Ig-like domain-containing protein

Overview
NameIg-like domain-containing protein
Smed IDSMED30004951
Length (bp)1431
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ig-like domain-containing protein (SMED30004951) t-SNE clustered cells

Violin plots show distribution of expression levels for Ig-like domain-containing protein (SMED30004951) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ig-like domain-containing protein (SMED30004951) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ig-like domain-containing protein (SMED30004951) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004951

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30004951SMESG000042663.1 dd_Smed_v4_1534_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30004951SMESG000042663.1 dd_Smed_v4_1534_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004951SMESG000042663.1 dd_Smed_v4_1534_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30004951SMESG000042663.1 dd_Smed_v4_1534_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30004951SMESG000042663.1 dd_Smed_v4_1534_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: BSG (basigin (Ok blood group) [Source:HGNC Symbol;Acc:HGNC:1116])

HSP 1 Score: 65.855 bits (159), Expect = 4.749e-12
Identity = 39/130 (30.00%), Postives = 67/130 (51.54%), Query Frame = 1
Query:  586 EGDPMRITCAYDAYPNATEIRWEMLSVIEYPDKSGNLSLHNSTIIIPNDRMIFISGKDTNKPNDTLFITKL-LKTDTGFYKCVVISPQGEDSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYEKYQ 972
            EG+   + C  ++ P  T+  W    + +  DK+         ++  ++   F+S   +++    L I  L ++ D G Y+C   S +G D  +I + V+   AAL+PF+GIV EV++LVT I  YEK +
Sbjct:   25 EGETAMLVCKSESVPPVTD--WAWYKITDSEDKA---------LMNGSESRFFVS---SSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRR 140          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: BSG (basigin (Ok blood group) [Source:HGNC Symbol;Acc:HGNC:1116])

HSP 1 Score: 65.4698 bits (158), Expect = 8.286e-12
Identity = 39/130 (30.00%), Postives = 67/130 (51.54%), Query Frame = 1
Query:  586 EGDPMRITCAYDAYPNATEIRWEMLSVIEYPDKSGNLSLHNSTIIIPNDRMIFISGKDTNKPNDTLFITKL-LKTDTGFYKCVVISPQGEDSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYEKYQ 972
            EG+   + C  ++ P  T+  W    + +  DK+         ++  ++   F+S   +++    L I  L ++ D G Y+C   S +G D  +I + V+   AAL+PF+GIV EV++LVT I  YEK +
Sbjct:   38 EGETAMLVCKSESVPPVTD--WAWYKITDSEDKA---------LMNGSESRFFVS---SSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRR 153          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: BSG (basigin (Ok blood group) [Source:HGNC Symbol;Acc:HGNC:1116])

HSP 1 Score: 65.4698 bits (158), Expect = 1.358e-11
Identity = 39/130 (30.00%), Postives = 67/130 (51.54%), Query Frame = 1
Query:  586 EGDPMRITCAYDAYPNATEIRWEMLSVIEYPDKSGNLSLHNSTIIIPNDRMIFISGKDTNKPNDTLFITKL-LKTDTGFYKCVVISPQGEDSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYEKYQ 972
            EG+   + C  ++ P  T+  W    + +  DK+         ++  ++   F+S   +++    L I  L ++ D G Y+C   S +G D  +I + V+   AAL+PF+GIV EV++LVT I  YEK +
Sbjct:   54 EGETAMLVCKSESVPPVTD--WAWYKITDSEDKA---------LMNGSESRFFVS---SSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRR 169          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: BSG (basigin (Ok blood group) [Source:HGNC Symbol;Acc:HGNC:1116])

HSP 1 Score: 65.0846 bits (157), Expect = 3.680e-11
Identity = 39/130 (30.00%), Postives = 67/130 (51.54%), Query Frame = 1
Query:  586 EGDPMRITCAYDAYPNATEIRWEMLSVIEYPDKSGNLSLHNSTIIIPNDRMIFISGKDTNKPNDTLFITKL-LKTDTGFYKCVVISPQGEDSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYEKYQ 972
            EG+   + C  ++ P  T+  W    + +  DK+         ++  ++   F+S   +++    L I  L ++ D G Y+C   S +G D  +I + V+   AAL+PF+GIV EV++LVT I  YEK +
Sbjct:  118 EGETAMLVCKSESVPPVTD--WAWYKITDSEDKA---------LMNGSESRFFVS---SSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRR 233          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: BSG (basigin (Ok blood group) [Source:HGNC Symbol;Acc:HGNC:1116])

HSP 1 Score: 64.6994 bits (156), Expect = 1.396e-10
Identity = 39/130 (30.00%), Postives = 67/130 (51.54%), Query Frame = 1
Query:  586 EGDPMRITCAYDAYPNATEIRWEMLSVIEYPDKSGNLSLHNSTIIIPNDRMIFISGKDTNKPNDTLFITKL-LKTDTGFYKCVVISPQGEDSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYEKYQ 972
            EG+   + C  ++ P  T+  W    + +  DK+         ++  ++   F+S   +++    L I  L ++ D G Y+C   S +G D  +I + V+   AAL+PF+GIV EV++LVT I  YEK +
Sbjct:  234 EGETAMLVCKSESVPPVTD--WAWYKITDSEDKA---------LMNGSESRFFVS---SSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRR 349          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: Bsg (gene:FBgn0261822 transcript:FBtr0079569)

HSP 1 Score: 50.0618 bits (118), Expect = 1.964e-6
Identity = 44/145 (30.34%), Postives = 67/145 (46.21%), Query Frame = 1
Query:  583 LEGDPMRITCAYDAYPNATEIRWEMLSVIEYPDKSGNLSLHNSTIIIPNDRMIFISGKDTNKPNDTLFITKLLKTDTGFYKCV-----------VISPQGEDSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYEKYQIRSQ 984
            +EG+ M +TC+        E+ W             N++L N+T     DR I +   D   PN  L +  +   D G YKC+             +P    S V  + VK ++AAL+PF+GI  EV++L   IL YEK + +S+
Sbjct:  131 VEGEKMSVTCS--VVGTKPELTWTF----------ANVTLTNAT-----DRFI-LKPDDNGVPNAILTLDNVTLDDRGEYKCIGRNAANVYGGNTTTPA---SDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEKRRNKSE 254          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: Bsg (gene:FBgn0261822 transcript:FBtr0079573)

HSP 1 Score: 50.0618 bits (118), Expect = 1.964e-6
Identity = 44/145 (30.34%), Postives = 67/145 (46.21%), Query Frame = 1
Query:  583 LEGDPMRITCAYDAYPNATEIRWEMLSVIEYPDKSGNLSLHNSTIIIPNDRMIFISGKDTNKPNDTLFITKLLKTDTGFYKCV-----------VISPQGEDSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYEKYQIRSQ 984
            +EG+ M +TC+        E+ W             N++L N+T     DR I +   D   PN  L +  +   D G YKC+             +P    S V  + VK ++AAL+PF+GI  EV++L   IL YEK + +S+
Sbjct:  131 VEGEKMSVTCS--VVGTKPELTWTF----------ANVTLTNAT-----DRFI-LKPDDNGVPNAILTLDNVTLDDRGEYKCIGRNAANVYGGNTTTPA---SDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEKRRNKSE 254          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: Bsg (gene:FBgn0261822 transcript:FBtr0079572)

HSP 1 Score: 50.0618 bits (118), Expect = 1.964e-6
Identity = 44/145 (30.34%), Postives = 67/145 (46.21%), Query Frame = 1
Query:  583 LEGDPMRITCAYDAYPNATEIRWEMLSVIEYPDKSGNLSLHNSTIIIPNDRMIFISGKDTNKPNDTLFITKLLKTDTGFYKCV-----------VISPQGEDSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYEKYQIRSQ 984
            +EG+ M +TC+        E+ W             N++L N+T     DR I +   D   PN  L +  +   D G YKC+             +P    S V  + VK ++AAL+PF+GI  EV++L   IL YEK + +S+
Sbjct:  131 VEGEKMSVTCS--VVGTKPELTWTF----------ANVTLTNAT-----DRFI-LKPDDNGVPNAILTLDNVTLDDRGEYKCIGRNAANVYGGNTTTPA---SDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEKRRNKSE 254          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: Bsg (gene:FBgn0261822 transcript:FBtr0079566)

