SMED30004950

Overview
NameSMED30004950
Smed IDSMED30004950
Length (bp)1128
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30004950 (SMED30004950) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30004950 (SMED30004950) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30004950 (SMED30004950) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30004950 (SMED30004950) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004950

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30004950SMESG000068540.1 SmedASXL_007638SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30004950SMESG000068540.1 SmedASXL_007639SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
prepharyngeal regionSMED30004950SMESG000068540.1 dd_Smed_v6_18107_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30004950SMESG000068540.1 OX_Smed_1.0.07968ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30004950 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.007926:36..2423 +5166
Homology
BLAST of SMED30004950 vs. Ensembl Human
Match: MYT1L (myelin transcription factor 1 like [Source:HGNC Symbol;Acc:HGNC:7623])

HSP 1 Score: 128.257 bits (321), Expect = 1.147e-31
Identity = 63/104 (60.58%), Postives = 77/104 (74.04%), Query Frame = 1
Query:  640 KKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRAD---RSLVLSLHIEQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHNGKITVKETEEECTDVKTI 942
            KKDL+ CPTPGCDGSGHV+ NY SHRSLSGCP AD   RS++ +   E +CPT  CDGSGHITGNY+SHRSLSGCPRA     K +G I + +++E+  D + I
Sbjct:  876 KKDLITCPTPGCDGSGHVTGNYASHRSLSGCPLADKSIRSMLATSSQELKCPTPGCDGSGHITGNYASHRSLSGCPRA-----KKSG-IRIAQSKEDKEDQEPI 973          

HSP 2 Score: 95.9005 bits (237), Expect = 1.083e-20
Identity = 43/77 (55.84%), Postives = 54/77 (70.13%), Query Frame = 1
Query:  655 RCPTPGCDGSGHVSNNYISHRSLSGCPRADR--SLVLSLHIEQ-RCPTISCDGSGHITGNYSSHRSLSGCPRASLER 876
            +CPTPGCDG+GHV+  Y  HRSLSGCP  DR    +L++H    +CPT  C G GH+  N +SHRSLSGCP A+ E+
Sbjct:  505 KCPTPGCDGTGHVTGLYPHHRSLSGCPHKDRVPPEILAMHESVLKCPTPGCTGRGHVNSNRNSHRSLSGCPIAAAEK 581          

HSP 3 Score: 94.7449 bits (234), Expect = 2.431e-20
Identity = 45/92 (48.91%), Postives = 57/92 (61.96%), Query Frame = 1
Query:  643 KDLLRCPTPGCDGSGHVSNNYISHRSLSGCP-RADRSLVLSLHIEQ-----------RCPTISCDGSGHITGNYSSHRSLSGCPRASLERKK 882
            ++ +RCP PGCDG GH++  Y SHRS SGCP  A R     L+  Q            CPT  CDGSGH++G++ +HRSLSGCPRA+   KK
Sbjct:  970 QEPIRCPVPGCDGQGHITGKYASHRSASGCPLAAKRQKDGYLNGSQFSWKSVKTEGMSCPTPGCDGSGHVSGSFLTHRSLSGCPRATSAMKK 1061          

HSP 4 Score: 63.5438 bits (153), Expect = 3.063e-10
Identity = 24/39 (61.54%), Postives = 33/39 (84.62%), Query Frame = 1
Query:  637 LKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSL 753
            +K + + CPTPGCDGSGHVS ++++HRSLSGCPRA  ++
Sbjct: 1021 VKTEGMSCPTPGCDGSGHVSGSFLTHRSLSGCPRATSAM 1059          

HSP 5 Score: 57.3806 bits (137), Expect = 2.703e-8
Identity = 22/35 (62.86%), Postives = 26/35 (74.29%), Query Frame = 1
Query:  643 KDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADR 747
            ++L  CPTPGCDGSGHVS  Y  HRS+ GCP A +
Sbjct:   26 QELFSCPTPGCDGSGHVSGKYARHRSVYGCPLAKK 60          

HSP 6 Score: 55.8398 bits (133), Expect = 8.535e-8
Identity = 29/69 (42.03%), Postives = 43/69 (62.32%), Query Frame = 1
Query:  589 NRIVSGNKNKNQL---LSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCP-RADRSLVLSLHIEQRC 783
            +R +SG  +K+++   +  + + +L+CPTPGC G GHV++N  SHRSLSGCP  A   L  +    Q C
Sbjct:  524 HRSLSGCPHKDRVPPEILAMHESVLKCPTPGCTGRGHVNSNRNSHRSLSGCPIAAAEKLAKAQEKHQSC 592          

HSP 7 Score: 53.5286 bits (127), Expect = 5.417e-7
Identity = 20/29 (68.97%), Postives = 23/29 (79.31%), Query Frame = 1
Query:  772 EQRCPTISCDGSGHITGNYSSHRSLSGCP 858
            E +CPT  CDG+GH+TG Y  HRSLSGCP
Sbjct:  503 ESKCPTPGCDGTGHVTGLYPHHRSLSGCP 531          

HSP 8 Score: 50.447 bits (119), Expect = 4.407e-6
Identity = 18/28 (64.29%), Postives = 22/28 (78.57%), Query Frame = 1
Query:  781 CPTISCDGSGHITGNYSSHRSLSGCPRA 864
            CPT  CDGSGH++G Y+ HRS+ GCP A
Sbjct:   31 CPTPGCDGSGHVSGKYARHRSVYGCPLA 58          
BLAST of SMED30004950 vs. Ensembl Human
Match: MYT1 (myelin transcription factor 1 [Source:HGNC Symbol;Acc:HGNC:7622])

HSP 1 Score: 127.487 bits (319), Expect = 2.040e-31
Identity = 56/79 (70.89%), Postives = 67/79 (84.81%), Query Frame = 1
Query:  637 LKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSL--VLSLH-IEQRCPTISCDGSGHITGNYSSHRSLSGCPRA 864
            +KK+LL CPTPGCDGSGH++ NY SHRSLSGCP AD+SL  +++ H  + +CPT  CDGSGHITGNY+SHRSLSGCPRA
Sbjct:  793 IKKELLTCPTPGCDGSGHITGNYASHRSLSGCPLADKSLRNLMAAHSADLKCPTPGCDGSGHITGNYASHRSLSGCPRA 871          

HSP 2 Score: 95.9005 bits (237), Expect = 1.050e-20
Identity = 44/85 (51.76%), Postives = 58/85 (68.24%), Query Frame = 1
Query:  631 SILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADR--SLVLSLHIEQ-RCPTISCDGSGHITGNYSSHRSLSGCPRASLER 876
            S  +K  ++CPTPGCDG+GHV+  Y  HRSLSGCP  DR    +L++H    +CPT  C G GH+  N ++HRSLSGCP A+ E+
Sbjct:  433 SRAEKREIKCPTPGCDGTGHVTGLYPHHRSLSGCPHKDRIPPEILAMHENVLKCPTPGCTGQGHVNSNRNTHRSLSGCPIAAAEK 517          

HSP 3 Score: 92.4337 bits (228), Expect = 1.309e-19
Identity = 49/100 (49.00%), Postives = 59/100 (59.00%), Query Frame = 1
Query:  646 DLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLV-----------LSLHIE-QRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHNGKITVKE 909
            +L++CP PGC G GH+S  Y SHRS SGCP A R               SL  E   CPT  CDGSGH  G++ +HRSLSGCPRA+   KK  GK++  E
Sbjct:  889 ELMKCPVPGCVGLGHISGKYASHRSASGCPLAARRQKEGSLNGSSFSWKSLKNEGPTCPTPGCDGSGHANGSFLTHRSLSGCPRATFAGKK--GKLSGDE 986          

HSP 4 Score: 59.3066 bits (142), Expect = 6.398e-9
Identity = 23/35 (65.71%), Postives = 29/35 (82.86%), Query Frame = 1
Query:  637 LKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRA 741
            LK +   CPTPGCDGSGH + ++++HRSLSGCPRA
Sbjct:  939 LKNEGPTCPTPGCDGSGHANGSFLTHRSLSGCPRA 973          

HSP 5 Score: 56.9954 bits (136), Expect = 3.557e-8
Identity = 27/67 (40.30%), Postives = 45/67 (67.16%), Query Frame = 1
Query:  589 NRIVSGNKNKNQL---LSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQR 780
            +R +SG  +K+++   +  + +++L+CPTPGC G GHV++N  +HRSLSGCP A    +   H +Q+
Sbjct:  460 HRSLSGCPHKDRIPPEILAMHENVLKCPTPGCTGQGHVNSNRNTHRSLSGCPIAAAEKLAKSHEKQQ 526          

HSP 6 Score: 50.0618 bits (118), Expect = 6.845e-6
Identity = 20/32 (62.50%), Postives = 21/32 (65.62%), Query Frame = 1
Query:  652 LRCPTPGCDGSGHVSNNYISHRSLSGCPRADR 747
            L CPTPGC GSGHV   Y  HRSL  CP A +
Sbjct:   28 LSCPTPGCTGSGHVRGKYSRHRSLQSCPLAKK 59          
BLAST of SMED30004950 vs. Ensembl Human
Match: MYT1 (myelin transcription factor 1 [Source:HGNC Symbol;Acc:HGNC:7622])

HSP 1 Score: 127.487 bits (319), Expect = 2.040e-31
Identity = 56/79 (70.89%), Postives = 67/79 (84.81%), Query Frame = 1
Query:  637 LKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSL--VLSLH-IEQRCPTISCDGSGHITGNYSSHRSLSGCPRA 864
            +KK+LL CPTPGCDGSGH++ NY SHRSLSGCP AD+SL  +++ H  + +CPT  CDGSGHITGNY+SHRSLSGCPRA
Sbjct:  793 IKKELLTCPTPGCDGSGHITGNYASHRSLSGCPLADKSLRNLMAAHSADLKCPTPGCDGSGHITGNYASHRSLSGCPRA 871          

HSP 2 Score: 95.9005 bits (237), Expect = 1.050e-20
Identity = 44/85 (51.76%), Postives = 58/85 (68.24%), Query Frame = 1
Query:  631 SILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADR--SLVLSLHIEQ-RCPTISCDGSGHITGNYSSHRSLSGCPRASLER 876
            S  +K  ++CPTPGCDG+GHV+  Y  HRSLSGCP  DR    +L++H    +CPT  C G GH+  N ++HRSLSGCP A+ E+
Sbjct:  433 SRAEKREIKCPTPGCDGTGHVTGLYPHHRSLSGCPHKDRIPPEILAMHENVLKCPTPGCTGQGHVNSNRNTHRSLSGCPIAAAEK 517          

HSP 3 Score: 92.4337 bits (228), Expect = 1.309e-19
Identity = 49/100 (49.00%), Postives = 59/100 (59.00%), Query Frame = 1
Query:  646 DLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLV-----------LSLHIE-QRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHNGKITVKE 909
            +L++CP PGC G GH+S  Y SHRS SGCP A R               SL  E   CPT  CDGSGH  G++ +HRSLSGCPRA+   KK  GK++  E
Sbjct:  889 ELMKCPVPGCVGLGHISGKYASHRSASGCPLAARRQKEGSLNGSSFSWKSLKNEGPTCPTPGCDGSGHANGSFLTHRSLSGCPRATFAGKK--GKLSGDE 986          

