Homeodomain interacting protein kinase

Overview
NameHomeodomain interacting protein kinase
Smed IDSMED30004965
Length (bp)4645
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Homeodomain interacting protein kinase (SMED30004965) t-SNE clustered cells

Violin plots show distribution of expression levels for Homeodomain interacting protein kinase (SMED30004965) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Homeodomain interacting protein kinase (SMED30004965) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Homeodomain interacting protein kinase (SMED30004965) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004965

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30004965SMESG000057968.1 dd_Smed_v4_4326_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004965SMESG000057968.1 dd_Smed_v4_4326_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004965SMESG000057968.1 dd_Smed_v4_7724_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Homeodomain interacting protein kinase vs. Ensembl Human
Match: HIPK2 (homeodomain interacting protein kinase 2 [Source:HGNC Symbol;Acc:HGNC:14402])

HSP 1 Score: 464.537 bits (1194), Expect = 5.433e-143
Identity = 232/408 (56.86%), Postives = 282/408 (69.12%), Query Frame = 3
Query:  582 ADGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDSCFE---WRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNRS-------NGRSNP-STHIIDASNSNIISKFN 1772
            ++GDYQ+V  E L SM+  YEVL FLGRGTFGQVVKC  R  N +VAIKILKNHPSY RQG +E+ IL  LS E  + +N VRA ECFQHKNH CLVFE+LEQNLY++LK NKF P+ L  IRP+ QQV TAL KLK L LIHADLKPENIMLV+P+     YRVKVIDFGSA   SKAV +TYLQSRYYRAPEI+LGLPF EAIDMWSLGCV+AELFLGWPLYPG+SEYDQIRYI +TQG+P   +L    K  RFF++D+      WRLK  DD+  ETG ++KE RKY+F  LD +  V+   +    D  VE  DR++F  LL +ML +  ++RITP   LNH  + M HL     +  V+  F  M++C R        N    P  TH+  ++++N+   FN
Sbjct:  173 SEGDYQLVQHEVLCSMTNTYEVLEFLGRGTFGQVVKCWKRGTNEIVAIKILKNHPSYARQGQIEVSILARLSTESADDYNFVRAYECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKYIRPVLQQVATALMKLKSLGLIHADLKPENIMLVDPSR--QPYRVKVIDFGSASHVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTRFFNRDTDSPYPLWRLKTPDDHEAETGIKSKEARKYIFNCLDDMAQVNMTTDLEGSDMLVEKADRREFIDLLKKMLTIDADKRITPIETLNHPFVTMTHLLDFPHSTHVKSCFQNMEICKRRVNMYDTVNQSKTPFITHVAPSTSTNLTMTFN 578          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Human
Match: HIPK2 (homeodomain interacting protein kinase 2 [Source:HGNC Symbol;Acc:HGNC:14402])

HSP 1 Score: 465.307 bits (1196), Expect = 1.124e-140
Identity = 239/449 (53.23%), Postives = 297/449 (66.15%), Query Frame = 3
Query:  582 ADGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDSCFE---WRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNRS-------NGRSNP-STHIIDASNSNIISKFNGANSSLLPFDQAGASHL---------LSNPVELITSNPDPY 1868
            ++GDYQ+V  E L SM+  YEVL FLGRGTFGQVVKC  R  N +VAIKILKNHPSY RQG +E+ IL  LS E  + +N VRA ECFQHKNH CLVFE+LEQNLY++LK NKF P+ L  IRP+ QQV TAL KLK L LIHADLKPENIMLV+P+     YRVKVIDFGSA   SKAV +TYLQSRYYRAPEI+LGLPF EAIDMWSLGCV+AELFLGWPLYPG+SEYDQIRYI +TQG+P   +L    K  RFF++D+      WRLK  DD+  ETG ++KE RKY+F  LD +  V+   +    D  VE  DR++F  LL +ML +  ++RITP   LNH  + M HL     +  V+  F  M++C R        N    P  TH+  ++++N+   FN   +++   +Q  A+ +         L      I + PDP+
Sbjct:  180 SEGDYQLVQHEVLCSMTNTYEVLEFLGRGTFGQVVKCWKRGTNEIVAIKILKNHPSYARQGQIEVSILARLSTESADDYNFVRAYECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKYIRPVLQQVATALMKLKSLGLIHADLKPENIMLVDPSR--QPYRVKVIDFGSASHVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTRFFNRDTDSPYPLWRLKTPDDHEAETGIKSKEARKYIFNCLDDMAQVNMTTDLEGSDMLVEKADRREFIDLLKKMLTIDADKRITPIETLNHPFVTMTHLLDFPHSTHVKSCFQNMEICKRRVNMYDTVNQSKTPFITHVAPSTSTNLTMTFNNQLTTV--HNQPSAASMAAVAQRSMPLQTGTAQICARPDPF 624          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Human
Match: HIPK2 (homeodomain interacting protein kinase 2 [Source:HGNC Symbol;Acc:HGNC:14402])

HSP 1 Score: 466.077 bits (1198), Expect = 1.282e-140
Identity = 232/408 (56.86%), Postives = 282/408 (69.12%), Query Frame = 3
Query:  582 ADGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDSCFE---WRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNRS-------NGRSNP-STHIIDASNSNIISKFN 1772
            ++GDYQ+V  E L SM+  YEVL FLGRGTFGQVVKC  R  N +VAIKILKNHPSY RQG +E+ IL  LS E  + +N VRA ECFQHKNH CLVFE+LEQNLY++LK NKF P+ L  IRP+ QQV TAL KLK L LIHADLKPENIMLV+P+     YRVKVIDFGSA   SKAV +TYLQSRYYRAPEI+LGLPF EAIDMWSLGCV+AELFLGWPLYPG+SEYDQIRYI +TQG+P   +L    K  RFF++D+      WRLK  DD+  ETG ++KE RKY+F  LD +  V+   +    D  VE  DR++F  LL +ML +  ++RITP   LNH  + M HL     +  V+  F  M++C R        N    P  TH+  ++++N+   FN
Sbjct:  180 SEGDYQLVQHEVLCSMTNTYEVLEFLGRGTFGQVVKCWKRGTNEIVAIKILKNHPSYARQGQIEVSILARLSTESADDYNFVRAYECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKYIRPVLQQVATALMKLKSLGLIHADLKPENIMLVDPSR--QPYRVKVIDFGSASHVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTRFFNRDTDSPYPLWRLKTPDDHEAETGIKSKEARKYIFNCLDDMAQVNMTTDLEGSDMLVEKADRREFIDLLKKMLTIDADKRITPIETLNHPFVTMTHLLDFPHSTHVKSCFQNMEICKRRVNMYDTVNQSKTPFITHVAPSTSTNLTMTFN 585          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Human
Match: HIPK1 (homeodomain interacting protein kinase 1 [Source:HGNC Symbol;Acc:HGNC:19006])

HSP 1 Score: 450.669 bits (1158), Expect = 3.810e-136
Identity = 225/408 (55.15%), Postives = 279/408 (68.38%), Query Frame = 3
Query:  582 ADGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDSCFE---WRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNR--------SNGRSNPSTHIIDASNSNIISKFN 1772
             +GDYQ+V  E L SM+  YEVL FLGRGTFGQV KC  R+   +VAIKILKNHPSY RQG +E+ IL  LS E+ + +N VR+ ECFQHKNH CLVFE+LEQNLY++LK NKF P+ L  IRPI QQV TAL KLK L LIHADLKPENIMLV+P      YRVKVIDFGSA   SKAV +TYLQSRYYRAPEI+LGLPF EAIDMWSLGCV+AELFLGWPLYPG+SEYDQIRYI +TQG+P   +L    K  RFF++D       WRLK  +++  ETG ++KE RKY+F  LD +  V+   +    D   E  DR+++  LL +ML +  ++RITP   LNH  + M HL     +  V+  F  M++C R        S  +S  +TH+   +++N+   F+
Sbjct:  171 GEGDYQLVQHEILCSMTNSYEVLEFLGRGTFGQVAKCWKRSTKEIVAIKILKNHPSYARQGQIEVSILSRLSSENADEYNFVRSYECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKYIRPILQQVATALMKLKSLGLIHADLKPENIMLVDPVR--QPYRVKVIDFGSASHVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTRFFNRDPNLGYPLWRLKTPEEHELETGIKSKEARKYIFNCLDDMAQVNMSTDLEGTDMLAEKADRREYIDLLKKMLTIDADKRITPLKTLNHQFVTMTHLLDFPHSNHVKSCFQNMEICKRRVHMYDTVSQIKSPFTTHVAPNTSTNLTMSFS 576          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Human
Match: HIPK1 (homeodomain interacting protein kinase 1 [Source:HGNC Symbol;Acc:HGNC:19006])

HSP 1 Score: 452.21 bits (1162), Expect = 6.634e-136
Identity = 225/408 (55.15%), Postives = 279/408 (68.38%), Query Frame = 3
Query:  582 ADGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDSCFE---WRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNR--------SNGRSNPSTHIIDASNSNIISKFN 1772
             +GDYQ+V  E L SM+  YEVL FLGRGTFGQV KC  R+   +VAIKILKNHPSY RQG +E+ IL  LS E+ + +N VR+ ECFQHKNH CLVFE+LEQNLY++LK NKF P+ L  IRPI QQV TAL KLK L LIHADLKPENIMLV+P      YRVKVIDFGSA   SKAV +TYLQSRYYRAPEI+LGLPF EAIDMWSLGCV+AELFLGWPLYPG+SEYDQIRYI +TQG+P   +L    K  RFF++D       WRLK  +++  ETG ++KE RKY+F  LD +  V+   +    D   E  DR+++  LL +ML +  ++RITP   LNH  + M HL     +  V+  F  M++C R        S  +S  +TH+   +++N+   F+
Sbjct:  171 GEGDYQLVQHEILCSMTNSYEVLEFLGRGTFGQVAKCWKRSTKEIVAIKILKNHPSYARQGQIEVSILSRLSSENADEYNFVRSYECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKYIRPILQQVATALMKLKSLGLIHADLKPENIMLVDPVR--QPYRVKVIDFGSASHVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTRFFNRDPNLGYPLWRLKTPEEHELETGIKSKEARKYIFNCLDDMAQVNMSTDLEGTDMLAEKADRREYIDLLKKMLTIDADKRITPLKTLNHQFVTMTHLLDFPHSNHVKSCFQNMEICKRRVHMYDTVSQIKSPFTTHVAPNTSTNLTMSFS 576          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Celegans
Match: hpk-1 (Homeodomain-interacting protein kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q8MQ70])

HSP 1 Score: 417.927 bits (1073), Expect = 2.115e-128
Identity = 211/386 (54.66%), Postives = 266/386 (68.91%), Query Frame = 3
Query:  579 TADGDYQIVVGENLNS-MSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDSCFE----------WRLKNQDDY-LNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNR 1700
            + +G+YQ++  E L S     YEVL FLG+GTFGQVVK   +  + +VAIKILK HPSY RQG +E+ IL  LS E++E  N VRA ECF HK+H CLVFE+LEQNLY++LK NKF P+ L  IRPI  QVLTAL KLK L LIHADLKPENIMLV+P      YRVKVIDFGSA   SKAV NTYLQSRYYRAPEI+LGLPFNE+IDMWSLGCV+AELFLGWPLYPGSSEYDQIR+II+TQG+PP+ ML+ A K++RFF +               +RLK  ++Y  + +  ++KETRKY+F  +D I  V    E    ++  +  DR++F  +L +ML + P+ RITP   L    + M H+    F   V ++   M++C +
Sbjct:   20 SGEGEYQLIKNEVLCSPYGNQYEVLEFLGKGTFGQVVKAWKKGTSEIVAIKILKKHPSYARQGQIEVSILSRLSNENSEEFNFVRAFECFNHKSHTCLVFEMLEQNLYDFLKQNKFMPLPLNAIRPILFQVLTALLKLKSLGLIHADLKPENIMLVDPQQ--QPYRVKVIDFGSASHRSKAVTNTYLQSRYYRAPEIILGLPFNESIDMWSLGCVIAELFLGWPLYPGSSEYDQIRFIIQTQGLPPTSMLESASKLHRFFKEVKSESPNHTNVGGSYYRLKTVEEYEASSSTAKSKETRKYIFNVIDDISRVCYGFESDPVEHLCDRIDRQEFVDVLKKMLVLNPDFRITPAEGLESKFVTMTHINGYNFANYVHEAHKRMEICRK 403          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Celegans
Match: hpk-1 (Homeodomain-interacting protein kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q8MQ70])

HSP 1 Score: 417.927 bits (1073), Expect = 2.115e-128
Identity = 211/386 (54.66%), Postives = 266/386 (68.91%), Query Frame = 3
Query:  579 TADGDYQIVVGENLNS-MSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDSCFE----------WRLKNQDDY-LNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNR 1700
            + +G+YQ++  E L S     YEVL FLG+GTFGQVVK   +  + +VAIKILK HPSY RQG +E+ IL  LS E++E  N VRA ECF HK+H CLVFE+LEQNLY++LK NKF P+ L  IRPI  QVLTAL KLK L LIHADLKPENIMLV+P      YRVKVIDFGSA   SKAV NTYLQSRYYRAPEI+LGLPFNE+IDMWSLGCV+AELFLGWPLYPGSSEYDQIR+II+TQG+PP+ ML+ A K++RFF +               +RLK  ++Y  + +  ++KETRKY+F  +D I  V    E    ++  +  DR++F  +L +ML + P+ RITP   L    + M H+    F   V ++   M++C +
Sbjct:   20 SGEGEYQLIKNEVLCSPYGNQYEVLEFLGKGTFGQVVKAWKKGTSEIVAIKILKKHPSYARQGQIEVSILSRLSNENSEEFNFVRAFECFNHKSHTCLVFEMLEQNLYDFLKQNKFMPLPLNAIRPILFQVLTALLKLKSLGLIHADLKPENIMLVDPQQ--QPYRVKVIDFGSASHRSKAVTNTYLQSRYYRAPEIILGLPFNESIDMWSLGCVIAELFLGWPLYPGSSEYDQIRFIIQTQGLPPTSMLESASKLHRFFKEVKSESPNHTNVGGSYYRLKTVEEYEASSSTAKSKETRKYIFNVIDDISRVCYGFESDPVEHLCDRIDRQEFVDVLKKMLVLNPDFRITPAEGLESKFVTMTHINGYNFANYVHEAHKRMEICRK 403          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Celegans
Match: hpk-1 (Homeodomain-interacting protein kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q8MQ70])

HSP 1 Score: 419.083 bits (1076), Expect = 8.848e-128
Identity = 211/386 (54.66%), Postives = 266/386 (68.91%), Query Frame = 3
Query:  579 TADGDYQIVVGENLNS-MSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDSCFE----------WRLKNQDDY-LNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNR 1700
            + +G+YQ++  E L S     YEVL FLG+GTFGQVVK   +  + +VAIKILK HPSY RQG +E+ IL  LS E++E  N VRA ECF HK+H CLVFE+LEQNLY++LK NKF P+ L  IRPI  QVLTAL KLK L LIHADLKPENIMLV+P      YRVKVIDFGSA   SKAV NTYLQSRYYRAPEI+LGLPFNE+IDMWSLGCV+AELFLGWPLYPGSSEYDQIR+II+TQG+PP+ ML+ A K++RFF +               +RLK  ++Y  + +  ++KETRKY+F  +D I  V    E    ++  +  DR++F  +L +ML + P+ RITP   L    + M H+    F   V ++   M++C +
Sbjct:  101 SGEGEYQLIKNEVLCSPYGNQYEVLEFLGKGTFGQVVKAWKKGTSEIVAIKILKKHPSYARQGQIEVSILSRLSNENSEEFNFVRAFECFNHKSHTCLVFEMLEQNLYDFLKQNKFMPLPLNAIRPILFQVLTALLKLKSLGLIHADLKPENIMLVDPQQ--QPYRVKVIDFGSASHRSKAVTNTYLQSRYYRAPEIILGLPFNESIDMWSLGCVIAELFLGWPLYPGSSEYDQIRFIIQTQGLPPTSMLESASKLHRFFKEVKSESPNHTNVGGSYYRLKTVEEYEASSSTAKSKETRKYIFNVIDDISRVCYGFESDPVEHLCDRIDRQEFVDVLKKMLVLNPDFRITPAEGLESKFVTMTHINGYNFANYVHEAHKRMEICRK 484          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Celegans
Match: hpk-1 (Homeodomain-interacting protein kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q8MQ70])

HSP 1 Score: 419.468 bits (1077), Expect = 1.065e-127
Identity = 211/386 (54.66%), Postives = 266/386 (68.91%), Query Frame = 3
Query:  579 TADGDYQIVVGENLNS-MSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDSCFE----------WRLKNQDDY-LNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNR 1700
            + +G+YQ++  E L S     YEVL FLG+GTFGQVVK   +  + +VAIKILK HPSY RQG +E+ IL  LS E++E  N VRA ECF HK+H CLVFE+LEQNLY++LK NKF P+ L  IRPI  QVLTAL KLK L LIHADLKPENIMLV+P      YRVKVIDFGSA   SKAV NTYLQSRYYRAPEI+LGLPFNE+IDMWSLGCV+AELFLGWPLYPGSSEYDQIR+II+TQG+PP+ ML+ A K++RFF +               +RLK  ++Y  + +  ++KETRKY+F  +D I  V    E    ++  +  DR++F  +L +ML + P+ RITP   L    + M H+    F   V ++   M++C +
Sbjct:  126 SGEGEYQLIKNEVLCSPYGNQYEVLEFLGKGTFGQVVKAWKKGTSEIVAIKILKKHPSYARQGQIEVSILSRLSNENSEEFNFVRAFECFNHKSHTCLVFEMLEQNLYDFLKQNKFMPLPLNAIRPILFQVLTALLKLKSLGLIHADLKPENIMLVDPQQ--QPYRVKVIDFGSASHRSKAVTNTYLQSRYYRAPEIILGLPFNESIDMWSLGCVIAELFLGWPLYPGSSEYDQIRFIIQTQGLPPTSMLESASKLHRFFKEVKSESPNHTNVGGSYYRLKTVEEYEASSSTAKSKETRKYIFNVIDDISRVCYGFESDPVEHLCDRIDRQEFVDVLKKMLVLNPDFRITPAEGLESKFVTMTHINGYNFANYVHEAHKRMEICRK 509          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Celegans
Match: mbk-2 (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTF3])

HSP 1 Score: 229.95 bits (585), Expect = 3.230e-65
Identity = 130/348 (37.36%), Postives = 193/348 (55.46%), Query Frame = 3
Query:  585 DGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTE-SHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDSCFEWRLKNQ--DDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQ--FAHLLIQMLQMRPEERITPDVALNH 1613
            +G YQ+VV +++   +  YEVL  +G+G+FGQV+K       + VA+K+++N   + RQ + EI+IL  L ++D++ +HNI+  ++ F  +NH C+ FELL  NLYE +K NKF+  +L  +R  A  +L  L  L++  LIH DLKPEN++L        R  +KVIDFGS+C   + +  TY+QSR+YRAPE++LG  +   IDMWSLGC++AEL  G+PL PG  E DQ+  IIE  GMPP   L+ A +   F +      +       D  +   G R+K  +               R  P    +   +++     F   L + L   PE R+TP  AL H
Sbjct:  119 NGSYQLVVHDHI---AYRYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRRQDSDGTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNRLIHCDLKPENVLLKQQG----RSGIKVIDFGSSCFDDQRIY-TYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRARTFITSKGYPRYCTATSMPDGSVVLAGARSKRGKM--------------RGPPASRSWSTALKNMGDELFVDFLKRCLDWDPETRMTPAQALKH 444          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Fly
Match: Hipk (gene:FBgn0035142 transcript:FBtr0331786)