HSP 1 Score: 50.0618 bits (118), Expect = 1.964e-6
Identity = 44/145 (30.34%), Postives = 67/145 (46.21%), Query Frame = 1
Query:  583 LEGDPMRITCAYDAYPNATEIRWEMLSVIEYPDKSGNLSLHNSTIIIPNDRMIFISGKDTNKPNDTLFITKLLKTDTGFYKCV-----------VISPQGEDSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYEKYQIRSQ 984
            +EG+ M +TC+        E+ W             N++L N+T     DR I +   D   PN  L +  +   D G YKC+             +P    S V  + VK ++AAL+PF+GI  EV++L   IL YEK + +S+
Sbjct:  131 VEGEKMSVTCS--VVGTKPELTWTF----------ANVTLTNAT-----DRFI-LKPDDNGVPNAILTLDNVTLDDRGEYKCIGRNAANVYGGNTTTPA---SDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEKRRNKSE 254          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: Bsg (gene:FBgn0261822 transcript:FBtr0079567)

HSP 1 Score: 50.0618 bits (118), Expect = 1.964e-6
Identity = 44/145 (30.34%), Postives = 67/145 (46.21%), Query Frame = 1
Query:  583 LEGDPMRITCAYDAYPNATEIRWEMLSVIEYPDKSGNLSLHNSTIIIPNDRMIFISGKDTNKPNDTLFITKLLKTDTGFYKCV-----------VISPQGEDSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYEKYQIRSQ 984
            +EG+ M +TC+        E+ W             N++L N+T     DR I +   D   PN  L +  +   D G YKC+             +P    S V  + VK ++AAL+PF+GI  EV++L   IL YEK + +S+
Sbjct:  131 VEGEKMSVTCS--VVGTKPELTWTF----------ANVTLTNAT-----DRFI-LKPDDNGVPNAILTLDNVTLDDRGEYKCIGRNAANVYGGNTTTPA---SDVTTVRVKGKFAALWPFLGICAEVLILCIIILIYEKRRNKSE 254          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: bsg (basigin [Source:ZFIN;Acc:ZDB-GENE-030131-9638])

HSP 1 Score: 68.5514 bits (166), Expect = 2.127e-12
Identity = 57/195 (29.23%), Postives = 88/195 (45.13%), Query Frame = 1
Query:  457 KFEFIQTGVYKMEITIRNEKVSNISHVYSSPIVNKFTKPKLGLEGDPMRITCAYDAYPNATEIRWEMLSVIEYPDKSGNLSLHNSTIIIPNDRMIFISGKDTNKPNDT-LFITKL-LKTDTGFYKCVVISPQGEDSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYEKYQIRSQNRKNYGENVDEDNNKDP 1035
            K ++  +G+Y        +  + I  V + P +      +   E D   ++C    YP+ T+  W  L     PD      + N T    +D+    S      PN T L++  L +  D GFY+C   S  G  +  I++ V+ + AAL+PF+GIV EVI+L+T I  YEK       RK    N D+D+   P
Sbjct:   82 KADYHHSGIYTCVFLTEPQANATI-EVKALPHIKASKSSENANEKDKAVLSCGSQGYPSPTDWSWFKL-----PDAGERTPIFNGT----DDKYEIKS-----TPNKTTLYVKDLDINEDMGFYQCQGTSEVGTGTDDIQLRVRSQLAALWPFLGIVAEVIILITIIFVYEK------RRKPDEINDDDDSGSAP 255          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: bsg (basigin [Source:ZFIN;Acc:ZDB-GENE-030131-9638])

HSP 1 Score: 68.1662 bits (165), Expect = 2.274e-12
Identity = 57/195 (29.23%), Postives = 88/195 (45.13%), Query Frame = 1
Query:  457 KFEFIQTGVYKMEITIRNEKVSNISHVYSSPIVNKFTKPKLGLEGDPMRITCAYDAYPNATEIRWEMLSVIEYPDKSGNLSLHNSTIIIPNDRMIFISGKDTNKPNDT-LFITKL-LKTDTGFYKCVVISPQGEDSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYEKYQIRSQNRKNYGENVDEDNNKDP 1035
            K ++  +G+Y        +  + I  V + P +      +   E D   ++C    YP+ T+  W  L     PD      + N T    +D+    S      PN T L++  L +  D GFY+C   S  G  +  I++ V+ + AAL+PF+GIV EVI+L+T I  YEK       RK    N D+D+   P
Sbjct:   69 KADYHHSGIYTCVFLTEPQANATIE-VKALPHIKASKSSENANEKDKAVLSCGSQGYPSPTDWSWFKL-----PDAGERTPIFNGT----DDKYEIKS-----TPNKTTLYVKDLDINEDMGFYQCQGTSEVGTGTDDIQLRVRSQLAALWPFLGIVAEVIILITIIFVYEK------RRKPDEINDDDDSGSAP 242          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: bsg (basigin [Source:ZFIN;Acc:ZDB-GENE-030131-9638])

HSP 1 Score: 68.1662 bits (165), Expect = 2.789e-12
Identity = 57/195 (29.23%), Postives = 88/195 (45.13%), Query Frame = 1
Query:  457 KFEFIQTGVYKMEITIRNEKVSNISHVYSSPIVNKFTKPKLGLEGDPMRITCAYDAYPNATEIRWEMLSVIEYPDKSGNLSLHNSTIIIPNDRMIFISGKDTNKPNDT-LFITKL-LKTDTGFYKCVVISPQGEDSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYEKYQIRSQNRKNYGENVDEDNNKDP 1035
            K ++  +G+Y        +  + I  V + P +      +   E D   ++C    YP+ T+  W  L     PD      + N T    +D+    S      PN T L++  L +  D GFY+C   S  G  +  I++ V+ + AAL+PF+GIV EVI+L+T I  YEK       RK    N D+D+   P
Sbjct:   94 KADYHHSGIYTCVFLTEPQANATI-EVKALPHIKASKSSENANEKDKAVLSCGSQGYPSPTDWSWFKL-----PDAGERTPIFNGT----DDKYEIKS-----TPNKTTLYVKDLDINEDMGFYQCQGTSEVGTGTDDIQLRVRSQLAALWPFLGIVAEVIILITIIFVYEK------RRKPDEINDDDDSGSAP 267          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: bsg (basigin [Source:ZFIN;Acc:ZDB-GENE-030131-9638])

HSP 1 Score: 68.1662 bits (165), Expect = 6.030e-12
Identity = 57/195 (29.23%), Postives = 88/195 (45.13%), Query Frame = 1
Query:  457 KFEFIQTGVYKMEITIRNEKVSNISHVYSSPIVNKFTKPKLGLEGDPMRITCAYDAYPNATEIRWEMLSVIEYPDKSGNLSLHNSTIIIPNDRMIFISGKDTNKPNDT-LFITKL-LKTDTGFYKCVVISPQGEDSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYEKYQIRSQNRKNYGENVDEDNNKDP 1035
            K ++  +G+Y        +  + I  V + P +      +   E D   ++C    YP+ T+  W  L     PD      + N T    +D+    S      PN T L++  L +  D GFY+C   S  G  +  I++ V+ + AAL+PF+GIV EVI+L+T I  YEK       RK    N D+D+   P
Sbjct:  199 KADYHHSGIYTCVFLTEPQANATI-EVKALPHIKASKSSENANEKDKAVLSCGSQGYPSPTDWSWFKL-----PDAGERTPIFNGT----DDKYEIKS-----TPNKTTLYVKDLDINEDMGFYQCQGTSEVGTGTDDIQLRVRSQLAALWPFLGIVAEVIILITIIFVYEK------RRKPDEINDDDDSGSAP 372          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: bsg (basigin [Source:ZFIN;Acc:ZDB-GENE-030131-9638])