HSP 4 Score: 59.3066 bits (142), Expect = 6.398e-9
Identity = 23/35 (65.71%), Postives = 29/35 (82.86%), Query Frame = 1
Query:  637 LKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRA 741
            LK +   CPTPGCDGSGH + ++++HRSLSGCPRA
Sbjct:  939 LKNEGPTCPTPGCDGSGHANGSFLTHRSLSGCPRA 973          

HSP 5 Score: 56.9954 bits (136), Expect = 3.557e-8
Identity = 27/67 (40.30%), Postives = 45/67 (67.16%), Query Frame = 1
Query:  589 NRIVSGNKNKNQL---LSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQR 780
            +R +SG  +K+++   +  + +++L+CPTPGC G GHV++N  +HRSLSGCP A    +   H +Q+
Sbjct:  460 HRSLSGCPHKDRIPPEILAMHENVLKCPTPGCTGQGHVNSNRNTHRSLSGCPIAAAEKLAKSHEKQQ 526          

HSP 6 Score: 50.0618 bits (118), Expect = 6.845e-6
Identity = 20/32 (62.50%), Postives = 21/32 (65.62%), Query Frame = 1
Query:  652 LRCPTPGCDGSGHVSNNYISHRSLSGCPRADR 747
            L CPTPGC GSGHV   Y  HRSL  CP A +
Sbjct:   28 LSCPTPGCTGSGHVRGKYSRHRSLQSCPLAKK 59          
BLAST of SMED30004950 vs. Ensembl Human
Match: MYT1 (myelin transcription factor 1 [Source:HGNC Symbol;Acc:HGNC:7622])

HSP 1 Score: 127.487 bits (319), Expect = 2.040e-31
Identity = 56/79 (70.89%), Postives = 67/79 (84.81%), Query Frame = 1
Query:  637 LKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSL--VLSLH-IEQRCPTISCDGSGHITGNYSSHRSLSGCPRA 864
            +KK+LL CPTPGCDGSGH++ NY SHRSLSGCP AD+SL  +++ H  + +CPT  CDGSGHITGNY+SHRSLSGCPRA
Sbjct:  793 IKKELLTCPTPGCDGSGHITGNYASHRSLSGCPLADKSLRNLMAAHSADLKCPTPGCDGSGHITGNYASHRSLSGCPRA 871          

HSP 2 Score: 95.9005 bits (237), Expect = 1.050e-20
Identity = 44/85 (51.76%), Postives = 58/85 (68.24%), Query Frame = 1
Query:  631 SILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADR--SLVLSLHIEQ-RCPTISCDGSGHITGNYSSHRSLSGCPRASLER 876
            S  +K  ++CPTPGCDG+GHV+  Y  HRSLSGCP  DR    +L++H    +CPT  C G GH+  N ++HRSLSGCP A+ E+
Sbjct:  433 SRAEKREIKCPTPGCDGTGHVTGLYPHHRSLSGCPHKDRIPPEILAMHENVLKCPTPGCTGQGHVNSNRNTHRSLSGCPIAAAEK 517          

HSP 3 Score: 92.4337 bits (228), Expect = 1.309e-19
Identity = 49/100 (49.00%), Postives = 59/100 (59.00%), Query Frame = 1
Query:  646 DLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLV-----------LSLHIE-QRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHNGKITVKE 909
            +L++CP PGC G GH+S  Y SHRS SGCP A R               SL  E   CPT  CDGSGH  G++ +HRSLSGCPRA+   KK  GK++  E
Sbjct:  889 ELMKCPVPGCVGLGHISGKYASHRSASGCPLAARRQKEGSLNGSSFSWKSLKNEGPTCPTPGCDGSGHANGSFLTHRSLSGCPRATFAGKK--GKLSGDE 986          

HSP 4 Score: 59.3066 bits (142), Expect = 6.398e-9
Identity = 23/35 (65.71%), Postives = 29/35 (82.86%), Query Frame = 1
Query:  637 LKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRA 741
            LK +   CPTPGCDGSGH + ++++HRSLSGCPRA
Sbjct:  939 LKNEGPTCPTPGCDGSGHANGSFLTHRSLSGCPRA 973          

HSP 5 Score: 56.9954 bits (136), Expect = 3.557e-8
Identity = 27/67 (40.30%), Postives = 45/67 (67.16%), Query Frame = 1
Query:  589 NRIVSGNKNKNQL---LSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQR 780
            +R +SG  +K+++   +  + +++L+CPTPGC G GHV++N  +HRSLSGCP A    +   H +Q+
Sbjct:  460 HRSLSGCPHKDRIPPEILAMHENVLKCPTPGCTGQGHVNSNRNTHRSLSGCPIAAAEKLAKSHEKQQ 526          

HSP 6 Score: 50.0618 bits (118), Expect = 6.845e-6
Identity = 20/32 (62.50%), Postives = 21/32 (65.62%), Query Frame = 1
Query:  652 LRCPTPGCDGSGHVSNNYISHRSLSGCPRADR 747
            L CPTPGC GSGHV   Y  HRSL  CP A +
Sbjct:   28 LSCPTPGCTGSGHVRGKYSRHRSLQSCPLAKK 59          
BLAST of SMED30004950 vs. Ensembl Human
Match: ST18 (ST18 C2H2C-type zinc finger transcription factor [Source:HGNC Symbol;Acc:HGNC:18695])

HSP 1 Score: 127.487 bits (319), Expect = 2.086e-31
Identity = 61/103 (59.22%), Postives = 77/103 (74.76%), Query Frame = 1
Query:  637 LKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRAD---RSLVLSLHIEQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHNGKITVKETEEECTDVK 936
            LKK+L+ CPTPGCDGSGHV+ NY SHRS+SGCP AD   +SL+ +   E +CPT  CDGSGH+TGNY+SHRSLSGCPRA    +K   K+T  + E+E  ++K
Sbjct:  717 LKKELITCPTPGCDGSGHVTGNYASHRSVSGCPLADKTLKSLMAANSQELKCPTPGCDGSGHVTGNYASHRSLSGCPRA----RKGGVKMTPTKEEKEDPELK 815          

HSP 2 Score: 109.383 bits (272), Expect = 2.522e-25
Identity = 57/115 (49.57%), Postives = 73/115 (63.48%), Query Frame = 1
Query:  577 NNIKNRIVSG----NKNKNQLLSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHI-------EQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHN 888
            N   +R VSG    +K    L++   ++L +CPTPGCDGSGHV+ NY SHRSLSGCPRA +  V            E +CP I CDG GHI+G Y+SHR+ SGCP A+ +R+K N
Sbjct:  738 NYASHRSVSGCPLADKTLKSLMAANSQEL-KCPTPGCDGSGHVTGNYASHRSLSGCPRARKGGVKMTPTKEEKEDPELKCPVIGCDGQGHISGKYTSHRTASGCPLAA-KRQKEN 850          

HSP 3 Score: 88.9669 bits (219), Expect = 1.938e-18
Identity = 39/77 (50.65%), Postives = 51/77 (66.23%), Query Frame = 1
Query:  655 RCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQ---RCPTISCDGSGHITGNYSSHRSLSGCPRASLER 876
            +CP PGCDG+GHV+  Y  HRSLSGCP   R  +  L + +   +CPT  C G GH+  N ++HRSLSGCP A+ E+
Sbjct:  367 KCPIPGCDGTGHVTGLYPHHRSLSGCPHKVRVPLEILAMHENVLKCPTPGCTGRGHVNSNRNTHRSLSGCPIAAAEK 443          

HSP 4 Score: 54.299 bits (129), Expect = 2.523e-7
Identity = 28/54 (51.85%), Postives = 40/54 (74.07%), Query Frame = 1
Query:  589 NRIVSGNKNKNQL-LSILK--KDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRA 741
            +R +SG  +K ++ L IL   +++L+CPTPGC G GHV++N  +HRSLSGCP A
Sbjct:  386 HRSLSGCPHKVRVPLEILAMHENVLKCPTPGCTGRGHVNSNRNTHRSLSGCPIA 439          

HSP 5 Score: 53.5286 bits (127), Expect = 4.741e-7
Identity = 20/32 (62.50%), Postives = 27/32 (84.38%), Query Frame = 1
Query:  640 KKDLLRCPTPGCDGSGHVSNNYISHRSLSGCP 735
            K++L  CP PGC+G GHV+N +++HRSLSGCP
Sbjct:  863 KQELPHCPLPGCNGLGHVNNVFVTHRSLSGCP 894          

HSP 6 Score: 51.2174 bits (121), Expect = 2.391e-6
Identity = 22/37 (59.46%), Postives = 25/37 (67.57%), Query Frame = 1
Query:  772 EQRCPTISCDGSGHITGNYSSHRSLSGCP---RASLE 873
            E +CP   CDG+GH+TG Y  HRSLSGCP   R  LE
Sbjct:  365 ETKCPIPGCDGTGHVTGLYPHHRSLSGCPHKVRVPLE 401          
BLAST of SMED30004950 vs. Ensembl Celegans
Match: ztf-11 (Zinc finger putative Transcription Factor family [Source:UniProtKB/TrEMBL;Acc:H2L2J7])

HSP 1 Score: 102.064 bits (253), Expect = 9.790e-24
Identity = 54/110 (49.09%), Postives = 68/110 (61.82%), Query Frame = 1
Query:  631 SILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCP-RADRSLVLSLHIEQ----RCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHNG-KITVKETEEECTDVKTI 942
            SI ++  L CPTPGCDGSGH +  Y  HRSLSGCP R D++++  L + Q    RC T  C G GH+ GN +SHRSLSGCP A  E+    G K T + T+   T +K I
Sbjct:  159 SIRREGKLACPTPGCDGSGHQTGLYTHHRSLSGCPRRPDKTVIQMLALRQDTVLRCTTAGCSGKGHVNGNRTSHRSLSGCPIAHQEKLARKGIKTTPQRTK---TPIKGI 265          

HSP 2 Score: 55.0694 bits (131), Expect = 4.498e-8
Identity = 24/45 (53.33%), Postives = 31/45 (68.89%), Query Frame = 1
Query:  607 NKNKNQLLSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRA 741
            +K   Q+L++ +  +LRC T GC G GHV+ N  SHRSLSGCP A
Sbjct:  197 DKTVIQMLALRQDTVLRCTTAGCSGKGHVNGNRTSHRSLSGCPIA 241          
BLAST of SMED30004950 vs. Ensembl Celegans
Match: ztf-11 (Zinc finger putative Transcription Factor family [Source:UniProtKB/TrEMBL;Acc:H2L2J7])

HSP 1 Score: 102.449 bits (254), Expect = 1.559e-23
Identity = 54/110 (49.09%), Postives = 68/110 (61.82%), Query Frame = 1
Query:  631 SILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCP-RADRSLVLSLHIEQ----RCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHNG-KITVKETEEECTDVKTI 942
            SI ++  L CPTPGCDGSGH +  Y  HRSLSGCP R D++++  L + Q    RC T  C G GH+ GN +SHRSLSGCP A  E+    G K T + T+   T +K I
Sbjct:  256 SIRREGKLACPTPGCDGSGHQTGLYTHHRSLSGCPRRPDKTVIQMLALRQDTVLRCTTAGCSGKGHVNGNRTSHRSLSGCPIAHQEKLARKGIKTTPQRTK---TPIKGI 362          

