Chromosome 8 open reading frame 82

Overview
NameChromosome 8 open reading frame 82
Smed IDSMED30004973
Length (bp)914
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Chromosome 8 open reading frame 82 (SMED30004973) t-SNE clustered cells

Violin plots show distribution of expression levels for Chromosome 8 open reading frame 82 (SMED30004973) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Chromosome 8 open reading frame 82 (SMED30004973) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Chromosome 8 open reading frame 82 (SMED30004973) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004973

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
zeta neoblastSMED30004973SMESG000026794.1 dd_Smed_v4_14037_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Chromosome 8 open reading frame 82 vs. Ensembl Human
Match: C8orf82 (chromosome 8 open reading frame 82 [Source:HGNC Symbol;Acc:HGNC:33826])

HSP 1 Score: 166.007 bits (419), Expect = 7.467e-50
Identity = 82/197 (41.62%), Postives = 113/197 (57.36%), Query Frame = 1
Query:  175 LSYIQGQRSELNIREYFYYIDHQGMVNLNMFCFVINEDILQLFLDDTKIKNFTSCFKDKVFLEFFFNRIKINSTGNYQEQFPYISFCGKERNYIRCDDRPIVFLQLKDIN-GKFFLTYAFPDSKLSVEFRPEDLFMYPISMRVYHPCSTSTSGIGLIKSSLAMDISNNFRWDQGKSENDLPSTFIWKGQPFTLNHSL 762
            +SY QGQ  E   REYFYY+DHQG                QLFLDD+K+KNF +CFKD  FL  FF+R++ N +G Y+  FP++S CG+ERN++RC+DRP+VF  L   + G   L+Y      L+V F P  L     + R+YHP      G+GL++S+LA ++S  F +  G     LPS   W+G+   L   L
Sbjct:   28 VSYTQGQSPEPRTREYFYYVDHQG----------------QLFLDDSKMKNFITCFKDPQFLVTFFSRLRPNRSGRYEAAFPFLSPCGRERNFLRCEDRPVVFTHLLTADHGPPRLSYCGGGEALAVPFEPARLLPLAANGRLYHPAPERAGGVGLVRSALAFELSACFEYGPGAPA--LPSHVRWQGRRLALTMDL 206          
BLAST of Chromosome 8 open reading frame 82 vs. Ensembl Human
Match: C8orf82 (chromosome 8 open reading frame 82 [Source:HGNC Symbol;Acc:HGNC:33826])

HSP 1 Score: 166.007 bits (419), Expect = 7.467e-50
Identity = 82/197 (41.62%), Postives = 113/197 (57.36%), Query Frame = 1
Query:  175 LSYIQGQRSELNIREYFYYIDHQGMVNLNMFCFVINEDILQLFLDDTKIKNFTSCFKDKVFLEFFFNRIKINSTGNYQEQFPYISFCGKERNYIRCDDRPIVFLQLKDIN-GKFFLTYAFPDSKLSVEFRPEDLFMYPISMRVYHPCSTSTSGIGLIKSSLAMDISNNFRWDQGKSENDLPSTFIWKGQPFTLNHSL 762
            +SY QGQ  E   REYFYY+DHQG                QLFLDD+K+KNF +CFKD  FL  FF+R++ N +G Y+  FP++S CG+ERN++RC+DRP+VF  L   + G   L+Y      L+V F P  L     + R+YHP      G+GL++S+LA ++S  F +  G     LPS   W+G+   L   L
Sbjct:   28 VSYTQGQSPEPRTREYFYYVDHQG----------------QLFLDDSKMKNFITCFKDPQFLVTFFSRLRPNRSGRYEAAFPFLSPCGRERNFLRCEDRPVVFTHLLTADHGPPRLSYCGGGEALAVPFEPARLLPLAANGRLYHPAPERAGGVGLVRSALAFELSACFEYGPGAPA--LPSHVRWQGRRLALTMDL 206          
BLAST of Chromosome 8 open reading frame 82 vs. Ensembl Human
Match: C8orf82 (chromosome 8 open reading frame 82 [Source:HGNC Symbol;Acc:HGNC:33826])

HSP 1 Score: 139.428 bits (350), Expect = 5.730e-39
Identity = 65/157 (41.40%), Postives = 95/157 (60.51%), Query Frame = 1
Query:  295 QLFLDDTKIKNFTSCFKDKVFLEFFFNRIKINSTGNYQEQFPYISFCGKERNYIRCDDRPIVFLQLKDIN-GKFFLTYAFPDSKLSVEFRPEDLFMYPISMRVYHPCSTSTSGIGLIKSSLAMDISNNFRWDQGKSENDLPSTFIWKGQPFTLNHSL 762
            +LFLDD+K+KNF +CFKD  FL  FF+R++ N +G Y+  FP++S CG+ERN++RC+DRP+VF  L   + G   L+Y      L+V F P  L     + R+YHP      G+GL++S+LA ++S  F +  G     LPS   W+G+   L   L
Sbjct:   97 ELFLDDSKMKNFITCFKDPQFLVTFFSRLRPNRSGRYEAAFPFLSPCGRERNFLRCEDRPVVFTHLLTADHGPPRLSYCGGGEALAVPFEPARLLPLAANGRLYHPAPERAGGVGLVRSALAFELSACFEYGPGAPA--LPSHVRWQGRRLALTMDL 251          
BLAST of Chromosome 8 open reading frame 82 vs. Ensembl Human
Match: C8orf82 (chromosome 8 open reading frame 82 [Source:HGNC Symbol;Acc:HGNC:33826])

HSP 1 Score: 62.003 bits (149), Expect = 6.358e-12
Identity = 29/57 (50.88%), Postives = 34/57 (59.65%), Query Frame = 1
Query:  175 LSYIQGQRSELNIREYFYYIDHQGMVNLNMFCFVINEDILQLFLDDTKIKNFTSCFK 345
            +SY QGQ  E   REYFYY+DHQG                QLFLDD+K+KNF +CFK
Sbjct:   28 VSYTQGQSPEPRTREYFYYVDHQG----------------QLFLDDSKMKNFITCFK 68          
BLAST of Chromosome 8 open reading frame 82 vs. Ensembl Celegans
Match: F59C6.12 (UPF0598 protein F59C6.12 [Source:UniProtKB/Swiss-Prot;Acc:Q564X7])