HSP 1 Score: 68.1662 bits (165), Expect = 6.351e-12
Identity = 57/195 (29.23%), Postives = 88/195 (45.13%), Query Frame = 1
Query:  457 KFEFIQTGVYKMEITIRNEKVSNISHVYSSPIVNKFTKPKLGLEGDPMRITCAYDAYPNATEIRWEMLSVIEYPDKSGNLSLHNSTIIIPNDRMIFISGKDTNKPNDT-LFITKL-LKTDTGFYKCVVISPQGEDSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYEKYQIRSQNRKNYGENVDEDNNKDP 1035
            K ++  +G+Y        +  + I  V + P +      +   E D   ++C    YP+ T+  W  L     PD      + N T    +D+    S      PN T L++  L +  D GFY+C   S  G  +  I++ V+ + AAL+PF+GIV EVI+L+T I  YEK       RK    N D+D+   P
Sbjct:  211 KADYHHSGIYTCVFLTEPQANATI-EVKALPHIKASKSSENANEKDKAVLSCGSQGYPSPTDWSWFKL-----PDAGERTPIFNGT----DDKYEIKS-----TPNKTTLYVKDLDINEDMGFYQCQGTSEVGTGTDDIQLRVRSQLAALWPFLGIVAEVIILITIIFVYEK------RRKPDEINDDDDSGSAP 384          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: slc25a13 (solute carrier family 25 member 13 [Source:Xenbase;Acc:XB-GENE-1013331])

HSP 1 Score: 62.7734 bits (151), Expect = 5.023e-10
Identity = 47/142 (33.10%), Postives = 73/142 (51.41%), Query Frame = 1
Query:  547 PIVNKFTKPKLGLEGDPMRITCAYDAYPNATEIRWEMLSVIEYPDKSGNLSLHNSTIIIPNDR-MIFISGKDTNKPNDTLFITKL-LKTDTGFYKCVVISPQGEDSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYEK 966
            P V+ +   + G EGD   +TC   ++P  T+  W ++S       +G  ++ N +    +DR +I  SG  T      L I  L ++ D   Y C   +  G    V+ ++V+ R AAL+PF+GIV EV++LVT I  YEK
Sbjct:  225 PQVHHYKATEHGNEGDTGVLTCKSSSFPPVTDWSWYIVS------PNGVEAIGNGS----SDRYVIKSSGNQT-----VLRIHNLDIENDQHDYTCNGTNELGAKGDVVHLHVRSRLAALWPFLGIVGEVVVLVTIIFIYEK 351          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: slc25a13 (solute carrier family 25 member 13 [Source:Xenbase;Acc:XB-GENE-1013331])

HSP 1 Score: 62.003 bits (149), Expect = 5.441e-10
Identity = 44/141 (31.21%), Postives = 71/141 (50.35%), Query Frame = 1
Query:  547 PIVNKFTKPKLGLEGDPMRITCAYDAYPNATEIRWEMLSVIEYPDKSGNLSLHNSTIIIPNDRMIFISGKDTNKPNDTLFITKL-LKTDTGFYKCVVISPQGEDSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYEK 966
            P V+ +   + G EGD   +TC   ++P  T+  W ++S       +G  ++ N +    +DR +  S  +       L I  L ++ D   Y C   +  G    V+ ++V+ R AAL+PF+GIV EV++LVT I  YEK
Sbjct:  108 PQVHHYKATEHGNEGDTGVLTCKSSSFPPVTDWSWYIVS------PNGVEAIGNGS----SDRYVIKSSGN----QTVLRIHNLDIENDQHDYTCNGTNELGAKGDVVHLHVRSRLAALWPFLGIVGEVVVLVTIIFIYEK 234          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: slc25a13 (solute carrier family 25 member 13 [Source:Xenbase;Acc:XB-GENE-1013331])

HSP 1 Score: 62.003 bits (149), Expect = 9.565e-10
Identity = 44/141 (31.21%), Postives = 71/141 (50.35%), Query Frame = 1
Query:  547 PIVNKFTKPKLGLEGDPMRITCAYDAYPNATEIRWEMLSVIEYPDKSGNLSLHNSTIIIPNDRMIFISGKDTNKPNDTLFITKL-LKTDTGFYKCVVISPQGEDSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYEK 966
            P V+ +   + G EGD   +TC   ++P  T+  W ++S       +G  ++ N +    +DR +  S  +       L I  L ++ D   Y C   +  G    V+ ++V+ R AAL+PF+GIV EV++LVT I  YEK
Sbjct:  225 PQVHHYKATEHGNEGDTGVLTCKSSSFPPVTDWSWYIVS------PNGVEAIGNGS----SDRYVIKSSGN----QTVLRIHNLDIENDQHDYTCNGTNELGAKGDVVHLHVRSRLAALWPFLGIVGEVVVLVTIIFIYEK 351          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: rabepk (Rab9 effector protein with kelch motifs [Source:Xenbase;Acc:XB-GENE-1009616])

HSP 1 Score: 53.9138 bits (128), Expect = 2.754e-7
Identity = 57/204 (27.94%), Postives = 86/204 (42.16%), Query Frame = 1
Query:  451 FTKFEFI-----QTGVYKMEITIRNEKVSNISHVYSSPIVNKFTKPKLGLEGDPMRITCAYDAYPNATEIRWEMLSVIEYPDKSGNLSLHNSTIIIPNDRMIFISGKDTNKPNDT-LFITKLLKTDTGFYKCVVISPQGEDSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYE------KYQIRSQNRKNYGENVDEDNN 1026
             T +EF+     +TG Y   I  R+ +V    H+ + P V    KP +   GD + + C    Y     I W    V E      N+SL ++   + + R            N+T L ++ L + D+G Y C  I   GE  G +K++V      L  F  I  EV +LVT IL YE      + Q  +QN     EN+  + +
Sbjct:  112 HTVYEFVLSDPSKTGTYTC-IFNRSSEVKAEFHI-TVPAVKGVDKPLVTYNGDSIVMKCDSSKY---NPIEWIWYKVNESEKVQLNMSLDSTKYTVEHKRA-----------NETKLQVSALSEKDSGTYICKAIFKVGESEGQVKLSVLSYMVPLKVFFIIAAEVAVLVTVILVYEMKTKKKEPQPDAQNETEQAENLKSEES 299          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Bsg (basigin [Source:MGI Symbol;Acc:MGI:88208])

HSP 1 Score: 64.6994 bits (156), Expect = 1.797e-11
Identity = 52/166 (31.33%), Postives = 80/166 (48.19%), Query Frame = 1
Query:  532 HVYSSPIVNKFTKPKLGLEGDPMRITCAYDA-YPNATEIRWEMLSVIEYPDKSGNLSLHNSTIIIPNDRMIFISGKDTNKPNDTLFITKL-LKTDTGFYKCVVISPQGEDSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYEKYQIRSQNRKNYGENVDEDN 1023
            +V   P +    K +   EG+  ++ C  DA YP  T+  W   S     D     ++ NST    N + + +S  + ++    L I+ L +  D G Y C   + QG     I + V+ R AAL+PF+GIV EV++LVT I  YEK       R+   + +DED+
Sbjct:   45 NVEGPPRIKVGKKSEHSSEGELAKLVCKSDASYPPITDWFWFKTS-----DTGEEEAITNSTEA--NGKYVVVSTPEKSQ----LTISNLDVNVDPGTYVCNATNAQGTTRETISLRVRSRMAALWPFLGIVAEVLVLVTIIFIYEK-------RRKPDQTLDEDD 192          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Bsg (basigin [Source:MGI Symbol;Acc:MGI:88208])

HSP 1 Score: 64.6994 bits (156), Expect = 3.857e-11
Identity = 51/166 (30.72%), Postives = 80/166 (48.19%), Query Frame = 1
Query:  532 HVYSSPIVNKFTKPKLGLEGDPMRITCAYDA-YPNATEIRWEMLSVIEYPDKSGNLSLHNSTIIIPNDRMIFISGKDTNKPNDTLFITKL-LKTDTGFYKCVVISPQGEDSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYEKYQIRSQNRKNYGENVDEDN 1023
            +V   P +    K +   EG+  ++ C  DA YP  T+  W      +  D     ++ NST    N + + +S  + ++    L I+ L +  D G Y C   + QG     I + V+ R AAL+PF+GIV EV++LVT I  YEK       R+   + +DED+
Sbjct:  100 NVEGPPRIKVGKKSEHSSEGELAKLVCKSDASYPPITDWFW-----FKTSDTGEEEAITNSTEA--NGKYVVVSTPEKSQ----LTISNLDVNVDPGTYVCNATNAQGTTRETISLRVRSRMAALWPFLGIVAEVLVLVTIIFIYEK-------RRKPDQTLDEDD 247          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Bsg (basigin [Source:MGI Symbol;Acc:MGI:88208])