HSP 2 Score: 55.0694 bits (131), Expect = 5.252e-8
Identity = 24/45 (53.33%), Postives = 31/45 (68.89%), Query Frame = 1
Query:  607 NKNKNQLLSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRA 741
            +K   Q+L++ +  +LRC T GC G GHV+ N  SHRSLSGCP A
Sbjct:  294 DKTVIQMLALRQDTVLRCTTAGCSGKGHVNGNRTSHRSLSGCPIA 338          
BLAST of SMED30004950 vs. Ensembl Fly
Match: CG43689 (gene:FBgn0263772 transcript:FBtr0310493)

HSP 1 Score: 100.138 bits (248), Expect = 1.672e-22
Identity = 46/81 (56.79%), Postives = 55/81 (67.90%), Query Frame = 1
Query:  652 LRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQ----RCPTISCDGSGHITGNYSSHRSLSGCPRASLERKK 882
            L+CPTPGCDGSGHV+ NY SHRSLSGCPRA++        +     RCP   CDGSGH TG + SHRS SGCP A+  + +
Sbjct: 1188 LKCPTPGCDGSGHVTGNYSSHRSLSGCPRANKPKSKPRDGQDSEPLRCPIPGCDGSGHSTGKFLSHRSASGCPIANRNKMR 1268          

HSP 2 Score: 80.4925 bits (197), Expect = 5.448e-16
Identity = 36/65 (55.38%), Postives = 46/65 (70.77%), Query Frame = 1
Query:  688 HVSNNYISHRSLSGCPRADRSLVLSLHIEQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKK 882
            H+  +  S   L+GC R+DR+ + S   E +CPT  CDGSGH+TGNYSSHRSLSGCPRA+  + K
Sbjct: 1159 HIPQHDKSKDGLTGCSRSDRNHLQSHSQELKCPTPGCDGSGHVTGNYSSHRSLSGCPRANKPKSK 1223          

HSP 3 Score: 68.1662 bits (165), Expect = 5.872e-12
Identity = 35/76 (46.05%), Postives = 45/76 (59.21%), Query Frame = 1
Query:  643 KDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQ--RCPTISCDGSGHITGNYSSHRSLSGCPRA 864
            +D ++CPTP C G GHV+  Y  H             +L+LH EQ  +CPT  C+G GH+  + S HRSLSGCPRA
Sbjct:  405 RDGVKCPTPHCTGQGHVTGLYSHH-------------LLALH-EQILKCPTPGCNGRGHVQPHRSVHRSLSGCPRA 466          

HSP 4 Score: 58.5362 bits (140), Expect = 5.876e-9
Identity = 29/62 (46.77%), Postives = 39/62 (62.90%), Query Frame = 1
Query:  577 NNIKNRIVSG----NKNKNQLLSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRS 750
            N   +R +SG    NK K++       + LRCP PGCDGSGH +  ++SHRS SGCP A+R+
Sbjct: 1204 NYSSHRSLSGCPRANKPKSKPRDGQDSEPLRCPIPGCDGSGHSTGKFLSHRSASGCPIANRN 1265          

HSP 5 Score: 56.225 bits (134), Expect = 3.586e-8
Identity = 24/40 (60.00%), Postives = 29/40 (72.50%), Query Frame = 1
Query:  628 LSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADR 747
            L  L + +L+CPTPGC+G GHV  +   HRSLSGCPRA R
Sbjct:  429 LLALHEQILKCPTPGCNGRGHVQPHRSVHRSLSGCPRAVR 468          
BLAST of SMED30004950 vs. Ensembl Fly
Match: CG43689 (gene:FBgn0263772 transcript:FBtr0310492)

HSP 1 Score: 100.138 bits (248), Expect = 1.680e-22
Identity = 46/81 (56.79%), Postives = 55/81 (67.90%), Query Frame = 1
Query:  652 LRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQ----RCPTISCDGSGHITGNYSSHRSLSGCPRASLERKK 882
            L+CPTPGCDGSGHV+ NY SHRSLSGCPRA++        +     RCP   CDGSGH TG + SHRS SGCP A+  + +
Sbjct: 1165 LKCPTPGCDGSGHVTGNYSSHRSLSGCPRANKPKSKPRDGQDSEPLRCPIPGCDGSGHSTGKFLSHRSASGCPIANRNKMR 1245          

HSP 2 Score: 80.4925 bits (197), Expect = 5.474e-16
Identity = 36/65 (55.38%), Postives = 46/65 (70.77%), Query Frame = 1
Query:  688 HVSNNYISHRSLSGCPRADRSLVLSLHIEQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKK 882
            H+  +  S   L+GC R+DR+ + S   E +CPT  CDGSGH+TGNYSSHRSLSGCPRA+  + K
Sbjct: 1136 HIPQHDKSKDGLTGCSRSDRNHLQSHSQELKCPTPGCDGSGHVTGNYSSHRSLSGCPRANKPKSK 1200          

HSP 3 Score: 58.5362 bits (140), Expect = 5.857e-9
Identity = 29/62 (46.77%), Postives = 39/62 (62.90%), Query Frame = 1
Query:  577 NNIKNRIVSG----NKNKNQLLSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRS 750
            N   +R +SG    NK K++       + LRCP PGCDGSGH +  ++SHRS SGCP A+R+
Sbjct: 1181 NYSSHRSLSGCPRANKPKSKPRDGQDSEPLRCPIPGCDGSGHSTGKFLSHRSASGCPIANRN 1242          

HSP 4 Score: 57.3806 bits (137), Expect = 1.553e-8
Identity = 25/45 (55.56%), Postives = 35/45 (77.78%), Query Frame = 1
Query:  613 NKNQLLSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADR 747
            ++N++L+ L + +L+CPTPGC+G GHV  +   HRSLSGCPRA R
Sbjct:  402 SQNRVLA-LHEQILKCPTPGCNGRGHVQPHRSVHRSLSGCPRAVR 445          

HSP 5 Score: 49.2914 bits (116), Expect = 4.605e-6
Identity = 24/39 (61.54%), Postives = 29/39 (74.36%), Query Frame = 1
Query:  754 VLSLHIEQ--RCPTISCDGSGHITGNYSSHRSLSGCPRA 864
            VL+LH EQ  +CPT  C+G GH+  + S HRSLSGCPRA
Sbjct:  406 VLALH-EQILKCPTPGCNGRGHVQPHRSVHRSLSGCPRA 443          
BLAST of SMED30004950 vs. Ensembl Fly
Match: CG43689 (gene:FBgn0263772 transcript:FBtr0310491)

HSP 1 Score: 100.138 bits (248), Expect = 1.905e-22
Identity = 46/81 (56.79%), Postives = 55/81 (67.90%), Query Frame = 1
Query:  652 LRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQ----RCPTISCDGSGHITGNYSSHRSLSGCPRASLERKK 882
            L+CPTPGCDGSGHV+ NY SHRSLSGCPRA++        +     RCP   CDGSGH TG + SHRS SGCP A+  + +
Sbjct: 1107 LKCPTPGCDGSGHVTGNYSSHRSLSGCPRANKPKSKPRDGQDSEPLRCPIPGCDGSGHSTGKFLSHRSASGCPIANRNKMR 1187          

HSP 2 Score: 80.4925 bits (197), Expect = 5.926e-16
Identity = 36/65 (55.38%), Postives = 46/65 (70.77%), Query Frame = 1
Query:  688 HVSNNYISHRSLSGCPRADRSLVLSLHIEQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKK 882
            H+  +  S   L+GC R+DR+ + S   E +CPT  CDGSGH+TGNYSSHRSLSGCPRA+  + K
Sbjct: 1078 HIPQHDKSKDGLTGCSRSDRNHLQSHSQELKCPTPGCDGSGHVTGNYSSHRSLSGCPRANKPKSK 1142          

HSP 3 Score: 58.5362 bits (140), Expect = 6.068e-9
Identity = 29/62 (46.77%), Postives = 39/62 (62.90%), Query Frame = 1
Query:  577 NNIKNRIVSG----NKNKNQLLSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRS 750
            N   +R +SG    NK K++       + LRCP PGCDGSGH +  ++SHRS SGCP A+R+
Sbjct: 1123 NYSSHRSLSGCPRANKPKSKPRDGQDSEPLRCPIPGCDGSGHSTGKFLSHRSASGCPIANRN 1184          
BLAST of SMED30004950 vs. Ensembl Fly
Match: CG43689 (gene:FBgn0263772 transcript:FBtr0310495)

HSP 1 Score: 99.7525 bits (247), Expect = 2.330e-22
Identity = 46/81 (56.79%), Postives = 55/81 (67.90%), Query Frame = 1
Query:  652 LRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQ----RCPTISCDGSGHITGNYSSHRSLSGCPRASLERKK 882
            L+CPTPGCDGSGHV+ NY SHRSLSGCPRA++        +     RCP   CDGSGH TG + SHRS SGCP A+  + +
Sbjct: 1165 LKCPTPGCDGSGHVTGNYSSHRSLSGCPRANKPKSKPRDGQDSEPLRCPIPGCDGSGHSTGKFLSHRSASGCPIANRNKMR 1245          

HSP 2 Score: 80.1073 bits (196), Expect = 7.178e-16
Identity = 36/65 (55.38%), Postives = 46/65 (70.77%), Query Frame = 1
Query:  688 HVSNNYISHRSLSGCPRADRSLVLSLHIEQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKK 882
            H+  +  S   L+GC R+DR+ + S   E +CPT  CDGSGH+TGNYSSHRSLSGCPRA+  + K
Sbjct: 1136 HIPQHDKSKDGLTGCSRSDRNHLQSHSQELKCPTPGCDGSGHVTGNYSSHRSLSGCPRANKPKSK 1200          

HSP 3 Score: 58.5362 bits (140), Expect = 7.091e-9
Identity = 29/62 (46.77%), Postives = 39/62 (62.90%), Query Frame = 1
Query:  577 NNIKNRIVSG----NKNKNQLLSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRS 750
            N   +R +SG    NK K++       + LRCP PGCDGSGH +  ++SHRS SGCP A+R+
Sbjct: 1181 NYSSHRSLSGCPRANKPKSKPRDGQDSEPLRCPIPGCDGSGHSTGKFLSHRSASGCPIANRN 1242          

HSP 4 Score: 56.9954 bits (136), Expect = 1.862e-8
Identity = 25/45 (55.56%), Postives = 35/45 (77.78%), Query Frame = 1
Query:  613 NKNQLLSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADR 747
            ++N++L+ L + +L+CPTPGC+G GHV  +   HRSLSGCPRA R
Sbjct:  402 SQNRVLA-LHEQILKCPTPGCNGRGHVQPHRSVHRSLSGCPRAVR 445          