HSP 1 Score: 461.07 bits (1185), Expect = 1.106e-138
Identity = 238/420 (56.67%), Postives = 289/420 (68.81%), Query Frame = 3
Query:  456 APLQINPMNHSSIKFASNNHSLIXXXXXXXXXXXXXXXRSATADGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSK--DSCFE-WRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNRSN 1706
             P  I P+  SS+K A   H+ +  S    + +  +   S+ ADGDYQ+V  E L S+S  YEVL FLGRGTFGQVVKC  R  + +VAIKILKNHPSY RQG +E+ IL  LSQE+ +  N VRA ECFQHKNH CLVFE+LEQNLY++LK NKF P+ L  IRPI +QVLTAL KLKQL LIHADLKPENIMLV+P      YRVKVIDFGSA   SK V NTYLQSRYYRAPEI+LGLPF EAIDMWSLGCV+AELFLGWPLYPGSSE+DQIRYI +TQG+P   ML  A K ++FF +  DS +  WRLK  +++  ET  ++KE RKY+F  LD I  V+   +        E  DR++F  LL +ML +  E R+TP  ALNH    + HL   ++   V+ S  +M+VC R +
Sbjct:   52 GPDGIGPI--SSLKTA---HTKVATSGGHANTQPPSKRSSSGADGDYQLVQHEVLYSLSAEYEVLEFLGRGTFGQVVKCWKRGTSEIVAIKILKNHPSYARQGQIEVSILSRLSQENADEFNFVRAFECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKYIRPILEQVLTALLKLKQLGLIHADLKPENIMLVDPVR--QPYRVKVIDFGSASHVSKTVCNTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVVAELFLGWPLYPGSSEFDQIRYISQTQGLPTEHMLNSASKTSKFFYRDVDSTYPFWRLKTTEEHEAETNTKSKEARKYIFNCLDDIGQVNVPTDLEGGQLLAEKTDRREFIDLLKRMLTIDQERRLTPAEALNHSFTRLTHLVDYVYCNNVKASVQMMEVCRRGD 464          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Fly
Match: Hipk (gene:FBgn0035142 transcript:FBtr0072552)

HSP 1 Score: 462.225 bits (1188), Expect = 2.400e-138
Identity = 238/420 (56.67%), Postives = 289/420 (68.81%), Query Frame = 3
Query:  456 APLQINPMNHSSIKFASNNHSLIXXXXXXXXXXXXXXXRSATADGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSK--DSCFE-WRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNRSN 1706
             P  I P+  SS+K A   H+ +  S    + +  +   S+ ADGDYQ+V  E L S+S  YEVL FLGRGTFGQVVKC  R  + +VAIKILKNHPSY RQG +E+ IL  LSQE+ +  N VRA ECFQHKNH CLVFE+LEQNLY++LK NKF P+ L  IRPI +QVLTAL KLKQL LIHADLKPENIMLV+P      YRVKVIDFGSA   SK V NTYLQSRYYRAPEI+LGLPF EAIDMWSLGCV+AELFLGWPLYPGSSE+DQIRYI +TQG+P   ML  A K ++FF +  DS +  WRLK  +++  ET  ++KE RKY+F  LD I  V+   +        E  DR++F  LL +ML +  E R+TP  ALNH    + HL   ++   V+ S  +M+VC R +
Sbjct:  136 GPDGIGPI--SSLKTA---HTKVATSGGHANTQPPSKRSSSGADGDYQLVQHEVLYSLSAEYEVLEFLGRGTFGQVVKCWKRGTSEIVAIKILKNHPSYARQGQIEVSILSRLSQENADEFNFVRAFECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKYIRPILEQVLTALLKLKQLGLIHADLKPENIMLVDPVR--QPYRVKVIDFGSASHVSKTVCNTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVVAELFLGWPLYPGSSEFDQIRYISQTQGLPTEHMLNSASKTSKFFYRDVDSTYPFWRLKTTEEHEAETNTKSKEARKYIFNCLDDIGQVNVPTDLEGGQLLAEKTDRREFIDLLKRMLTIDQERRLTPAEALNHSFTRLTHLVDYVYCNNVKASVQMMEVCRRGD 548          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Fly
Match: Hipk (gene:FBgn0035142 transcript:FBtr0072551)

HSP 1 Score: 462.225 bits (1188), Expect = 2.400e-138
Identity = 238/420 (56.67%), Postives = 289/420 (68.81%), Query Frame = 3
Query:  456 APLQINPMNHSSIKFASNNHSLIXXXXXXXXXXXXXXXRSATADGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSK--DSCFE-WRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNRSN 1706
             P  I P+  SS+K A   H+ +  S    + +  +   S+ ADGDYQ+V  E L S+S  YEVL FLGRGTFGQVVKC  R  + +VAIKILKNHPSY RQG +E+ IL  LSQE+ +  N VRA ECFQHKNH CLVFE+LEQNLY++LK NKF P+ L  IRPI +QVLTAL KLKQL LIHADLKPENIMLV+P      YRVKVIDFGSA   SK V NTYLQSRYYRAPEI+LGLPF EAIDMWSLGCV+AELFLGWPLYPGSSE+DQIRYI +TQG+P   ML  A K ++FF +  DS +  WRLK  +++  ET  ++KE RKY+F  LD I  V+   +        E  DR++F  LL +ML +  E R+TP  ALNH    + HL   ++   V+ S  +M+VC R +
Sbjct:  136 GPDGIGPI--SSLKTA---HTKVATSGGHANTQPPSKRSSSGADGDYQLVQHEVLYSLSAEYEVLEFLGRGTFGQVVKCWKRGTSEIVAIKILKNHPSYARQGQIEVSILSRLSQENADEFNFVRAFECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKYIRPILEQVLTALLKLKQLGLIHADLKPENIMLVDPVR--QPYRVKVIDFGSASHVSKTVCNTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVVAELFLGWPLYPGSSEFDQIRYISQTQGLPTEHMLNSASKTSKFFYRDVDSTYPFWRLKTTEEHEAETNTKSKEARKYIFNCLDDIGQVNVPTDLEGGQLLAEKTDRREFIDLLKRMLTIDQERRLTPAEALNHSFTRLTHLVDYVYCNNVKASVQMMEVCRRGD 548          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Fly
Match: mnb (gene:FBgn0259168 transcript:FBtr0299619)

HSP 1 Score: 235.728 bits (600), Expect = 1.026e-65
Identity = 137/348 (39.37%), Postives = 203/348 (58.33%), Query Frame = 3
Query:  591 DYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTE-SHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLK--QLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSK---DSCFEWRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHD-PDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNH 1613
            DY I  GE        YE+ + +G+G+FGQVVK         VAIKI+KN   +L Q  +E+++L+ +++ D E  + IV+    F  +NH+CLVFELL  NLY+ L++  FR ++L   R  AQQ+ TAL  L   +L++IH DLKPENI+L NP   A    +K++DFGS+C   + + + Y+QSR+YR+PE+LLG+ ++ AIDMWSLGC++ E+  G PL+ G +E DQ+  I+E  GMPP  +L  A K  +FF K   D  +  + KNQ+      G++ K         +  +    P     D P + V   D  +F  L+++ML   P+ R+TP  AL H
Sbjct:  151 DYIIKNGEKF---LDRYEIDSLIGKGSFGQVVKAYDHEEQCHVAIKIIKNKKPFLNQAQIEVKLLEMMNRADAENKYYIVKLKRHFMWRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLSTPELNIIHCDLKPENILLCNPKRSA----IKIVDFGSSCQLGQRIYH-YIQSRFYRSPEVLLGIQYDLAIDMWSLGCILVEMHTGEPLFSGCNEVDQMNKIVEVLGMPPKYLLDQAHKTRKFFDKIVADGSYVLK-KNQN------GRKYKPPGSRKLHDILGVETGGPGGRRLDEPGHSV--SDYLKFKDLILRMLDFDPKTRVTPYYALQH 481          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Fly
Match: mnb (gene:FBgn0259168 transcript:FBtr0300509)

HSP 1 Score: 235.728 bits (600), Expect = 1.098e-65
Identity = 135/348 (38.79%), Postives = 201/348 (57.76%), Query Frame = 3
Query:  591 DYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTE-SHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLK--QLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSK---DSCFEWRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHD-PDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNH 1613
            DY I  GE        YE+ + +G+G+FGQVVK         VAIKI+KN   +L Q  +E+++L+ +++ D E  + IV+    F  +NH+CLVFELL  NLY+ L++  FR ++L   R  AQQ+ TAL  L   +L++IH DLKPENI+L NP   A    +K++DFGS+C   + + + Y+QSR+YR+PE+LLG+ ++ AIDMWSLGC++ E+  G PL+ G +E DQ+  I+E  GMPP  +L  A K  +FF K   D  +  +        N+ G++ K         +  +    P     D P + V   D  +F  L+++ML   P+ R+TP  AL H
Sbjct:  151 DYIIKNGEKF---LDRYEIDSLIGKGSFGQVVKAYDHEEQCHVAIKIIKNKKPFLNQAQIEVKLLEMMNRADAENKYYIVKLKRHFMWRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLSTPELNIIHCDLKPENILLCNPKRSA----IKIVDFGSSCQLGQRIYH-YIQSRFYRSPEVLLGIQYDLAIDMWSLGCILVEMHTGEPLFSGCNEVDQMNKIVEVLGMPPKYLLDQAHKTRKFFDKIVADGSYVLK-------KNQNGRKYKPPGSRKLHDILGVETGGPGGRRLDEPGHSV--SDYLKFKDLILRMLDFDPKTRVTPYYALQH 481          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Zebrafish
Match: hipk2 (homeodomain interacting protein kinase 2 [Source:ZFIN;Acc:ZDB-GENE-031125-4])

HSP 1 Score: 461.84 bits (1187), Expect = 5.021e-139
Identity = 232/411 (56.45%), Postives = 283/411 (68.86%), Query Frame = 3
Query:  573 SATADGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSK--DSCFE-WRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNRS-------NGRSNP-STHIIDASNSNIISKFN 1772
             A ++GDYQ++  E L SM+  YEVL FLGRGTFGQVVKC  R  + +VAIKILKNHPSY RQG +E+ IL  LS E  + +N VRA ECFQHKNH CLVFE+LEQNLY++LK NKF P+ L  IRPI QQV TAL KLK L LIHADLKPENIMLV+PA     YRVKVIDFGSA   SKAV +TYLQSRYYRAPEI+LGLPF EAIDMWSLGCV+AELFLGWPLYPG+SEYDQIRYI +TQG+P   +L    K  RFF++  DS +  WRLK  +D+  ETG ++KE RKY+F  LD +  V+   +    D   E  DR++F  LL +ML +  ++RITP   LNH  + M HL     +  V+  F  M++C R        N    P  TH+  ++++N+   FN
Sbjct:  191 GANSEGDYQLLQHEVLCSMTNTYEVLEFLGRGTFGQVVKCWKRGTSEIVAIKILKNHPSYARQGQIEVSILARLSTESADDYNFVRAYECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKYIRPILQQVATALMKLKSLGLIHADLKPENIMLVDPAR--QPYRVKVIDFGSASHVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTRFFNRDPDSTYPLWRLKTPEDHEAETGIKSKEARKYIFNCLDDMAQVNMTTDLEGSDMLAEKADRREFIDLLTKMLTIDADKRITPIETLNHPFVTMTHLLDFPHSTHVKSCFQNMEICKRRVNMYDTVNQSKTPFITHVAPSTSTNLTMTFN 599          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Zebrafish
Match: hipk2 (homeodomain interacting protein kinase 2 [Source:ZFIN;Acc:ZDB-GENE-031125-4])

HSP 1 Score: 461.455 bits (1186), Expect = 6.069e-139
Identity = 232/411 (56.45%), Postives = 283/411 (68.86%), Query Frame = 3
Query:  573 SATADGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSK--DSCFE-WRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNRS-------NGRSNP-STHIIDASNSNIISKFN 1772
             A ++GDYQ++  E L SM+  YEVL FLGRGTFGQVVKC  R  + +VAIKILKNHPSY RQG +E+ IL  LS E  + +N VRA ECFQHKNH CLVFE+LEQNLY++LK NKF P+ L  IRPI QQV TAL KLK L LIHADLKPENIMLV+PA     YRVKVIDFGSA   SKAV +TYLQSRYYRAPEI+LGLPF EAIDMWSLGCV+AELFLGWPLYPG+SEYDQIRYI +TQG+P   +L    K  RFF++  DS +  WRLK  +D+  ETG ++KE RKY+F  LD +  V+   +    D   E  DR++F  LL +ML +  ++RITP   LNH  + M HL     +  V+  F  M++C R        N    P  TH+  ++++N+   FN
Sbjct:  191 GANSEGDYQLLQHEVLCSMTNTYEVLEFLGRGTFGQVVKCWKRGTSEIVAIKILKNHPSYARQGQIEVSILARLSTESADDYNFVRAYECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKYIRPILQQVATALMKLKSLGLIHADLKPENIMLVDPAR--QPYRVKVIDFGSASHVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTRFFNRDPDSTYPLWRLKTPEDHEAETGIKSKEARKYIFNCLDDMAQVNMTTDLEGSDMLAEKADRREFIDLLTKMLTIDADKRITPIETLNHPFVTMTHLLDFPHSTHVKSCFQNMEICKRRVNMYDTVNQSKTPFITHVAPSTSTNLTMTFN 599          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Zebrafish
Match: hipk2 (homeodomain interacting protein kinase 2 [Source:ZFIN;Acc:ZDB-GENE-031125-4])

HSP 1 Score: 461.07 bits (1185), Expect = 8.819e-139
Identity = 232/411 (56.45%), Postives = 283/411 (68.86%), Query Frame = 3
Query:  573 SATADGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSK--DSCFE-WRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNRS-------NGRSNP-STHIIDASNSNIISKFN 1772
             A ++GDYQ++  E L SM+  YEVL FLGRGTFGQVVKC  R  + +VAIKILKNHPSY RQG +E+ IL  LS E  + +N VRA ECFQHKNH CLVFE+LEQNLY++LK NKF P+ L  IRPI QQV TAL KLK L LIHADLKPENIMLV+PA     YRVKVIDFGSA   SKAV +TYLQSRYYRAPEI+LGLPF EAIDMWSLGCV+AELFLGWPLYPG+SEYDQIRYI +TQG+P   +L    K  RFF++  DS +  WRLK  +D+  ETG ++KE RKY+F  LD +  V+   +    D   E  DR++F  LL +ML +  ++RITP   LNH  + M HL     +  V+  F  M++C R        N    P  TH+  ++++N+   FN
Sbjct:  198 GANSEGDYQLLQHEVLCSMTNTYEVLEFLGRGTFGQVVKCWKRGTSEIVAIKILKNHPSYARQGQIEVSILARLSTESADDYNFVRAYECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKYIRPILQQVATALMKLKSLGLIHADLKPENIMLVDPAR--QPYRVKVIDFGSASHVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTRFFNRDPDSTYPLWRLKTPEDHEAETGIKSKEARKYIFNCLDDMAQVNMTTDLEGSDMLAEKADRREFIDLLTKMLTIDADKRITPIETLNHPFVTMTHLLDFPHSTHVKSCFQNMEICKRRVNMYDTVNQSKTPFITHVAPSTSTNLTMTFN 606          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Zebrafish
Match: hipk1a (homeodomain interacting protein kinase 1a [Source:ZFIN;Acc:ZDB-GENE-081031-101])

HSP 1 Score: 439.113 bits (1128), Expect = 1.985e-136
Identity = 219/375 (58.40%), Postives = 261/375 (69.60%), Query Frame = 3
Query:  585 DGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSK--DSCFE-WRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNR 1700
            +GDYQ+V  E L S+S  YEVL FLGRGTFGQV KC  R  N +VAIKILKNHPSY RQG +E+ IL  LS E+ +  N VR+ ECFQHKNH CLVFE+LEQNLY++LK +KF P+ L  IRP+ QQV TAL KLK L LIHADLKPENIMLV+P      YRVKVIDFGSA   SKAV +TYLQSRYYRAPEI+LGLPF EAIDMWSLGCV+AELFLGWPLYPG+SEYDQIRYI +TQG+P   +L    K +RFF +  DS +  WRLK   ++  E G ++KE RKY+F  LD +  V         D   E  DR++F  LL +ML +  ++RITP   LNH  + M HL     +  V+  F  M +C R
Sbjct:  183 EGDYQLVQHEILCSVSNSYEVLEFLGRGTFGQVAKCWKRGTNEIVAIKILKNHPSYARQGQIEVSILSRLSTENADEFNFVRSYECFQHKNHTCLVFEMLEQNLYDFLKHSKFSPLLLKCIRPVLQQVSTALMKLKSLGLIHADLKPENIMLVDPIR--QPYRVKVIDFGSASHVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTSRFFHRGPDSSYPLWRLKTPAEHEAEFGIKSKEARKYIFNCLDDMMQVVNMTNLEGTDILAEKADRREFIDLLKKMLTLDADKRITPTKTLNHPFVTMTHLLHFPHSSHVKSCFQNMDICKR 555          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Zebrafish
Match: hipk3a (homeodomain interacting protein kinase 3a [Source:ZFIN;Acc:ZDB-GENE-061207-54])

HSP 1 Score: 449.129 bits (1154), Expect = 2.157e-134
Identity = 222/377 (58.89%), Postives = 264/377 (70.03%), Query Frame = 3
Query:  576 ATADGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDS---CFEWRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCN 1697
             T DGDYQ+V  E L SM   YEVL FLGRGTFGQVVKC  R  N +VA+KILKNHPSY RQG +E+ IL  LS E+ E HN+VRA ECFQH++H CLVFE+LEQNLY++LK NKF P+ L  IRP+ QQV TAL KLK L LIHADLKPENIMLV+P      +RVKVIDFGSA   SKAV +TYLQSRYYRAPEI+LGLPF EAIDMWSLGCV+AELFLGWPLYPG+ EYDQIRYI +TQG+P   +L    K  RFF K+S      WRLK  +++  ETG ++KE RKY+F+ LD I +V+        D   E  DR++F  LL  ML +  ++RI P  AL H  + M HL        V+  F +M VC+
Sbjct:  212 GTGDGDYQLVQHEVLCSMKHTYEVLEFLGRGTFGQVVKCWKRGTNEIVAVKILKNHPSYARQGQIEVSILARLSGENAEEHNLVRAFECFQHRSHTCLVFEMLEQNLYDFLKQNKFSPLPLKVIRPVLQQVATALKKLKSLGLIHADLKPENIMLVDPVR--QPFRVKVIDFGSASHVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGALEYDQIRYISQTQGLPGEQLLNVGTKTARFFCKESDSPYTAWRLKTTEEHEAETGLKSKEARKYIFSCLDDIGHVNLMLNMEGCDQLAEKADRREFVDLLKMMLMIDADQRIAPSDALTHPFVTMQHLMDFPHCNHVQSCFHIMDVCH 586          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Xenopus
Match: hipk2 (homeodomain interacting protein kinase 2 [Source:NCBI gene;Acc:780207])