HSP 1 Score: 63.929 bits (154), Expect = 1.564e-10
Identity = 52/165 (31.52%), Postives = 79/165 (47.88%), Query Frame = 1
Query:  535 VYSSPIVNKFTKPKLGLEGDPMRITCAYDA-YPNATEIRWEMLSVIEYPDKSGNLSLHNSTIIIPNDRMIFISGKDTNKPNDTLFITKL-LKTDTGFYKCVVISPQGEDSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYEKYQIRSQNRKNYGENVDEDN 1023
            V   P +    K +   EG+  ++ C  DA YP  T+  W   S     D     ++ NST    N + + +S  + ++    L I+ L +  D G Y C   + QG     I + V+ R AAL+PF+GIV EV++LVT I  YEK       R+   + +DED+
Sbjct:  217 VEGPPRIKVGKKSEHSSEGELAKLVCKSDASYPPITDWFWFKTS-----DTGEEEAITNSTEA--NGKYVVVSTPEKSQ----LTISNLDVNVDPGTYVCNATNAQGTTRETISLRVRSRMAALWPFLGIVAEVLVLVTIIFIYEK-------RRKPDQTLDEDD 363          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q28740|BASI_RABIT (Basigin OS=Oryctolagus cuniculus OX=9986 GN=BSG PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 5.475e-14
Identity = 61/207 (29.47%), Postives = 93/207 (44.93%), Query Frame = 1
Query:  547 PIVNKFTKPKLGLEGDPMRITCAYDAYPNATEIRWEMLSVIEYPDKSGNLSLHNSTIIIPNDRMIFISGKDTNKPNDTLFITKL-LKTDTGFYKCVVISPQGEDSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYEKYQIRSQNRKNYGENVDEDNNKDPDMLLTNRTGDDENVPAEIDNQQVEIEGEKVNNNVDPSVKQREA 1164
            P +    K +   EGD + + C  +++P  T   W  ++       SG+  + N +         FIS    ++    L I  L L +D G Y C   S QG D+ V+ + V+ R AAL+PF+GIV EV++LVT I  YEK                    + PD +L     DDE+  A      ++  G  VN++   +V+QR A
Sbjct:  105 PRIKAVKKSEHANEGDSVTLLCKSESFPFVTAWVWYKVA------DSGDQVIQNGS-----QSRFFIS---HSEAQSELHIKDLDLTSDPGEYACNGTSLQGTDAAVVTLRVRSRLAALWPFLGIVAEVLVLVTVIFIYEK-------------------RRKPDEVL-----DDEDAGA----APLKSSGHHVNDDKGKNVRQRNA 269          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q99PA3|BASI_CRIGR (Basigin (Fragment) OS=Cricetulus griseus OX=10029 GN=BSG PE=2 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 4.887e-11
Identity = 51/165 (30.91%), Postives = 82/165 (49.70%), Query Frame = 1
Query:  535 VYSSPIVNKFTKPKLGLEGDPMRITCAYDA-YPNATEIRWEMLSVIEYPDKSGNLSLHNSTIIIPNDRMIFISGKDTNKPNDTLFITKL-LKTDTGFYKCVVISPQGEDSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYEKYQIRSQNRKNYGENVDEDN 1023
            V   P +    K +   EG+ +R+ C  ++ +P  TE  W   S       SG+  + NS+      + + IS  D ++    L I+ L + +D G Y C   + QG    ++ + V+ R AAL+PF+GIV EV++LVT I  YEK       R+   + +DED+
Sbjct:   80 VEGPPRIKVGKKSEHSSEGENVRLICKSESSHPPVTEWSWFKTS------DSGDQLITNSS----ESKYVVISTADRSE----LTISNLDINSDPGTYMCNATNTQGSVQEIMTLRVRSRLAALWPFLGIVAEVLVLVTIIFIYEK-------RRKPDQTLDEDD 223          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|P17790|BASI_CHICK (Basigin OS=Gallus gallus OX=9031 GN=BSG PE=1 SV=2)

HSP 1 Score: 67.3958 bits (163), Expect = 7.932e-11
Identity = 60/203 (29.56%), Postives = 90/203 (44.33%), Query Frame = 1
Query:  472 QTGVYKMEITIRNEKVSNISHVYSSPIVNKFTKPKLGLEGDPMRITCAYDAYPNATEIRWEMLSVIEYPDKSGNLSLHNSTIIIPNDRMIFISGKDTNKPNDTLFITKL-LKTDTGFYKCVVISPQGEDSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYEKYQIRSQNRKNYGENVDEDNNKDPDMLLTNRTGDDENV 1077
             +GVY+           N+S +   P V  + K + G EGD   +TC   +YP      W          KSG       T+ + +   I+   +  NK    L I KL ++ D G Y C   + +G  S  + + V+ R AAL+PF+GIV EV++LVT I  YEK       R+   E +D+D+     +        D+NV
Sbjct:  205 HSGVYECIYNTNPVAKGNVS-IEVEPQVVAYKKSEHGNEGDVGVLTCKSPSYPPVDHWAWY---------KSGQ------TVPLESSAGIYNISRTGNKTE--LRILKLNIEQDMGDYSCNGTNMKGSGSATVNLRVRSRLAALWPFLGIVAEVLVLVTIIFIYEK-------RRKPDEVLDDDDGGSAPLKSNATNHKDKNV 382          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|P35613|BASI_HUMAN (Basigin OS=Homo sapiens OX=9606 GN=BSG PE=1 SV=2)

HSP 1 Score: 64.6994 bits (156), Expect = 6.703e-10
Identity = 39/130 (30.00%), Postives = 67/130 (51.54%), Query Frame = 1
Query:  586 EGDPMRITCAYDAYPNATEIRWEMLSVIEYPDKSGNLSLHNSTIIIPNDRMIFISGKDTNKPNDTLFITKL-LKTDTGFYKCVVISPQGEDSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYEKYQ 972
            EG+   + C  ++ P  T+  W    + +  DK+         ++  ++   F+S   +++    L I  L ++ D G Y+C   S +G D  +I + V+   AAL+PF+GIV EV++LVT I  YEK +
Sbjct:  234 EGETAMLVCKSESVPPVTD--WAWYKITDSEDKA---------LMNGSESRFFVS---SSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRR 349          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|P18572|BASI_MOUSE (Basigin OS=Mus musculus OX=10090 GN=Bsg PE=1 SV=2)