HSP 5 Score: 49.2914 bits (116), Expect = 5.431e-6
Identity = 24/39 (61.54%), Postives = 29/39 (74.36%), Query Frame = 1
Query:  754 VLSLHIEQ--RCPTISCDGSGHITGNYSSHRSLSGCPRA 864
            VL+LH EQ  +CPT  C+G GH+  + S HRSLSGCPRA
Sbjct:  406 VLALH-EQILKCPTPGCNGRGHVQPHRSVHRSLSGCPRA 443          
BLAST of SMED30004950 vs. Ensembl Fly
Match: CG43689 (gene:FBgn0263772 transcript:FBtr0339681)

HSP 1 Score: 99.7525 bits (247), Expect = 2.349e-22
Identity = 46/81 (56.79%), Postives = 55/81 (67.90%), Query Frame = 1
Query:  652 LRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQ----RCPTISCDGSGHITGNYSSHRSLSGCPRASLERKK 882
            L+CPTPGCDGSGHV+ NY SHRSLSGCPRA++        +     RCP   CDGSGH TG + SHRS SGCP A+  + +
Sbjct: 1077 LKCPTPGCDGSGHVTGNYSSHRSLSGCPRANKPKSKPRDGQDSEPLRCPIPGCDGSGHSTGKFLSHRSASGCPIANRNKMR 1157          

HSP 2 Score: 80.1073 bits (196), Expect = 7.110e-16
Identity = 36/65 (55.38%), Postives = 46/65 (70.77%), Query Frame = 1
Query:  688 HVSNNYISHRSLSGCPRADRSLVLSLHIEQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKK 882
            H+  +  S   L+GC R+DR+ + S   E +CPT  CDGSGH+TGNYSSHRSLSGCPRA+  + K
Sbjct: 1048 HIPQHDKSKDGLTGCSRSDRNHLQSHSQELKCPTPGCDGSGHVTGNYSSHRSLSGCPRANKPKSK 1112          

HSP 3 Score: 58.5362 bits (140), Expect = 7.101e-9
Identity = 29/62 (46.77%), Postives = 39/62 (62.90%), Query Frame = 1
Query:  577 NNIKNRIVSG----NKNKNQLLSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRS 750
            N   +R +SG    NK K++       + LRCP PGCDGSGH +  ++SHRS SGCP A+R+
Sbjct: 1093 NYSSHRSLSGCPRANKPKSKPRDGQDSEPLRCPIPGCDGSGHSTGKFLSHRSASGCPIANRN 1154          
BLAST of SMED30004950 vs. Ensembl Zebrafish
Match: myt1b (myelin transcription factor 1b [Source:ZFIN;Acc:ZDB-GENE-090313-67])

HSP 1 Score: 130.568 bits (327), Expect = 1.284e-32
Identity = 59/78 (75.64%), Postives = 66/78 (84.62%), Query Frame = 1
Query:  640 KKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSL--VLSLH-IEQRCPTISCDGSGHITGNYSSHRSLSGCPRA 864
            KKDLL CPTPGCDGSGH++ NY SHRSLSGCP AD+SL  +++ H  E +CPT  CDGSGHITGNYSSHRSLSGCPRA
Sbjct:  812 KKDLLMCPTPGCDGSGHITGNYASHRSLSGCPLADKSLRSLMAAHTAELKCPTPGCDGSGHITGNYSSHRSLSGCPRA 889          

HSP 2 Score: 95.9005 bits (237), Expect = 5.854e-21
Identity = 43/82 (52.44%), Postives = 57/82 (69.51%), Query Frame = 1
Query:  640 KKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADR--SLVLSLHIEQ-RCPTISCDGSGHITGNYSSHRSLSGCPRASLER 876
            +K  ++CPTPGCDG+GHV+  Y  HRSLSGCP  DR    +L++H    +CPT  C G GH+  N ++HRSLSGCP A+ E+
Sbjct:  432 EKREIKCPTPGCDGTGHVTGLYPHHRSLSGCPHKDRIPPEILAMHENVLKCPTPGCTGQGHVNSNRNTHRSLSGCPIAAAEK 513          

HSP 3 Score: 93.5893 bits (231), Expect = 3.002e-20
Identity = 45/91 (49.45%), Postives = 53/91 (58.24%), Query Frame = 1
Query:  646 DLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSL------------HIEQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKK 882
            +LL+CP PGCD  GH+S  Y +HRS  GCP A R     L                 CPT  CDGSGH  G++ +HRSLSGCPRASL +KK
Sbjct:  907 ELLKCPVPGCDSLGHISGKYATHRSAYGCPLAARRQKEGLLNGSPFSWKAFKTEGPTCPTPGCDGSGHANGSFLTHRSLSGCPRASLNKKK 997          

HSP 4 Score: 60.077 bits (144), Expect = 2.518e-9
Identity = 34/89 (38.20%), Postives = 54/89 (60.67%), Query Frame = 1
Query:  589 NRIVSGNKNKNQL---LSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQRCPTISCDGSGHITGNYSSHRSL 846
            +R +SG  +K+++   +  + +++L+CPTPGC G GHV++N  +HRSLSGCP A    +   H +Q  P    +   HI G+ +S R L
Sbjct:  456 HRSLSGCPHKDRIPPEILAMHENVLKCPTPGCTGQGHVNSNRNTHRSLSGCPIAAAEKLSKSHDKQHLPQPMGE---HIKGSPNSDRVL 541          
BLAST of SMED30004950 vs. Ensembl Zebrafish
Match: myt1a (myelin transcription factor 1a [Source:ZFIN;Acc:ZDB-GENE-030131-3885])

HSP 1 Score: 130.183 bits (326), Expect = 1.650e-32
Identity = 57/79 (72.15%), Postives = 67/79 (84.81%), Query Frame = 1
Query:  637 LKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSL--VLSLH-IEQRCPTISCDGSGHITGNYSSHRSLSGCPRA 864
            LKK++L CPTPGCDGSGH++ NY SHRSLSGCP AD+SL  +++ H  E +CPT  CDGSGHITGNY+SHRSLSGCPRA
Sbjct:  666 LKKEILLCPTPGCDGSGHITGNYASHRSLSGCPLADKSLRTLMAAHTAELKCPTPGCDGSGHITGNYASHRSLSGCPRA 744          

HSP 2 Score: 98.9821 bits (245), Expect = 5.805e-22
Identity = 47/97 (48.45%), Postives = 64/97 (65.98%), Query Frame = 1
Query:  631 SILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADR--SLVLSLHIEQ-RCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHNGKITVKET 912
            S L+K  ++CPTPGCDG+GHV+  Y  HRSLSGCP  DR    +L++H    +CPT  C G GH+  N ++HRSLSGCP A+  + K + K +  +T
Sbjct:  343 SRLEKKEVKCPTPGCDGTGHVTGLYPHHRSLSGCPHKDRIPPEILAMHENVLKCPTPGCTGQGHVNSNRNTHRSLSGCPIAAAGKHKSHDKQSQPQT 439          

HSP 3 Score: 90.1225 bits (222), Expect = 4.013e-19
Identity = 41/91 (45.05%), Postives = 52/91 (57.14%), Query Frame = 1
Query:  646 DLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSL------------HIEQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKK 882
            +L++CP PGCD  GH+S  Y +HRS  GCP A R     +                 CPT  CDGSGH  G++ +HRSLSGCPRAS  +K+
Sbjct:  762 ELIKCPVPGCDSLGHISGKYATHRSAYGCPLAARRQKEGMLNGTPFSWKAFKTEGPTCPTPGCDGSGHANGSFLTHRSLSGCPRASANKKR 852          
BLAST of SMED30004950 vs. Ensembl Zebrafish
Match: myt1a (myelin transcription factor 1a [Source:ZFIN;Acc:ZDB-GENE-030131-3885])

HSP 1 Score: 130.183 bits (326), Expect = 1.650e-32
Identity = 57/79 (72.15%), Postives = 67/79 (84.81%), Query Frame = 1
Query:  637 LKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSL--VLSLH-IEQRCPTISCDGSGHITGNYSSHRSLSGCPRA 864
            LKK++L CPTPGCDGSGH++ NY SHRSLSGCP AD+SL  +++ H  E +CPT  CDGSGHITGNY+SHRSLSGCPRA
Sbjct:  666 LKKEILLCPTPGCDGSGHITGNYASHRSLSGCPLADKSLRTLMAAHTAELKCPTPGCDGSGHITGNYASHRSLSGCPRA 744          

HSP 2 Score: 98.9821 bits (245), Expect = 5.805e-22
Identity = 47/97 (48.45%), Postives = 64/97 (65.98%), Query Frame = 1
Query:  631 SILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADR--SLVLSLHIEQ-RCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHNGKITVKET 912
            S L+K  ++CPTPGCDG+GHV+  Y  HRSLSGCP  DR    +L++H    +CPT  C G GH+  N ++HRSLSGCP A+  + K + K +  +T
Sbjct:  343 SRLEKKEVKCPTPGCDGTGHVTGLYPHHRSLSGCPHKDRIPPEILAMHENVLKCPTPGCTGQGHVNSNRNTHRSLSGCPIAAAGKHKSHDKQSQPQT 439          

HSP 3 Score: 90.1225 bits (222), Expect = 4.013e-19
Identity = 41/91 (45.05%), Postives = 52/91 (57.14%), Query Frame = 1
Query:  646 DLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSL------------HIEQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKK 882
            +L++CP PGCD  GH+S  Y +HRS  GCP A R     +                 CPT  CDGSGH  G++ +HRSLSGCPRAS  +K+
Sbjct:  762 ELIKCPVPGCDSLGHISGKYATHRSAYGCPLAARRQKEGMLNGTPFSWKAFKTEGPTCPTPGCDGSGHANGSFLTHRSLSGCPRASANKKR 852          
BLAST of SMED30004950 vs. Ensembl Zebrafish
Match: myt1a (myelin transcription factor 1a [Source:ZFIN;Acc:ZDB-GENE-030131-3885])

HSP 1 Score: 130.183 bits (326), Expect = 1.847e-32
Identity = 57/79 (72.15%), Postives = 67/79 (84.81%), Query Frame = 1
Query:  637 LKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSL--VLSLH-IEQRCPTISCDGSGHITGNYSSHRSLSGCPRA 864
            LKK++L CPTPGCDGSGH++ NY SHRSLSGCP AD+SL  +++ H  E +CPT  CDGSGHITGNY+SHRSLSGCPRA
Sbjct:  674 LKKEILLCPTPGCDGSGHITGNYASHRSLSGCPLADKSLRTLMAAHTAELKCPTPGCDGSGHITGNYASHRSLSGCPRA 752          

HSP 2 Score: 98.5969 bits (244), Expect = 6.544e-22
Identity = 47/97 (48.45%), Postives = 64/97 (65.98%), Query Frame = 1
Query:  631 SILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADR--SLVLSLHIEQ-RCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHNGKITVKET 912
            S L+K  ++CPTPGCDG+GHV+  Y  HRSLSGCP  DR    +L++H    +CPT  C G GH+  N ++HRSLSGCP A+  + K + K +  +T
Sbjct:  331 SRLEKKEVKCPTPGCDGTGHVTGLYPHHRSLSGCPHKDRIPPEILAMHENVLKCPTPGCTGQGHVNSNRNTHRSLSGCPIAAAGKHKSHDKQSQPQT 427          