HSP 1 Score: 114.39 bits (285), Expect = 6.202e-31
Identity = 66/169 (39.05%), Postives = 91/169 (53.85%), Query Frame = 1
Query:  181 YIQGQRSELNIREYFYYIDHQGMVNLNMFCFVINEDILQLFLDDTKIKNFTSCFKDKVFLEFFFNRIKINSTGNYQEQFPYISFCGKERNYIRCDDRPIVFLQLKDINGKFFLTYAFPDSKLSVEFRPEDLFMYPISMRVYHPCSTSTSGIGLIKSSLAMDISNNFRWD 687
            Y QGQ +   IREYFYY+ H G                 LFLDD+++KNFT+ +KD  FL FF+ +IK N TG Y++ FP++S CG ERN++RCDD P+V+ +L     +  +      S +   F+P  L M   S RVYH C     G  L+   L   +   FR+D
Sbjct:   10 YTQGQYNG-KIREYFYYVSHNGF----------------LFLDDSRMKNFTAAYKDIQFLNFFYRKIKENKTGRYEDTFPWVSLCGIERNFLRCDDTPLVYTELDSTEKELRIG----QSTIYHSFQPSSLSMNS-SGRVYHKC--PIGGKALVADKLTDKLYRRFRFD 154          
BLAST of Chromosome 8 open reading frame 82 vs. Ensembl Fly
Match: CG30010 (gene:FBgn0050010 transcript:FBtr0332914)

HSP 1 Score: 155.992 bits (393), Expect = 6.557e-47
Identity = 71/156 (45.51%), Postives = 104/156 (66.67%), Query Frame = 1
Query:  298 LFLDDTKIKNFTSCFKDKVFLEFFFNRIKINSTGNYQEQFPYISFCGKERNYIRCDDRPIVFLQLKDINGKFFLTYAFPDSKLSVEFRPEDLFMYPISMRVYHPCSTSTSGIGLIKSSLAMDISNNFRWDQGKSENDLPSTFIWKGQPFTLNHSLL 765
            LFLDD K+KNFTSCFK+K FL+FFFNR+++N T  Y+ +FPYIS CG+ERN+IRCDD P+VF +    +    L+YA     L++ + P  L+M P + RVYHP +    GIGL++S LA+++S +F +  G++    P+ F W G+   L +  +
Sbjct:    2 LFLDDAKMKNFTSCFKEKDFLKFFFNRLRLNKTSRYESEFPYISLCGRERNFIRCDDTPVVFTEQLRKDDTEVLSYAHAGQVLTLPYEPHKLYMDPRNGRVYHPAAPQVGGIGLVRSKLAIELSQHFEFLAGEAS---PTHFQWNGERLELQNEWV 154          
BLAST of Chromosome 8 open reading frame 82 vs. Ensembl Fly
Match: CG30010 (gene:FBgn0050010 transcript:FBtr0088374)

HSP 1 Score: 155.992 bits (393), Expect = 6.557e-47
Identity = 71/156 (45.51%), Postives = 104/156 (66.67%), Query Frame = 1
Query:  298 LFLDDTKIKNFTSCFKDKVFLEFFFNRIKINSTGNYQEQFPYISFCGKERNYIRCDDRPIVFLQLKDINGKFFLTYAFPDSKLSVEFRPEDLFMYPISMRVYHPCSTSTSGIGLIKSSLAMDISNNFRWDQGKSENDLPSTFIWKGQPFTLNHSLL 765
            LFLDD K+KNFTSCFK+K FL+FFFNR+++N T  Y+ +FPYIS CG+ERN+IRCDD P+VF +    +    L+YA     L++ + P  L+M P + RVYHP +    GIGL++S LA+++S +F +  G++    P+ F W G+   L +  +
Sbjct:    2 LFLDDAKMKNFTSCFKEKDFLKFFFNRLRLNKTSRYESEFPYISLCGRERNFIRCDDTPVVFTEQLRKDDTEVLSYAHAGQVLTLPYEPHKLYMDPRNGRVYHPAAPQVGGIGLVRSKLAIELSQHFEFLAGEAS---PTHFQWNGERLELQNEWV 154          
BLAST of Chromosome 8 open reading frame 82 vs. Ensembl Zebrafish
Match: si:ch1073-287p18.1 (si:ch1073-287p18.1 [Source:ZFIN;Acc:ZDB-GENE-081104-80])

HSP 1 Score: 202.216 bits (513), Expect = 3.220e-64
Identity = 104/218 (47.71%), Postives = 141/218 (64.68%), Query Frame = 1
Query:  154 RNINLRLLSYIQGQRSELNIREYFYYIDHQGMVNLNMFCFVINEDILQLFLDDTKIKNFTSCFKDKVFLEFFFNRIKINSTGNYQEQFPYISFCGKERNYIRCDDRPIVFLQL-KDINGKFFLTYAFPDSKLSVEFRPEDLFMYPISMRVYHPCSTSTSGIGLIKSSLAMDISNNFRWDQGKSENDL-PSTFIWKGQPFTLNHSLLKTF-TQEPESLK 798
            RN++    SY QGQ  E  IREYFYYIDHQG                QLFLDDTK+KNF +CFKD+ FL FFF+R+K+N +G YQ+ FP++S CG+ERN++RC+D+PIVF  L  ++  +  L+Y    +KLSV FRP+ LFM+P S RVYHP    T G GL++S+LA++IS +F +D G+      P+ F W G+   L+  L K F  Q+ E +K
Sbjct:   17 RNVS----SYTQGQSPEARIREYFYYIDHQG----------------QLFLDDTKVKNFVTCFKDQHFLVFFFSRLKVNQSGRYQQDFPFVSLCGRERNFLRCEDQPIVFTHLFSEVGLEDRLSYCGGGAKLSVPFRPQSLFMHPDSGRVYHPGPERTGGAGLLRSALAIEISAHFGYDTGQDGTAAQPTHFTWAGRRHALSKELEKHFPVQKDECMK 214          
BLAST of Chromosome 8 open reading frame 82 vs. Ensembl Zebrafish
Match: si:ch1073-287p18.1 (si:ch1073-287p18.1 [Source:ZFIN;Acc:ZDB-GENE-081104-80])