HSP 1 Score: 63.929 bits (154), Expect = 1.094e-9
Identity = 52/165 (31.52%), Postives = 79/165 (47.88%), Query Frame = 1
Query:  535 VYSSPIVNKFTKPKLGLEGDPMRITCAYDA-YPNATEIRWEMLSVIEYPDKSGNLSLHNSTIIIPNDRMIFISGKDTNKPNDTLFITKL-LKTDTGFYKCVVISPQGEDSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYEKYQIRSQNRKNYGENVDEDN 1023
            V   P +    K +   EG+  ++ C  DA YP  T+  W   S     D     ++ NST    N + + +S  + ++    L I+ L +  D G Y C   + QG     I + V+ R AAL+PF+GIV EV++LVT I  YEK       R+   + +DED+
Sbjct:  217 VEGPPRIKVGKKSEHSSEGELAKLVCKSDASYPPITDWFWFKTS-----DTGEEEAITNSTEA--NGKYVVVSTPEKSQ----LTISNLDVNVDPGTYVCNATNAQGTTRETISLRVRSRMAALWPFLGIVAEVLVLVTIIFIYEK-------RRKPDQTLDEDD 363          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A5K3EPP5 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 9.059e-32
Identity = 88/304 (28.95%), Postives = 157/304 (51.64%), Query Frame = 1
Query:  103 MVYIYFVYALVFFCITVNSYSLNSLGSPTIPTKNQLVKIDNYEYNKLQRDESGNVSLAFQLEGAIDSEIGKITLNVNNQNQANIEIIKPSDTVSKGQKIYITKEXXXXXXXXXXXXFTKFEFIQTGVYKMEITIRNEKVSNISHVYSSPIVNKFTKPKLGLEGDPMRITCAYDAYPNATEIRWEMLSV-IEYPDKSGNLSLHNSTIIIPNDRMIFISGKD---------TNKPNDTLFITKLLKTDTGFYKCVVISPQGEDSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYEKYQIRSQ 984
            ++ I+ + +   F  TV S       + T+PT    ++ ++ ++ K  ++E+ ++ L + + G   +++ K++   NN++   I +    D      KI+  +E  S   ++      K +   +G+Y + I    E  S  +HVY++PI+  ++KPK  L+GDP+RI+C    YP    ++W    + +E  D    +S  ++     N R I ++ K+            PNDTL ++    +  G + C V +  G DS  + + VKDRWAAL+PFIGIV+EV ++V AIL YE++QIR +
Sbjct:    7 VIGIFLLLSQFTFGFTVESSE-----NATLPTHTSNLQYESIQFLKRSKNETVHLKLKYVINGLTSTDV-KLSWAFNNES---ISVSNSEDR----NKIFAQREFDSGGNLISVTLNLKDDAANSGIYVLTINAGRESASGAAHVYAAPILPVYSKPKRVLQGDPLRISCRVSGYPTPDSVQWLFAPIAVELSDDKAAISDASA-----NLRPIDLTDKEWENAKLYNEDGTPNDTLRLSAPNISQNGLFACNVSNILGTDSTFLLVGVKDRWAALWPFIGIVVEVTVIVAAILLYERHQIRKK 292          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A183K6F0 (Ig-like domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS10575 PE=4 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 2.716e-31
Identity = 66/172 (38.37%), Postives = 99/172 (57.56%), Query Frame = 1
Query:  478 GVYKMEITIRNEKVSNISHVYSSPIVNKFTKPKLGLEGDPMRITCAYDAYPNATEIRWEMLSVIEYP---DKSGNLSLHNSTIIIPNDRMIFISGKDTNKPNDTLFITKLLKTDTGFYKCVVISPQGEDSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYEKYQIRSQ 984
            G Y +  T+     S     YS+P++  FTKPK  LEGD MR+ C   +YP  + + W   S+       D + N +L+N   ++ N+    +   D   PNDTL    L ++D G Y C V + +G D  ++ +NVKDRWAAL+PFIGI++EV +LV AIL YE++Q+ ++
Sbjct:   91 GNYTLIATMGGVTSSGSGQAYSAPVLPLFTKPKRVLEGDIMRLVCRVSSYPQPSSVIWSFASIQASQMDDDNAINTALYNLLPLLTNETHYVLETSDGGTPNDTLRFLDLKESDNGLYACNVSTERGTDFALMVVNVKDRWAALWPFIGIIVEVTILVAAILLYERHQMHTK 262          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A430Q1H2 (Ig-like domain-containing protein OS=Schistosoma bovis OX=6184 GN=DC041_0002950 PE=4 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 3.040e-30
Identity = 66/172 (38.37%), Postives = 99/172 (57.56%), Query Frame = 1
Query:  478 GVYKMEITIRNEKVSNISHVYSSPIVNKFTKPKLGLEGDPMRITCAYDAYPNATEIRWEMLSVIEYP---DKSGNLSLHNSTIIIPNDRMIFISGKDTNKPNDTLFITKLLKTDTGFYKCVVISPQGEDSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYEKYQIRSQ 984
            G Y +  T+     S     YS+P++  FTKPK  LEGD MR+ C   +YP  + + W   S+       D + N +L+N   ++ N+    +   D   PNDTL    L ++D G Y C V + +G D  ++ +NVKDRWAAL+PFIGI++EV +LV AIL YE++Q+ ++
Sbjct:   91 GNYTLIATMGGVTSSGSGQAYSAPVLPLFTKPKRVLEGDIMRLVCRVSSYPQPSSVIWSFASIQASQMDDDNAINTALYNLLPLLTNETHYVLETSDGGTPNDTLRFLDLKESDNGLYACNVSTERGTDFALMVVNVKDRWAALWPFIGIIVEVTILVAAILLYERHQMHTK 262          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A0R3TKF2 (Ig-like domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS7643 PE=4 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 4.635e-30
Identity = 88/272 (32.35%), Postives = 141/272 (51.84%), Query Frame = 1
Query:  190 IPTKNQLVKIDNYEYNKLQRDESGNVSLAFQLEGAIDSEIGKITLNVNNQNQANIEIIKPSDTVSKGQKIYITKEXXXXXXXXXXXXFTKFEFIQTGVYKMEITIRNEKVSNISHVYSSPIVNKFTKPKLGLEGDPMRITCAYDAYPNATEIRWEMLSV-IEYPDKSGNLSLHNSTII---IPNDR---MIFISGKDTNKPNDTLFITKLLKTDTGFYKCVVISPQGEDSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYEKYQIRSQ 984
            +PT    ++ ++ ++ K  ++ES N++L F +   + S+   I+L  NNQ+   I +  P D +     +Y  K L S+  +       K     +G YK+ +T  ++  S ++ V S+PI+  ++KPK  L+GDP+RI+C    YP    + W    + +E  D    +S     ++     N+     IF S   T  PNDTL    +     G + C V +  G DS  + + VKDRWAAL+PF+ IV+EV LLVT IL YE++QIR +
Sbjct:   18 LPTFMSSIQYESIQFQKRAKNESLNLALKFNVVD-VPSKSVAISLLYNNQS---ISVGTPDDRM----DVYAEKHLNSSGFLTDITLHLKNSAANSGSYKLTLTSDSQTASAVAKVDSAPILPVYSKPKRVLQGDPLRISCRVSCYPTPVNVSWFFAPIPVELSDDKTAISEAAGLLVEIDFSNESWKDAIFSSEGGT--PNDTLKFESISIAQNGLFACNVSNVIGSDSTFLLVGVKDRWAALWPFVAIVVEVTLLVTGILLYERHQIRKK 279          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A0X3PF15 (Basigin OS=Schistocephalus solidus OX=70667 GN=BASI PE=4 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 8.407e-30
Identity = 92/303 (30.36%), Postives = 149/303 (49.17%), Query Frame = 1
Query:  190 IPTKNQLVKIDNYEYNKLQRDESGNVSLAFQLEGAIDSEIGKITLNVNNQNQANIEIIKPSDTVSKGQKIYITKEXXXXXXXXXXXXFTKFEFIQTGVYKMEITIRNEKVSNISHVYSSPIVNKFTKPKLGLEGDPMRITCAYDAYPNATEIRWEM--LSVIEYPDKSG--NLSLHNSTIIIPNDRMIFISGKDTNK---PNDTLFITKLLKTDTGFYKCVVISPQGEDSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYEKYQIRSQNRKNYGENVDEDNNKDPDMLLTNRTGDDENV 1077
            +PT   L++ +N E+ K  R+ S ++ L++ + G    ++  +T  +N       E++   D  S+   +Y      +           K   I  G Y +  T      +  + V S+PI+  ++KPK  L+GDP+R++C   A+P    ++W    + V +  DK+   N  LH   + +  D + + + K T +    +DTL  T+L     G Y C V +  GED   + ++VKDRWAAL+PFIGIVIEV +LV AIL YE++Q+RS+       NVD  +       +  RT   E V
Sbjct:   31 LPTYTSLLQYENIEFPKRNRNSSVHLVLSYVVTGLQGPDVS-LTWQLNG------EVLTLQDQSSRA-TLYAVTNYDTASRKESVDLHLKDSGILPGEYTLTATQSGASATGKASVKSAPILPVYSKPKRVLQGDPLRLSCKVSAWPVPPNVKWSFHHIDVAQSDDKTAINNAFLHLKPLDL--DALQWENVKYTTEDDVQSDTLRFTELDPKHNGLYACKVSNALGEDVTFLLVDVKDRWAALWPFIGIVIEVTVLVAAILLYERHQMRSKPPTANNANVDSASPNGAASGVNERTSRTEEV 323          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: bsg (basigin (Ok blood group) [Source:NCBI gene;Acc:103043475])