HSP 3 Score: 90.1225 bits (222), Expect = 4.953e-19
Identity = 41/91 (45.05%), Postives = 52/91 (57.14%), Query Frame = 1
Query:  646 DLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSL------------HIEQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKK 882
            +L++CP PGCD  GH+S  Y +HRS  GCP A R     +                 CPT  CDGSGH  G++ +HRSLSGCPRAS  +K+
Sbjct:  770 ELIKCPVPGCDSLGHISGKYATHRSAYGCPLAARRQKEGMLNGTPFSWKAFKTEGPTCPTPGCDGSGHANGSFLTHRSLSGCPRASANKKR 860          
BLAST of SMED30004950 vs. Ensembl Zebrafish
Match: myt1a (myelin transcription factor 1a [Source:ZFIN;Acc:ZDB-GENE-030131-3885])

HSP 1 Score: 130.183 bits (326), Expect = 1.847e-32
Identity = 57/79 (72.15%), Postives = 67/79 (84.81%), Query Frame = 1
Query:  637 LKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSL--VLSLH-IEQRCPTISCDGSGHITGNYSSHRSLSGCPRA 864
            LKK++L CPTPGCDGSGH++ NY SHRSLSGCP AD+SL  +++ H  E +CPT  CDGSGHITGNY+SHRSLSGCPRA
Sbjct:  674 LKKEILLCPTPGCDGSGHITGNYASHRSLSGCPLADKSLRTLMAAHTAELKCPTPGCDGSGHITGNYASHRSLSGCPRA 752          

HSP 2 Score: 98.5969 bits (244), Expect = 6.544e-22
Identity = 47/97 (48.45%), Postives = 64/97 (65.98%), Query Frame = 1
Query:  631 SILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADR--SLVLSLHIEQ-RCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHNGKITVKET 912
            S L+K  ++CPTPGCDG+GHV+  Y  HRSLSGCP  DR    +L++H    +CPT  C G GH+  N ++HRSLSGCP A+  + K + K +  +T
Sbjct:  331 SRLEKKEVKCPTPGCDGTGHVTGLYPHHRSLSGCPHKDRIPPEILAMHENVLKCPTPGCTGQGHVNSNRNTHRSLSGCPIAAAGKHKSHDKQSQPQT 427          

HSP 3 Score: 90.1225 bits (222), Expect = 4.953e-19
Identity = 41/91 (45.05%), Postives = 52/91 (57.14%), Query Frame = 1
Query:  646 DLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSL------------HIEQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKK 882
            +L++CP PGCD  GH+S  Y +HRS  GCP A R     +                 CPT  CDGSGH  G++ +HRSLSGCPRAS  +K+
Sbjct:  770 ELIKCPVPGCDSLGHISGKYATHRSAYGCPLAARRQKEGMLNGTPFSWKAFKTEGPTCPTPGCDGSGHANGSFLTHRSLSGCPRASANKKR 860          
BLAST of SMED30004950 vs. Ensembl Xenopus
Match: dpysl5 (dihydropyrimidinase like 5 [Source:Xenbase;Acc:XB-GENE-6073088])

HSP 1 Score: 128.642 bits (322), Expect = 9.467e-32
Identity = 61/90 (67.78%), Postives = 71/90 (78.89%), Query Frame = 1
Query:  640 KKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSL--VLSLH-IEQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHNGKIT 900
            KK+LL CPTPGCDGSGH++ NY SHRSLSGCP AD+SL  +++ H  + +CPT  CDGSGHITGNY+SHRSLSGCPRA    KK   KIT
Sbjct:  724 KKELLTCPTPGCDGSGHITGNYASHRSLSGCPLADKSLRNLMAAHSADLKCPTPGCDGSGHITGNYASHRSLSGCPRA----KKSGLKIT 809          

HSP 2 Score: 100.138 bits (248), Expect = 2.815e-22
Identity = 52/100 (52.00%), Postives = 60/100 (60.00%), Query Frame = 1
Query:  646 DLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLV-----------LSLHIE-QRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHNGKITVKE 909
            +L++CP PGCDG GH+S  Y SHRS SGCP A R               SL  E   CPT  CDGSGH  G++ +HRSLSGCPRAS   KK  GKI+  E
Sbjct:  819 ELMKCPVPGCDGLGHISGKYASHRSASGCPLAARRQKEGALNGSAFSWKSLKTEGPTCPTPGCDGSGHANGSFLTHRSLSGCPRASFAGKK--GKISGDE 916          

HSP 3 Score: 96.6709 bits (239), Expect = 4.427e-21
Identity = 43/82 (52.44%), Postives = 57/82 (69.51%), Query Frame = 1
Query:  640 KKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADR--SLVLSLHIEQ-RCPTISCDGSGHITGNYSSHRSLSGCPRASLER 876
            +K  ++CPTPGCDG+GHV+  Y  HRSLSGCP  DR    +L++H    +CPT  C G GH+  N ++HRSLSGCP A+ E+
Sbjct:  370 EKREIKCPTPGCDGTGHVTGLYPHHRSLSGCPHKDRIPPEILAMHENVLKCPTPGCTGQGHVNSNRNTHRSLSGCPIAAAEK 451          

HSP 4 Score: 60.077 bits (144), Expect = 3.812e-9
Identity = 23/35 (65.71%), Postives = 29/35 (82.86%), Query Frame = 1
Query:  637 LKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRA 741
            LK +   CPTPGCDGSGH + ++++HRSLSGCPRA
Sbjct:  869 LKTEGPTCPTPGCDGSGHANGSFLTHRSLSGCPRA 903          

HSP 5 Score: 58.9214 bits (141), Expect = 8.278e-9
Identity = 28/69 (40.58%), Postives = 46/69 (66.67%), Query Frame = 1
Query:  589 NRIVSGNKNKNQL---LSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQRCP 786
            +R +SG  +K+++   +  + +++L+CPTPGC G GHV++N  +HRSLSGCP A    +   H +Q+ P
Sbjct:  394 HRSLSGCPHKDRIPPEILAMHENVLKCPTPGCTGQGHVNSNRNTHRSLSGCPIAAAEKLARSHEKQQQP 462          
BLAST of SMED30004950 vs. Ensembl Xenopus
Match: dpysl5 (dihydropyrimidinase like 5 [Source:Xenbase;Acc:XB-GENE-6073088])

HSP 1 Score: 128.257 bits (321), Expect = 1.305e-31
Identity = 61/90 (67.78%), Postives = 71/90 (78.89%), Query Frame = 1
Query:  640 KKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSL--VLSLH-IEQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHNGKIT 900
            KK+LL CPTPGCDGSGH++ NY SHRSLSGCP AD+SL  +++ H  + +CPT  CDGSGHITGNY+SHRSLSGCPRA    KK   KIT
Sbjct:  785 KKELLTCPTPGCDGSGHITGNYASHRSLSGCPLADKSLRNLMAAHSADLKCPTPGCDGSGHITGNYASHRSLSGCPRA----KKSGLKIT 870          

HSP 2 Score: 100.138 bits (248), Expect = 3.388e-22
Identity = 52/100 (52.00%), Postives = 60/100 (60.00%), Query Frame = 1
Query:  646 DLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLV-----------LSLHIE-QRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHNGKITVKE 909
            +L++CP PGCDG GH+S  Y SHRS SGCP A R               SL  E   CPT  CDGSGH  G++ +HRSLSGCPRAS   KK  GKI+  E
Sbjct:  880 ELMKCPVPGCDGLGHISGKYASHRSASGCPLAARRQKEGALNGSAFSWKSLKTEGPTCPTPGCDGSGHANGSFLTHRSLSGCPRASFAGKK--GKISGDE 977          

HSP 3 Score: 97.4413 bits (241), Expect = 2.847e-21
Identity = 48/113 (42.48%), Postives = 71/113 (62.83%), Query Frame = 1
Query:  577 NNIKNRIVSGNKNKNQLLSILKKDL----------LRCPTPGCDGSGHVSNNYISHRSLSGCPRADR--SLVLSLHIEQ-RCPTISCDGSGHITGNYSSHRSLSGCPRASLER 876
            +N+KN   S ++ +N+ +  ++K+           ++CPTPGCDG+GHV+  Y  HRSLSGCP  DR    +L++H    +CPT  C G GH+  N ++HRSLSGCP A+ E+
Sbjct:  406 DNMKN--FSADEKQNRPIDTMRKNFYDAARPEKREIKCPTPGCDGTGHVTGLYPHHRSLSGCPHKDRIPPEILAMHENVLKCPTPGCTGQGHVNSNRNTHRSLSGCPIAAAEK 516          

HSP 4 Score: 59.6918 bits (143), Expect = 4.294e-9
Identity = 23/35 (65.71%), Postives = 29/35 (82.86%), Query Frame = 1
Query:  637 LKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRA 741
            LK +   CPTPGCDGSGH + ++++HRSLSGCPRA
Sbjct:  930 LKTEGPTCPTPGCDGSGHANGSFLTHRSLSGCPRA 964          

HSP 5 Score: 58.9214 bits (141), Expect = 9.404e-9
Identity = 28/69 (40.58%), Postives = 46/69 (66.67%), Query Frame = 1
Query:  589 NRIVSGNKNKNQL---LSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQRCP 786
            +R +SG  +K+++   +  + +++L+CPTPGC G GHV++N  +HRSLSGCP A    +   H +Q+ P
Sbjct:  459 HRSLSGCPHKDRIPPEILAMHENVLKCPTPGCTGQGHVNSNRNTHRSLSGCPIAAAEKLARSHEKQQQP 527          
BLAST of SMED30004950 vs. Ensembl Xenopus
Match: cecr2 (CECR2, histone acetyl-lysine reader [Source:Xenbase;Acc:XB-GENE-6461178])

HSP 1 Score: 126.716 bits (317), Expect = 3.387e-31
Identity = 61/98 (62.24%), Postives = 72/98 (73.47%), Query Frame = 1
Query:  637 LKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRAD---RSLVLSLHIEQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHNGKITVKETEEE 921
            +KKDL+ CPTPGCDGSGHV+ NY SHRS+SGCP AD   +SL+ +   E +CPT  CDGSGH+TGNY+SHRSLSGCPRA   RK        KE +EE
Sbjct:  653 MKKDLITCPTPGCDGSGHVTGNYASHRSVSGCPLADKTLKSLMAANSQELKCPTPGCDGSGHVTGNYASHRSLSGCPRA---RKNGVKLFASKEDKEE 747          

HSP 2 Score: 109.383 bits (272), Expect = 2.355e-25
Identity = 55/113 (48.67%), Postives = 72/113 (63.72%), Query Frame = 1
Query:  577 NNIKNRIVSG----NKNKNQLLSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSL-------HIEQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKK 882
            N   +R VSG    +K    L++   ++L +CPTPGCDGSGHV+ NY SHRSLSGCPRA ++ V            E +CP + CDG GHI+G Y+SHRS SGCP A+  +K+
Sbjct:  674 NYASHRSVSGCPLADKTLKSLMAANSQEL-KCPTPGCDGSGHVTGNYASHRSLSGCPRARKNGVKLFASKEDKEEQELKCPVVGCDGQGHISGKYTSHRSASGCPLAAKRQKE 785          