HSP 1 Score: 459.529 bits (1181), Expect = 5.205e-144
Identity = 231/408 (56.62%), Postives = 282/408 (69.12%), Query Frame = 3
Query:  582 ADGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDSCFE---WRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNRS-------NGRSNP-STHIIDASNSNIISKFN 1772
            ++GDYQ+V  E L SM+  YEVL FLGRGTFGQVVKC  R  N +VAIKILKNHPSY RQG +E+ IL  LS E  + +N VRA ECFQHKNH CLVFE+LEQNLY++LK NKF P+ L  IRP+ QQV TAL KLK L LIHADLKPENIMLV+P+     YRVKVIDFGSA   SKAV +TYLQSRYYRAPEI+LGLPF EAIDMWSLGCV+AELFLGWPLYPG+SEYDQIRYI +TQG+P   +L    K  RFF++D       WRLK  +D+ NETG ++KE RKY+F  LD +  V+   +    D  VE  DR++F  LL +ML +  ++RITP   LNH  + M HL     +  V+  F  M++C R        N    P  TH+  ++++N+   F+
Sbjct:  168 SEGDYQLVQHEVLCSMTNTYEVLEFLGRGTFGQVVKCWKRGTNEIVAIKILKNHPSYARQGQIEVSILARLSTESADDYNFVRAYECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKYIRPVLQQVGTALMKLKSLGLIHADLKPENIMLVDPSR--QPYRVKVIDFGSASHVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSSGTKTTRFFNRDGDSPYPLWRLKTPEDHENETGIKSKEARKYIFNCLDDMAQVNMASDLEGSDMLVEKADRREFIDLLKKMLTIDADKRITPIETLNHPFVTMTHLLDFPHSSHVKSCFQNMEICKRRVNMYDTVNHSKTPFITHVAPSTSTNLTMTFS 573          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Xenopus
Match: hipk2 (homeodomain interacting protein kinase 2 [Source:NCBI gene;Acc:780207])

HSP 1 Score: 458.759 bits (1179), Expect = 8.385e-143
Identity = 231/408 (56.62%), Postives = 282/408 (69.12%), Query Frame = 3
Query:  582 ADGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDSCFE---WRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNRS-------NGRSNP-STHIIDASNSNIISKFN 1772
            ++GDYQ+V  E L SM+  YEVL FLGRGTFGQVVKC  R  N +VAIKILKNHPSY RQG +E+ IL  LS E  + +N VRA ECFQHKNH CLVFE+LEQNLY++LK NKF P+ L  IRP+ QQV TAL KLK L LIHADLKPENIMLV+P+     YRVKVIDFGSA   SKAV +TYLQSRYYRAPEI+LGLPF EAIDMWSLGCV+AELFLGWPLYPG+SEYDQIRYI +TQG+P   +L    K  RFF++D       WRLK  +D+ NETG ++KE RKY+F  LD +  V+   +    D  VE  DR++F  LL +ML +  ++RITP   LNH  + M HL     +  V+  F  M++C R        N    P  TH+  ++++N+   F+
Sbjct:  168 SEGDYQLVQHEVLCSMTNTYEVLEFLGRGTFGQVVKCWKRGTNEIVAIKILKNHPSYARQGQIEVSILARLSTESADDYNFVRAYECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKYIRPVLQQVGTALMKLKSLGLIHADLKPENIMLVDPSR--QPYRVKVIDFGSASHVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSSGTKTTRFFNRDGDSPYPLWRLKTPEDHENETGIKSKEARKYIFNCLDDMAQVNMASDLEGSDMLVEKADRREFIDLLKKMLTIDADKRITPIETLNHPFVTMTHLLDFPHSSHVKSCFQNMEICKRRVNMYDTVNHSKTPFITHVAPSTSTNLTMTFS 573          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Xenopus
Match: hipk1 (homeodomain interacting protein kinase 1 [Source:NCBI gene;Acc:734033])

HSP 1 Score: 456.447 bits (1173), Expect = 7.240e-138
Identity = 227/411 (55.23%), Postives = 282/411 (68.61%), Query Frame = 3
Query:  573 SATADGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDSCFE---WRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNRSNG--------RSNPSTHIIDASNSNIISKFN 1772
            S+  +GDYQ+V  E L SM+  YEVL FLGRGTFGQV KC  R+   +VAIKILKNHPSY RQG +E+ IL  LS E+ + +N VR+ ECFQHKNH CLVFE+LEQNLY++LK NKF P+ L  IRPI QQV TAL KLK L LIHADLKPENIMLV+P      YRVKVIDFGSA   SKAV +TYLQSRYYRAPEI+LGLPF EAIDMWSLGCV+AELFLGWPLYPG+SEYDQIRYI +TQG+P   +L    K +RFF++D       WRLK  D++  ETG ++KE RKY+F  LD +  V+   +    D   E  DR+++  LL +ML +  ++RITP   LNH  + M HL     +  V+  F  M++C R +         +S  +TH+   +++N+   FN
Sbjct:  168 SSNGEGDYQLVQHEILCSMTNSYEVLEFLGRGTFGQVAKCWKRSTKEIVAIKILKNHPSYARQGQIEVSILSRLSSENADEYNFVRSYECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKYIRPILQQVATALMKLKSLGLIHADLKPENIMLVDPVR--QPYRVKVIDFGSASHVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTSRFFNRDPDLGYPLWRLKAPDEHEMETGIKSKEARKYIFNCLDDMAQVNMSTDLEGTDMLAEKADRREYIDLLKKMLTIDADKRITPLKTLNHPFVTMTHLLDFPHSNHVKSCFQNMEICKRRSNMYDTVNQIKSPFTTHVAPNTSTNLTMSFN 576          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Xenopus
Match: hipk1 (homeodomain interacting protein kinase 1 [Source:NCBI gene;Acc:734033])

HSP 1 Score: 455.677 bits (1171), Expect = 7.653e-138
Identity = 227/411 (55.23%), Postives = 282/411 (68.61%), Query Frame = 3
Query:  573 SATADGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDSCFE---WRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNRSNG--------RSNPSTHIIDASNSNIISKFN 1772
            S+  +GDYQ+V  E L SM+  YEVL FLGRGTFGQV KC  R+   +VAIKILKNHPSY RQG +E+ IL  LS E+ + +N VR+ ECFQHKNH CLVFE+LEQNLY++LK NKF P+ L  IRPI QQV TAL KLK L LIHADLKPENIMLV+P      YRVKVIDFGSA   SKAV +TYLQSRYYRAPEI+LGLPF EAIDMWSLGCV+AELFLGWPLYPG+SEYDQIRYI +TQG+P   +L    K +RFF++D       WRLK  D++  ETG ++KE RKY+F  LD +  V+   +    D   E  DR+++  LL +ML +  ++RITP   LNH  + M HL     +  V+  F  M++C R +         +S  +TH+   +++N+   FN
Sbjct:  168 SSNGEGDYQLVQHEILCSMTNSYEVLEFLGRGTFGQVAKCWKRSTKEIVAIKILKNHPSYARQGQIEVSILSRLSSENADEYNFVRSYECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKYIRPILQQVATALMKLKSLGLIHADLKPENIMLVDPVR--QPYRVKVIDFGSASHVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTSRFFNRDPDLGYPLWRLKAPDEHEMETGIKSKEARKYIFNCLDDMAQVNMSTDLEGTDMLAEKADRREYIDLLKKMLTIDADKRITPLKTLNHPFVTMTHLLDFPHSNHVKSCFQNMEICKRRSNMYDTVNQIKSPFTTHVAPNTSTNLTMSFN 576          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Xenopus
Match: hipk1 (homeodomain interacting protein kinase 1 [Source:NCBI gene;Acc:734033])

HSP 1 Score: 456.447 bits (1173), Expect = 8.270e-138
Identity = 227/411 (55.23%), Postives = 282/411 (68.61%), Query Frame = 3
Query:  573 SATADGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDSCFE---WRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNRSNG--------RSNPSTHIIDASNSNIISKFN 1772
            S+  +GDYQ+V  E L SM+  YEVL FLGRGTFGQV KC  R+   +VAIKILKNHPSY RQG +E+ IL  LS E+ + +N VR+ ECFQHKNH CLVFE+LEQNLY++LK NKF P+ L  IRPI QQV TAL KLK L LIHADLKPENIMLV+P      YRVKVIDFGSA   SKAV +TYLQSRYYRAPEI+LGLPF EAIDMWSLGCV+AELFLGWPLYPG+SEYDQIRYI +TQG+P   +L    K +RFF++D       WRLK  D++  ETG ++KE RKY+F  LD +  V+   +    D   E  DR+++  LL +ML +  ++RITP   LNH  + M HL     +  V+  F  M++C R +         +S  +TH+   +++N+   FN
Sbjct:  175 SSNGEGDYQLVQHEILCSMTNSYEVLEFLGRGTFGQVAKCWKRSTKEIVAIKILKNHPSYARQGQIEVSILSRLSSENADEYNFVRSYECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKYIRPILQQVATALMKLKSLGLIHADLKPENIMLVDPVR--QPYRVKVIDFGSASHVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTSRFFNRDPDLGYPLWRLKAPDEHEMETGIKSKEARKYIFNCLDDMAQVNMSTDLEGTDMLAEKADRREYIDLLKKMLTIDADKRITPLKTLNHPFVTMTHLLDFPHSNHVKSCFQNMEICKRRSNMYDTVNQIKSPFTTHVAPNTSTNLTMSFN 583          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Mouse
Match: Hipk2 (homeodomain interacting protein kinase 2 [Source:MGI Symbol;Acc:MGI:1314872])

HSP 1 Score: 464.537 bits (1194), Expect = 1.198e-140
Identity = 231/408 (56.62%), Postives = 282/408 (69.12%), Query Frame = 3
Query:  582 ADGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDSCFE---WRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNRS-------NGRSNP-STHIIDASNSNIISKFN 1772
            ++GDYQ+V  E L SM+  YEVL FLGRGTFGQVVKC  R  N +VAIKILKNHPSY RQG +E+ IL  LS E  + +N VRA ECFQHKNH CLVFE+LEQNLY++LK NKF P+ L  IRP+ QQV TAL KLK L LIHADLKPENIMLV+P+     YRVKVIDFGSA   SKAV +TYLQSRYYRAPEI+LGLPF EAIDMWSLGCV+AELFLGWPLYPG+SEYDQIRYI +TQG+P   +L    K  RFF++D+      WRLK  DD+  ETG ++KE RKY+F  LD +  V+   +    D  VE  DR++F  LL +ML +  ++R+TP   LNH  + M HL     +  V+  F  M++C R        N    P  TH+  ++++N+   FN
Sbjct:  173 SEGDYQLVQHEVLCSMTNTYEVLEFLGRGTFGQVVKCWKRGTNEIVAIKILKNHPSYARQGQIEVSILARLSTESADDYNFVRAYECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKYIRPVLQQVATALMKLKSLGLIHADLKPENIMLVDPSR--QPYRVKVIDFGSASHVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTRFFNRDTDSPYPLWRLKTPDDHEAETGIKSKEARKYIFNCLDDMAQVNMTTDLEGSDMLVEKADRREFIDLLKKMLTIDADKRVTPIETLNHPFVTMTHLLDFPHSAHVKSCFQNMEICKRRVNMYDTVNQSKTPFITHVAPSTSTNLTMTFN 578          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Mouse
Match: Hipk2 (homeodomain interacting protein kinase 2 [Source:MGI Symbol;Acc:MGI:1314872])

HSP 1 Score: 464.537 bits (1194), Expect = 1.366e-140
Identity = 231/408 (56.62%), Postives = 282/408 (69.12%), Query Frame = 3
Query:  582 ADGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDSCFE---WRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNRS-------NGRSNP-STHIIDASNSNIISKFN 1772
            ++GDYQ+V  E L SM+  YEVL FLGRGTFGQVVKC  R  N +VAIKILKNHPSY RQG +E+ IL  LS E  + +N VRA ECFQHKNH CLVFE+LEQNLY++LK NKF P+ L  IRP+ QQV TAL KLK L LIHADLKPENIMLV+P+     YRVKVIDFGSA   SKAV +TYLQSRYYRAPEI+LGLPF EAIDMWSLGCV+AELFLGWPLYPG+SEYDQIRYI +TQG+P   +L    K  RFF++D+      WRLK  DD+  ETG ++KE RKY+F  LD +  V+   +    D  VE  DR++F  LL +ML +  ++R+TP   LNH  + M HL     +  V+  F  M++C R        N    P  TH+  ++++N+   FN
Sbjct:  180 SEGDYQLVQHEVLCSMTNTYEVLEFLGRGTFGQVVKCWKRGTNEIVAIKILKNHPSYARQGQIEVSILARLSTESADDYNFVRAYECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKYIRPVLQQVATALMKLKSLGLIHADLKPENIMLVDPSR--QPYRVKVIDFGSASHVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTRFFNRDTDSPYPLWRLKTPDDHEAETGIKSKEARKYIFNCLDDMAQVNMTTDLEGSDMLVEKADRREFIDLLKKMLTIDADKRVTPIETLNHPFVTMTHLLDFPHSAHVKSCFQNMEICKRRVNMYDTVNQSKTPFITHVAPSTSTNLTMTFN 585          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Mouse
Match: Hipk2 (homeodomain interacting protein kinase 2 [Source:MGI Symbol;Acc:MGI:1314872])

HSP 1 Score: 464.537 bits (1194), Expect = 1.544e-140
Identity = 231/408 (56.62%), Postives = 282/408 (69.12%), Query Frame = 3
Query:  582 ADGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDSCFE---WRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNRS-------NGRSNP-STHIIDASNSNIISKFN 1772
            ++GDYQ+V  E L SM+  YEVL FLGRGTFGQVVKC  R  N +VAIKILKNHPSY RQG +E+ IL  LS E  + +N VRA ECFQHKNH CLVFE+LEQNLY++LK NKF P+ L  IRP+ QQV TAL KLK L LIHADLKPENIMLV+P+     YRVKVIDFGSA   SKAV +TYLQSRYYRAPEI+LGLPF EAIDMWSLGCV+AELFLGWPLYPG+SEYDQIRYI +TQG+P   +L    K  RFF++D+      WRLK  DD+  ETG ++KE RKY+F  LD +  V+   +    D  VE  DR++F  LL +ML +  ++R+TP   LNH  + M HL     +  V+  F  M++C R        N    P  TH+  ++++N+   FN
Sbjct:  180 SEGDYQLVQHEVLCSMTNTYEVLEFLGRGTFGQVVKCWKRGTNEIVAIKILKNHPSYARQGQIEVSILARLSTESADDYNFVRAYECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKYIRPVLQQVATALMKLKSLGLIHADLKPENIMLVDPSR--QPYRVKVIDFGSASHVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTRFFNRDTDSPYPLWRLKTPDDHEAETGIKSKEARKYIFNCLDDMAQVNMTTDLEGSDMLVEKADRREFIDLLKKMLTIDADKRVTPIETLNHPFVTMTHLLDFPHSAHVKSCFQNMEICKRRVNMYDTVNQSKTPFITHVAPSTSTNLTMTFN 585          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Mouse
Match: Hipk2 (homeodomain interacting protein kinase 2 [Source:MGI Symbol;Acc:MGI:1314872])

HSP 1 Score: 464.537 bits (1194), Expect = 3.033e-140
Identity = 231/408 (56.62%), Postives = 282/408 (69.12%), Query Frame = 3
Query:  582 ADGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDSCFE---WRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNRS-------NGRSNP-STHIIDASNSNIISKFN 1772
            ++GDYQ+V  E L SM+  YEVL FLGRGTFGQVVKC  R  N +VAIKILKNHPSY RQG +E+ IL  LS E  + +N VRA ECFQHKNH CLVFE+LEQNLY++LK NKF P+ L  IRP+ QQV TAL KLK L LIHADLKPENIMLV+P+     YRVKVIDFGSA   SKAV +TYLQSRYYRAPEI+LGLPF EAIDMWSLGCV+AELFLGWPLYPG+SEYDQIRYI +TQG+P   +L    K  RFF++D+      WRLK  DD+  ETG ++KE RKY+F  LD +  V+   +    D  VE  DR++F  LL +ML +  ++R+TP   LNH  + M HL     +  V+  F  M++C R        N    P  TH+  ++++N+   FN
Sbjct:  180 SEGDYQLVQHEVLCSMTNTYEVLEFLGRGTFGQVVKCWKRGTNEIVAIKILKNHPSYARQGQIEVSILARLSTESADDYNFVRAYECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKYIRPVLQQVATALMKLKSLGLIHADLKPENIMLVDPSR--QPYRVKVIDFGSASHVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTRFFNRDTDSPYPLWRLKTPDDHEAETGIKSKEARKYIFNCLDDMAQVNMTTDLEGSDMLVEKADRREFIDLLKKMLTIDADKRVTPIETLNHPFVTMTHLLDFPHSAHVKSCFQNMEICKRRVNMYDTVNQSKTPFITHVAPSTSTNLTMTFN 585          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Mouse
Match: Hipk1 (homeodomain interacting protein kinase 1 [Source:MGI Symbol;Acc:MGI:1314873])

HSP 1 Score: 449.514 bits (1155), Expect = 6.416e-140
Identity = 225/408 (55.15%), Postives = 280/408 (68.63%), Query Frame = 3
Query:  582 ADGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDSCFE---WRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNR--------SNGRSNPSTHIIDASNSNIISKFN 1772
             +GDYQ+V  E L SM+  YEVL FLGRGTFGQV KC  R+   +VAIKILKNHPSY RQG +E+ IL  LS E+ + +N VR+ ECFQHKNH CLVFE+LEQNLY++LK NKF P+ L  IRPI QQV TAL KLK L LIHADLKPENIMLV+P      YRVKVIDFGSA   SKAV +TYLQSRYYRAPEI+LGLPF EAIDMWSLGCV+AELFLGWPLYPG+SEYDQIRYI +TQG+P   +L    K  RFF++D       WRLK  +++  ETG ++KE RKY+F  LD +  V+   +    D   E  DR+++  LL +ML +  ++RITP   LNH  + M+HL     +  V+  F  M++C R        S  +S  +TH+   +++N+   F+
Sbjct:  171 GEGDYQLVQHEILCSMTNSYEVLEFLGRGTFGQVAKCWKRSTKEIVAIKILKNHPSYARQGQIEVSILSRLSSENADEYNFVRSYECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKYIRPILQQVATALMKLKSLGLIHADLKPENIMLVDPVR--QPYRVKVIDFGSASHVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTRFFNRDPNLGYPLWRLKTPEEHELETGIKSKEARKYIFNCLDDMAQVNMSTDLEGTDMLAEKADRREYIDLLKKMLTIDADKRITPLKTLNHQFVTMSHLLDFPHSSHVKSCFQNMEICKRRVHMYDTVSQIKSPFTTHVAPNTSTNLTMSFS 576          
BLAST of Homeodomain interacting protein kinase vs. UniProt/SwissProt
Match: sp|Q9WUM7|HIPK2_MESAU (Homeodomain-interacting protein kinase 2 OS=Mesocricetus auratus OX=10036 GN=Hipk2 PE=1 SV=2)