HSP 1 Score: 64.6994 bits (156), Expect = 1.174e-12
Identity = 34/65 (52.31%), Postives = 38/65 (58.46%), Query Frame = 1
Query:  154 RNINLRLLSYIQGQRSELNIREYFYYIDHQGMVNLNMFCFVINEDILQLFLDDTKIKNFTSCFKD 348
            RN++    SY QGQ  E  IREYFYYIDHQG                QLFLDDTK+KNF +CFK 
Sbjct:   17 RNVS----SYTQGQSPEARIREYFYYIDHQG----------------QLFLDDTKVKNFVTCFKG 61          
BLAST of Chromosome 8 open reading frame 82 vs. Ensembl Mouse
Match: C030006K11Rik (RIKEN cDNA C030006K11 gene [Source:MGI Symbol;Acc:MGI:1925941])

HSP 1 Score: 161.77 bits (408), Expect = 2.158e-48
Identity = 80/211 (37.91%), Postives = 120/211 (56.87%), Query Frame = 1
Query:  124 MILSKNFYKFRNINLRLLSYIQGQRSELNIREYFYYIDHQGMVNLNMFCFVINEDILQLFLDDTKIKNFTSCFKDKVFLEFFFNRIKINSTGNYQEQFPYISFCGKERNYIRCDDRPIVFLQLKDINGKF-FLTYAFPDSKLSVEFRPEDLFMYPISMRVYHPCSTSTSGIGLIKSSLAMDISNNFRWDQGKSENDLPSTFIWKGQPFTLN 753
            ++L+++        +  +SY QGQ  E   REYFYY+DHQG                QLFLDD+K+KNF +CFKD  FL  FF+R++ N +G Y+  FP++S CG+ERN++RC+DRP+VF  L   + +   L+Y      L++ F P  L     + R+YHP      G+GL++S+LA ++S  F +  G S   +PS   W+G+   L 
Sbjct:   13 LVLARSQRARTCSGVERVSYTQGQSPEPRTREYFYYVDHQG----------------QLFLDDSKMKNFITCFKDLQFLVTFFSRLRPNHSGRYEASFPFLSLCGRERNFLRCEDRPVVFTHLLASDSESPRLSYCGGGEALAIPFEPARLLPLAANGRLYHPAPERAGGVGLVRSALAFELSACFEY--GPSSPTVPSHVHWQGRRIALT 205          
BLAST of Chromosome 8 open reading frame 82 vs. UniProt/SwissProt
Match: sp|A8E4L3|CH082_BOVIN (UPF0598 protein C8orf82 homolog OS=Bos taurus OX=9913 PE=2 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 5.301e-50
Identity = 82/194 (42.27%), Postives = 113/194 (58.25%), Query Frame = 1
Query:  175 LSYIQGQRSELNIREYFYYIDHQGMVNLNMFCFVINEDILQLFLDDTKIKNFTSCFKDKVFLEFFFNRIKINSTGNYQEQFPYISFCGKERNYIRCDDRPIVFLQLKDIN-GKFFLTYAFPDSKLSVEFRPEDLFMYPISMRVYHPCSTSTSGIGLIKSSLAMDISNNFRWDQGKSENDLPSTFIWKGQPFTLN 753
            +SY QGQ  E   REYFYY+DHQG                QLFLDD+++KNFT+CFKD  FL  FF+R++ N +G Y+  FP++S CG+ERN++RC+DRP+VF  L         L+Y      L+V F P  L     + R+YHP      G+GL++S+LA ++S  F +  G  E  LPS   W+G+ F L 
Sbjct:   30 VSYTQGQSPEPRTREYFYYVDHQG----------------QLFLDDSRMKNFTTCFKDPQFLVMFFSRLRPNRSGRYEAYFPFLSLCGRERNFLRCEDRPVVFTHLLAAGPAPQRLSYCGGGEALAVPFEPARLLPLATNGRLYHPAPERAGGVGLVRSALAFELSACFEYAPGAPE--LPSHVRWQGRRFALT 205          
BLAST of Chromosome 8 open reading frame 82 vs. UniProt/SwissProt
Match: sp|Q6P1X6|CH082_HUMAN (UPF0598 protein C8orf82 OS=Homo sapiens OX=9606 GN=C8orf82 PE=1 SV=2)