HSP 3 Score: 92.8189 bits (229), Expect = 8.924e-20
Identity = 46/102 (45.10%), Postives = 62/102 (60.78%), Query Frame = 1
Query:  580 NIKNRIVSGNKNKNQLLSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQ---RCPTISCDGSGHITGNYSSHRSLSGCPRASLER 876
            +I  R +  NKN  +     +K   +CP PGCDGSGHV+  Y  HRSLSGCP   R  +  L + +   +CPT  C+G GH+  N ++HRSLSGCP A+ E+
Sbjct:  295 DITGRQIYSNKNSPRP----EKRETKCPIPGCDGSGHVTGLYPHHRSLSGCPHKVRVPIEILAMHENVLKCPTPGCNGRGHVNSNRNTHRSLSGCPIAAAEK 392          

HSP 4 Score: 53.9138 bits (128), Expect = 3.254e-7
Identity = 21/38 (55.26%), Postives = 30/38 (78.95%), Query Frame = 1
Query:  640 KKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSL 753
            K++L  CP PGC+G GHV+N +++HRSLSGCP   ++L
Sbjct:  799 KQELPHCPLPGCNGLGHVNNVFVTHRSLSGCPLNAQAL 836          
BLAST of SMED30004950 vs. Ensembl Xenopus
Match: cecr2 (CECR2, histone acetyl-lysine reader [Source:Xenbase;Acc:XB-GENE-6461178])

HSP 1 Score: 126.716 bits (317), Expect = 3.750e-31
Identity = 61/98 (62.24%), Postives = 72/98 (73.47%), Query Frame = 1
Query:  637 LKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRAD---RSLVLSLHIEQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHNGKITVKETEEE 921
            +KKDL+ CPTPGCDGSGHV+ NY SHRS+SGCP AD   +SL+ +   E +CPT  CDGSGH+TGNY+SHRSLSGCPRA   RK        KE +EE
Sbjct:  671 MKKDLITCPTPGCDGSGHVTGNYASHRSVSGCPLADKTLKSLMAANSQELKCPTPGCDGSGHVTGNYASHRSLSGCPRA---RKNGVKLFASKEDKEE 765          

HSP 2 Score: 109.383 bits (272), Expect = 2.509e-25
Identity = 55/113 (48.67%), Postives = 72/113 (63.72%), Query Frame = 1
Query:  577 NNIKNRIVSG----NKNKNQLLSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSL-------HIEQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKK 882
            N   +R VSG    +K    L++   ++L +CPTPGCDGSGHV+ NY SHRSLSGCPRA ++ V            E +CP + CDG GHI+G Y+SHRS SGCP A+  +K+
Sbjct:  692 NYASHRSVSGCPLADKTLKSLMAANSQEL-KCPTPGCDGSGHVTGNYASHRSLSGCPRARKNGVKLFASKEDKEEQELKCPVVGCDGQGHISGKYTSHRSASGCPLAAKRQKE 803          

HSP 3 Score: 92.8189 bits (229), Expect = 8.824e-20
Identity = 46/102 (45.10%), Postives = 62/102 (60.78%), Query Frame = 1
Query:  580 NIKNRIVSGNKNKNQLLSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQ---RCPTISCDGSGHITGNYSSHRSLSGCPRASLER 876
            +I  R +  NKN  +     +K   +CP PGCDGSGHV+  Y  HRSLSGCP   R  +  L + +   +CPT  C+G GH+  N ++HRSLSGCP A+ E+
Sbjct:  309 DITGRQIYSNKNSPRP----EKRETKCPIPGCDGSGHVTGLYPHHRSLSGCPHKVRVPIEILAMHENVLKCPTPGCNGRGHVNSNRNTHRSLSGCPIAAAEK 406          

HSP 4 Score: 53.9138 bits (128), Expect = 3.327e-7
Identity = 21/38 (55.26%), Postives = 30/38 (78.95%), Query Frame = 1
Query:  640 KKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSL 753
            K++L  CP PGC+G GHV+N +++HRSLSGCP   ++L
Sbjct:  817 KQELPHCPLPGCNGLGHVNNVFVTHRSLSGCPLNAQAL 854          
BLAST of SMED30004950 vs. Ensembl Xenopus
Match: cecr2 (CECR2, histone acetyl-lysine reader [Source:Xenbase;Acc:XB-GENE-6461178])

HSP 1 Score: 126.331 bits (316), Expect = 4.294e-31
Identity = 61/98 (62.24%), Postives = 72/98 (73.47%), Query Frame = 1
Query:  637 LKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRAD---RSLVLSLHIEQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHNGKITVKETEEE 921
            +KKDL+ CPTPGCDGSGHV+ NY SHRS+SGCP AD   +SL+ +   E +CPT  CDGSGH+TGNY+SHRSLSGCPRA   RK        KE +EE
Sbjct:  681 MKKDLITCPTPGCDGSGHVTGNYASHRSVSGCPLADKTLKSLMAANSQELKCPTPGCDGSGHVTGNYASHRSLSGCPRA---RKNGVKLFASKEDKEE 775          

HSP 2 Score: 109.383 bits (272), Expect = 2.614e-25
Identity = 55/113 (48.67%), Postives = 72/113 (63.72%), Query Frame = 1
Query:  577 NNIKNRIVSG----NKNKNQLLSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSL-------HIEQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKK 882
            N   +R VSG    +K    L++   ++L +CPTPGCDGSGHV+ NY SHRSLSGCPRA ++ V            E +CP + CDG GHI+G Y+SHRS SGCP A+  +K+
Sbjct:  702 NYASHRSVSGCPLADKTLKSLMAANSQEL-KCPTPGCDGSGHVTGNYASHRSLSGCPRARKNGVKLFASKEDKEEQELKCPVVGCDGQGHISGKYTSHRSASGCPLAAKRQKE 813          

HSP 3 Score: 92.4337 bits (228), Expect = 1.016e-19
Identity = 46/102 (45.10%), Postives = 62/102 (60.78%), Query Frame = 1
Query:  580 NIKNRIVSGNKNKNQLLSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQ---RCPTISCDGSGHITGNYSSHRSLSGCPRASLER 876
            +I  R +  NKN  +     +K   +CP PGCDGSGHV+  Y  HRSLSGCP   R  +  L + +   +CPT  C+G GH+  N ++HRSLSGCP A+ E+
Sbjct:  318 DITGRQIYSNKNSPRP----EKRETKCPIPGCDGSGHVTGLYPHHRSLSGCPHKVRVPIEILAMHENVLKCPTPGCNGRGHVNSNRNTHRSLSGCPIAAAEK 415          

HSP 4 Score: 53.9138 bits (128), Expect = 3.640e-7
Identity = 21/38 (55.26%), Postives = 30/38 (78.95%), Query Frame = 1
Query:  640 KKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSL 753
            K++L  CP PGC+G GHV+N +++HRSLSGCP   ++L
Sbjct:  827 KQELPHCPLPGCNGLGHVNNVFVTHRSLSGCPLNAQAL 864          
BLAST of SMED30004950 vs. Ensembl Mouse
Match: Myt1 (myelin transcription factor 1 [Source:MGI Symbol;Acc:MGI:1100535])

HSP 1 Score: 127.872 bits (320), Expect = 1.251e-31
Identity = 56/79 (70.89%), Postives = 67/79 (84.81%), Query Frame = 1
Query:  637 LKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSL--VLSLH-IEQRCPTISCDGSGHITGNYSSHRSLSGCPRA 864
            +KK+LL CPTPGCDGSGH++ NY SHRSLSGCP AD+SL  +++ H  + +CPT  CDGSGHITGNY+SHRSLSGCPRA
Sbjct:  757 IKKELLTCPTPGCDGSGHITGNYASHRSLSGCPLADKSLRNLMAAHSADLKCPTPGCDGSGHITGNYASHRSLSGCPRA 835          

HSP 2 Score: 92.4337 bits (228), Expect = 8.277e-20
Identity = 49/100 (49.00%), Postives = 59/100 (59.00%), Query Frame = 1
Query:  646 DLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLV-----------LSLHIE-QRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHNGKITVKE 909
            +L++CP PGC G GH+S  Y SHRS SGCP A R               SL  E   CPT  CDGSGH  G++ +HRSLSGCPRA+   KK  GK++  E
Sbjct:  853 ELMKCPVPGCVGLGHISGKYASHRSASGCPLAARRQKEGALNGSSFSWKSLKNEGPTCPTPGCDGSGHANGSFLTHRSLSGCPRATFAGKK--GKLSGDE 950          

HSP 3 Score: 80.1073 bits (196), Expect = 1.062e-15
Identity = 36/73 (49.32%), Postives = 49/73 (67.12%), Query Frame = 1
Query:  631 SILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADR--SLVLSLHIEQ-RCPTISCDGSGHITGNYSSHR 840
            S ++K  ++CPTPGCDG+GHV+  Y  HRSLSGCP  DR    +L++H    +CPT  C G GH+  N ++HR
Sbjct:  435 SRVEKREIKCPTPGCDGTGHVTGLYPHHRSLSGCPHKDRIPPEILAMHENVLKCPTPGCTGQGHVNSNRNTHR 507          

HSP 4 Score: 59.3066 bits (142), Expect = 4.441e-9
Identity = 23/35 (65.71%), Postives = 29/35 (82.86%), Query Frame = 1
Query:  637 LKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRA 741
            LK +   CPTPGCDGSGH + ++++HRSLSGCPRA
Sbjct:  903 LKNEGPTCPTPGCDGSGHANGSFLTHRSLSGCPRA 937          

HSP 5 Score: 52.373 bits (124), Expect = 7.026e-7
Identity = 20/29 (68.97%), Postives = 23/29 (79.31%), Query Frame = 1
Query:  772 EQRCPTISCDGSGHITGNYSSHRSLSGCP 858
            E +CPT  CDG+GH+TG Y  HRSLSGCP
Sbjct:  441 EIKCPTPGCDGTGHVTGLYPHHRSLSGCP 469          

HSP 6 Score: 50.0618 bits (118), Expect = 4.715e-6
Identity = 20/32 (62.50%), Postives = 21/32 (65.62%), Query Frame = 1
Query:  652 LRCPTPGCDGSGHVSNNYISHRSLSGCPRADR 747
            L CPTPGC GSGHV   Y  HRSL  CP A +
Sbjct:   28 LSCPTPGCTGSGHVRGKYSRHRSLQSCPLAKK 59          
BLAST of SMED30004950 vs. Ensembl Mouse
Match: St18 (suppression of tumorigenicity 18 [Source:MGI Symbol;Acc:MGI:2446700])