HSP 1 Score: 467.233 bits (1201), Expect = 1.335e-140
Identity = 240/449 (53.45%), Postives = 297/449 (66.15%), Query Frame = 3
Query:  582 ADGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDSCFE---WRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNRS-------NGRSNP-STHIIDASNSNIISKFNGANSSLLPFDQAGASHL---------LSNPVELITSNPDPY 1868
            ++GDYQ+V  E L SM+  YEVL FLGRGTFGQVVKC  R  N +VAIKILKNHPSY RQG +E+ IL  LS E  + +N VRA ECFQHKNH CLVFE+LEQNLY++LK NKF P+ L  IRP+ QQV TAL KLK L LIHADLKPENIMLV+P+     YRVKVIDFGSA   SKAV +TYLQSRYYRAPEI+LGLPF EAIDMWSLGCV+AELFLGWPLYPG+SEYDQIRYI +TQG+P   +L    K  RFF++D+      WRLK  DD+  ETG ++KE RKY+F  LD +  VS   +    D  VE  DR++F  LL +ML +  ++RITP   LNH  + M HL     +  V+  F  M++C R        N    P  TH+  ++++N+   FN   +++   +Q  A+ +         L      I + PDP+
Sbjct:  180 SEGDYQLVQHEVLCSMTNTYEVLEFLGRGTFGQVVKCWKRGTNEIVAIKILKNHPSYARQGQIEVSILARLSTESADDYNFVRAYECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKYIRPVLQQVATALMKLKSLGLIHADLKPENIMLVDPSR--QPYRVKVIDFGSASHVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTRFFNRDTDSPYPLWRLKTPDDHEAETGIKSKEARKYIFNCLDDMAQVSMTTDLEGSDMLVEKADRREFIDLLKKMLTIDADKRITPIETLNHPFVTMTHLLDFPHSTHVKSCFQNMEICKRRVNMYDTVNQSKTPFITHVAPSTSTNLTMTFNNQLTTV--HNQPSAASMAAVAQRSMPLQTGTAQICARPDPF 624          
BLAST of Homeodomain interacting protein kinase vs. UniProt/SwissProt
Match: sp|Q9H2X6|HIPK2_HUMAN (Homeodomain-interacting protein kinase 2 OS=Homo sapiens OX=9606 GN=HIPK2 PE=1 SV=2)

HSP 1 Score: 466.077 bits (1198), Expect = 6.156e-140
Identity = 232/408 (56.86%), Postives = 282/408 (69.12%), Query Frame = 3
Query:  582 ADGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDSCFE---WRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNRS-------NGRSNP-STHIIDASNSNIISKFN 1772
            ++GDYQ+V  E L SM+  YEVL FLGRGTFGQVVKC  R  N +VAIKILKNHPSY RQG +E+ IL  LS E  + +N VRA ECFQHKNH CLVFE+LEQNLY++LK NKF P+ L  IRP+ QQV TAL KLK L LIHADLKPENIMLV+P+     YRVKVIDFGSA   SKAV +TYLQSRYYRAPEI+LGLPF EAIDMWSLGCV+AELFLGWPLYPG+SEYDQIRYI +TQG+P   +L    K  RFF++D+      WRLK  DD+  ETG ++KE RKY+F  LD +  V+   +    D  VE  DR++F  LL +ML +  ++RITP   LNH  + M HL     +  V+  F  M++C R        N    P  TH+  ++++N+   FN
Sbjct:  180 SEGDYQLVQHEVLCSMTNTYEVLEFLGRGTFGQVVKCWKRGTNEIVAIKILKNHPSYARQGQIEVSILARLSTESADDYNFVRAYECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKYIRPVLQQVATALMKLKSLGLIHADLKPENIMLVDPSR--QPYRVKVIDFGSASHVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTRFFNRDTDSPYPLWRLKTPDDHEAETGIKSKEARKYIFNCLDDMAQVNMTTDLEGSDMLVEKADRREFIDLLKKMLTIDADKRITPIETLNHPFVTMTHLLDFPHSTHVKSCFQNMEICKRRVNMYDTVNQSKTPFITHVAPSTSTNLTMTFN 585          
BLAST of Homeodomain interacting protein kinase vs. UniProt/SwissProt
Match: sp|Q9QZR5|HIPK2_MOUSE (Homeodomain-interacting protein kinase 2 OS=Mus musculus OX=10090 GN=Hipk2 PE=1 SV=2)

HSP 1 Score: 464.537 bits (1194), Expect = 2.122e-139
Identity = 231/408 (56.62%), Postives = 282/408 (69.12%), Query Frame = 3
Query:  582 ADGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDSCFE---WRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNRS-------NGRSNP-STHIIDASNSNIISKFN 1772
            ++GDYQ+V  E L SM+  YEVL FLGRGTFGQVVKC  R  N +VAIKILKNHPSY RQG +E+ IL  LS E  + +N VRA ECFQHKNH CLVFE+LEQNLY++LK NKF P+ L  IRP+ QQV TAL KLK L LIHADLKPENIMLV+P+     YRVKVIDFGSA   SKAV +TYLQSRYYRAPEI+LGLPF EAIDMWSLGCV+AELFLGWPLYPG+SEYDQIRYI +TQG+P   +L    K  RFF++D+      WRLK  DD+  ETG ++KE RKY+F  LD +  V+   +    D  VE  DR++F  LL +ML +  ++R+TP   LNH  + M HL     +  V+  F  M++C R        N    P  TH+  ++++N+   FN
Sbjct:  180 SEGDYQLVQHEVLCSMTNTYEVLEFLGRGTFGQVVKCWKRGTNEIVAIKILKNHPSYARQGQIEVSILARLSTESADDYNFVRAYECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKYIRPVLQQVATALMKLKSLGLIHADLKPENIMLVDPSR--QPYRVKVIDFGSASHVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTRFFNRDTDSPYPLWRLKTPDDHEAETGIKSKEARKYIFNCLDDMAQVNMTTDLEGSDMLVEKADRREFIDLLKKMLTIDADKRVTPIETLNHPFVTMTHLLDFPHSAHVKSCFQNMEICKRRVNMYDTVNQSKTPFITHVAPSTSTNLTMTFN 585          
BLAST of Homeodomain interacting protein kinase vs. UniProt/SwissProt
Match: sp|A4L9P5|HIPK1_RAT (Homeodomain-interacting protein kinase 1 OS=Rattus norvegicus OX=10116 GN=Hipk1 PE=2 SV=1)

HSP 1 Score: 453.751 bits (1166), Expect = 2.187e-135
Identity = 224/408 (54.90%), Postives = 280/408 (68.63%), Query Frame = 3
Query:  582 ADGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDSCFE---WRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNR--------SNGRSNPSTHIIDASNSNIISKFN 1772
             +GDYQ+V  E L SM+  YEVL FLGRGTFGQV KC  R+   +VAIKILKNHPSY RQG +E+ IL  LS E+ + +N VR+ ECFQHKNH CLVFE+LEQNLY++LK NKF P+ L  IRPI QQV TAL KLK L LIHADLKPENIMLV+P      YRVKVIDFGSA   SKAV +TYLQSRYYRAPEI+LGLPF EAIDMWSLGCV+AELFLGWPLYPG+SEYDQIRYI +TQG+P   +L    K  RFF++D       WRLK  +++  ETG ++KE RKY+F  LD +  V+   +    D   E  DR+++  LL +ML +  ++R+TP   LNH  + M HL     +  V+  F  M++C R        S  +S  +TH+  ++++N+   F+
Sbjct:  171 GEGDYQLVQHEILCSMTNSYEVLEFLGRGTFGQVAKCWKRSTKEIVAIKILKNHPSYARQGQIEVSILSRLSSENADEYNFVRSYECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKYIRPILQQVATALMKLKSLGLIHADLKPENIMLVDPVR--QPYRVKVIDFGSASHVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTRFFNRDPNLGYPLWRLKTPEEHELETGIKSKEARKYIFNCLDDMAQVNMSTDLEGTDMLAEKADRREYIDLLKKMLTIDADKRVTPLKTLNHQFVTMTHLLDFPHSNHVKSCFQNMEICKRRVHMYDTVSQIKSPFTTHVAPSTSTNLTMSFS 576          
BLAST of Homeodomain interacting protein kinase vs. UniProt/SwissProt
Match: sp|O88904|HIPK1_MOUSE (Homeodomain-interacting protein kinase 1 OS=Mus musculus OX=10090 GN=Hipk1 PE=1 SV=2)

HSP 1 Score: 452.595 bits (1163), Expect = 5.551e-135
Identity = 225/408 (55.15%), Postives = 280/408 (68.63%), Query Frame = 3
Query:  582 ADGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDSCFE---WRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNR--------SNGRSNPSTHIIDASNSNIISKFN 1772
             +GDYQ+V  E L SM+  YEVL FLGRGTFGQV KC  R+   +VAIKILKNHPSY RQG +E+ IL  LS E+ + +N VR+ ECFQHKNH CLVFE+LEQNLY++LK NKF P+ L  IRPI QQV TAL KLK L LIHADLKPENIMLV+P      YRVKVIDFGSA   SKAV +TYLQSRYYRAPEI+LGLPF EAIDMWSLGCV+AELFLGWPLYPG+SEYDQIRYI +TQG+P   +L    K  RFF++D       WRLK  +++  ETG ++KE RKY+F  LD +  V+   +    D   E  DR+++  LL +ML +  ++RITP   LNH  + M+HL     +  V+  F  M++C R        S  +S  +TH+   +++N+   F+
Sbjct:  171 GEGDYQLVQHEILCSMTNSYEVLEFLGRGTFGQVAKCWKRSTKEIVAIKILKNHPSYARQGQIEVSILSRLSSENADEYNFVRSYECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKYIRPILQQVATALMKLKSLGLIHADLKPENIMLVDPVR--QPYRVKVIDFGSASHVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTRFFNRDPNLGYPLWRLKTPEEHELETGIKSKEARKYIFNCLDDMAQVNMSTDLEGTDMLAEKADRREYIDLLKKMLTIDADKRITPLKTLNHQFVTMSHLLDFPHSSHVKSCFQNMEICKRRVHMYDTVSQIKSPFTTHVAPNTSTNLTMSFS 576          
BLAST of Homeodomain interacting protein kinase vs. TrEMBL
Match: A0A0X3P4S1 (Homeodomain-interacting protein kinase 2 OS=Schistocephalus solidus OX=70667 GN=HIPK2 PE=4 SV=1)

HSP 1 Score: 613.224 bits (1580), Expect = 0.000e+0
Identity = 284/382 (74.35%), Postives = 321/382 (84.03%), Query Frame = 3
Query:  570 RSATADGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDS-CFEWRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNRSNGR 1712
            R    DGDY IVVGE L+SMS+ YEV +F+GRGTFGQVVKC CR++NR VAIKILKNHPSYLRQGNVEIQILQTLSQ+DTESHNIVRAIECFQHKNHMC+VFELLEQNLYE+LKSNKFRP+ L EIRPIAQQVLTALSKLK L LIHADLKPENIMLV P++G MRYRVKVIDFGSAC +SKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCV+AELFLGWPLYPGSSEYDQIRYI+ETQG+P  DML++AGK +RFF +D    EWR K Q++Y  ETGQ+ KE RKY+F+ LDQIR VS   +  DPD ++E+EDR  FA LL QML+MRP +RI PD AL+H  I M +L    F KR  +S +LMQVC+ +  R
Sbjct:  217 RPTGGDGDYTIVVGEVLHSMSEGYEVTSFMGRGTFGQVVKCLCRSSNRSVAIKILKNHPSYLRQGNVEIQILQTLSQQDTESHNIVRAIECFQHKNHMCIVFELLEQNLYEFLKSNKFRPLALREIRPIAQQVLTALSKLKTLGLIHADLKPENIMLVRPSDGIMRYRVKVIDFGSACYSSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVIAELFLGWPLYPGSSEYDQIRYIVETQGLPSRDMLRNAGKGSRFFVRDPYTLEWRFKTQEEYALETGQQAKEARKYIFSSLDQIREVSLTNKSLDPDADIELEDRFHFAQLLSQMLKMRPSDRILPDTALSHSFITMTYLHAYAFRKRTHESVALMQVCHEAGRR 598          
BLAST of Homeodomain interacting protein kinase vs. TrEMBL
Match: A0A5K3EJI1 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 603.594 bits (1555), Expect = 0.000e+0
Identity = 285/392 (72.70%), Postives = 324/392 (82.65%), Query Frame = 3
Query:  570 RSATADGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDS-CFEWRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVS----------PRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNRSNGR 1712
            R+  ++GDY IVVGE L SMS+ YEVL+FLGRGTFGQVVKC+CR +NR+VAIKILKNHPSYLRQGNVEIQILQTLSQ+DTES+NIVRAIECFQH+NHMCLVFELLEQNLYE+LKSNKFRP+ L EIRPIAQQVLTALSKLK L LIHADLKPENIMLV P +G MRYRVKVIDFGSAC +SKA+QNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCV+AELFLGWPLYPGSSEYDQIRYI+ETQGMPP D+LK AGK +RFF +D+  +EWRLK Q++Y  ETGQ  KE RKY+F+ LDQIR VS              P D D ++E+EDR  FA LL QML++RP ERI PD AL H  I M +L+   F KR  +S +LM+VC+ +  R
Sbjct:  218 RAVGSEGDYNIVVGEVLRSMSESYEVLSFLGRGTFGQVVKCQCRTSNRVVAIKILKNHPSYLRQGNVEIQILQTLSQQDTESYNIVRAIECFQHRNHMCLVFELLEQNLYEFLKSNKFRPLALREIRPIAQQVLTALSKLKTLGLIHADLKPENIMLVCPTDGVMRYRVKVIDFGSACHSSKAIQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVVAELFLGWPLYPGSSEYDQIRYIVETQGMPPRDLLKMAGKGSRFFVRDTYTYEWRLKTQEEYALETGQHAKEARKYIFSSLDQIREVSLTTSGGKVVGGSSSPEDFDADIEMEDRFHFAQLLAQMLKLRPSERILPDNALAHSFITMTYLQAYPFRKRTHESVALMRVCSEACRR 609          
BLAST of Homeodomain interacting protein kinase vs. TrEMBL
Match: A0A5J4P247 (Homeodomain interacting protein kinase OS=Paragonimus westermani OX=34504 GN=DEA37_0001638 PE=4 SV=1)

HSP 1 Score: 602.053 bits (1551), Expect = 0.000e+0
Identity = 286/383 (74.67%), Postives = 318/383 (83.03%), Query Frame = 3
Query:  570 RSATADGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKD--SCFEWRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNRSNGR 1712
            +SA   GDY IVVGE L S ++ YEVLAFLGRGTFGQVVKCRC ++ R VAIKILKN PSYLRQGNVEIQILQTLSQ+DTESHNIVRAIECFQHKNHMC VFELLEQNLYEYLKSNKFRP++LPEIRPIAQQVLTALSKLK L LIHADLKPENIMLV+   GA+R+RVKVIDFGSAC +SKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCV+AELFLGWPLYPGSSEYDQ+RYI+ETQG+PPSD+L+ AGK   FF +D   C EWRLK Q++Y  ETGQ+ KE RKY FT LDQI  VS  P   DPDYE + +DR+QFA LL  ML+MRP ER+ PD AL+H  I M HL+   F+KR  +S +LMQVC     R
Sbjct:   40 KSAITQGDYAIVVGEVLRSSNESYEVLAFLGRGTFGQVVKCRCSSSKRCVAIKILKNLPSYLRQGNVEIQILQTLSQQDTESHNIVRAIECFQHKNHMCFVFELLEQNLYEYLKSNKFRPLSLPEIRPIAQQVLTALSKLKSLGLIHADLKPENIMLVSTTAGALRFRVKVIDFGSACHSSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVLAELFLGWPLYPGSSEYDQMRYIVETQGLPPSDLLQSAGKCGTFFIRDIYQC-EWRLKTQEEYALETGQQAKEARKYFFTSLDQICEVSGLPSCDDPDYEFDRDDRQQFASLLALMLKMRPCERVVPDSALSHRFITMIHLQAHPFSKRFNESVTLMQVCREYTRR 421          
BLAST of Homeodomain interacting protein kinase vs. TrEMBL
Match: A0A3R7G493 (Homeodomain-interacting protein kinase 1 OS=Clonorchis sinensis OX=79923 GN=Hipk1 PE=4 SV=1)

HSP 1 Score: 600.127 bits (1546), Expect = 0.000e+0
Identity = 284/383 (74.15%), Postives = 316/383 (82.51%), Query Frame = 3
Query:  570 RSATADGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDS--CFEWRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNRSNGR 1712
            + ATA GDY IVVGE L S ++ YEVLAFLGRGTFGQVVKCRC +  R VAIKILKN PSYLRQGNVEIQILQTLSQ+DTESHNIVRAIECFQHKNHMC VFELLEQNLYEYLKSNKFRP++L EIRPI QQVLTALSKLK L LIHADLKPENIMLV+   G MRYRVKVIDFGSAC +SKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCV+AELFLGWPLYPGSSEYDQ+RYI+ETQG PP D+L++AGK + FF +D   C +WRLK Q++Y  ETGQ+ KE RKY FT L QI  V   P P DPD E++IEDR+QFA LL  ML+MRP ER+ PD AL H  I M HL+   F+KR  +S +LMQVC+ +  R
Sbjct:  180 KPATAQGDYAIVVGEMLRSSNESYEVLAFLGRGTFGQVVKCRCSSTKRCVAIKILKNLPSYLRQGNVEIQILQTLSQQDTESHNIVRAIECFQHKNHMCFVFELLEQNLYEYLKSNKFRPLSLLEIRPITQQVLTALSKLKSLGLIHADLKPENIMLVSSTTGIMRYRVKVIDFGSACHSSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVIAELFLGWPLYPGSSEYDQMRYIVETQGPPPPDLLQNAGKCSTFFIRDPYHC-DWRLKTQEEYTLETGQQAKEARKYFFTSLSQICEVPGVPSPSDPDRELDIEDRQQFASLLSLMLKMRPSERVVPDSALLHPFITMLHLQAYPFSKRFHESLTLMQVCHEATRR 561          
BLAST of Homeodomain interacting protein kinase vs. TrEMBL
Match: A0A4S2L6D9 (Protein kinase domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009608 PE=4 SV=1)

HSP 1 Score: 599.356 bits (1544), Expect = 0.000e+0
Identity = 284/383 (74.15%), Postives = 316/383 (82.51%), Query Frame = 3
Query:  570 RSATADGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDS--CFEWRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNRSNGR 1712
            + ATA GDY IVVGE L S ++ YEVLAFLGRGTFGQVVKCRC +  R VAIKILKN PSYLRQGNVEIQILQTLSQ+DTESHNIVRAIECFQHKNHMC VFELLEQNLYEYLKSNKFRP++L EIRPI QQVLTALSKLK L LIHADLKPENIMLV+   G MRYRVKVIDFGSAC +SKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCV+AELFLGWPLYPGSSEYDQ+RYI+ETQG PP D+L++AGK + FF +D   C +WRLK Q++Y  ETGQ+ KE RKY FT L QI  V   P P DPD E++IEDR+QFA LL  ML+MRP ER+ PD AL H  I M HL+   F+KR  +S +LMQVC+ +  R
Sbjct:  180 KPATAQGDYAIVVGEMLRSSNESYEVLAFLGRGTFGQVVKCRCSSTKRCVAIKILKNLPSYLRQGNVEIQILQTLSQQDTESHNIVRAIECFQHKNHMCFVFELLEQNLYEYLKSNKFRPLSLLEIRPITQQVLTALSKLKSLGLIHADLKPENIMLVSSTTGIMRYRVKVIDFGSACHSSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVIAELFLGWPLYPGSSEYDQMRYIVETQGPPPPDLLQNAGKCSTFFIRDPYHC-DWRLKTQEEYTLETGQQAKEARKYFFTSLSQICEVPGVPSPSDPDRELDIEDRQQFASLLSLMLKMRPSERVVPDSALLHPFITMLHLQAYPFSKRFHESLTLMQVCHEATRR 561          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Cavefish
Match: hipk2 (homeodomain interacting protein kinase 2 [Source:NCBI gene;Acc:103040439])