HSP 1 Score: 166.007 bits (419), Expect = 3.586e-49
Identity = 82/197 (41.62%), Postives = 113/197 (57.36%), Query Frame = 1
Query:  175 LSYIQGQRSELNIREYFYYIDHQGMVNLNMFCFVINEDILQLFLDDTKIKNFTSCFKDKVFLEFFFNRIKINSTGNYQEQFPYISFCGKERNYIRCDDRPIVFLQLKDIN-GKFFLTYAFPDSKLSVEFRPEDLFMYPISMRVYHPCSTSTSGIGLIKSSLAMDISNNFRWDQGKSENDLPSTFIWKGQPFTLNHSL 762
            +SY QGQ  E   REYFYY+DHQG                QLFLDD+K+KNF +CFKD  FL  FF+R++ N +G Y+  FP++S CG+ERN++RC+DRP+VF  L   + G   L+Y      L+V F P  L     + R+YHP      G+GL++S+LA ++S  F +  G     LPS   W+G+   L   L
Sbjct:   28 VSYTQGQSPEPRTREYFYYVDHQG----------------QLFLDDSKMKNFITCFKDPQFLVTFFSRLRPNRSGRYEAAFPFLSPCGRERNFLRCEDRPVVFTHLLTADHGPPRLSYCGGGEALAVPFEPARLLPLAANGRLYHPAPERAGGVGLVRSALAFELSACFEYGPGAPA--LPSHVRWQGRRLALTMDL 206          
BLAST of Chromosome 8 open reading frame 82 vs. UniProt/SwissProt
Match: sp|Q8VE95|CH082_MOUSE (UPF0598 protein C8orf82 homolog OS=Mus musculus OX=10090 PE=1 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 1.510e-47
Identity = 80/211 (37.91%), Postives = 120/211 (56.87%), Query Frame = 1
Query:  124 MILSKNFYKFRNINLRLLSYIQGQRSELNIREYFYYIDHQGMVNLNMFCFVINEDILQLFLDDTKIKNFTSCFKDKVFLEFFFNRIKINSTGNYQEQFPYISFCGKERNYIRCDDRPIVFLQLKDINGKF-FLTYAFPDSKLSVEFRPEDLFMYPISMRVYHPCSTSTSGIGLIKSSLAMDISNNFRWDQGKSENDLPSTFIWKGQPFTLN 753
            ++L+++        +  +SY QGQ  E   REYFYY+DHQG                QLFLDD+K+KNF +CFKD  FL  FF+R++ N +G Y+  FP++S CG+ERN++RC+DRP+VF  L   + +   L+Y      L++ F P  L     + R+YHP      G+GL++S+LA ++S  F +  G S   +PS   W+G+   L 
Sbjct:   13 LVLARSQRARTCSGVERVSYTQGQSPEPRTREYFYYVDHQG----------------QLFLDDSKMKNFITCFKDLQFLVTFFSRLRPNHSGRYEASFPFLSLCGRERNFLRCEDRPVVFTHLLASDSESPRLSYCGGGEALAIPFEPARLLPLAANGRLYHPAPERAGGVGLVRSALAFELSACFEY--GPSSPTVPSHVHWQGRRIALT 205          
BLAST of Chromosome 8 open reading frame 82 vs. UniProt/SwissProt
Match: sp|Q642A4|CH082_RAT (UPF0598 protein C8orf82 homolog OS=Rattus norvegicus OX=10116 PE=2 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 1.297e-46
Identity = 78/194 (40.21%), Postives = 113/194 (58.25%), Query Frame = 1
Query:  175 LSYIQGQRSELNIREYFYYIDHQGMVNLNMFCFVINEDILQLFLDDTKIKNFTSCFKDKVFLEFFFNRIKINSTGNYQEQFPYISFCGKERNYIRCDDRPIVFLQLKDINGKF-FLTYAFPDSKLSVEFRPEDLFMYPISMRVYHPCSTSTSGIGLIKSSLAMDISNNFRWDQGKSENDLPSTFIWKGQPFTLN 753
            +SY QGQ  E   REYFYY+DHQG                QLFLDD+K+KNF +CFKD  FL  FF+R++ N +G Y+  FP++S CG+ERN++RC+DRP+VF  L   + +   L+Y      L++ F P  L     + R+YHP      G+GL++S+LA ++S  F +  G +   +PS   W+G+   L 
Sbjct:   30 VSYTQGQSPEPRTREYFYYVDHQG----------------QLFLDDSKMKNFITCFKDLQFLVTFFSRLRPNHSGRYEASFPFLSLCGRERNFLRCEDRPVVFTHLLASDSESPRLSYCGGGEALAIPFEPARLLPLAANGRLYHPAPERAGGVGLVRSALAFELSACFEY--GPNSPTVPSHVQWQGRRIALT 205          
BLAST of Chromosome 8 open reading frame 82 vs. UniProt/SwissProt
Match: sp|Q8MKL1|U598_DROME (UPF0598 protein CG30010 OS=Drosophila melanogaster OX=7227 GN=CG30010 PE=2 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 6.573e-46
Identity = 71/156 (45.51%), Postives = 104/156 (66.67%), Query Frame = 1
Query:  298 LFLDDTKIKNFTSCFKDKVFLEFFFNRIKINSTGNYQEQFPYISFCGKERNYIRCDDRPIVFLQLKDINGKFFLTYAFPDSKLSVEFRPEDLFMYPISMRVYHPCSTSTSGIGLIKSSLAMDISNNFRWDQGKSENDLPSTFIWKGQPFTLNHSLL 765
            LFLDD K+KNFTSCFK+K FL+FFFNR+++N T  Y+ +FPYIS CG+ERN+IRCDD P+VF +    +    L+YA     L++ + P  L+M P + RVYHP +    GIGL++S LA+++S +F +  G++    P+ F W G+   L +  +
Sbjct:    2 LFLDDAKMKNFTSCFKEKDFLKFFFNRLRLNKTSRYESEFPYISLCGRERNFIRCDDTPVVFTEQLRKDDTEVLSYAHAGQVLTLPYEPHKLYMDPRNGRVYHPAAPQVGGIGLVRSKLAIELSQHFEFLAGEAS---PTHFQWNGERLELQNEWV 154          
BLAST of Chromosome 8 open reading frame 82 vs. TrEMBL
Match: A0A4W6F978 (Uncharacterized protein OS=Lates calcarifer OX=8187 GN=C8orf82 PE=4 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 1.853e-65
Identity = 103/213 (48.36%), Postives = 139/213 (65.26%), Query Frame = 1
Query:  178 SYIQGQRSELNIREYFYYIDHQGMVNLNMFCFVINEDILQLFLDDTKIKNFTSCFKDKVFLEFFFNRIKINSTGNYQEQFPYISFCGKERNYIRCDDRPIVF---LQLKDINGKFFLTYAFPDSKLSVEFRPEDLFMYPISMRVYHPCSTSTSGIGLIKSSLAMDISNNFRWDQGKSENDLPSTFIWKGQPFTLNHSLLKTFTQEPESLKGTH 807
            +YIQGQ  E  IREYFYYIDHQG                QLFLDDTK+KNF +CFKDK FL FFF+R++ N +G Y+E FP++S CG+ERN++RCDDRP+VF   LQ     G+  L+Y     KLSV FRPE L+M+P+S R+YHPCS  + G+GL++S+LA+++S  F +   + ++  P+ F+W GQ  TL + L   F+   E   G H
Sbjct:   32 TYIQGQSPEPRIREYFYYIDHQG----------------QLFLDDTKVKNFVTCFKDKQFLVFFFSRLRSNQSGRYEEDFPFLSLCGRERNFLRCDDRPVVFTHLLQTPTQPGQELLSYCGGAEKLSVPFRPEALYMHPVSGRLYHPCSERSGGVGLVRSALAIELSPFFVYAPEQGQSGQPTHFLWGGQKHTLTNELAGCFSSAEEG-SGQH 227          
BLAST of Chromosome 8 open reading frame 82 vs. TrEMBL
Match: A0A3B4ZZC6 (Chromosome 8 open reading frame 82 OS=Stegastes partitus OX=144197 GN=C8orf82 PE=4 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 2.611e-65
Identity = 107/234 (45.73%), Postives = 142/234 (60.68%), Query Frame = 1
Query:  130 LSKNFYKFRNINLRLLSYIQGQRSELNIREYFYYIDHQGMVNLNMFCFVINEDILQLFLDDTKIKNFTSCFKDKVFLEFFFNRIKINSTGNYQEQFPYISFCGKERNYIRCDDRPIVFLQLKD--------INGKFFLTYAFPDSKLSVEFRPEDLFMYPISMRVYHPCSTSTSGIGLIKSSLAMDISNNFRWDQGKSENDLPSTFIWKGQPFTLNHSLLKTFTQEPESLKGTH 807
            L   F  FR+      +Y+QGQ  E  IREYFYYIDHQG                QLFLDDTK+KNF +CFKDK FL FFFNR++ N +G Y+E FP++S CG+ERN++RCDDRP+VF  L          +  +  L+Y     KLS  FRPE LFM+P+S RVYHPCS  + G+GL++S+LA+++S  F ++    ++  P+ F+WKGQ  TL + L   F    E   G H
Sbjct:   20 LPVGFTAFRSTA----TYVQGQSPEPRIREYFYYIDHQG----------------QLFLDDTKVKNFVTCFKDKQFLVFFFNRLRFNQSGRYEEDFPFLSLCGRERNFVRCDDRPVVFTHLLQSPTGPQGIVGEQELLSYCGGAEKLSDPFRPEALFMHPVSGRVYHPCSEGSGGVGLVRSALAIELSPFFVYEHEGGQSGQPTHFLWKGQKHTLTNELAGCFPTAEEG-SGQH 232          
BLAST of Chromosome 8 open reading frame 82 vs. TrEMBL
Match: A0A498NT83 (UPF0598 C8orf82-like protein OS=Labeo rohita OX=84645 GN=ROHU_014581 PE=4 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 2.919e-65
Identity = 114/248 (45.97%), Postives = 150/248 (60.48%), Query Frame = 1
Query:   76 SVHLN**VELQLFASNMILSKNFYKFRNINLRLL-----SYIQGQRSELNIREYFYYIDHQGMVNLNMFCFVINEDILQLFLDDTKIKNFTSCFKDKVFLEFFFNRIKINSTGNYQEQFPYISFCGKERNYIRCDDRPIVFLQLKDINGK-FFLTYAFPDSKLSVEFRPEDLFMYPISMRVYHPCSTSTSGIGLIKSSLAMDISNNFRWDQGKSENDLPSTFIWKGQPFTLNHSLLKTF-TQEPESLK 798
            S  +N  +E  L A   +   N   F +   RLL     SY QGQ  E  IREYFYYIDHQG                QLFLDDTK+KNF +CFKD+ FL FFFNR+K+N +G Y++ FP++S CG+ERN++RCDDRP+VF  L    G    L+Y    +KL+V FRPE LFM+P+S RVYHP      G+GL++S+LA+++S +F +  G+     PS FIW G   TL + L K F  Q+ E +K
Sbjct:   11 STRMNEDLEHALSARVSVTIDNLTLFSSGWRRLLCRDVSSYTQGQSPEARIREYFYYIDHQG----------------QLFLDDTKVKNFVTCFKDQHFLVFFFNRLKVNQSGRYEQDFPFLSLCGRERNFLRCDDRPVVFTHLLSEAGHDERLSYCGGGAKLTVPFRPESLFMHPVSGRVYHPGPERGGGMGLVRSALAIELSAHFEYATGQESTGQPSHFIWAGCRHTLTNELAKHFPVQKDECVK 242          
BLAST of Chromosome 8 open reading frame 82 vs. TrEMBL
Match: H2S9D5 (Chromosome 8 open reading frame 82 OS=Takifugu rubripes OX=31033 GN=C8orf82 PE=4 SV=2)