HSP 1 Score: 127.487 bits (319), Expect = 1.391e-31
Identity = 63/101 (62.38%), Postives = 75/101 (74.26%), Query Frame = 1
Query:  637 LKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRAD---RSLVLSLHIEQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHNGKITVKETEEECTD 930
            LKK+L+ CPTPGCDGSGHV+ NY SHRS+SGCP AD   +SL+ +   E +CPT  CDGSGH+TGNY+SHRSLSGCPRA   RK   G I +  T+EE  D
Sbjct:  715 LKKELITCPTPGCDGSGHVTGNYASHRSVSGCPLADKTLKSLMAANSQELKCPTPGCDGSGHVTGNYASHRSLSGCPRA---RK---GGIKMTPTKEEKED 809          

HSP 2 Score: 110.153 bits (274), Expect = 1.171e-25
Identity = 57/115 (49.57%), Postives = 73/115 (63.48%), Query Frame = 1
Query:  577 NNIKNRIVSG----NKNKNQLLSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHI-------EQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHN 888
            N   +R VSG    +K    L++   ++L +CPTPGCDGSGHV+ NY SHRSLSGCPRA +  +            E RCP I CDG GHI+G Y+SHR+ SGCP A+ +R+K N
Sbjct:  736 NYASHRSVSGCPLADKTLKSLMAANSQEL-KCPTPGCDGSGHVTGNYASHRSLSGCPRARKGGIKMTPTKEEKEDSELRCPVIGCDGQGHISGKYTSHRTASGCPLAA-KRQKEN 848          

HSP 3 Score: 88.9669 bits (219), Expect = 1.317e-18
Identity = 39/77 (50.65%), Postives = 51/77 (66.23%), Query Frame = 1
Query:  655 RCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQ---RCPTISCDGSGHITGNYSSHRSLSGCPRASLER 876
            +CP PGCDG+GHV+  Y  HRSLSGCP   R  +  L + +   +CPT  C G GH+  N ++HRSLSGCP A+ E+
Sbjct:  365 KCPIPGCDGTGHVTGLYPHHRSLSGCPHKVRVPLEILAMHENVLKCPTPGCTGRGHVNSNRNTHRSLSGCPIAAAEK 441          

HSP 4 Score: 55.8398 bits (133), Expect = 6.099e-8
Identity = 25/62 (40.32%), Postives = 39/62 (62.90%), Query Frame = 1
Query:  640 KKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQRCPTISCDGSGHITGN 825
            K++L  CP PGC+G GHV+N +++HRSLSGCP  +   +  + + +   TI    +G I G+
Sbjct:  861 KQELPHCPLPGCNGLGHVNNVFVTHRSLSGCP-LNAQAIKKVKVSEELMTIKLKATGGIDGD 921          

HSP 5 Score: 55.8398 bits (133), Expect = 6.485e-8
Identity = 44/117 (37.61%), Postives = 63/117 (53.85%), Query Frame = 1
Query:  589 NRIVSGNKNKNQL-LSILK--KDLLRCPTPGCDGSGHVSNNYISHRSLSGCP-RADRSLVLSLHIEQ--RCPTISCDGSGH-------ITGNYSSHRSLSGCPRASLERKKHN-GKI 897
            +R +SG  +K ++ L IL   +++L+CPTPGC G GHV++N  +HRSLSGCP  A   L ++    Q     T  C    H       I  N+ SH   S  PRAS  +++   GK+
Sbjct:  384 HRSLSGCPHKVRVPLEILAMHENVLKCPTPGCTGRGHVNSNRNTHRSLSGCPIAAAEKLAMTQDKSQLDSSQTGQCPEQAHRVNLVKQIEFNFRSHAITS--PRASASKEQEKFGKV 498          

HSP 6 Score: 51.9878 bits (123), Expect = 1.079e-6
Identity = 25/50 (50.00%), Postives = 29/50 (58.00%), Query Frame = 1
Query:  733 PRADRSLVLSLHIEQRCPTISCDGSGHITGNYSSHRSLSGCP---RASLE 873
            PR +R        E +CP   CDG+GH+TG Y  HRSLSGCP   R  LE
Sbjct:  357 PRPERR-------EAKCPIPGCDGTGHVTGLYPHHRSLSGCPHKVRVPLE 399          
BLAST of SMED30004950 vs. Ensembl Mouse
Match: St18 (suppression of tumorigenicity 18 [Source:MGI Symbol;Acc:MGI:2446700])

HSP 1 Score: 127.487 bits (319), Expect = 1.391e-31
Identity = 63/101 (62.38%), Postives = 75/101 (74.26%), Query Frame = 1
Query:  637 LKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRAD---RSLVLSLHIEQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHNGKITVKETEEECTD 930
            LKK+L+ CPTPGCDGSGHV+ NY SHRS+SGCP AD   +SL+ +   E +CPT  CDGSGH+TGNY+SHRSLSGCPRA   RK   G I +  T+EE  D
Sbjct:  715 LKKELITCPTPGCDGSGHVTGNYASHRSVSGCPLADKTLKSLMAANSQELKCPTPGCDGSGHVTGNYASHRSLSGCPRA---RK---GGIKMTPTKEEKED 809          

HSP 2 Score: 110.153 bits (274), Expect = 1.171e-25
Identity = 57/115 (49.57%), Postives = 73/115 (63.48%), Query Frame = 1
Query:  577 NNIKNRIVSG----NKNKNQLLSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHI-------EQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHN 888
            N   +R VSG    +K    L++   ++L +CPTPGCDGSGHV+ NY SHRSLSGCPRA +  +            E RCP I CDG GHI+G Y+SHR+ SGCP A+ +R+K N
Sbjct:  736 NYASHRSVSGCPLADKTLKSLMAANSQEL-KCPTPGCDGSGHVTGNYASHRSLSGCPRARKGGIKMTPTKEEKEDSELRCPVIGCDGQGHISGKYTSHRTASGCPLAA-KRQKEN 848          

HSP 3 Score: 88.9669 bits (219), Expect = 1.317e-18
Identity = 39/77 (50.65%), Postives = 51/77 (66.23%), Query Frame = 1
Query:  655 RCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQ---RCPTISCDGSGHITGNYSSHRSLSGCPRASLER 876
            +CP PGCDG+GHV+  Y  HRSLSGCP   R  +  L + +   +CPT  C G GH+  N ++HRSLSGCP A+ E+
Sbjct:  365 KCPIPGCDGTGHVTGLYPHHRSLSGCPHKVRVPLEILAMHENVLKCPTPGCTGRGHVNSNRNTHRSLSGCPIAAAEK 441          

HSP 4 Score: 55.8398 bits (133), Expect = 6.099e-8
Identity = 25/62 (40.32%), Postives = 39/62 (62.90%), Query Frame = 1
Query:  640 KKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQRCPTISCDGSGHITGN 825
            K++L  CP PGC+G GHV+N +++HRSLSGCP  +   +  + + +   TI    +G I G+
Sbjct:  861 KQELPHCPLPGCNGLGHVNNVFVTHRSLSGCP-LNAQAIKKVKVSEELMTIKLKATGGIDGD 921          

HSP 5 Score: 55.8398 bits (133), Expect = 6.485e-8
Identity = 44/117 (37.61%), Postives = 63/117 (53.85%), Query Frame = 1
Query:  589 NRIVSGNKNKNQL-LSILK--KDLLRCPTPGCDGSGHVSNNYISHRSLSGCP-RADRSLVLSLHIEQ--RCPTISCDGSGH-------ITGNYSSHRSLSGCPRASLERKKHN-GKI 897
            +R +SG  +K ++ L IL   +++L+CPTPGC G GHV++N  +HRSLSGCP  A   L ++    Q     T  C    H       I  N+ SH   S  PRAS  +++   GK+
Sbjct:  384 HRSLSGCPHKVRVPLEILAMHENVLKCPTPGCTGRGHVNSNRNTHRSLSGCPIAAAEKLAMTQDKSQLDSSQTGQCPEQAHRVNLVKQIEFNFRSHAITS--PRASASKEQEKFGKV 498          

HSP 6 Score: 51.9878 bits (123), Expect = 1.079e-6
Identity = 25/50 (50.00%), Postives = 29/50 (58.00%), Query Frame = 1
Query:  733 PRADRSLVLSLHIEQRCPTISCDGSGHITGNYSSHRSLSGCP---RASLE 873
            PR +R        E +CP   CDG+GH+TG Y  HRSLSGCP   R  LE
Sbjct:  357 PRPERR-------EAKCPIPGCDGTGHVTGLYPHHRSLSGCPHKVRVPLE 399          
BLAST of SMED30004950 vs. Ensembl Mouse
Match: St18 (suppression of tumorigenicity 18 [Source:MGI Symbol;Acc:MGI:2446700])

HSP 1 Score: 127.487 bits (319), Expect = 1.391e-31
Identity = 63/101 (62.38%), Postives = 75/101 (74.26%), Query Frame = 1
Query:  637 LKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRAD---RSLVLSLHIEQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHNGKITVKETEEECTD 930
            LKK+L+ CPTPGCDGSGHV+ NY SHRS+SGCP AD   +SL+ +   E +CPT  CDGSGH+TGNY+SHRSLSGCPRA   RK   G I +  T+EE  D
Sbjct:  715 LKKELITCPTPGCDGSGHVTGNYASHRSVSGCPLADKTLKSLMAANSQELKCPTPGCDGSGHVTGNYASHRSLSGCPRA---RK---GGIKMTPTKEEKED 809          

HSP 2 Score: 110.153 bits (274), Expect = 1.171e-25
Identity = 57/115 (49.57%), Postives = 73/115 (63.48%), Query Frame = 1
Query:  577 NNIKNRIVSG----NKNKNQLLSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHI-------EQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHN 888
            N   +R VSG    +K    L++   ++L +CPTPGCDGSGHV+ NY SHRSLSGCPRA +  +            E RCP I CDG GHI+G Y+SHR+ SGCP A+ +R+K N
Sbjct:  736 NYASHRSVSGCPLADKTLKSLMAANSQEL-KCPTPGCDGSGHVTGNYASHRSLSGCPRARKGGIKMTPTKEEKEDSELRCPVIGCDGQGHISGKYTSHRTASGCPLAA-KRQKEN 848          

HSP 3 Score: 88.9669 bits (219), Expect = 1.317e-18
Identity = 39/77 (50.65%), Postives = 51/77 (66.23%), Query Frame = 1
Query:  655 RCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQ---RCPTISCDGSGHITGNYSSHRSLSGCPRASLER 876
            +CP PGCDG+GHV+  Y  HRSLSGCP   R  +  L + +   +CPT  C G GH+  N ++HRSLSGCP A+ E+
Sbjct:  365 KCPIPGCDGTGHVTGLYPHHRSLSGCPHKVRVPLEILAMHENVLKCPTPGCTGRGHVNSNRNTHRSLSGCPIAAAEK 441          

HSP 4 Score: 55.8398 bits (133), Expect = 6.099e-8
Identity = 25/62 (40.32%), Postives = 39/62 (62.90%), Query Frame = 1
Query:  640 KKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQRCPTISCDGSGHITGN 825
            K++L  CP PGC+G GHV+N +++HRSLSGCP  +   +  + + +   TI    +G I G+
Sbjct:  861 KQELPHCPLPGCNGLGHVNNVFVTHRSLSGCP-LNAQAIKKVKVSEELMTIKLKATGGIDGD 921          