HSP 1 Score: 461.07 bits (1185), Expect = 1.151e-138
Identity = 231/410 (56.34%), Postives = 283/410 (69.02%), Query Frame = 3
Query:  576 ATADGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSK--DSCFE-WRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNRS-------NGRSNP-STHIIDASNSNIISKFN 1772
            A ++GDYQ++  E L SM+  YEVL FLGRGTFGQVVKC  R  + +VAIKILKNHPSY RQG +E+ IL  LS E  + +N VRA ECFQHKNH CLVFE+LEQNLY++LK NKF P+ L  IRP+ QQV TAL KLK L LIHADLKPENIMLV+PA     YRVKVIDFGSA   SKAV +TYLQSRYYRAPEI+LGLPF EAIDMWSLGCV+AELFLGWPLYPG+SEYDQIRYI +TQG+P   +L    K  RFF++  DS +  WRLK  +D+  ETG ++KE RKY+F  LD +  V+   +    D   E  DR++F  LL +ML +  ++RITP   LNH  + M HL     +  V+  F  M++C R        N    P  TH+  ++++N+   FN
Sbjct:  209 ANSEGDYQLLQHEVLCSMTNTYEVLEFLGRGTFGQVVKCWKRGTSEIVAIKILKNHPSYARQGQIEVSILARLSTESADDYNFVRAYECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKYIRPVLQQVATALMKLKSLGLIHADLKPENIMLVDPAR--QPYRVKVIDFGSASHVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTRFFNRDPDSTYPLWRLKTPEDHEGETGIKSKEARKYIFNCLDDMAQVNVTTDLEGSDMLAEKADRREFIDLLTKMLTIDADKRITPIETLNHPFVTMAHLLDFPHSTHVKSCFQNMEICKRRVNMYDTVNQSKTPFITHVAPSTSTNLTMTFN 616          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Cavefish
Match: hipk1a (homeodomain-interacting protein kinase 1-like [Source:NCBI gene;Acc:103023558])

HSP 1 Score: 436.802 bits (1122), Expect = 3.376e-131
Identity = 217/375 (57.87%), Postives = 263/375 (70.13%), Query Frame = 3
Query:  585 DGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSK--DSCFE-WRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNR 1700
            +GDYQ+V  E L S+S  YEVL FLGRGTFGQV KC  R  N +VAIKILKNHPSY RQG +E+ IL  LS E+ +  N VR+ ECFQHKNH CLVFE+LEQNLY++LK +KF P+ L  IRP+ QQV TAL KLK L LIHADLKPENIMLV+P      YRVKVIDFGSA   SKAV +TYLQSRYYRAPEI+LGLPF EAIDMWSLGCV+AELFLGWPLYPG+SEYDQIRYI +TQG+P   +L    K +RFF +  D+ +  WRL+   ++  E G ++KE RKY+F  LD +  V+        D   E  DR++F  LL +ML +  ++RITP   LNH  + M HL     +  V+  F  M++C R
Sbjct:  185 EGDYQLVQHEILCSVSNSYEVLEFLGRGTFGQVAKCWKRGTNEIVAIKILKNHPSYARQGQIEVSILSRLSTENADEFNFVRSYECFQHKNHTCLVFEMLEQNLYDFLKHSKFSPLMLKCIRPVLQQVATALLKLKSLGLIHADLKPENIMLVDPIR--QPYRVKVIDFGSASHVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTSRFFHRGPDASYPLWRLRTPAEHEAELGIKSKEARKYIFNCLDDMMQVN-MTNLEGTDILAEKADRREFIDLLKKMLTLDADKRITPMKTLNHPFVTMTHLLHFPHSAHVKSCFQNMEICKR 556          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Cavefish
Match: hipk1a (homeodomain-interacting protein kinase 1-like [Source:NCBI gene;Acc:103023558])

HSP 1 Score: 437.187 bits (1123), Expect = 7.445e-131
Identity = 217/375 (57.87%), Postives = 263/375 (70.13%), Query Frame = 3
Query:  585 DGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSK--DSCFE-WRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNR 1700
            +GDYQ+V  E L S+S  YEVL FLGRGTFGQV KC  R  N +VAIKILKNHPSY RQG +E+ IL  LS E+ +  N VR+ ECFQHKNH CLVFE+LEQNLY++LK +KF P+ L  IRP+ QQV TAL KLK L LIHADLKPENIMLV+P      YRVKVIDFGSA   SKAV +TYLQSRYYRAPEI+LGLPF EAIDMWSLGCV+AELFLGWPLYPG+SEYDQIRYI +TQG+P   +L    K +RFF +  D+ +  WRL+   ++  E G ++KE RKY+F  LD +  V+        D   E  DR++F  LL +ML +  ++RITP   LNH  + M HL     +  V+  F  M++C R
Sbjct:  185 EGDYQLVQHEILCSVSNSYEVLEFLGRGTFGQVAKCWKRGTNEIVAIKILKNHPSYARQGQIEVSILSRLSTENADEFNFVRSYECFQHKNHTCLVFEMLEQNLYDFLKHSKFSPLMLKCIRPVLQQVATALLKLKSLGLIHADLKPENIMLVDPIR--QPYRVKVIDFGSASHVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTSRFFHRGPDASYPLWRLRTPAEHEAELGIKSKEARKYIFNCLDDMMQVN-MTNLEGTDILAEKADRREFIDLLKKMLTLDADKRITPMKTLNHPFVTMTHLLHFPHSAHVKSCFQNMEICKR 556          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Cavefish
Match: hipk1a (homeodomain-interacting protein kinase 1-like [Source:NCBI gene;Acc:103023558])

HSP 1 Score: 437.187 bits (1123), Expect = 7.541e-131
Identity = 217/375 (57.87%), Postives = 263/375 (70.13%), Query Frame = 3
Query:  585 DGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSK--DSCFE-WRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNR 1700
            +GDYQ+V  E L S+S  YEVL FLGRGTFGQV KC  R  N +VAIKILKNHPSY RQG +E+ IL  LS E+ +  N VR+ ECFQHKNH CLVFE+LEQNLY++LK +KF P+ L  IRP+ QQV TAL KLK L LIHADLKPENIMLV+P      YRVKVIDFGSA   SKAV +TYLQSRYYRAPEI+LGLPF EAIDMWSLGCV+AELFLGWPLYPG+SEYDQIRYI +TQG+P   +L    K +RFF +  D+ +  WRL+   ++  E G ++KE RKY+F  LD +  V+        D   E  DR++F  LL +ML +  ++RITP   LNH  + M HL     +  V+  F  M++C R
Sbjct:  185 EGDYQLVQHEILCSVSNSYEVLEFLGRGTFGQVAKCWKRGTNEIVAIKILKNHPSYARQGQIEVSILSRLSTENADEFNFVRSYECFQHKNHTCLVFEMLEQNLYDFLKHSKFSPLMLKCIRPVLQQVATALLKLKSLGLIHADLKPENIMLVDPIR--QPYRVKVIDFGSASHVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTSRFFHRGPDASYPLWRLRTPAEHEAELGIKSKEARKYIFNCLDDMMQVN-MTNLEGTDILAEKADRREFIDLLKKMLTLDADKRITPMKTLNHPFVTMTHLLHFPHSAHVKSCFQNMEICKR 556          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Cavefish
Match: hipk3a (homeodomain-interacting protein kinase 3 [Source:NCBI gene;Acc:103046977])

HSP 1 Score: 436.417 bits (1121), Expect = 4.172e-130
Identity = 222/372 (59.68%), Postives = 264/372 (70.97%), Query Frame = 3
Query:  591 DYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDS---CFEWRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCN 1697
            DYQ+V  E L S+   YEVL FLGRGTFGQVVKC  R  N +VA+KILKNHPSY RQG +E+ IL  LS E+ E HN+VRA ECFQH+NH CLVFE+LEQNLY++LK NKF P+ L  IRP+ QQV TAL KLK L LIHADLKPENIMLV+P      YRVKVIDFGSA   SKAV +TYLQSRYYRAPEI+LGLPF EAIDMWSLGCV+AELFLGWPLYPG+ EYDQIRYI +TQG+P   +L    K +RFF K+S      WRLK  +++  ETG ++KE RKY+F+ LD I +V+        D   E  DR++F  LL  ML +  E+RI P  ALNH  + M HL     +  V+  F +M VC+
Sbjct:  190 DYQLVQHEVLYSIKHTYEVLEFLGRGTFGQVVKCWKRGTNEIVAVKILKNHPSYARQGQIEVGILSRLSGENAEEHNLVRAFECFQHRNHTCLVFEMLEQNLYDFLKQNKFSPLPLKIIRPVLQQVATALKKLKSLGLIHADLKPENIMLVDPVR--QPYRVKVIDFGSASHVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGALEYDQIRYISQTQGLPGEQLLNVGTKTSRFFRKESDSPYAAWRLKTTEEHETETGMKSKEARKYIFSCLDDIGHVNLVLNMEGCDQLAEKADRREFVDLLKMMLLIDAEQRIAPLDALNHPFVTMQHLLDFPHSNHVQSCFHIMDVCH 559          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Sea Lamprey
Match: hipk2 (homeodomain interacting protein kinase 2 [Source:ZFIN;Acc:ZDB-GENE-031125-4])

HSP 1 Score: 440.654 bits (1132), Expect = 4.657e-133
Identity = 216/373 (57.91%), Postives = 261/373 (69.97%), Query Frame = 3
Query:  591 DYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDSCFE---WRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNR 1700
            DY +V  E L SM+  YEVL FLGRGTFGQVVKC  R  + +VAIKILKNHPSY RQG VE+ IL  LS E  + +N VRA ECFQHK+H CLVFE+LEQNLY++LK N F P+ L  IRP+ QQV +AL KLK L LIHADLKPENIMLV+P      YRVKVIDFGSA   SKAV +TYLQSRYYRAPEI+LGLPF EAIDMWSLGCV+AELFLGWPLYPG+SEYDQIRYI  TQG+PP  +L    K  RFF +++      WR+K+ +++  ETG ++KE RKY+F  L+ +  V+P  +    D   E  DR+QF  LL +ML M  ++RI+P   L H  + M HL        ++  F  M+VC R
Sbjct:  176 DYTLVQHEVLRSMTNSYEVLEFLGRGTFGQVVKCWKRGTSEIVAIKILKNHPSYARQGQVEVGILARLSSESADDYNFVRAHECFQHKSHTCLVFEMLEQNLYDFLKQNNFSPLPLKYIRPVLQQVASALMKLKSLGLIHADLKPENIMLVDPVR--QPYRVKVIDFGSASHVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISATQGLPPEQLLSAGTKTGRFFQRETGAGYPLWRIKSPEEHEAETGIKSKEARKYMFNCLEDMGQVNPASDLEGSDVLAEKADRRQFIELLRRMLTMDADKRISPLETLAHPFVTMTHLVDFPRTNHIKSCFQNMEVCKR 546          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Sea Lamprey
Match: dyrk1aa (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A, a [Source:ZFIN;Acc:ZDB-GENE-050302-29])

HSP 1 Score: 247.284 bits (630), Expect = 8.302e-69
Identity = 136/334 (40.72%), Postives = 201/334 (60.18%), Query Frame = 3
Query:  639 YEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTE-SHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLK--QLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDSCFEWRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDP------DYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNH 1613
            YE+ + +G+G+FGQVVK         VAIKI+KN  ++L Q  +E+++L+ +++ DT+  + IV     F  +NH+CLVFELL  NLY+ L++  FR ++L   R  AQQ+ TAL  L   +L +IH DLKPENI+L NP   A    +K++DFGS+C   + +   Y+QSR+YR+PE+LLG+P++ AIDMWSLGC++ E+  G PL+ GS+E DQ+  I+E  G+PP+ ML+ A K  ++F + S   W +K   D   E   +T  +RK     L  I  V    E   P      +    + D  +F  L+++ML   P+ RITP  AL H
Sbjct:  162 YEIDSLIGKGSFGQVVKAYDHQEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTDMKYYIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSA----IKIVDFGSSCQLGQRIYQ-YIQSRFYRSPEVLLGIPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMNKIVEVLGLPPTHMLEQAPKARKYFERLSDGSWTVKKTKDSKRE--YKTAGSRK-----LHDIIGV----ESGGPGGRRMGEAGHTVADYLKFKDLILRMLDYDPKTRITPFYALQH 479          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Sea Lamprey
Match: dyrk2 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2804])

HSP 1 Score: 224.942 bits (572), Expect = 4.293e-63
Identity = 128/328 (39.02%), Postives = 175/328 (53.35%), Query Frame = 3
Query:  639 YEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTE-SHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDSCFEWRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIE--DRKQFAHLLIQMLQMRPEERITPDVALNH 1613
            YEVL  +G+G+FGQVVK         VA+K+++N   + RQ   EI+IL+ L ++D E S NI+  +E F  + H+C+ FELL  NLYE +K NKF+  +L  +R  A  +L  L  L +  +IH DLKPENI+L  P     R  +KVIDFGS+C   + V  TY+QSR+YRAPE++LG  +   IDMWSLGC++AEL  G PL PG  E DQ+   +E  GMPP  +L    +   F S         +    Y       T+     V  +  + R   PR  P   +    +   D       L   L+  P ER+TP  AL H
Sbjct:  162 YEVLKVIGKGSFGQVVKAFDHKTQTHVALKMVRNEKRFHRQAAEEIRILEHLRKQDRENSMNIIHLLESFTFRGHVCMTFELLSMNLYELIKKNKFQGFSLALVRKFAHSILQCLDTLHRNRIIHCDLKPENILLKQPG----RSGIKVIDFGSSCFEHQRVY-TYIQSRFYRAPEVVLGARYGPPIDMWSLGCILAELLTGSPLLPGEDEGDQLACAMELLGMPPQRLLAQGKRSRNFVSS--------RGHPRYCGV----TEAPDGAVVLNAGRSRRGKPRGPPGSRELPAALRGCDDPLLLDFLRGCLEWEPSERLTPAQALRH 472          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Sea Lamprey
Match: dyrk2 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2804])

HSP 1 Score: 213.001 bits (541), Expect = 4.555e-59
Identity = 126/332 (37.95%), Postives = 180/332 (54.22%), Query Frame = 3
Query:  639 YEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTE-SHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDS----CFEWRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIE--DRKQFAHLLIQMLQMRPEERITPDVALNH 1613
            YEVL  +G+G+FGQVVK      ++ VA+K+++N   + RQ   EI+IL+ L ++D E + N++  +E F  +NH+C+ FELL  NLYE +K NKF+  +L  +R  A  +L  L+ L +  +IH DLKPENI+L       ++    +IDFGS+C   + V  TY+QSR+YRAP    GLP    IDMWSLGC++AEL  G PL PG  E DQ+   +E  G PP+ +L+ + +  +FFS       C    L      LN  G RT+  +               R  P   D+   ++  D   F   L + L   P  R+TP  AL H
Sbjct:  172 YEVLRVIGKGSFGQVVKAYDHRTHQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKENTMNVIHMLESFNFRNHICMTFELLSMNLYELIKKNKFQGFSLQVVRKFAHSILLCLNALHKNRIIHCDLKPENILLRQQGRSGIKI---IIDFGSSCYEHQRVY-TYIQSRFYRAPGGRYGLP----IDMWSLGCILAELLTGSPLLPGEDEGDQLACAMELTGSPPARLLEQSKRARQFFSSLGHPRYCTVTTLPGGPVVLN--GGRTRRGKL--------------RGPPSSRDWTTALKGCDDHLFIDFLKKCLDWDPATRLTPSQALKH 479          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007958.1 (pep scaffold:Pmarinus_7.0:GL476685:157443:173166:-1 gene:ENSPMAG00000007188.1 transcript:ENSPMAT00000007958.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 170.629 bits (431), Expect = 3.683e-47
Identity = 110/325 (33.85%), Postives = 160/325 (49.23%), Query Frame = 3
Query:  639 YEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDSCFEWRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNH 1613
            YEVL  LG+G+FG+V+KC    +   VAIK+L            EI+IL+ L Q   ES  I+R +E F  +   C+VFELL  NL   LK    +   L  +R  A  +L +L +L+  ++IH DLKP NI + +   G     VK+ DFG +C   +    T +Q+R+YRAPE++L L ++   DMWSLGC +AEL  G  L+PG +  DQ+  I+E  G+PP DM++ +     FF+      W + N    +   G R              +R                    + F   +   LQ  PE R+TP  A++H
Sbjct:   11 YEVLEVLGQGSFGKVLKCLDHKSKEFVAIKVLNRARFNESVHRREIEILKRL-QTARESSKIIRMMEHFSFRGRECVVFELLNGNLRSQLKLTHRQGFGLEMVRLFAISLLKSLEQLRDANVIHGDLKPGNIGICSYEAG----EVKLFDFGCSCFDHEE-HFTKIQTRHYRAPEVILDLGYSFPADMWSLGCTLAELHSGQKLFPGHTNEDQLHSIMEVFGLPPQDMIEESRVQLGFFAITKPTHWDINNHRGLVRVPGSRALPL---------ALRTTD-----------------EHFTDFIRSCLQWDPEWRLTPHGAMDH 303          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Yeast
Match: YAK1 (Serine-threonine protein kinase; component of a glucose-sensing system that inhibits growth in response to glucose availability; upon nutrient deprivation Yak1p phosphorylates Pop2p to regulate mRNA deadenylation, the co-repressor Crf1p to inhibit transcription of ribosomal genes, and the stress-responsive transcription factors Hsf1p and Msn2p; nuclear localization negatively regulated by the Ras/PKA signaling pathway in the presence of glucose [Source:SGD;Acc:S000003677])

HSP 1 Score: 266.159 bits (679), Expect = 3.671e-75
Identity = 155/371 (41.78%), Postives = 225/371 (60.65%), Query Frame = 3
Query:  585 DGDYQIVVGENLN-SMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQ--EDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPS---DMLKHAGKINRFF----SKDSCFEWRLKNQDDYLNETGQRTKETRKYV-FTHL-DQIRNVSPRPEPHDPDYEV---EIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMF 1652
            + DY + V + L    ++ Y VL  LG+GTFGQVVKC+      ++A+K++K+   YL Q   E +IL+ L+Q  + T  H+ +R  + F HKNH+CLVFELL  NLYE LK NKF  +++  IR    Q+L +L  LK+  LIH DLKPENI+L  P     +  +K+IDFGS+C  ++ V  TY+QSR+YRAPEI+LG+P++ +IDMWSLGC++AELFLG P++PG+SEY+Q+  II+T G PPS   DM K++GK  +      S  S  + R+K  +++  E     K +++Y  +  L D IRN    P+      E+   E+++R+   H L  +L + P ER TP  A+ H  I         F
Sbjct:  350 NSDYILYVNDVLGVEQNRKYLVLDILGQGTFGQVVKCQNLLTKEILAVKVVKSRTEYLTQSITEAKILELLNQKIDPTNKHHFLRMYDSFVHKNHLCLVFELLSNNLYELLKQNKFHGLSIQLIRTFTTQILDSLCVLKESKLIHCDLKPENILLCAPD----KPELKIIDFGSSCEEARTVY-TYIQSRFYRAPEIILGIPYSTSIDMWSLGCIVAELFLGIPIFPGASEYNQLTRIIDTLGYPPSWMIDMGKNSGKFMKKLAPEESSSSTQKHRMKTIEEFCREYNIVEKPSKQYFKWRKLPDIIRNYR-YPKSIQNSQELIDQEMQNRECLIHFLGGVLNLNPLERWTPQQAMLHPFITKQEFTGEWF 714          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Yeast
Match: KNS1 (Protein kinase involved in negative regulation of PolIII transcription; effector kinase of the TOR signaling pathway and phosphorylates Rpc53p to regulate ribosome and tRNA biosynthesis; member of the LAMMER family of protein kinases, which are serine/threonine kinases also capable of phosphorylating tyrosine residues; capable of autophosphorylation [Source:SGD;Acc:S000003942])