HSP 1 Score: 213.386 bits (542), Expect = 3.589e-65
Identity = 102/203 (50.25%), Postives = 134/203 (66.01%), Query Frame = 1
Query:  181 YIQGQRSELNIREYFYYIDHQGMVNLNMFCFVINEDILQLFLDDTKIKNFTSCFKDKVFLEFFFNRIKINSTGNYQEQFPYISFCGKERNYIRCDDRPIVFLQL--KDINGKFFLTYAFPDSKLSVEFRPEDLFMYPISMRVYHPCSTSTSGIGLIKSSLAMDISNNFRWDQGKSENDLPSTFIWKGQPFTLNHSLLKTFTQE 783
            Y+QGQ  E  IREYFYY+DHQG                QLFLDDTK+KNF +CFKDK FL FFF+R++ N +G YQE FPY+S CG+ERN++RCDDRP+VF  L          L+Y     KL+V FRPE LFM+PIS RVYHPCS    G+GL++S+LA+++S +F +D G +E + P+ F W GQ   L + L + F+ +
Sbjct:   31 YVQGQSPEPRIREYFYYLDHQG----------------QLFLDDTKVKNFVTCFKDKQFLVFFFHRLRSNRSGRYQEDFPYLSLCGRERNFLRCDDRPVVFTHLLPGQSGDPALLSYCGGAEKLAVAFRPEALFMHPISGRVYHPCSEQRGGVGLVRSALAIELSPSFAYD-GGAETEQPTHFQWGGQRHRLTNELSERFSSQ 216          
BLAST of Chromosome 8 open reading frame 82 vs. TrEMBL
Match: A0A087T938 (Uncharacterized protein (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_19445 PE=4 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 4.225e-65
Identity = 105/202 (51.98%), Postives = 137/202 (67.82%), Query Frame = 1
Query:  163 NLRLLSYIQGQRSELNIREYFYYIDHQGMVNLNMFCFVINEDILQLFLDDTKIKNFTSCFKDKVFLEFFFNRIKINSTGNYQEQFPYISFCGKERNYIRCDDRPIVFLQLKDINGKFFLTYAFPDSKLSVEFRPEDLFMYPISMRVYHPCSTSTSGIGLIKSSLAMDISNNFRWDQGKSENDLPSTFIWKGQPFTLNHSLLK 768
            + R +SYIQGQ  E N REYFY+IDH GM                LFLDD+K+KNFTSCFKDK FLEFFF R+++N TG Y++QFPY S CG+E+N++RCDD PIVF  + + +   +L+YA+    L V+F PE + M P + RVYHP   +T G+GLIKSSLA+ IS NF +   K+E D+P  FIWK Q +TL + +LK
Sbjct:   24 SFRYVSYIQGQSPEPNTREYFYFIDHNGM----------------LFLDDSKMKNFTSCFKDKKFLEFFFKRLRMNDTGKYEKQFPYYSPCGREKNFVRCDDVPIVFTHILERDAANYLSYAYAGDLLQVKFEPEKICMLPETGRVYHPGPEATGGVGLIKSSLAIQISQNFIYKDNKTE-DVPLYFIWKDQKYTLTNEVLK 208          
BLAST of Chromosome 8 open reading frame 82 vs. Ensembl Cavefish
Match: C8orf82 (chromosome 8 open reading frame 82 [Source:HGNC Symbol;Acc:HGNC:33826])