HSP 1 Score: 66.6254 bits (161), Expect = 7.001e-12
Identity = 54/182 (29.67%), Postives = 80/182 (43.96%), Query Frame = 1
Query:  457 KFEFIQTGVYKMEITIRNEKVSNISHVYSSPIVNKFTKPKLGLEGDPMRITCAYDAYPNATEIRWEMLSVIEYPDKSGNLSLHNSTIIIPNDRMIFISG---------KDTNKPNDTLFITKL-LKTDTGFYKCVVISPQGEDSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYEKYQ 972
            K ++  +G Y        E   +I  V   P V+ + + +   E D   + C    YP   +  W  L                      N R + +SG         K+T+  N TL I  L +  D G Y+C+  +  GE+SG + + V+ R AAL+PF+GIV EVI+LVT I  YEK +
Sbjct:   82 KIDYHVSGKYTCVFMSEPEAKHDIE-VMVPPHVSPYKQSENSNEKDKAALVCVNHGYPYIKDWEWYKLEE-------------------SNGRRLIVSGVNGTGKYVVKNTDH-NSTLTIDDLDINGDMGTYECLGKNDLGENSGKVNLRVRSRLAALWPFLGIVAEVIILVTIIFIYEKRR 242          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: bsg (basigin (Ok blood group) [Source:NCBI gene;Acc:103043475])

HSP 1 Score: 66.6254 bits (161), Expect = 1.870e-11
Identity = 60/203 (29.56%), Postives = 87/203 (42.86%), Query Frame = 1
Query:  457 KFEFIQTGVYKMEITIRNEKVSNISHVYSSPIVNKFTKPKLGLEGDPMRITCAYDAYPNATEIRWEMLSVIEYPDKSGNLSLHNSTIIIPNDRMIFISG---------KDTNKPNDTLFITKL-LKTDTGFYKCVVISPQGEDSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYEKYQIRSQNRKNYGENVDEDNNKDP 1035
            K ++  +G Y        E   +I  V   P V+ + + +   E D   + C    YP   +  W  L                      N R + +SG         K+T+  N TL I  L +  D G Y+C+  +  GE+SG + + V+ R AAL+PF+GIV EVI+LVT I  YEK       RK    N D+D+   P
Sbjct:  199 KIDYHVSGKYTCVFMSEPEAKHDIE-VMVPPHVSPYKQSENSNEKDKAALVCVNHGYPYIKDWEWYKLEE-------------------SNGRRLIVSGVNGTGKYVVKNTDH-NSTLTIDDLDINGDMGTYECLGKNDLGENSGKVNLRVRSRLAALWPFLGIVAEVIILVTIIFIYEK------RRKPDEINDDDDSGSAP 374          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: bsg (basigin (Ok blood group) [Source:NCBI gene;Acc:103043475])

HSP 1 Score: 65.4698 bits (158), Expect = 3.755e-11
Identity = 54/180 (30.00%), Postives = 79/180 (43.89%), Query Frame = 1
Query:  457 KFEFIQTGVYKMEITIRNEKVSNISHVYSSPIVNKFTKPKLGLEGDPMRITCAYDAYPNATEIRWEMLSVIEYPDKSGNLSLHNSTIIIPNDRMIFISG---------KDTNKPNDTLFITKL-LKTDTGFYKCVVISPQGEDSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYEK 966
            K ++  +G Y        E   +I  V   P V+ + + +   E D   + C    YP   +  W  L                      N R + +SG         K+T+  N TL I  L +  D G Y+C+  +  GE+SG + + V+ R AAL+PF+GIV EVI+LVT I  YEK
Sbjct:  199 KIDYHVSGKYTCVFMSEPEAKHDIE-VMVPPHVSPYKQSENSNEKDKAALVCVNHGYPYIKDWEWYKLEE-------------------SNGRRLIVSGVNGTGKYVVKNTDH-NSTLTIDDLDINGDMGTYECLGKNDLGENSGKVNLRVRSRLAALWPFLGIVAEVIILVTIIFIYEK 357          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: nptna (neuroplastin a [Source:ZFIN;Acc:ZDB-GENE-030804-7])

HSP 1 Score: 54.6842 bits (130), Expect = 1.834e-8
Identity = 44/180 (24.44%), Postives = 77/180 (42.78%), Query Frame = 1
Query:  454 TKFEFIQTGVYKMEITIRNEKVSNIS--HVYSSPIVNKFTKPKLGLEGDPMRITCAYDAYPNATEIRWEM-------LSVIEYPDKSGNLSLHNSTIIIPNDRMIFISGKDTNKPNDTLFITKLLKTDTGFYKCVVISPQGEDSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYEK 966
            TK +   +GVY            NI+     + P +    K +   EGD   + C  + YP+  +  W         + V+    + G L++ ++     N  ++ + G              ++ TD G Y C   + +G  +  + + V+ R AAL+PF+GIV EV++L+  I  YEK
Sbjct:  184 TKPKAEHSGVYVCVFQTSPPAKGNITVKSCAAWPDITTHKKSENHGEGDAAELVCKCNGYPD-VDWTWSYKPRDNDDVVVVANGSRDGRLAIASTG----NQTVLSLHGL-------------VVDTDGGEYTCQATNSEGTATHTMLLRVRSRLAALWPFLGIVAEVVILIAIIFIYEK 345          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: RNF126 (ring finger protein 126 [Source:NCBI gene;Acc:101169433])

HSP 1 Score: 73.559 bits (179), Expect = 3.028e-14
Identity = 70/211 (33.18%), Postives = 99/211 (46.92%), Query Frame = 1
Query:  457 KFEFIQTGVYKMEITIRNE-KVSNISHVYSSPIVNKFTKPKLGLEGDPMRITCAYDAYPNATEIRWEMLSVIEYPDKSGNLSL-HNSTIIIPNDRMIFISGKDTNKPNDT-LFITKL-LKTDTGFYKCVVISPQGEDSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYEKYQIRSQNRKNYGENVDEDNNKDPDMLLTNRTGDDENV 1077
            K    QTG+Y  E     E +V ++  V ++P V+ +   + G E D   +TC    YP  T+  W       +  + G  +L  N T    +DR    S      PN T L I  L ++TD G Y C   +  G ++  I + V+ R AAL+PF+GIV EVI+LVT I  YEK       RK    N D+D+   P    +N    D+NV
Sbjct:   80 KISHAQTGMY--ECVFETEPQVKDVIEVKNAPHVSAYKHSEHGSENDKGVMTCVGHGYPLPTDWVW-------FKQEDGEQTLISNGT----SDRYEIKS-----TPNKTVLTINDLNIETDIGNYICAGTNEVGTNTDKIYLRVRSRLAALWPFLGIVAEVIILVTIIFIYEK------RRKPDEVNDDDDSGAAPLKSNSNANHKDKNV 266          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: RNF126 (ring finger protein 126 [Source:NCBI gene;Acc:101169433])

HSP 1 Score: 73.559 bits (179), Expect = 8.439e-14
Identity = 70/211 (33.18%), Postives = 99/211 (46.92%), Query Frame = 1
Query:  457 KFEFIQTGVYKMEITIRNE-KVSNISHVYSSPIVNKFTKPKLGLEGDPMRITCAYDAYPNATEIRWEMLSVIEYPDKSGNLSL-HNSTIIIPNDRMIFISGKDTNKPNDT-LFITKL-LKTDTGFYKCVVISPQGEDSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYEKYQIRSQNRKNYGENVDEDNNKDPDMLLTNRTGDDENV 1077
            K    QTG+Y  E     E +V ++  V ++P V+ +   + G E D   +TC    YP  T+  W       +  + G  +L  N T    +DR    S      PN T L I  L ++TD G Y C   +  G ++  I + V+ R AAL+PF+GIV EVI+LVT I  YEK       RK    N D+D+   P    +N    D+NV
Sbjct:  197 KISHAQTGMY--ECVFETEPQVKDVIEVKNAPHVSAYKHSEHGSENDKGVMTCVGHGYPLPTDWVW-------FKQEDGEQTLISNGT----SDRYEIKS-----TPNKTVLTINDLNIETDIGNYICAGTNEVGTNTDKIYLRVRSRLAALWPFLGIVAEVIILVTIIFIYEK------RRKPDEVNDDDDSGAAPLKSNSNANHKDKNV 383          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: RNF126 (ring finger protein 126 [Source:NCBI gene;Acc:101169433])