HSP 1 Score: 140.584 bits (353), Expect = 2.385e-34
Identity = 86/278 (30.94%), Postives = 141/278 (50.72%), Query Frame = 3
Query:  582 ADGDYQIVVGEN-LNSMSQMYEVLAFLGRGTFGQVVKC-RCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESH-NIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRY--------------------------RVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMP-PSDML 1325
             D D   V  EN +      + V   LG+GTFG+V+KC   +     VA+K+++    Y      E++ILQT+   D +     +   ECF +KNH+CLV +L  +++Y+++ SN         I+ IA+Q++ ++  L  L +IH DLKPENI++ +  + A +                            +K+IDFGSA    +      + +R+YRAPEI+LGL ++   D+WS+ CV+ EL +G  LYP     + +  +    G P P+D++
Sbjct:  293 TDKDGHYVYQENDIFGSGGRFVVKDLLGQGTFGKVLKCIDNKYEPNYVAVKVIRAVDRYREAAKTELRILQTILNNDPQGQFQCLLLRECFDYKNHICLVTDLYGRSIYDFMCSNGIARFPGSHIQAIARQLIRSVCFLHDLGIIHTDLKPENILICDETHIAQKLPLKTVQSLSKRRREASKGKRKILKNPEIKIIDFGSAIFHYE-YHPPVISTRHYRAPEIVLGLGWSFPCDIWSIACVLVELVIGESLYPIHENLEHMAMMQRINGTPFPTDII 569          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Yeast
Match: MRK1 (Glycogen synthase kinase 3 (GSK-3) homolog; one of four GSK-3 homologs in S. cerevisiae that function to activate Msn2p-dependent transcription of stress responsive genes and that function in protein degradation; MRK1 has a paralog, RIM11, that arose from the whole genome duplication [Source:SGD;Acc:S000002237])

HSP 1 Score: 119.398 bits (298), Expect = 2.128e-28
Identity = 80/233 (34.33%), Postives = 126/233 (54.08%), Query Frame = 3
Query:  639 YEVLAFLGRGTFGQVVKCRCRANNRMVAIK-ILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLP--EIRPIAQQVLTALSKLKQL-HLIHADLKPENIMLVNPANGAMRYRVKVIDFGSA-CLTSKAVQNTYLQSRYYRAPEILLGLP-FNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSD 1319
            Y     +G G+FG VV       N+ VAIK +L++     R  N E++ ++ L   +T         +  + + ++ LV + + Q+LY+ L+      M +P  EI+  A Q+  AL+ L  +  + H D+KP+N +LV+P      +  K+ DFGSA CL       +Y+ SRYYRAPE++ G   ++  +D+WS  CV+AEL LG PL+ G S  DQ+  II+  G+P  D
Sbjct:  164 YPTTEVVGHGSFGVVVTTVIIETNQKVAIKKVLQDR----RYKNRELETMKMLCHPNTVGLQYYFYEKDEEDEVYLNLVLDYMPQSLYQRLRHFVNLKMQMPRVEIKFYAYQLFKALNYLHNVPRICHRDIKPQN-LLVDPTT----FSFKICDFGSAKCLKPDQPNVSYICSRYYRAPELMFGATNYSNQVDVWSSACVIAELLLGKPLFSGESGIDQLVEIIKIMGIPTKD 387          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Yeast
Match: RIM11 (Protein kinase; required for signal transduction during entry into meiosis; promotes the formation of the Ime1p-Ume6p complex by phosphorylating Ime1p and Ume6p; shares similarity with mammalian glycogen synthase kinase 3-beta; protein abundance increases in response to DNA replication stress; RIM11 has a paralog, MRK1, that arose from the whole genome duplication [Source:SGD;Acc:S000004747])

HSP 1 Score: 114.39 bits (285), Expect = 1.943e-27
Identity = 81/229 (35.37%), Postives = 127/229 (55.46%), Query Frame = 3
Query:  657 LGRGTFGQVVKCRCRANNRMVAIK-ILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKN-----HMCLVFELLEQNLYEYLK--SNKFRPMTLPEIRPIAQQVLTALSKLKQL-HLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQN-TYLQSRYYRAPEILLGLP-FNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMP 1310
            +G G+FG V     +  N  VAIK +L++     R  N E++I++ LS       NI+     F  ++     ++ L+ E + Q+LY+ L+   ++  PM+  EI+    Q+  +L+ L    ++ H D+KP+N +LV+P      + +K+ DFGSA        N +Y+ SRYYRAPE++ G   +   ID+WS GCVMAEL LG P++PG S  DQ+  II+  G P
Sbjct:   45 VGHGSFGVVFATVIQETNEKVAIKKVLQDK----RFKNRELEIMKMLSH-----INIIDLKYFFYERDSQDEIYLNLILEYMPQSLYQRLRHFVHQRTPMSRLEIKYYMFQLFKSLNYLHHFANVCHRDIKPQN-LLVDPET----WSLKLCDFGSAKQLKPTEPNVSYICSRYYRAPELIFGATNYTNQIDIWSSGCVMAELLLGQPMFPGESGIDQLVEIIKILGTP 259          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Yeast
Match: PHO85 (Cyclin-dependent kinase; has ten cyclin partners; involved in regulating the cellular response to nutrient levels and environmental conditions and progression through the cell cycle; human lissencephaly-associated homolog CDK5 functionally complements null mutation [Source:SGD;Acc:S000005952])

HSP 1 Score: 111.694 bits (278), Expect = 4.650e-27
Identity = 74/251 (29.48%), Postives = 133/251 (52.99%), Query Frame = 3
Query:  624 SMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKS----NKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTY---LQSRYYRAPEILLG-LPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRF 1352
            S S  ++ L  LG GT+  V K   +     VA+K +K       +G     I +    ++ +  NIVR  +    +N + LVFE ++ +L +Y+ S    N  R + L  ++    Q+L  L+   +  ++H DLKP+N +L+N      R ++K+ DFG A      V NT+   + + +YRAP++L+G   ++ +ID+WS GC++AE+  G PL+PG+++ +Q++ I +  G P   +     K+ ++
Sbjct:    2 SSSSQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDS---EEGTPSTAIREISLMKELKHENIVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLAFCHENKILHRDLKPQN-LLINK-----RGQLKLGDFGLARAFGIPV-NTFSSEVVTLWYRAPDVLMGSRTYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQLKLIFDIMGTPNESLWPSVTKLPKY 242          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Nematostella
Match: EDO49238 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGV4])

HSP 1 Score: 423.32 bits (1087), Expect = 6.872e-136
Identity = 209/357 (58.54%), Postives = 257/357 (71.99%), Query Frame = 3
Query:  645 VLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSK-----DSCFEWRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNR 1700
            VL FLGRGTFGQVVKC  +  N +VAIKILK+HPSY RQG +EI IL  LS E++E++N VRAIECFQHKNH CLVFE+L+QNLY+YLK +KF P+ L  IRPI QQVL ALSKL+ L LIHADLKPENIMLV+P      +RVKVIDFGSA   SK V +TYLQSRYYRAPE++LGLPF E+IDMWSLGCV+AELFLGWPLYPGSSE+DQIRYII+TQG+P   +L +A K +RFF K         EW+LKN +++  ET   +KE RKY+F  LD I  V+        +   E  DR +F  LL +ML +  E+RITP+ AL+H  + ++HL     +   + S   M++C R
Sbjct:    1 VLEFLGRGTFGQVVKCWKKGTNELVAIKILKDHPSYARQGQIEISILAKLSAENSEAYNFVRAIECFQHKNHTCLVFEMLQQNLYDYLKQSKFNPLPLKHIRPIVQQVLVALSKLRTLGLIHADLKPENIMLVDPDKQP--FRVKVIDFGSATHVSKVVCSTYLQSRYYRAPEVILGLPFCESIDMWSLGCVIAELFLGWPLYPGSSEFDQIRYIIQTQGLPYDHLLNNATKTSRFFKKAINTHTGVLEWKLKNANEHERETKIPSKEARKYIFNSLDDIAQVNLSSSLTGNERIAEKIDRYEFVSLLKRMLTIDQEKRITPEEALSHQFVTLSHLVDFAHSNVFKSSVKNMEICCR 355          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Nematostella
Match: EDO45187 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTC8])

HSP 1 Score: 234.958 bits (598), Expect = 1.482e-67
Identity = 135/352 (38.35%), Postives = 206/352 (58.52%), Query Frame = 3
Query:  591 DYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTES-HNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKL--KQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSK--DSCFEWRLKNQD---DYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLI 1622
            DY +  GE        YE+ + +G+G+FGQV K         +A+KI+KN   +L Q  +E+++L+ +++ D +  + IVR    F  +NH+CLVFELL  NLY+ L++  FR ++L   R  AQQ+ TAL  L   +L +IH DLKPENI+L NP   A    +K++DFGS+C   + +   Y+QSR+YR+PE+LLG+P+N AIDMWSLGC++ E+  G PL+ G++E+DQ+  I+E  GMPP D+L +A K  +FF +  D  ++  LK +D   +YL+  G R         T     R +         +    ++D  +F  L+++ML    + RI P  AL+HC  
Sbjct:   66 DYIVKAGEK---WFDRYEIESLIGKGSFGQVCKAYDHQEKEHIAVKIIKNKKPFLNQAQIEVKLLELMNKNDPDGKYYIVRLKRHFMWRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLCSPELSIIHCDLKPENILLCNPKRSA----IKIVDFGSSCQIGQRIYQ-YIQSRFYRSPEVLLGIPYNLAIDMWSLGCILVEMHTGEPLFSGANEFDQMMKIVEVLGMPPKDILDNAPKARKFFDRLPDGSYQC-LKVKDGVKEYLS-PGSRKLHDILGCETGGPGGRRLG--------EAGHTLQDYLKFKDLILRMLDYDRKTRIVPYAALHHCFF 399          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Nematostella
Match: EDO36294 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ45])

HSP 1 Score: 219.935 bits (559), Expect = 1.241e-63
Identity = 106/246 (43.09%), Postives = 162/246 (65.85%), Query Frame = 3
Query:  621 NSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTE-SHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFF 1355
            + ++  YEVL  LG+G+FGQVVK       + VA+KI++N   + +Q  VE++IL  L ++D + +HN++  IE F  +NH+C+ FEL+  NLYE +K N F+  +L  IR  A  +L  L  + +  +IH DLKPENI+L      +    +KVIDFGS+C   + V  TY+QSR+YR+PE++LGLP++ AIDMWS GC++AEL+ G+PL+PG +E +Q+  I+E  G+P   +++ A +   FF
Sbjct:   54 DHLAYRYEVLEVLGKGSFGQVVKALDHKTGQHVAVKIIRNKKRFHQQALVEVKILDNLRKKDKDNTHNLIHMIEHFYFRNHLCITFELMGMNLYELIKKNNFQGFSLALIRRFAFALLHCLKVIHKEKIIHCDLKPENILLRQRGQTS----IKVIDFGSSCYEHQRVY-TYIQSRFYRSPEVILGLPYSMAIDMWSFGCILAELYTGYPLFPGENEVEQLACIMEVLGLPSPKLIESASRRRLFF 294          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Nematostella
Match: EDO46144 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQP1])

HSP 1 Score: 221.09 bits (562), Expect = 1.325e-61
Identity = 125/342 (36.55%), Postives = 185/342 (54.09%), Query Frame = 3
Query:  639 YEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTE-SHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDS----CFEWRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIE--DRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLER 1643
            YEVL  +G+G+FGQVVK      N  VA+K+++N   + RQ   EI+IL+ L ++D + +HNI+  +E F  +NH+C+ FELL  NLYE +K NKF+  +LP +R  A  +L  L  L +  +IH DLKPENI+L        R  +KVIDFGS+C   + +  TY+QSR+YRAPE++LG  +   IDMWS GC++AEL  G+PL+PG  E DQ+   +E  G  P  + + + +   F +       C    L   D  +  +G R++  +               R  P+   +   ++  D   F   L + L+  P  R+TP  AL H  +    L R
Sbjct:  167 YEVLKIIGKGSFGQVVKALDHKTNTHVALKMVRNEKRFHRQAQEEIRILEHLKKQDKDNTHNIIHMLEHFTFRNHVCMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQG----RSGIKVIDFGSSCYEHQRIY-TYIQSRFYRAPEVILGARYGMPIDMWSFGCILAELLTGYPLFPGEDEGDQLACNMELLGYIPEKLRETSKRAKNFINSKGYPRYCTITTLP--DGSVAVSGGRSRRGKT--------------RGAPNSKTFVQALKGCDDAMFIDFLKRCLEWDPSARMTPSQALRHPWLRRRALPR 487          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Nematostella
Match: EDO33758 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR83])

HSP 1 Score: 176.792 bits (447), Expect = 1.769e-47
Identity = 109/362 (30.11%), Postives = 186/362 (51.38%), Query Frame = 3
Query:  585 DGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNI-VRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNP---------ANGAMRY----RVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDSCFEWRLKNQD-DYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLIN 1625
            DG      G+ L+S    YEV   LG GTFG+V++C  +    +VA+K++KN   Y     +EI++L+ ++Q++    ++ ++ ++ F H  HMCLVFE +  ++++++K N + P  L ++R I+ Q++ A+  L ++ L H DLKPEN++ VN               RY     +++IDFGSA    +   +T + +R+YRAPE++L L ++   D+WS+GC+M EL+ G+ L+      + +  +    G  PSD  K + K   F+      EW  K+    Y+ E     K  +KY+ +                     + E  + F +LL  +L+  PE+RIT   A+ H   N
Sbjct:  110 DGHLIYHKGDQLHSR---YEVHCLLGEGTFGKVLECYDKKTGDVVAVKVIKNIEKYREAAKLEIKVLEKINQKNRYGKSLCIKMLDWFNHHGHMCLVFEKMGLSVFDFMKDNNYEPYPLDQVRHISYQLIVAVKFLHEMKLTHTDLKPENMLFVNSDCDVFYNKDTKQDQRYVKSSHMRLIDFGSATFEHEH-HSTTVSTRHYRAPEVILELGWSYPCDIWSIGCIMFELYTGFTLFQTHENREHLAMMERIIGPIPSDFAKKSRKTKYFYKGK--LEWDEKSSSGKYVREN---CKPLKKYMLS---------------------DSEGHQLFFNLLDYLLEYDPEKRITAKEAMQHPFFN 441          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Medaka
Match: hipk3a (homeodomain-interacting protein kinase 3 [Source:NCBI gene;Acc:101162288])

HSP 1 Score: 476.478 bits (1225), Expect = 2.836e-143
Identity = 234/400 (58.50%), Postives = 286/400 (71.50%), Query Frame = 3
Query:  570 RSATADGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDS---CFEWRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNRSNGRSNPSTHIIDASNSNII 1760
            R+ + DGDYQ+V  E L S+   YEVL FLGRGTFGQVVKC  R  N +VA+KILKNHPSY RQG +E++IL  LS E+ E HN+VRA+ECFQH++H CLVFE+LEQNLY++LK NKF P+ L  IRPI QQV TAL KLK L LIHADLKPENIMLV+P+     YRVKVIDFGSA   SKAV +TYLQSRYYRAPEI+LGLPF+EAIDMWSLGCV+AELFLGWPLYPG+ EYDQIRYI +TQG+P   +L    K +RFF+K+S      WRLK  +++  ETG ++KE RKY+F+ LD I +V+    P + D + E EDR++F  LL  ML +  E+R  P   LNH  + M HL     +  V+ SF +M +C+     S PS  I DA N N I
Sbjct:  271 RTGSGDGDYQLVQHEVLCSLKNSYEVLEFLGRGTFGQVVKCWKRGTNDVVAVKILKNHPSYARQGQIEVEILARLSSENAEEHNVVRALECFQHRSHTCLVFEMLEQNLYDFLKQNKFSPLPLKVIRPILQQVATALKKLKSLGLIHADLKPENIMLVDPSR--QPYRVKVIDFGSASHVSKAVCSTYLQSRYYRAPEIILGLPFSEAIDMWSLGCVIAELFLGWPLYPGALEYDQIRYISQTQGLPAEKLLNKGTKTSRFFTKESDSPYASWRLKTTEEHEKETGLKSKEARKYIFSCLDDIAHVNLVLSPDNGDMQSEKEDRREFVSLLKSMLTIDAEDRTVPSSVLNHPFLTMTHLLDFPHSHHVQSSFRIMDMCH-----SRPSNAIFDALNQNTI 663          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Medaka
Match: hipk2 (homeodomain interacting protein kinase 2 [Source:NCBI gene;Acc:101162924])

HSP 1 Score: 461.455 bits (1186), Expect = 3.010e-139
Identity = 231/407 (56.76%), Postives = 282/407 (69.29%), Query Frame = 3
Query:  585 DGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSK--DSCFE-WRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNRS-------NGRSNP-STHIIDASNSNIISKFN 1772
            +GDYQ+V  E L SM+  YEVL FLGRGTFGQVVKC  R  N +VAIKILKNHPSY RQG +E+ IL  LS E  + +N VRA ECFQHKNH CLVFE+LEQNLY++LK NKF P+ L  IRP+ QQV TAL KLK L LIHADLKPENIMLV+P+     YRVKVIDFGSA   SKAV +TYLQSRYYRAPEI+LGLPF EAIDMWSLGCV+AELFLGWPLYPG+SEYDQIRYI +TQG+P   +L    K  RFF++  DS +  WRLK  +D+  ETG ++KE RKY+F  LD +  V+   +    D   E  DR++F  LL +ML +  ++RITP   LNH  + M+HL     +  V+  F  M++C R        N    P  TH+  ++++N+   FN
Sbjct:  178 EGDYQLVQHEVLCSMTNTYEVLEFLGRGTFGQVVKCWKRGTNEIVAIKILKNHPSYARQGQIEVSILARLSTESADDYNFVRAYECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKYIRPVLQQVATALMKLKSLGLIHADLKPENIMLVDPSR--QPYRVKVIDFGSASHVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTRFFNRDPDSTYPLWRLKTPEDHEAETGIKSKEARKYIFNCLDDMAQVNMTSDLEGSDLLAEKADRREFIDLLTKMLTIDADKRITPIETLNHPFVTMSHLLDFPHSTHVKSCFQNMEICKRRVNMYDTVNQSKTPFITHVAPSTSTNLTMTFN 582          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Medaka
Match: hipk2 (homeodomain interacting protein kinase 2 [Source:NCBI gene;Acc:101162924])

HSP 1 Score: 461.84 bits (1187), Expect = 4.367e-139
Identity = 231/407 (56.76%), Postives = 282/407 (69.29%), Query Frame = 3
Query:  585 DGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSK--DSCFE-WRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNRS-------NGRSNP-STHIIDASNSNIISKFN 1772
            +GDYQ+V  E L SM+  YEVL FLGRGTFGQVVKC  R  N +VAIKILKNHPSY RQG +E+ IL  LS E  + +N VRA ECFQHKNH CLVFE+LEQNLY++LK NKF P+ L  IRP+ QQV TAL KLK L LIHADLKPENIMLV+P+     YRVKVIDFGSA   SKAV +TYLQSRYYRAPEI+LGLPF EAIDMWSLGCV+AELFLGWPLYPG+SEYDQIRYI +TQG+P   +L    K  RFF++  DS +  WRLK  +D+  ETG ++KE RKY+F  LD +  V+   +    D   E  DR++F  LL +ML +  ++RITP   LNH  + M+HL     +  V+  F  M++C R        N    P  TH+  ++++N+   FN
Sbjct:  205 EGDYQLVQHEVLCSMTNTYEVLEFLGRGTFGQVVKCWKRGTNEIVAIKILKNHPSYARQGQIEVSILARLSTESADDYNFVRAYECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKYIRPVLQQVATALMKLKSLGLIHADLKPENIMLVDPSR--QPYRVKVIDFGSASHVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTRFFNRDPDSTYPLWRLKTPEDHEAETGIKSKEARKYIFNCLDDMAQVNMTSDLEGSDLLAEKADRREFIDLLTKMLTIDADKRITPIETLNHPFVTMSHLLDFPHSTHVKSCFQNMEICKRRVNMYDTVNQSKTPFITHVAPSTSTNLTMTFN 609          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Medaka
Match: si:ch211-160o17.4 (homeodomain-interacting protein kinase 1-like [Source:NCBI gene;Acc:101164719])