HSP 1 Score: 204.142 bits (518), Expect = 3.630e-65
Identity = 96/201 (47.76%), Postives = 131/201 (65.17%), Query Frame = 1
Query:  175 LSYIQGQRSELNIREYFYYIDHQGMVNLNMFCFVINEDILQLFLDDTKIKNFTSCFKDKVFLEFFFNRIKINSTGNYQEQFPYISFCGKERNYIRCDDRPIVFLQLKDING-KFFLTYAFPDSKLSVEFRPEDLFMYPISMRVYHPCSTSTSGIGLIKSSLAMDISNNFRWDQGKSENDLPSTFIWKGQPFTLNHSLLKTF 774
            +SY QGQ  E   REYFYYIDHQG                QLFLDDTK+KNF +CFKD  FL FFF ++K+N +G YQ+ FP++S CG+ERN++RCDD+PIV+  L    G +  L+Y     KL+V FRPE LFM+P+S RVYHP      G+GL++S+LA+++S +F++  G+     P+ F+W GQ  TL + L + F
Sbjct:   14 VSYTQGQSPEARSREYFYYIDHQG----------------QLFLDDTKVKNFVTCFKDPKFLVFFFKQLKVNQSGRYQQHFPFLSLCGRERNFLRCDDQPIVYTHLLSKAGCEERLSYCGGGDKLTVLFRPESLFMHPVSGRVYHPAPEHVGGVGLVRSALAIELSPHFQYSSGQDNTAQPTHFLWAGQQHTLTNDLSRHF 198          
BLAST of Chromosome 8 open reading frame 82 vs. Ensembl Sea Lamprey
Match: C8orf82 (chromosome 8 open reading frame 82 [Source:HGNC Symbol;Acc:HGNC:33826])

HSP 1 Score: 153.68 bits (387), Expect = 1.525e-46
Identity = 77/167 (46.11%), Postives = 103/167 (61.68%), Query Frame = 1
Query:  295 QLFLDDTKIKNFTSCFKDKVFLEFFFNRIKINSTGNYQEQFPYISFCGKERNYIRCDDRPIVFLQL-----KDINGKFFLTYAFPDSKLSVEFRPEDLFMYPISMRVYHPCSTSTSGIGLIKSSLAMDISNNFRWDQGKSENDLPSTFIWKGQPFTLNHSLLKTFTQ 780
            QLFLDD KIKNFTSCFKDK FL FFF R++ N T  Y+ +FP++S CG+ERNYI CDDRP+VF +L        +G+  L +    S L+V F PE L M   S RVYHP +    G+GL+ S LAM +S  F ++    E+  P+ F W+G+ + L + L     +
Sbjct:    1 QLFLDDAKIKNFTSCFKDKKFLVFFFRRLQANGTPRYRSEFPWLSLCGRERNYIHCDDRPVVFTELLTPPGVGASGRQELAFGRAGSALTVPFEPEQLCMSRASGRVYHPAAERFGGVGLVSSDLAMRLSPFFHYES-DDESVPPTHFEWQGRTYELTNQLWDALME 166          
BLAST of Chromosome 8 open reading frame 82 vs. Ensembl Nematostella
Match: EDO32465 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SV11])

