21Hypoxanthine phosphoribosyltransferase OS=Oryzias ... [more]
A0A3P9HZJ01.178e-8861.21Hypoxanthine phosphoribosyltransferase OS=Oryzias ... [more]
A0A141GF451.671e-8861.21Hypoxanthine phosphoribosyltransferase OS=Acanthog... [more]
A0A0S7HKN11.863e-8861.21Hypoxanthine phosphoribosyltransferase OS=Poecilio... [more]
back to top
BLAST of Hypoxanthine phosphoribosyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prtfdc12.685e-7452.61hypoxanthine-guanine phosphoribosyltransferase-lik... [more]
unm_sa8213.897e-7351.89phosphoribosyltransferase domain-containing protei... [more]
prtfdc12.239e-6850.24hypoxanthine-guanine phosphoribosyltransferase-lik... [more]
hprt1l1.901e-5747.37hypoxanthine phosphoribosyltransferase 1, like [So... [more]
hprt1l1.985e-5747.37hypoxanthine phosphoribosyltransferase 1, like [So... [more]
back to top
BLAST of Hypoxanthine phosphoribosyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Hypoxanthine phosphoribosyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Hypoxanthine phosphoribosyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO329382.873e-8255.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Hypoxanthine phosphoribosyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hprt14.435e-9261.21hypoxanthine phosphoribosyltransferase 1 [Source:N... [more]
hprt16.533e-8359.33hypoxanthine phosphoribosyltransferase 1 [Source:N... [more]
hprt1l1.031e-8259.81hypoxanthine-guanine phosphoribosyltransferase [So... [more]
hprt1l8.362e-7759.60hypoxanthine-guanine phosphoribosyltransferase [So... [more]
prtfdc18.111e-7351.40phosphoribosyltransferase domain-containing protei... [more]
back to top
BLAST of Hypoxanthine phosphoribosyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000007399.11.232e-15198.16SMESG000007399.1[more]
SMESG000025931.14.368e-9664.38SMESG000025931.1[more]
SMESG000025931.14.448e-9664.38SMESG000025931.1[more]
SMESG000034670.16.217e-4457.14SMESG000034670.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004975 ID=SMED30004975|Name=Hypoxanthine phosphoribosyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=899bp
TGAAATTTATTTTTCAAGAAAAATAATTTATATCATTTTTTAACATTTTA
AACGACAAAAACTTTCATGTTCAAAAAGTCAAATTGTATTATAATTTCAG
ATGAAATAGAAGGTTATAATTCATCACAATTTTGTATAGTTAGCCATTAC
GAAAATGTGTTGGATTCAGTTTTAATCCCACATGGATTGATAAAAGACCG
AATTGAAAAATTAGCCGTTGATATAGCAACTGATGAAGATTTTAGTGAAA
ATGGTATTGCAGCTCTTTGTGTGTTAAAAGGAGGATTCAAGTTTTTCGCT
GATTTAACGGAAGCCATTGACAGAAATAATAGAAGTAAAGGAAAATCAAT
TCCATTGTCGATAGACTTTATTAAAGTCAAAAGTTATGTTGATGATCATT
CCATCAATGAAGTTACCGTATCAGGGATCGACAACCTGAGTTCACTAACT
GGAAAGAGTGTATTGATTGTTGAGGATATAGTCGACACTGGTAAAACAAT
GATGAAGCTTTTAAATCATTTAAAGAATTTCAACCCAGCATCAGTGAAAG
TTGCCAGTTTACTAGTTAAAAGAACTCCATTGAGCATCGGTTACATTCCT
GATTATGTTGGATTCGAAATTCCAAATAAATTCTTAGTTGGCTATGCATT
AGATTATAATGATTATTTTCGAGATTTAAATCATATTTGTATCATCAACG
AAGAGGGAAAAATGCGGTTCAGTAAAAAAGGTTGATTTATTTAAAAATAA
TTCAATTCTGAAGCCGCTTTTAGCCAACTCGGTTTTCATAATAGCACATA
TTAGTATATTGCACATTTAATTGTTATTGTTATTTATTTATTACTACTGA
CTGAGGTCTAGTTTTGTACTGAATGTATTGAATATTATTTTAACTAGAT
back to top

protein sequence of SMED30004975-orf-1

>SMED30004975-orf-1 ID=SMED30004975-orf-1|Name=SMED30004975-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=223bp
MFKKSNCIIISDEIEGYNSSQFCIVSHYENVLDSVLIPHGLIKDRIEKLA
VDIATDEDFSENGIAALCVLKGGFKFFADLTEAIDRNNRSKGKSIPLSID
FIKVKSYVDDHSINEVTVSGIDNLSSLTGKSVLIVEDIVDTGKTMMKLLN
HLKNFNPASVKVASLLVKRTPLSIGYIPDYVGFEIPNKFLVGYALDYNDY
FRDLNHICIINEEGKMRFSKKG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000428musculature system
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR005904Hxn_phspho_trans
IPR000836PRibTrfase_dom
IPR029057PRTase-like
Vocabulary: biological process
TermDefinition
GO:0009116nucleoside metabolic process
GO:0001975response to amphetamine
GO:0006164purine nucleotide biosynthetic process
GO:0006166purine ribonucleoside salvage
GO:0006168adenine salvage
GO:0006178guanine salvage
GO:0007625grooming behavior
GO:0007626locomotory behavior
GO:0019835cytolysis
GO:0021756striatum development
GO:0021895cerebral cortex neuron differentiation
GO:0021954central nervous system neuron development
GO:0032264IMP salvage
GO:0042417dopamine metabolic process
GO:0043103hypoxanthine salvage
GO:0045964positive regulation of dopamine metabolic process
GO:0046038GMP catabolic process
GO:0046040IMP metabolic process
GO:0046083adenine metabolic process
GO:0046100hypoxanthine metabolic process
GO:0046651lymphocyte proliferation
GO:0048813dendrite morphogenesis
GO:0051289protein homotetramerization
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0000287magnesium ion binding
GO:0002057guanine binding
GO:0002060purine nucleobase binding
GO:0004422hypoxanthine phosphoribosyltransferase activity
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
GO:0042802identical protein binding
GO:0042803protein homodimerization activity
GO:0046872metal ion binding
GO:0052657guanine phosphoribosyltransferase activity
Vocabulary: cellular component
TermDefinition
GO:0005694chromosome
GO:0005737cytoplasm
GO:0005829cytosol
GO:0070062extracellular exosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR029057Phosphoribosyltransferase-likeGENE3DG3DSA:3.40.50.2020coord: 2..217
e-value: 1.2E-81
score: 275.1
IPR029057Phosphoribosyltransferase-likeSUPERFAMILYSSF53271PRTase-likecoord: 16..213
IPR005904Hypoxanthine phosphoribosyl transferaseTIGRFAMTIGR01203TIGR01203coord: 35..210
e-value: 8.2E-52
score: 173.3
IPR000836Phosphoribosyltransferase domainPFAMPF00156Pribosyltrancoord: 40..197
e-value: 1.3E-20
score: 73.6
IPR000836Phosphoribosyltransferase domainCDDcd06223PRTases_typeIcoord: 46..184
e-value: 4.41673E-18
score: 75.1248
NoneNo IPR availablePANTHERPTHR43340FAMILY NOT NAMEDcoord: 3..215
NoneNo IPR availablePANTHERPTHR43340:SF6HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASEcoord: 3..215