HSP 1 Score: 442.195 bits (1136), Expect = 2.928e-133
Identity = 218/379 (57.52%), Postives = 267/379 (70.45%), Query Frame = 3
Query:  573 SATADGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSK--DSCFE-WRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNR 1700
            S+  +GDYQ+V  E L S+S  YEVL FLGRGTFGQV KC  R  N +VAIKILKNHPSY RQG +E+ IL  LS E+ + +N VR+ ECFQHK H CLVFE+LEQNLY++LK +KF P+ L  IRPI QQV TAL KLK L LIHADLKPENIMLV+P      +RVKVIDFGSA   SKAV +TYLQSRYYRAPEI+LGLPF EAIDMWSLGCV+AELFLGWPLYPG+SEYDQIRYI +TQG+P   +L    K +RFF++  DS +  WRLK   ++  E G ++KE RKY+F  LD +  V+        D   E  DR++F  LL +ML++  ++RITP   L H  + M+HL     +  V+  F  M++C R
Sbjct:  175 SSNGEGDYQLVQHEILCSVSCSYEVLEFLGRGTFGQVAKCWKRGTNEIVAIKILKNHPSYARQGQIEVGILNRLSAENADEYNFVRSYECFQHKGHTCLVFEMLEQNLYDFLKQSKFSPLPLRHIRPILQQVATALMKLKSLGLIHADLKPENIMLVDPIR--QPFRVKVIDFGSASHVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTSRFFNRGPDSSYPLWRLKTPAEHEMEMGIKSKEARKYIFNCLDDMMQVNLSSHLEGTDMLAEKADRREFIDLLKRMLRLDADKRITPTKTLGHPFVTMSHLMDYPHSSHVKSCFQNMEICKR 551          
BLAST of Homeodomain interacting protein kinase vs. Ensembl Medaka
Match: si:ch211-160o17.4 (homeodomain-interacting protein kinase 1-like [Source:NCBI gene;Acc:101164719])

HSP 1 Score: 442.195 bits (1136), Expect = 8.359e-133
Identity = 218/379 (57.52%), Postives = 267/379 (70.45%), Query Frame = 3
Query:  573 SATADGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSK--DSCFE-WRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNR 1700
            S+  +GDYQ+V  E L S+S  YEVL FLGRGTFGQV KC  R  N +VAIKILKNHPSY RQG +E+ IL  LS E+ + +N VR+ ECFQHK H CLVFE+LEQNLY++LK +KF P+ L  IRPI QQV TAL KLK L LIHADLKPENIMLV+P      +RVKVIDFGSA   SKAV +TYLQSRYYRAPEI+LGLPF EAIDMWSLGCV+AELFLGWPLYPG+SEYDQIRYI +TQG+P   +L    K +RFF++  DS +  WRLK   ++  E G ++KE RKY+F  LD +  V+        D   E  DR++F  LL +ML++  ++RITP   L H  + M+HL     +  V+  F  M++C R
Sbjct:  175 SSNGEGDYQLVQHEILCSVSCSYEVLEFLGRGTFGQVAKCWKRGTNEIVAIKILKNHPSYARQGQIEVGILNRLSAENADEYNFVRSYECFQHKGHTCLVFEMLEQNLYDFLKQSKFSPLPLRHIRPILQQVATALMKLKSLGLIHADLKPENIMLVDPIR--QPFRVKVIDFGSASHVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTSRFFNRGPDSSYPLWRLKTPAEHEMEMGIKSKEARKYIFNCLDDMMQVNLSSHLEGTDMLAEKADRREFIDLLKRMLRLDADKRITPTKTLGHPFVTMSHLMDYPHSSHVKSCFQNMEICKR 551          
BLAST of Homeodomain interacting protein kinase vs. Planmine SMEST
Match: SMESG000057968.1 (SMESG000057968.1)

HSP 1 Score: 2639.76 bits (6841), Expect = 0.000e+0
Identity = 1464/1465 (99.93%), Postives = 1464/1465 (99.93%), Query Frame = 3
Query:   48 MIEYLENKYNTHNAANLNRKRKIENIENIYTTADMNHSNENFIKSCQISLPILHHQNFPFVNNNSVKKFNHFNGTQNSSLELTNDKLSMPDNSRKVVQPNSKYITSKKRKAEEVPEFNFPMSYRNIGAVDLSSNFQAPLQINPMNHSSIKFASNNHSLIXXXXXXXXXXXXXXXRSATADGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDSCFEWRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNRSNGRSNPSTHIIDASNSNIISKFNGANSSLLPFDQAGASHLLSNPVELITSNPDPYFLENFEIQNQNMMISSNNLMHPANIHPNRMLNSQISLYDIVAAGSNALSILAAASQPVAARDLLHQAMVLXXXXXXXXXXXXXXXXXXXXXXXXFVLSNQYPEFNEMANLYQKNPIYLNRYPNNYHGPNNIENFIPESKFLTNAIPAQLMQNCVPTNINWLDKSSMNLPRQQSNSGSFNSFINKQETNEFLTSALNRHNIPNPQNSQKLAQNIHSHGQIIHDNPYLHQSHQQSVASLMAGFDHPVINNDLSFTNSDTNHSRSTNGSLTALQQMLTSPNTSFFNSMQSHXXXXXXXXXXXXXXNNRELKFSNWNILPNSNSTCDSRSFLNDSLAFQRNLRGICVPXXXXXXXXXXXXYFNLLSKSNHETMHALRQTDHKVEFVPQVDNSQSSNRXXXXXXXXXXXXXXXXXXXQSTQKPAVPVTCMNSSILPDPFMIKMSDTSNMFRHIGTDNSLYNTLSASKSSDTLSLHHPILDSINNSFDANLHYQNADDKIPXXXXXXXXXXXXXXXXXXXXXXXQLLDAMQQHFGERNKSFIPKSDSESMITTSAEMKISIRDVECSVNHSKLASNWSANEYDEKFHNAIYNTNKTDNIKHVLITDNNNTFPFSIKTESCKEDPVFSENPNFCKQEKDKKPFLILEGDGTDEDQADVKFIVTDSINTEEWNVKFENQHEKRSGGNQEDNHGLTNNQKAKLKNCEQLSNKINPTKESNGKEKKNVPVGRVQPMIKEERQXXXXXXXXXXXXXXXXXXXFDFSRILNNAASRISTIAALNGVNQMFSTRSAAXXXXXXXXXXXXXXXLLQDTVQEXXXXXXXXXXXXXXXXXXXXXXKNGAHNILTNPVFVDHSPTPAGVLHQQRI 4442
            MIEYLENKYNTHNAANLNRKRKIENIENIYTTADMNHSNENFIKSCQISLPILHHQNFPFVNNNSVKKFNHFNGTQNSSLELTNDKLSMPDNSRKVVQ NSKYITSKKRKAEEVPEFNFPMSYRNIGAVDLSSNFQAPLQINPMNHSSIKFASNNHSLIQNSNNQNSFKTNNANRSATADGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDSCFEWRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNRSNGRSNPSTHIIDASNSNIISKFNGANSSLLPFDQAGASHLLSNPVELITSNPDPYFLENFEIQNQNMMISSNNLMHPANIHPNRMLNSQISLYDIVAAGSNALSILAAASQPVAARDLLHQAMVLQQQQQQSNQMHQDQCQAAATAAAAFVLSNQYPEFNEMANLYQKNPIYLNRYPNNYHGPNNIENFIPESKFLTNAIPAQLMQNCVPTNINWLDKSSMNLPRQQSNSGSFNSFINKQETNEFLTSALNRHNIPNPQNSQKLAQNIHSHGQIIHDNPYLHQSHQQSVASLMAGFDHPVINNDLSFTNSDTNHSRSTNGSLTALQQMLTSPNTSFFNSMQSHQSQMAAAIEAMQQQNNRELKFSNWNILPNSNSTCDSRSFLNDSLAFQRNLRGICVPSSSHVNSNEISSYFNLLSKSNHETMHALRQTDHKVEFVPQVDNSQSSNRAALFNPNNLNHLLPALNALQSTQKPAVPVTCMNSSILPDPFMIKMSDTSNMFRHIGTDNSLYNTLSASKSSDTLSLHHPILDSINNSFDANLHYQNADDKIPSIITSTNTMISSSSISNENTTTSQLLDAMQQHFGERNKSFIPKSDSESMITTSAEMKISIRDVECSVNHSKLASNWSANEYDEKFHNAIYNTNKTDNIKHVLITDNNNTFPFSIKTESCKEDPVFSENPNFCKQEKDKKPFLILEGDGTDEDQADVKFIVTDSINTEEWNVKFENQHEKRSGGNQEDNHGLTNNQKAKLKNCEQLSNKINPTKESNGKEKKNVPVGRVQPMIKEERQSINSSVSSNASNYAGNASNFDFSRILNNAASRISTIAALNGVNQMFSTRSAATYQSITGTTTTSSTSLLQDTVQENGSANASSNNNTSSELLLFNSSKNGAHNILTNPVFVDHSPTPAGVLHQQRI
Sbjct:    1 MIEYLENKYNTHNAANLNRKRKIENIENIYTTADMNHSNENFIKSCQISLPILHHQNFPFVNNNSVKKFNHFNGTQNSSLELTNDKLSMPDNSRKVVQSNSKYITSKKRKAEEVPEFNFPMSYRNIGAVDLSSNFQAPLQINPMNHSSIKFASNNHSLIQNSNNQNSFKTNNANRSATADGDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDSCFEWRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCNRSNGRSNPSTHIIDASNSNIISKFNGANSSLLPFDQAGASHLLSNPVELITSNPDPYFLENFEIQNQNMMISSNNLMHPANIHPNRMLNSQISLYDIVAAGSNALSILAAASQPVAARDLLHQAMVLQQQQQQSNQMHQDQCQAAATAAAAFVLSNQYPEFNEMANLYQKNPIYLNRYPNNYHGPNNIENFIPESKFLTNAIPAQLMQNCVPTNINWLDKSSMNLPRQQSNSGSFNSFINKQETNEFLTSALNRHNIPNPQNSQKLAQNIHSHGQIIHDNPYLHQSHQQSVASLMAGFDHPVINNDLSFTNSDTNHSRSTNGSLTALQQMLTSPNTSFFNSMQSHQSQMAAAIEAMQQQNNRELKFSNWNILPNSNSTCDSRSFLNDSLAFQRNLRGICVPSSSHVNSNEISSYFNLLSKSNHETMHALRQTDHKVEFVPQVDNSQSSNRAALFNPNNLNHLLPALNALQSTQKPAVPVTCMNSSILPDPFMIKMSDTSNMFRHIGTDNSLYNTLSASKSSDTLSLHHPILDSINNSFDANLHYQNADDKIPSIITSTNTMISSSSISNENTTTSQLLDAMQQHFGERNKSFIPKSDSESMITTSAEMKISIRDVECSVNHSKLASNWSANEYDEKFHNAIYNTNKTDNIKHVLITDNNNTFPFSIKTESCKEDPVFSENPNFCKQEKDKKPFLILEGDGTDEDQADVKFIVTDSINTEEWNVKFENQHEKRSGGNQEDNHGLTNNQKAKLKNCEQLSNKINPTKESNGKEKKNVPVGRVQPMIKEERQSINSSVSSNASNYAGNASNFDFSRILNNAASRISTIAALNGVNQMFSTRSAATYQSITGTTTTSSTSLLQDTVQENGSANASSNNNTSSELLLFNSSKNGAHNILTNPVFVDHSPTPAGVLHQQRI 1465          
BLAST of Homeodomain interacting protein kinase vs. Planmine SMEST
Match: SMESG000081181.1 (SMESG000081181.1)

HSP 1 Score: 234.958 bits (598), Expect = 6.961e-66
Identity = 131/333 (39.34%), Postives = 190/333 (57.06%), Query Frame = 3
Query:  627 MSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTE-SHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDSCFEWRLKNQDDYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEV---EIEDRKQFAHLLIQMLQMRPEERITPDVALNH 1613
            +S  +E+L  +G+G+FGQVV+       ++VA+KI++N   + RQ   EI+IL+ L  EDT+  HN+V  +E F  +NHMC+ FELL  NLYE +K NKF   +L  +R  A  +L  L  L +  +IH DLKPENI+L        R  +KVIDFGS+C   + V N Y+QSR+YRAPE++LG  +  +IDMWSLGC++ EL  G+PL+PG  E DQ+  IIE  GMPP  +L+   K +R F     F      + DY  +   +  ++R+     L   R++    +  D D ++   E E +  F   +   L    E+R+ P  AL H
Sbjct:  231 ISYRFEILKIIGKGSFGQVVRAFDHMQGQLVALKIVRNEKRFARQALEEIKILEHLRHEDTDNGHNVVHLLEHFTFRNHMCMTFELLSYNLYELIKKNKFHGFSLQLVRKFAHAILQCLDLLYRNRIIHCDLKPENILLKQTG----RSGIKVIDFGSSCYDHQKVYN-YVQSRFYRAPEVILGASYGLSIDMWSLGCILCELVTGYPLFPGEDEGDQLACIIEVLGMPPPSLLE-ISKRSRVFFTSRGFPRYCVIETDYNGQCAIKPGKSRRGKVRGLPGSRDLQTSLKLLD-DNQIENSEYESKLDFLDFVKSCLMWNCEDRLIPREALRH 556          
BLAST of Homeodomain interacting protein kinase vs. Planmine SMEST
Match: SMESG000076583.1 (SMESG000076583.1)

HSP 1 Score: 228.409 bits (581), Expect = 1.381e-64
Identity = 131/344 (38.08%), Postives = 198/344 (57.56%), Query Frame = 3
Query:  588 GDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESH-NIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDSCFEWRLKNQDDYLNETGQRTKE-TRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNH 1613
            G Y  +V +++   +  YEV   +G+G+FG+V+K      +R VA+KI+K+   + RQ   EI+IL+ L Q D ES  NIV   E F  +NH+C+ FELL  NL+E +K NKFR  +L  +R  A  +L  L  L++  +IH DLKPENI+L +      R  +KVIDFGS+C  ++ V  TY+QSR+YRAPE++LG  +   IDMWS GC++AEL  G PL+PG +E DQ+  I E  G+P  +MLK   + N FF+ D   ++    ++   +   + T   TR+  F    Q + +    + +  D+E        F   L++ +++ P  RI P+ A+ H
Sbjct:   75 GSYIHIVNDHI---AYRYEVCKIIGKGSFGEVIKAYDYKFHRYVALKIIKSDNRFTRQAAEEIRILEHLQQYDKESKCNIVHIYEHFTFRNHVCITFELLNNNLFELIKKNKFRGFSLVLVRKFAISILQCLDALEKNQIIHCDLKPENILLRH----MNRSSIKVIDFGSSCYENQRVY-TYIQSRFYRAPEVILGGKYGLPIDMWSFGCILAELVTGHPLFPGENESDQLSCIFELLGIPSLEMLKDCKRKNTFFNSDCLPKYCTVIKNSVNSSLPKLTGSYTRRGTFRGPPQSKGIKSYLKLNGTDHE--------FLDFLLRCIELNPTTRIKPEEAMKH 402          
BLAST of Homeodomain interacting protein kinase vs. Planmine SMEST
Match: SMESG000064198.1 (SMESG000064198.1)

HSP 1 Score: 224.557 bits (571), Expect = 1.759e-63
Identity = 132/360 (36.67%), Postives = 195/360 (54.17%), Query Frame = 3
Query:  588 GDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESH-NIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDS----C-FEWRLKNQDD---------YLNETGQRTKETRKYVFTH-LDQIRNVSPRPEPHDP--DYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNH 1613
            G YQ V  +++   S  YE+L  LG+G+FGQVVK         VA+K+++N   + +Q   EI+IL+ L  +D +++ NIV  +E F  +NH+C+ FELL  NLY  +K NKF+  +L  ++  A  +L  L  L +  +IH DLKPENI+L        R  +KVIDFGS+C   + +  TY+QSR+YRAPE++LG  ++  IDMWS GC++ E+  G+PL+PG  E DQ+  IIE  GMPP + L    +   FF        C  E   + Q           YL     +  + R    +  L  I N        D   D E++++D   F + L++ L+  P++R TP  AL H
Sbjct:   89 GSYQHVAHDHV---SYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQG----RSGIKVIDFGSSCYDHQRIY-TYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRH 440          
BLAST of Homeodomain interacting protein kinase vs. Planmine SMEST
Match: SMESG000064198.1 (SMESG000064198.1)