HSP 1 Score: 191.045 bits (484), Expect = 4.350e-60
Identity = 101/201 (50.25%), Postives = 125/201 (62.19%), Query Frame = 1
Query:  169 RLLSYIQGQRSELNIREYFYYIDHQGMVNLNMFCFVINEDILQLFLDDTKIKNFTSCFKDKVFLEFFFNRIKINSTGNYQEQFPYISFCGKERNYIRCDDRPIVFLQL---KDINGKFFLTYAFPDSKLSVEFRPEDLFMYPISMRVYHPCSTSTSGIGLIKSSLAMDISNNFRWDQGKSENDLPSTFIWKGQPFTLNHSL 762
            R +SY+QGQ     +REYFYYIDHQG                QLFLDDTKIKNF +CFKDK FL FFF R+KIN TG + ++FPYIS CG E+NYIRC+D PIVF +L   +D      L     +  + VEF+P  + M P S RVYHP      GIGLIKSSLA+ +S+ F +  G S+ D PS F W G+   L++SL
Sbjct:   26 RCISYVQGQSPAPKVREYFYYIDHQG----------------QLFLDDTKIKNFVTCFKDKQFLRFFFRRLKINKTGRFDDEFPYISPCGVEKNYIRCEDLPIVFHKLETSQDNTSFSVLKCNGVEDGMDVEFQPSKICMLPESGRVYHPGPEKAGGIGLIKSSLAISLSSYFEYKAGSSDEDPPSHFNWNGELHELDNSL 210          
BLAST of Chromosome 8 open reading frame 82 vs. Ensembl Medaka
Match: C8orf82 (chromosome 4 C8orf82 homolog [Source:NCBI gene;Acc:101162918])

HSP 1 Score: 203.371 bits (516), Expect = 1.427e-64
Identity = 101/247 (40.89%), Postives = 148/247 (59.92%), Query Frame = 1
Query:  109 LFASNMILSKNFYKFRNINLR-LLSYIQGQRSELNIREYFYYIDHQGMVNLNMFCFVINEDILQLFLDDTKIKNFTSCFKDKVFLEFFFNRIKINSTGNYQEQFPYISFCGKERNYIRCDDRPIVFLQLKDING--------KFFLTYAFPDSKLSVEFRPEDLFMYPISMRVYHPCSTSTSGIGLIKSSLAMDISNNFRWDQGKSENDLPSTFIWKGQPFTLNHSLLKTFTQEPESLKGTHFKEIK 822
            L     +L     + R +  R   SY+QGQ  +  IREYFYY+DHQG                QLFLDDTK+KNF +CFKDK FL FFF+R++ N +G Y++ FP++S CG+ERN++RCDDRP+VF  L   +G        +  L++     KL+V FRPE L+M+P S RVYHPC     G+GL++S+LA+++S  F +    S++  PS F+W G+  TL + L   F   P + +G+  ++++
Sbjct:    2 LLVRTAVLGGGALRCRPVGCRSAASYVQGQSPDPRIREYFYYVDHQG----------------QLFLDDTKVKNFVTCFKDKQFLVFFFSRLRSNQSGRYEKDFPFLSMCGRERNFLRCDDRPMVFTHLLQSSGGPRGLGGDQELLSFCGGGEKLAVPFRPEALYMHPTSGRVYHPCLERVGGVGLVRSALAIELSPFFVYPPETSQSGQPSHFLWGGEKHTLTNELAAFF---PVAEEGSEERQLE 229          
BLAST of Chromosome 8 open reading frame 82 vs. Planmine SMEST
Match: SMESG000026794.1 (SMESG000026794.1)

HSP 1 Score: 177.178 bits (448), Expect = 2.495e-56
Identity = 83/83 (100.00%), Postives = 83/83 (100.00%), Query Frame = 1
Query:  577 MYPISMRVYHPCSTSTSGIGLIKSSLAMDISNNFRWDQGKSENDLPSTFIWKGQPFTLNHSLLKTFTQEPESLKGTHFKEIKQ 825
            MYPISMRVYHPCSTSTSGIGLIKSSLAMDISNNFRWDQGKSENDLPSTFIWKGQPFTLNHSLLKTFTQEPESLKGTHFKEIKQ
Sbjct:    1 MYPISMRVYHPCSTSTSGIGLIKSSLAMDISNNFRWDQGKSENDLPSTFIWKGQPFTLNHSLLKTFTQEPESLKGTHFKEIKQ 83          
BLAST of Chromosome 8 open reading frame 82 vs. Planmine SMEST
Match: SMESG000026794.1 (SMESG000026794.1)