HSP 1 Score: 72.7886 bits (177), Expect = 2.123e-13
Identity = 70/211 (33.18%), Postives = 99/211 (46.92%), Query Frame = 1
Query:  457 KFEFIQTGVYKMEITIRNE-KVSNISHVYSSPIVNKFTKPKLGLEGDPMRITCAYDAYPNATEIRWEMLSVIEYPDKSGNLSL-HNSTIIIPNDRMIFISGKDTNKPNDT-LFITKL-LKTDTGFYKCVVISPQGEDSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYEKYQIRSQNRKNYGENVDEDNNKDPDMLLTNRTGDDENV 1077
            K    QTG+Y  E     E +V ++  V ++P V+ +   + G E D   +TC    YP  T+  W       +  + G  +L  N T    +DR    S      PN T L I  L ++TD G Y C   +  G ++  I + V+ R AAL+PF+GIV EVI+LVT I  YEK       RK    N D+D+   P    +N    D+NV
Sbjct:  282 KISHAQTGMY--ECVFETEPQVKDVIEVKNAPHVSAYKHSEHGSENDKGVMTCVGHGYPLPTDWVW-------FKQEDGEQTLISNGT----SDRYEIKS-----TPNKTVLTINDLNIETDIGNYICAGTNEVGTNTDKIYLRVRSRLAALWPFLGIVAEVIILVTIIFIYEK------RRKPDEVNDDDDSGAAPLKSNSNANHKDKNV 468          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000042663.1 (SMESG000042663.1)

HSP 1 Score: 702.975 bits (1813), Expect = 0.000e+0
Identity = 360/360 (100.00%), Postives = 360/360 (100.00%), Query Frame = 1
Query:  103 MVYIYFVYALVFFCITVNSYSLNSLGSPTIPTKNQLVKIDNYEYNKLQRDESGNVSLAFQLEGAIDSEIGKITLNVNNQNQANIEIIKPSDTVSKGQKIYITKEXXXXXXXXXXXXFTKFEFIQTGVYKMEITIRNEKVSNISHVYSSPIVNKFTKPKLGLEGDPMRITCAYDAYPNATEIRWEMLSVIEYPDKSGNLSLHNSTIIIPNDRMIFISGKDTNKPNDTLFITKLLKTDTGFYKCVVISPQGEDSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYEKYQIRSQNRKNYGENVDEDNNKDPDMLLTNRTGDDENVPAEIDNQQVEIEGEKVNNNVDPSVKQREAITTKNV 1182
            MVYIYFVYALVFFCITVNSYSLNSLGSPTIPTKNQLVKIDNYEYNKLQRDESGNVSLAFQLEGAIDSEIGKITLNVNNQNQANIEIIKPSDTVSKGQKIYITKELISNKIILLNIKFTKFEFIQTGVYKMEITIRNEKVSNISHVYSSPIVNKFTKPKLGLEGDPMRITCAYDAYPNATEIRWEMLSVIEYPDKSGNLSLHNSTIIIPNDRMIFISGKDTNKPNDTLFITKLLKTDTGFYKCVVISPQGEDSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYEKYQIRSQNRKNYGENVDEDNNKDPDMLLTNRTGDDENVPAEIDNQQVEIEGEKVNNNVDPSVKQREAITTKNV
Sbjct:    1 MVYIYFVYALVFFCITVNSYSLNSLGSPTIPTKNQLVKIDNYEYNKLQRDESGNVSLAFQLEGAIDSEIGKITLNVNNQNQANIEIIKPSDTVSKGQKIYITKELISNKIILLNIKFTKFEFIQTGVYKMEITIRNEKVSNISHVYSSPIVNKFTKPKLGLEGDPMRITCAYDAYPNATEIRWEMLSVIEYPDKSGNLSLHNSTIIIPNDRMIFISGKDTNKPNDTLFITKLLKTDTGFYKCVVISPQGEDSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYEKYQIRSQNRKNYGENVDEDNNKDPDMLLTNRTGDDENVPAEIDNQQVEIEGEKVNNNVDPSVKQREAITTKNV 360          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000010356.1 (SMESG000010356.1)

HSP 1 Score: 79.337 bits (194), Expect = 2.265e-16
Identity = 52/174 (29.89%), Postives = 87/174 (50.00%), Query Frame = 1
Query:  451 FTKFEFIQTGVYKMEITIRN-EKVSNISHVYSSPIVNKFTKPKLGLEGDPMRITCAYDAYP-NATEIRWEMLSVIEYPDKSGNLSLHNSTIIIPNDRMIFISGKDTNKPNDTLFITKLLKTDTGFYKCVVISPQGEDSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYEK 966
            F KF     G Y ++I   +   ++   +++S P + +F + K  +EG  + + C   ++P    ++ W      E+P +  N           N R       +  K +D +   KL K D G+YKC   +  G DS ++++ VKD+ A L+PFIGIVIEVI+L+  I+ YE+
Sbjct:   65 FKKFTEKIAGEYTLKIIADDGSSINATGNIFSPPFLQEFQESKRSVEGGRIEVLCTGFSHPFELHDLVWN-----EFPTRKVN-----------NYRRA--RSNNVTKFDDVIVWDKLSKADAGYYKCEAKNKYGNDSVIMQLRVKDKLAPLWPFIGIVIEVIILLAVIIFYER 220          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000010356.1 (SMESG000010356.1)