HSP 1 Score: 223.787 bits (569), Expect = 9.427e-63
Identity = 132/360 (36.67%), Postives = 195/360 (54.17%), Query Frame = 3
Query:  588 GDYQIVVGENLNSMSQMYEVLAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLSQEDTESH-NIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEIRPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGSACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWPLYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDS----C-FEWRLKNQDD---------YLNETGQRTKETRKYVFTH-LDQIRNVSPRPEPHDP--DYEVEIEDRKQFAHLLIQMLQMRPEERITPDVALNH 1613
            G YQ V  +++   S  YE+L  LG+G+FGQVVK         VA+K+++N   + +Q   EI+IL+ L  +D +++ NIV  +E F  +NH+C+ FELL  NLY  +K NKF+  +L  ++  A  +L  L  L +  +IH DLKPENI+L        R  +KVIDFGS+C   + +  TY+QSR+YRAPE++LG  ++  IDMWS GC++ E+  G+PL+PG  E DQ+  IIE  GMPP + L    +   FF        C  E   + Q           YL     +  + R    +  L  I N        D   D E++++D   F + L++ L+  P++R TP  AL H
Sbjct:  132 GSYQHVAHDHV---SYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQG----RSGIKVIDFGSSCYDHQRIY-TYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRH 483          
The following BLAST results are available for this feature:
BLAST of Homeodomain interacting protein kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HIPK25.433e-14356.86homeodomain interacting protein kinase 2 [Source:H... [more]
HIPK21.124e-14053.23homeodomain interacting protein kinase 2 [Source:H... [more]
HIPK21.282e-14056.86homeodomain interacting protein kinase 2 [Source:H... [more]
HIPK13.810e-13655.15homeodomain interacting protein kinase 1 [Source:H... [more]
HIPK16.634e-13655.15homeodomain interacting protein kinase 1 [Source:H... [more]
back to top
BLAST of Homeodomain interacting protein kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hpk-12.115e-12854.66Homeodomain-interacting protein kinase 1 [Source:... [more]
hpk-12.115e-12854.66Homeodomain-interacting protein kinase 1 [Source:... [more]
hpk-18.848e-12854.66Homeodomain-interacting protein kinase 1 [Source:... [more]
hpk-11.065e-12754.66Homeodomain-interacting protein kinase 1 [Source:... [more]
mbk-23.230e-6537.36Dual specificity tyrosine-phosphorylation-regulate... [more]
back to top
BLAST of Homeodomain interacting protein kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hipk1.106e-13856.67gene:FBgn0035142 transcript:FBtr0331786[more]
Hipk2.400e-13856.67gene:FBgn0035142 transcript:FBtr0072552[more]
Hipk2.400e-13856.67gene:FBgn0035142 transcript:FBtr0072551[more]
mnb1.026e-6539.37gene:FBgn0259168 transcript:FBtr0299619[more]
mnb1.098e-6538.79gene:FBgn0259168 transcript:FBtr0300509[more]
back to top
BLAST of Homeodomain interacting protein kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hipk25.021e-13956.45homeodomain interacting protein kinase 2 [Source:Z... [more]
hipk26.069e-13956.45homeodomain interacting protein kinase 2 [Source:Z... [more]
hipk28.819e-13956.45homeodomain interacting protein kinase 2 [Source:Z... [more]
hipk1a1.985e-13658.40homeodomain interacting protein kinase 1a [Source:... [more]
hipk3a2.157e-13458.89homeodomain interacting protein kinase 3a [Source:... [more]
back to top
BLAST of Homeodomain interacting protein kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hipk25.205e-14456.62homeodomain interacting protein kinase 2 [Source:N... [more]
hipk28.385e-14356.62homeodomain interacting protein kinase 2 [Source:N... [more]
hipk17.240e-13855.23homeodomain interacting protein kinase 1 [Source:N... [more]
hipk17.653e-13855.23homeodomain interacting protein kinase 1 [Source:N... [more]
hipk18.270e-13855.23homeodomain interacting protein kinase 1 [Source:N... [more]
back to top
BLAST of Homeodomain interacting protein kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hipk21.198e-14056.62homeodomain interacting protein kinase 2 [Source:M... [more]
Hipk21.366e-14056.62homeodomain interacting protein kinase 2 [Source:M... [more]
Hipk21.544e-14056.62homeodomain interacting protein kinase 2 [Source:M... [more]
Hipk23.033e-14056.62homeodomain interacting protein kinase 2 [Source:M... [more]
Hipk16.416e-14055.15homeodomain interacting protein kinase 1 [Source:M... [more]
back to top
BLAST of Homeodomain interacting protein kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9WUM7|HIPK2_MESAU1.335e-14053.45Homeodomain-interacting protein kinase 2 OS=Mesocr... [more]
sp|Q9H2X6|HIPK2_HUMAN6.156e-14056.86Homeodomain-interacting protein kinase 2 OS=Homo s... [more]
sp|Q9QZR5|HIPK2_MOUSE2.122e-13956.62Homeodomain-interacting protein kinase 2 OS=Mus mu... [more]
sp|A4L9P5|HIPK1_RAT2.187e-13554.90Homeodomain-interacting protein kinase 1 OS=Rattus... [more]
sp|O88904|HIPK1_MOUSE5.551e-13555.15Homeodomain-interacting protein kinase 1 OS=Mus mu... [more]
back to top
BLAST of Homeodomain interacting protein kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3P4S10.000e+074.35Homeodomain-interacting protein kinase 2 OS=Schist... [more]
A0A5K3EJI10.000e+072.70Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5J4P2470.000e+074.67Homeodomain interacting protein kinase OS=Paragoni... [more]
A0A3R7G4930.000e+074.15Homeodomain-interacting protein kinase 1 OS=Clonor... [more]
A0A4S2L6D90.000e+074.15Protein kinase domain-containing protein OS=Opisth... [more]
back to top
BLAST of Homeodomain interacting protein kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hipk21.151e-13856.34homeodomain interacting protein kinase 2 [Source:N... [more]
hipk1a3.376e-13157.87homeodomain-interacting protein kinase 1-like [Sou... [more]
hipk1a7.445e-13157.87homeodomain-interacting protein kinase 1-like [Sou... [more]
hipk1a7.541e-13157.87homeodomain-interacting protein kinase 1-like [Sou... [more]
hipk3a4.172e-13059.68homeodomain-interacting protein kinase 3 [Source:N... [more]
back to top
BLAST of Homeodomain interacting protein kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hipk24.657e-13357.91homeodomain interacting protein kinase 2 [Source:Z... [more]
dyrk1aa8.302e-6940.72dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk24.293e-6339.02dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk24.555e-5937.95dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
ENSPMAT00000007958.13.683e-4733.85pep scaffold:Pmarinus_7.0:GL476685:157443:173166:-... [more]
back to top
BLAST of Homeodomain interacting protein kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
YAK13.671e-7541.78Serine-threonine protein kinase; component of a gl... [more]
KNS12.385e-3430.94Protein kinase involved in negative regulation of ... [more]
MRK12.128e-2834.33Glycogen synthase kinase 3 (GSK-3) homolog; one of... [more]
RIM111.943e-2735.37Protein kinase; required for signal transduction d... [more]
PHO854.650e-2729.48Cyclin-dependent kinase; has ten cyclin partners; ... [more]
back to top
BLAST of Homeodomain interacting protein kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO492386.872e-13658.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451871.482e-6738.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362941.241e-6343.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461441.325e-6136.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337581.769e-4730.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Homeodomain interacting protein kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hipk3a2.836e-14358.50homeodomain-interacting protein kinase 3 [Source:N... [more]
hipk23.010e-13956.76homeodomain interacting protein kinase 2 [Source:N... [more]
hipk24.367e-13956.76homeodomain interacting protein kinase 2 [Source:N... [more]
si:ch211-160o17.42.928e-13357.52homeodomain-interacting protein kinase 1-like [Sou... [more]
si:ch211-160o17.48.359e-13357.52homeodomain-interacting protein kinase 1-like [Sou... [more]
back to top
BLAST of Homeodomain interacting protein kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000057968.10.000e+099.93SMESG000057968.1[more]
SMESG000081181.16.961e-6639.34SMESG000081181.1[more]
SMESG000076583.11.381e-6438.08SMESG000076583.1[more]
SMESG000064198.11.759e-6336.67SMESG000064198.1[more]
SMESG000064198.19.427e-6336.67SMESG000064198.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004965 ID=SMED30004965|Name=Homeodomain interacting protein kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=4645bp
TCTATATAAATCTTATATGATATTCTAAGTTGAATGAATAATTCTATATG
ATAGAGTACTTGGAAAATAAGTATAATACTCATAACGCTGCAAATTTAAA
TCGAAAACGTAAAATCGAAAATATAGAAAATATTTATACAACGGCTGACA
TGAATCATTCCAACGAAAATTTCATTAAAAGTTGTCAAATTTCATTACCA
ATATTGCACCATCAAAATTTTCCATTTGTGAATAATAATTCAGTTAAAAA
GTTCAATCATTTTAATGGAACTCAAAATTCATCGTTGGAGTTAACGAATG
ATAAGTTATCTATGCCTGATAACTCTCGAAAAGTCGTTCAACCAAATTCG
AAATATATTACGAGCAAAAAACGTAAAGCAGAAGAAGTTCCTGAATTTAA
TTTTCCAATGTCATATAGAAATATTGGTGCTGTAGATTTATCATCCAATT
TCCAAGCACCATTACAAATTAATCCAATGAATCATTCATCGATTAAATTT
GCCAGTAATAATCATTCATTAATCCAAAATTCGAATAATCAAAACAGCTT
TAAAACAAATAATGCCAATAGATCGGCCACTGCTGACGGTGATTATCAAA
TTGTAGTTGGTGAAAACCTAAATTCCATGTCGCAAATGTATGAGGTTCTC
GCTTTTCTCGGAAGAGGCACATTTGGCCAAGTAGTCAAATGCCGTTGTCG
TGCCAACAATAGAATGGTAGCAATTAAAATTCTCAAAAATCACCCATCAT
ACTTAAGACAAGGTAATGTAGAAATTCAAATTTTACAGACTCTAAGCCAA
GAAGATACAGAGTCTCATAACATAGTCAGAGCTATCGAATGTTTTCAGCA
TAAAAATCACATGTGTTTAGTATTCGAATTACTAGAACAAAATTTATATG
AATATTTGAAATCGAACAAGTTTCGTCCGATGACATTACCGGAGATACGC
CCGATTGCTCAACAAGTTCTGACAGCACTTTCTAAATTAAAACAACTCCA
TTTGATTCATGCTGATTTGAAACCCGAAAACATAATGCTTGTCAACCCAG
CGAATGGTGCTATGAGATATCGGGTAAAAGTAATTGATTTTGGTTCAGCG
TGTTTGACTTCCAAAGCTGTACAAAATACTTATTTACAGTCCCGATATTA
TAGAGCTCCAGAGATTTTATTAGGTCTACCGTTCAATGAAGCCATTGATA
TGTGGTCATTGGGCTGCGTGATGGCTGAATTATTTCTTGGTTGGCCACTT
TATCCTGGTTCTTCGGAATATGATCAGATAAGGTATATAATTGAAACTCA
AGGAATGCCACCGTCAGATATGCTAAAACACGCTGGTAAAATTAATCGAT
TTTTCTCGAAAGATTCATGCTTTGAATGGCGTTTAAAAAATCAAGATGAT
TATTTAAATGAAACTGGACAACGCACTAAAGAAACGAGAAAATATGTATT
TACTCATTTGGATCAGATTCGAAATGTTAGTCCTCGACCTGAACCCCATG
ATCCCGATTATGAGGTTGAGATTGAGGACCGTAAACAATTTGCTCATTTG
CTTATTCAAATGCTTCAAATGCGCCCAGAAGAACGAATTACACCAGACGT
TGCCTTAAATCATTGTCTTATCAACATGAATCACTTGGAGAGACTTATGT
TCAACAAAAGAGTTCGAGACTCATTTTCCTTGATGCAAGTTTGTAATCGA
AGTAACGGTCGGTCGAATCCAAGCACTCACATAATAGATGCATCAAATTC
AAATATTATTTCCAAATTCAATGGGGCCAACAGCTCATTATTGCCGTTCG
ATCAGGCTGGGGCATCACATTTATTGTCGAATCCGGTGGAATTAATCACT
TCAAACCCTGACCCTTATTTCTTAGAAAATTTCGAAATCCAAAATCAAAA
CATGATGATTAGCAGTAATAATCTCATGCATCCCGCAAATATCCATCCGA
ATCGAATGCTCAATTCTCAAATATCTCTTTATGATATTGTAGCAGCTGGC
AGCAATGCTTTATCAATTCTAGCTGCAGCGTCACAGCCAGTGGCTGCTAG
AGATTTGTTGCATCAGGCCATGGTGCTACAGCAACAGCAGCAACAATCGA
ATCAAATGCATCAAGATCAATGCCAAGCAGCAGCCACTGCTGCGGCCGCT
TTTGTTTTATCGAATCAATATCCAGAATTCAACGAAATGGCAAACCTTTA
TCAAAAAAACCCCATTTATCTTAATCGTTATCCAAATAACTATCATGGAC
CAAATAATATTGAAAATTTCATTCCCGAATCAAAATTCCTCACAAATGCT
ATACCAGCACAGCTCATGCAAAACTGTGTGCCTACGAACATAAATTGGCT
AGATAAGTCCTCAATGAATTTACCTCGTCAGCAGTCTAATAGTGGCTCAT
TCAATTCATTTATTAACAAACAAGAAACAAATGAATTTCTAACGTCAGCT
CTCAATCGGCATAATATCCCTAATCCCCAAAATTCTCAGAAATTGGCTCA
AAATATCCATTCACATGGACAAATAATTCACGACAATCCCTACTTACACC
AGTCTCATCAACAGTCTGTAGCAAGTCTAATGGCCGGATTTGATCATCCG
GTTATCAATAATGACTTGAGTTTTACTAATTCTGATACAAATCACAGTCG
ATCTACTAATGGATCTCTCACTGCTTTGCAACAAATGTTAACATCACCAA
ATACTTCCTTTTTCAATTCTATGCAATCACATCAGTCTCAGATGGCAGCA
GCAATTGAGGCTATGCAACAACAGAACAATCGGGAATTGAAATTTTCGAA
CTGGAACATCTTACCCAACTCAAATTCTACTTGTGATAGTCGAAGTTTTC
TTAATGATTCTTTGGCATTCCAGAGAAATCTGAGAGGAATTTGCGTGCCA
TCATCAAGTCACGTGAATAGCAATGAAATATCATCATATTTCAATTTGCT
ATCGAAATCAAATCACGAAACAATGCATGCTCTCAGACAAACAGATCATA
AAGTGGAATTCGTACCGCAAGTTGATAACTCGCAGAGCTCTAATCGAGCA
GCGTTGTTCAATCCGAATAACCTTAATCATCTTCTTCCCGCTCTCAACGC
TCTTCAGTCAACTCAGAAGCCCGCGGTCCCAGTAACATGCATGAATTCTT
CAATTCTTCCGGATCCGTTTATGATTAAAATGTCTGATACTAGCAATATG
TTTCGGCACATCGGAACTGATAATTCCCTCTACAATACTTTAAGCGCTTC
AAAATCCAGTGATACATTGTCTCTTCATCATCCGATTCTCGATAGCATTA
ATAACTCTTTTGACGCTAATCTTCATTATCAGAATGCTGATGATAAAATT
CCTAGCATCATTACCTCAACAAACACCATGATTTCATCGTCATCCATTAG
CAATGAAAATACTACCACGTCTCAATTGTTAGATGCAATGCAACAACATT
TCGGTGAAAGAAATAAATCTTTCATTCCAAAGTCTGATAGTGAATCTATG
ATTACAACGTCTGCTGAAATGAAAATATCCATAAGGGATGTTGAATGCTC
TGTCAACCATAGCAAATTAGCTTCCAATTGGTCGGCAAATGAATATGACG
AAAAATTTCACAATGCTATATACAATACAAATAAAACAGATAACATTAAG
CACGTCCTCATTACCGATAATAATAATACGTTTCCATTTTCAATAAAAAC
AGAAAGTTGTAAAGAAGATCCGGTTTTCTCAGAAAACCCAAATTTTTGCA
AACAGGAAAAAGACAAAAAACCTTTTTTGATATTGGAAGGAGATGGAACA
GATGAAGATCAAGCCGATGTCAAATTTATTGTTACAGATTCCATCAATAC
GGAGGAATGGAATGTGAAATTTGAAAATCAACATGAAAAACGCAGTGGTG
GCAATCAGGAGGATAATCATGGATTGACAAATAATCAGAAGGCTAAATTG
AAGAATTGCGAGCAGTTATCAAATAAGATAAATCCCACAAAGGAATCAAA
TGGCAAAGAGAAAAAGAATGTTCCTGTTGGGCGCGTGCAGCCAATGATTA
AAGAGGAACGGCAGTCAATCAATAGCAGCGTGTCTAGTAACGCGAGCAAT
TATGCGGGGAACGCGAGCAACTTTGATTTTTCACGGATATTGAACAATGC
CGCTTCTCGCATCTCTACAATAGCTGCATTGAATGGAGTCAATCAAATGT
TCTCAACTCGGTCGGCAGCAACCTACCAGTCAATTACAGGCACTACTACT
ACCTCATCTACCTCACTTCTACAAGATACTGTACAGGAAAACGGTTCTGC
TAATGCTAGCAGTAATAATAATACTAGCAGTGAACTCCTTTTATTTAACT
CTTCGAAAAATGGCGCTCACAATATTTTGACAAATCCAGTCTTCGTTGAT
CATTCGCCAACCCCAGCTGGAGTGCTTCATCAACAACGTATCTAAATCTT
TCGATATCACGATTTTACATAGGCTTCCGTATACTTTATATACAATTATT
CAACGTAACCAATCATAATATATTATGATATTTTTAGTAATTGTTGGAAA
TGTATTTCTTTCATTTTGTATTTAAAATTCTCTTGTGCATTGTGTCTGTT
TTGAGGGATTGCGTGTGAGTGTGTGTGATTATGTGTGATTATGTG
back to top

protein sequence of SMED30004965-orf-1

>SMED30004965-orf-1 ID=SMED30004965-orf-1|Name=SMED30004965-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1466bp
MIEYLENKYNTHNAANLNRKRKIENIENIYTTADMNHSNENFIKSCQISL
PILHHQNFPFVNNNSVKKFNHFNGTQNSSLELTNDKLSMPDNSRKVVQPN
SKYITSKKRKAEEVPEFNFPMSYRNIGAVDLSSNFQAPLQINPMNHSSIK
FASNNHSLIQNSNNQNSFKTNNANRSATADGDYQIVVGENLNSMSQMYEV
LAFLGRGTFGQVVKCRCRANNRMVAIKILKNHPSYLRQGNVEIQILQTLS
QEDTESHNIVRAIECFQHKNHMCLVFELLEQNLYEYLKSNKFRPMTLPEI
RPIAQQVLTALSKLKQLHLIHADLKPENIMLVNPANGAMRYRVKVIDFGS
ACLTSKAVQNTYLQSRYYRAPEILLGLPFNEAIDMWSLGCVMAELFLGWP
LYPGSSEYDQIRYIIETQGMPPSDMLKHAGKINRFFSKDSCFEWRLKNQD
DYLNETGQRTKETRKYVFTHLDQIRNVSPRPEPHDPDYEVEIEDRKQFAH
LLIQMLQMRPEERITPDVALNHCLINMNHLERLMFNKRVRDSFSLMQVCN
RSNGRSNPSTHIIDASNSNIISKFNGANSSLLPFDQAGASHLLSNPVELI
TSNPDPYFLENFEIQNQNMMISSNNLMHPANIHPNRMLNSQISLYDIVAA
GSNALSILAAASQPVAARDLLHQAMVLQQQQQQSNQMHQDQCQAAATAAA
AFVLSNQYPEFNEMANLYQKNPIYLNRYPNNYHGPNNIENFIPESKFLTN
AIPAQLMQNCVPTNINWLDKSSMNLPRQQSNSGSFNSFINKQETNEFLTS
ALNRHNIPNPQNSQKLAQNIHSHGQIIHDNPYLHQSHQQSVASLMAGFDH
PVINNDLSFTNSDTNHSRSTNGSLTALQQMLTSPNTSFFNSMQSHQSQMA
AAIEAMQQQNNRELKFSNWNILPNSNSTCDSRSFLNDSLAFQRNLRGICV
PSSSHVNSNEISSYFNLLSKSNHETMHALRQTDHKVEFVPQVDNSQSSNR
AALFNPNNLNHLLPALNALQSTQKPAVPVTCMNSSILPDPFMIKMSDTSN
MFRHIGTDNSLYNTLSASKSSDTLSLHHPILDSINNSFDANLHYQNADDK
IPSIITSTNTMISSSSISNENTTTSQLLDAMQQHFGERNKSFIPKSDSES
MITTSAEMKISIRDVECSVNHSKLASNWSANEYDEKFHNAIYNTNKTDNI
KHVLITDNNNTFPFSIKTESCKEDPVFSENPNFCKQEKDKKPFLILEGDG
TDEDQADVKFIVTDSINTEEWNVKFENQHEKRSGGNQEDNHGLTNNQKAK
LKNCEQLSNKINPTKESNGKEKKNVPVGRVQPMIKEERQSINSSVSSNAS
NYAGNASNFDFSRILNNAASRISTIAALNGVNQMFSTRSAATYQSITGTT
TTSSTSLLQDTVQENGSANASSNNNTSSELLLFNSSKNGAHNILTNPVFV
DHSPTPAGVLHQQRI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0003677DNA binding
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 892..912
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 254..522
e-value: 4.6E-109
score: 366.6
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 180..278
e-value: 4.6E-109
score: 366.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1276..1301
NoneNo IPR availablePANTHERPTHR24058:SF45HOMEODOMAIN-INTERACTING PROTEIN KINASE 3coord: 147..689
NoneNo IPR availablePANTHERPTHR24058DUAL SPECIFICITY PROTEIN KINASEcoord: 147..689
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 198..525
e-value: 1.9E-77
score: 273.3
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 198..523
e-value: 1.4E-50
score: 172.1
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 198..525
score: 36.753
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 204..227
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 319..331
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 197..532