HSP 1 Score: 166.007 bits (419), Expect = 3.807e-52
Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = 1
Query:  592 MRVYHPCSTSTSGIGLIKSSLAMDISNNFRWDQGKSENDLPSTFIWKGQPFTLNHSLLKTFTQEPESLKGTHFKEIKQ 825
            MRVYHPCSTSTSGIGLIKSSLAMDISNNFRWDQGKSENDLPSTFIWKGQPFTLNHSLLKTFTQEPESLKGTHFKEIKQ
Sbjct:    1 MRVYHPCSTSTSGIGLIKSSLAMDISNNFRWDQGKSENDLPSTFIWKGQPFTLNHSLLKTFTQEPESLKGTHFKEIKQ 78          
The following BLAST results are available for this feature:
BLAST of Chromosome 8 open reading frame 82 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
C8orf827.467e-5041.62chromosome 8 open reading frame 82 [Source:HGNC Sy... [more]
C8orf827.467e-5041.62chromosome 8 open reading frame 82 [Source:HGNC Sy... [more]
C8orf825.730e-3941.40chromosome 8 open reading frame 82 [Source:HGNC Sy... [more]
C8orf826.358e-1250.88chromosome 8 open reading frame 82 [Source:HGNC Sy... [more]
back to top
BLAST of Chromosome 8 open reading frame 82 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
F59C6.126.202e-3139.05UPF0598 protein F59C6.12 [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of Chromosome 8 open reading frame 82 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG300106.557e-4745.51gene:FBgn0050010 transcript:FBtr0332914[more]
CG300106.557e-4745.51gene:FBgn0050010 transcript:FBtr0088374[more]
back to top
BLAST of Chromosome 8 open reading frame 82 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:ch1073-287p18.13.220e-6447.71si:ch1073-287p18.1 [Source:ZFIN;Acc:ZDB-GENE-08110... [more]
si:ch1073-287p18.11.174e-1252.31si:ch1073-287p18.1 [Source:ZFIN;Acc:ZDB-GENE-08110... [more]
back to top
BLAST of Chromosome 8 open reading frame 82 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromosome 8 open reading frame 82 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
C030006K11Rik2.158e-4837.91RIKEN cDNA C030006K11 gene [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Chromosome 8 open reading frame 82 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A8E4L3|CH082_BOVIN5.301e-5042.27UPF0598 protein C8orf82 homolog OS=Bos taurus OX=9... [more]
sp|Q6P1X6|CH082_HUMAN3.586e-4941.62UPF0598 protein C8orf82 OS=Homo sapiens OX=9606 GN... [more]
sp|Q8VE95|CH082_MOUSE1.510e-4737.91UPF0598 protein C8orf82 homolog OS=Mus musculus OX... [more]
sp|Q642A4|CH082_RAT1.297e-4640.21UPF0598 protein C8orf82 homolog OS=Rattus norvegic... [more]
sp|Q8MKL1|U598_DROME6.573e-4645.51UPF0598 protein CG30010 OS=Drosophila melanogaster... [more]
back to top
BLAST of Chromosome 8 open reading frame 82 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4W6F9781.853e-6548.36Uncharacterized protein OS=Lates calcarifer OX=818... [more]
A0A3B4ZZC62.611e-6545.73Chromosome 8 open reading frame 82 OS=Stegastes pa... [more]
A0A498NT832.919e-6545.97UPF0598 C8orf82-like protein OS=Labeo rohita OX=84... [more]
H2S9D53.589e-6550.25Chromosome 8 open reading frame 82 OS=Takifugu rub... [more]
A0A087T9384.225e-6551.98Uncharacterized protein (Fragment) OS=Stegodyphus ... [more]
back to top
BLAST of Chromosome 8 open reading frame 82 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
C8orf823.630e-6547.76chromosome 8 open reading frame 82 [Source:HGNC Sy... [more]
back to top
BLAST of Chromosome 8 open reading frame 82 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
C8orf821.525e-4646.11chromosome 8 open reading frame 82 [Source:HGNC Sy... [more]
back to top
BLAST of Chromosome 8 open reading frame 82 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromosome 8 open reading frame 82 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO324654.350e-6050.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Chromosome 8 open reading frame 82 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
C8orf821.427e-6440.89chromosome 4 C8orf82 homolog [Source:NCBI gene;Acc... [more]
back to top
BLAST of Chromosome 8 open reading frame 82 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000026794.12.495e-56100.00SMESG000026794.1[more]
SMESG000026794.13.807e-52100.00SMESG000026794.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004973 ID=SMED30004973|Name=Chromosome 8 open reading frame 82|organism=Schmidtea mediterranea sexual|type=transcript|length=914bp
TTTTATATTAATATTCAAAATAACTTTAAATCCTATCAATTTCTTACTAA
TAATTTTTAGCATTTAAATTTATTTTCTGTTCATTTAAACTAATAAGTTG
AGCTACAATTGTTTGCTTCAAACATGATATTGTCAAAAAATTTCTACAAA
TTTCGAAACATAAATTTGAGATTATTGTCCTACATTCAAGGTCAACGCTC
TGAATTAAATATTCGTGAATATTTTTATTATATCGATCATCAAGGAATGG
TAAACTTGAATATGTTCTGTTTTGTGATTAATGAAGACATTCTTCAGTTG
TTTCTTGATGATACTAAAATCAAAAATTTTACTTCATGCTTTAAAGATAA
AGTATTCCTTGAATTCTTTTTTAATCGAATTAAAATTAATTCAACTGGAA
ATTATCAAGAACAATTTCCCTATATTTCCTTCTGTGGCAAAGAAAGGAAT
TACATTCGATGTGATGACAGACCAATCGTTTTCCTTCAACTCAAAGATAT
TAATGGCAAATTCTTTTTGACATATGCATTTCCAGATAGCAAATTATCTG
TTGAATTTCGTCCCGAAGATTTATTTATGTATCCCATTTCGATGCGTGTT
TATCATCCGTGTTCAACTTCAACCAGCGGAATCGGACTGATTAAATCGTC
ATTGGCCATGGATATATCGAACAATTTTCGATGGGACCAAGGAAAATCCG
AAAATGATTTGCCATCCACTTTCATTTGGAAGGGTCAGCCTTTCACTCTC
AATCATTCTTTGTTAAAAACATTTACTCAAGAACCTGAATCTTTGAAAGG
AACGCACTTTAAAGAAATTAAACAGTAGATTTTCGAGCTTCTTTTTTATT
GTCATTGGTCAGTTTGTGAATTTTTTAATTGGTTGATTTCATGATACAAT
TTGTTTGCCTTAGA
back to top

protein sequence of SMED30004973-orf-1

>SMED30004973-orf-1 ID=SMED30004973-orf-1|Name=SMED30004973-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=235bp
MILSKNFYKFRNINLRLLSYIQGQRSELNIREYFYYIDHQGMVNLNMFCF
VINEDILQLFLDDTKIKNFTSCFKDKVFLEFFFNRIKINSTGNYQEQFPY
ISFCGKERNYIRCDDRPIVFLQLKDINGKFFLTYAFPDSKLSVEFRPEDL
FMYPISMRVYHPCSTSTSGIGLIKSSLAMDISNNFRWDQGKSENDLPSTF
IWKGQPFTLNHSLLKTFTQEPESLKGTHFKEIKQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
Vocabulary: INTERPRO
TermDefinition
IPR028108DUF4505
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
GO:0051965positive regulation of synapse assembly
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR028108Protein of unknown function DUF4505PFAMPF14956DUF4505coord: 22..213
e-value: 3.5E-66
score: 222.3
IPR028108Protein of unknown function DUF4505PANTHERPTHR31449FAMILY NOT NAMEDcoord: 16..216
NoneNo IPR availablePANTHERPTHR31449:SF3UPF0598 PROTEIN C8ORF82coord: 16..216