HSP 1 Score: 78.9518 bits (193), Expect = 4.683e-16
Identity = 52/174 (29.89%), Postives = 87/174 (50.00%), Query Frame = 1
Query:  451 FTKFEFIQTGVYKMEITIRN-EKVSNISHVYSSPIVNKFTKPKLGLEGDPMRITCAYDAYP-NATEIRWEMLSVIEYPDKSGNLSLHNSTIIIPNDRMIFISGKDTNKPNDTLFITKLLKTDTGFYKCVVISPQGEDSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYEK 966
            F KF     G Y ++I   +   ++   +++S P + +F + K  +EG  + + C   ++P    ++ W      E+P +  N           N R       +  K +D +   KL K D G+YKC   +  G DS ++++ VKD+ A L+PFIGIVIEVI+L+  I+ YE+
Sbjct:  105 FKKFTEKIAGEYTLKIIADDGSSINATGNIFSPPFLQEFQESKRSVEGGRIEVLCTGFSHPFELHDLVWN-----EFPTRKVN-----------NYRRA--RSNNVTKFDDVIVWDKLSKADAGYYKCEAKNKYGNDSVIMQLRVKDKLAPLWPFIGIVIEVIILLAVIIFYER 260          
The following BLAST results are available for this feature:
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BSG4.749e-1230.00basigin (Ok blood group) [Source:HGNC Symbol;Acc:H... [more]
BSG8.286e-1230.00basigin (Ok blood group) [Source:HGNC Symbol;Acc:H... [more]
BSG1.358e-1130.00basigin (Ok blood group) [Source:HGNC Symbol;Acc:H... [more]
BSG3.680e-1130.00basigin (Ok blood group) [Source:HGNC Symbol;Acc:H... [more]
BSG1.396e-1030.00basigin (Ok blood group) [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Bsg1.964e-630.34gene:FBgn0261822 transcript:FBtr0079569[more]
Bsg1.964e-630.34gene:FBgn0261822 transcript:FBtr0079573[more]
Bsg1.964e-630.34gene:FBgn0261822 transcript:FBtr0079572[more]
Bsg1.964e-630.34gene:FBgn0261822 transcript:FBtr0079566[more]
Bsg1.964e-630.34gene:FBgn0261822 transcript:FBtr0079567[more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bsg2.127e-1229.23basigin [Source:ZFIN;Acc:ZDB-GENE-030131-9638][more]
bsg2.274e-1229.23basigin [Source:ZFIN;Acc:ZDB-GENE-030131-9638][more]
bsg2.789e-1229.23basigin [Source:ZFIN;Acc:ZDB-GENE-030131-9638][more]
bsg6.030e-1229.23basigin [Source:ZFIN;Acc:ZDB-GENE-030131-9638][more]
bsg6.351e-1229.23basigin [Source:ZFIN;Acc:ZDB-GENE-030131-9638][more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
slc25a135.023e-1033.10solute carrier family 25 member 13 [Source:Xenbase... [more]
slc25a135.441e-1031.21solute carrier family 25 member 13 [Source:Xenbase... [more]
slc25a139.565e-1031.21solute carrier family 25 member 13 [Source:Xenbase... [more]
rabepk2.754e-727.94Rab9 effector protein with kelch motifs [Source:Xe... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Bsg1.797e-1131.33basigin [Source:MGI Symbol;Acc:MGI:88208][more]
Bsg3.857e-1130.72basigin [Source:MGI Symbol;Acc:MGI:88208][more]
Bsg1.564e-1031.52basigin [Source:MGI Symbol;Acc:MGI:88208][more]
back to top
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q28740|BASI_RABIT5.475e-1429.47Basigin OS=Oryctolagus cuniculus OX=9986 GN=BSG PE... [more]
sp|Q99PA3|BASI_CRIGR4.887e-1130.91Basigin (Fragment) OS=Cricetulus griseus OX=10029 ... [more]
sp|P17790|BASI_CHICK7.932e-1129.56Basigin OS=Gallus gallus OX=9031 GN=BSG PE=1 SV=2[more]
sp|P35613|BASI_HUMAN6.703e-1030.00Basigin OS=Homo sapiens OX=9606 GN=BSG PE=1 SV=2[more]
sp|P18572|BASI_MOUSE1.094e-931.52Basigin OS=Mus musculus OX=10090 GN=Bsg PE=1 SV=2[more]
back to top
BLAST of Ig-like domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3EPP59.059e-3228.95Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A183K6F02.716e-3138.37Ig-like domain-containing protein OS=Schistosoma c... [more]
A0A430Q1H23.040e-3038.37Ig-like domain-containing protein OS=Schistosoma b... [more]
A0A0R3TKF24.635e-3032.35Ig-like domain-containing protein OS=Rodentolepis ... [more]
A0A0X3PF158.407e-3030.36Basigin OS=Schistocephalus solidus OX=70667 GN=BAS... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
bsg7.001e-1229.67basigin (Ok blood group) [Source:NCBI gene;Acc:103... [more]
bsg1.870e-1129.56basigin (Ok blood group) [Source:NCBI gene;Acc:103... [more]
bsg3.755e-1130.00basigin (Ok blood group) [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nptna1.834e-824.44neuroplastin a [Source:ZFIN;Acc:ZDB-GENE-030804-7][more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
RNF1263.028e-1433.18ring finger protein 126 [Source:NCBI gene;Acc:1011... [more]
RNF1268.439e-1433.18ring finger protein 126 [Source:NCBI gene;Acc:1011... [more]
RNF1262.123e-1333.18ring finger protein 126 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000042663.10.000e+0100.00SMESG000042663.1[more]
SMESG000010356.12.265e-1629.89SMESG000010356.1[more]
SMESG000010356.14.683e-1629.89SMESG000010356.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004951 ID=SMED30004951|Name=Ig-like domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1431bp
ATTAGTTTGTGATTTAAATATATATTAGCTAACTTTCATTAGTTAAATTT
GTCATAAAGATATTTGTTTAAAGTGTTCAAATTACTAAAAAATTATACCA
TTATGGTTTATATATATTTTGTATATGCTTTGGTTTTTTTCTGTATTACA
GTTAATTCATATTCTTTGAATTCTCTAGGAAGTCCAACAATACCGACAAA
AAATCAACTCGTGAAAATAGATAACTATGAATATAATAAACTTCAAAGAG
ACGAATCAGGAAATGTAAGTTTAGCTTTTCAATTAGAAGGAGCTATTGAT
TCAGAAATTGGCAAAATAACTTTGAATGTTAATAATCAAAATCAAGCCAA
TATTGAAATCATTAAACCATCTGATACTGTGTCCAAAGGCCAAAAAATTT
ATATAACAAAAGAATTGATATCCAACAAAATTATATTATTAAATATTAAG
TTCACAAAATTCGAATTTATTCAAACTGGAGTATATAAAATGGAAATTAC
AATTAGAAATGAAAAAGTATCTAATATTTCTCATGTATACTCTAGTCCAA
TTGTTAATAAATTCACAAAGCCTAAATTAGGACTAGAAGGAGATCCAATG
CGTATAACATGTGCCTATGACGCTTATCCTAATGCTACTGAAATTAGATG
GGAAATGCTTTCAGTTATTGAATATCCCGATAAATCTGGAAACTTGTCTT
TGCATAATTCAACTATTATCATTCCTAATGATAGAATGATATTTATATCC
GGAAAGGATACAAACAAACCAAACGATACATTATTTATCACGAAATTACT
AAAAACCGATACTGGATTTTACAAATGTGTCGTAATTTCTCCGCAGGGCG
AAGATTCAGGTGTAATTAAAATAAATGTCAAAGATCGTTGGGCTGCACTT
TATCCATTTATCGGTATTGTCATAGAGGTCATTCTTCTTGTAACAGCGAT
TCTTGCGTATGAAAAATATCAAATTCGTTCACAAAACAGAAAGAATTACG
GAGAAAATGTTGATGAAGACAACAATAAAGATCCCGATATGCTTTTGACA
AATCGAACAGGAGATGATGAGAATGTTCCAGCGGAAATCGATAATCAACA
AGTTGAAATTGAAGGGGAAAAGGTGAATAATAATGTCGATCCGTCGGTGA
AACAGCGAGAAGCAATAACAACGAAGAATGTTTAATGAAATTAATTGTCC
TTATTCATGACTTAATAACTATCCGCTTATGATCCGCTTATGGAATAGAT
ATTCGGTCTGGATTGGGAACATGATTTCTAGTTTTCATTTGTTAGAGTGC
TCCTTTTGCAGATTATATTTCTATATGTGTCGTCTATTCTCTCTTCAGTT
TTCATTGAAATGTTTTTTGTAATTGCACACTGCATTTGTTTGTAATTTCC
AATAAAGTTTTGTTAATCTTTTGAAAAACAA
back to top

protein sequence of SMED30004951-orf-1

>SMED30004951-orf-1 ID=SMED30004951-orf-1|Name=SMED30004951-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=361bp
MVYIYFVYALVFFCITVNSYSLNSLGSPTIPTKNQLVKIDNYEYNKLQRD
ESGNVSLAFQLEGAIDSEIGKITLNVNNQNQANIEIIKPSDTVSKGQKIY
ITKELISNKIILLNIKFTKFEFIQTGVYKMEITIRNEKVSNISHVYSSPI
VNKFTKPKLGLEGDPMRITCAYDAYPNATEIRWEMLSVIEYPDKSGNLSL
HNSTIIIPNDRMIFISGKDTNKPNDTLFITKLLKTDTGFYKCVVISPQGE
DSGVIKINVKDRWAALYPFIGIVIEVILLVTAILAYEKYQIRSQNRKNYG
ENVDEDNNKDPDMLLTNRTGDDENVPAEIDNQQVEIEGEKVNNNVDPSVK
QREAITTKNV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0007155cell adhesion
GO:0007411axon guidance
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036179Ig-like_dom_sf
IPR003599Ig_sub
IPR013783Ig-like_fold
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 155..260
e-value: 2.2E-6
score: 37.2
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 153..264
e-value: 2.0E-10
score: 42.5
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 149..260
score: 9.627
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 149..262
NoneNo IPR availableTMHMMTMhelixcoord: 264..286
NoneNo IPR availableTMHMMTMhelixcoord: 4..26