HSP 5 Score: 55.8398 bits (133), Expect = 6.485e-8
Identity = 44/117 (37.61%), Postives = 63/117 (53.85%), Query Frame = 1
Query:  589 NRIVSGNKNKNQL-LSILK--KDLLRCPTPGCDGSGHVSNNYISHRSLSGCP-RADRSLVLSLHIEQ--RCPTISCDGSGH-------ITGNYSSHRSLSGCPRASLERKKHN-GKI 897
            +R +SG  +K ++ L IL   +++L+CPTPGC G GHV++N  +HRSLSGCP  A   L ++    Q     T  C    H       I  N+ SH   S  PRAS  +++   GK+
Sbjct:  384 HRSLSGCPHKVRVPLEILAMHENVLKCPTPGCTGRGHVNSNRNTHRSLSGCPIAAAEKLAMTQDKSQLDSSQTGQCPEQAHRVNLVKQIEFNFRSHAITS--PRASASKEQEKFGKV 498          

HSP 6 Score: 51.9878 bits (123), Expect = 1.079e-6
Identity = 25/50 (50.00%), Postives = 29/50 (58.00%), Query Frame = 1
Query:  733 PRADRSLVLSLHIEQRCPTISCDGSGHITGNYSSHRSLSGCP---RASLE 873
            PR +R        E +CP   CDG+GH+TG Y  HRSLSGCP   R  LE
Sbjct:  357 PRPERR-------EAKCPIPGCDGTGHVTGLYPHHRSLSGCPHKVRVPLE 399          
BLAST of SMED30004950 vs. Ensembl Mouse
Match: St18 (suppression of tumorigenicity 18 [Source:MGI Symbol;Acc:MGI:2446700])

HSP 1 Score: 127.487 bits (319), Expect = 1.391e-31
Identity = 63/101 (62.38%), Postives = 75/101 (74.26%), Query Frame = 1
Query:  637 LKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRAD---RSLVLSLHIEQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHNGKITVKETEEECTD 930
            LKK+L+ CPTPGCDGSGHV+ NY SHRS+SGCP AD   +SL+ +   E +CPT  CDGSGH+TGNY+SHRSLSGCPRA   RK   G I +  T+EE  D
Sbjct:  715 LKKELITCPTPGCDGSGHVTGNYASHRSVSGCPLADKTLKSLMAANSQELKCPTPGCDGSGHVTGNYASHRSLSGCPRA---RK---GGIKMTPTKEEKED 809          

HSP 2 Score: 110.153 bits (274), Expect = 1.171e-25
Identity = 57/115 (49.57%), Postives = 73/115 (63.48%), Query Frame = 1
Query:  577 NNIKNRIVSG----NKNKNQLLSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHI-------EQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHN 888
            N   +R VSG    +K    L++   ++L +CPTPGCDGSGHV+ NY SHRSLSGCPRA +  +            E RCP I CDG GHI+G Y+SHR+ SGCP A+ +R+K N
Sbjct:  736 NYASHRSVSGCPLADKTLKSLMAANSQEL-KCPTPGCDGSGHVTGNYASHRSLSGCPRARKGGIKMTPTKEEKEDSELRCPVIGCDGQGHISGKYTSHRTASGCPLAA-KRQKEN 848          

HSP 3 Score: 88.9669 bits (219), Expect = 1.317e-18
Identity = 39/77 (50.65%), Postives = 51/77 (66.23%), Query Frame = 1
Query:  655 RCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQ---RCPTISCDGSGHITGNYSSHRSLSGCPRASLER 876
            +CP PGCDG+GHV+  Y  HRSLSGCP   R  +  L + +   +CPT  C G GH+  N ++HRSLSGCP A+ E+
Sbjct:  365 KCPIPGCDGTGHVTGLYPHHRSLSGCPHKVRVPLEILAMHENVLKCPTPGCTGRGHVNSNRNTHRSLSGCPIAAAEK 441          

HSP 4 Score: 55.8398 bits (133), Expect = 6.099e-8
Identity = 25/62 (40.32%), Postives = 39/62 (62.90%), Query Frame = 1
Query:  640 KKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQRCPTISCDGSGHITGN 825
            K++L  CP PGC+G GHV+N +++HRSLSGCP  +   +  + + +   TI    +G I G+
Sbjct:  861 KQELPHCPLPGCNGLGHVNNVFVTHRSLSGCP-LNAQAIKKVKVSEELMTIKLKATGGIDGD 921          

HSP 5 Score: 55.8398 bits (133), Expect = 6.485e-8
Identity = 44/117 (37.61%), Postives = 63/117 (53.85%), Query Frame = 1
Query:  589 NRIVSGNKNKNQL-LSILK--KDLLRCPTPGCDGSGHVSNNYISHRSLSGCP-RADRSLVLSLHIEQ--RCPTISCDGSGH-------ITGNYSSHRSLSGCPRASLERKKHN-GKI 897
            +R +SG  +K ++ L IL   +++L+CPTPGC G GHV++N  +HRSLSGCP  A   L ++    Q     T  C    H       I  N+ SH   S  PRAS  +++   GK+
Sbjct:  384 HRSLSGCPHKVRVPLEILAMHENVLKCPTPGCTGRGHVNSNRNTHRSLSGCPIAAAEKLAMTQDKSQLDSSQTGQCPEQAHRVNLVKQIEFNFRSHAITS--PRASASKEQEKFGKV 498          

HSP 6 Score: 51.9878 bits (123), Expect = 1.079e-6
Identity = 25/50 (50.00%), Postives = 29/50 (58.00%), Query Frame = 1
Query:  733 PRADRSLVLSLHIEQRCPTISCDGSGHITGNYSSHRSLSGCP---RASLE 873
            PR +R        E +CP   CDG+GH+TG Y  HRSLSGCP   R  LE
Sbjct:  357 PRPERR-------EAKCPIPGCDGTGHVTGLYPHHRSLSGCPHKVRVPLE 399          
BLAST of SMED30004950 vs. UniProt/SwissProt
Match: sp|P70047|MYT1_XENLA (Myelin transcription factor 1 OS=Xenopus laevis OX=8355 GN=myt1 PE=2 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 7.607e-31
Identity = 56/78 (71.79%), Postives = 66/78 (84.62%), Query Frame = 1
Query:  640 KKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSL--VLSLH-IEQRCPTISCDGSGHITGNYSSHRSLSGCPRA 864
            KK+LL CPTPGCDGSGH++ NY SHRSLSGCP AD+SL  +++ H  + +CPT  CDGSGHITGNY+SHRSLSGCPRA
Sbjct:  791 KKELLSCPTPGCDGSGHITGNYASHRSLSGCPLADKSLRNLMAAHSADLKCPTPGCDGSGHITGNYASHRSLSGCPRA 868          

HSP 2 Score: 100.138 bits (248), Expect = 1.954e-21
Identity = 52/99 (52.53%), Postives = 59/99 (59.60%), Query Frame = 1
Query:  649 LLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLV-----------LSLHIE-QRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHNGKITVKE 909
            L++CP PGCDG GH+S  Y SHRS SGCP A R               SL  E   CPT  CDGSGH  G++ +HRSLSGCPRAS   KK  GKI+  E
Sbjct:  887 LMKCPVPGCDGLGHISGKYASHRSASGCPLAARRQKEGALNGSAFSWKSLKTEGPSCPTPGCDGSGHANGSFLTHRSLSGCPRASFAGKK--GKISGDE 983          

HSP 3 Score: 97.4413 bits (241), Expect = 1.430e-20
Identity = 48/113 (42.48%), Postives = 70/113 (61.95%), Query Frame = 1
Query:  577 NNIKNRIVSGNKNKNQLLSILKKDL----------LRCPTPGCDGSGHVSNNYISHRSLSGCPRADR--SLVLSLHIEQ-RCPTISCDGSGHITGNYSSHRSLSGCPRASLER 876
            +N+KN   S ++ +N+ +  ++K            ++CPTPGCDG+GHV+  Y  HRSLSGCP  DR    +L++H    +CPT  C G GH+  N ++HRSLSGCP A+ E+
Sbjct:  368 DNMKN--FSADEKQNRPIDTMRKSFYDAGRPEKRDIKCPTPGCDGTGHVTGLYPHHRSLSGCPHKDRIPPEILAMHENVLKCPTPGCTGQGHVNSNRNTHRSLSGCPIAAAEK 478          

HSP 4 Score: 60.4622 bits (145), Expect = 1.702e-8
Identity = 23/35 (65.71%), Postives = 29/35 (82.86%), Query Frame = 1
Query:  637 LKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRA 741
            LK +   CPTPGCDGSGH + ++++HRSLSGCPRA
Sbjct:  936 LKTEGPSCPTPGCDGSGHANGSFLTHRSLSGCPRA 970          

HSP 5 Score: 58.9214 bits (141), Expect = 4.527e-8
Identity = 28/69 (40.58%), Postives = 46/69 (66.67%), Query Frame = 1
Query:  589 NRIVSGNKNKNQL---LSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQRCP 786
            +R +SG  +K+++   +  + +++L+CPTPGC G GHV++N  +HRSLSGCP A    +   H +Q+ P
Sbjct:  421 HRSLSGCPHKDRIPPEILAMHENVLKCPTPGCTGQGHVNSNRNTHRSLSGCPIAAAEKLTRSHEKQQQP 489          
BLAST of SMED30004950 vs. UniProt/SwissProt
Match: sp|Q80TY4|ST18_MOUSE (Suppression of tumorigenicity 18 protein OS=Mus musculus OX=10090 GN=St18 PE=2 SV=2)

HSP 1 Score: 127.487 bits (319), Expect = 9.733e-31
Identity = 63/101 (62.38%), Postives = 75/101 (74.26%), Query Frame = 1
Query:  637 LKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRAD---RSLVLSLHIEQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHNGKITVKETEEECTD 930
            LKK+L+ CPTPGCDGSGHV+ NY SHRS+SGCP AD   +SL+ +   E +CPT  CDGSGH+TGNY+SHRSLSGCPRA   RK   G I +  T+EE  D
Sbjct:  715 LKKELITCPTPGCDGSGHVTGNYASHRSVSGCPLADKTLKSLMAANSQELKCPTPGCDGSGHVTGNYASHRSLSGCPRA---RK---GGIKMTPTKEEKED 809          

HSP 2 Score: 110.153 bits (274), Expect = 8.192e-25
Identity = 57/115 (49.57%), Postives = 73/115 (63.48%), Query Frame = 1
Query:  577 NNIKNRIVSG----NKNKNQLLSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHI-------EQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHN 888
            N   +R VSG    +K    L++   ++L +CPTPGCDGSGHV+ NY SHRSLSGCPRA +  +            E RCP I CDG GHI+G Y+SHR+ SGCP A+ +R+K N
Sbjct:  736 NYASHRSVSGCPLADKTLKSLMAANSQEL-KCPTPGCDGSGHVTGNYASHRSLSGCPRARKGGIKMTPTKEEKEDSELRCPVIGCDGQGHISGKYTSHRTASGCPLAA-KRQKEN 848          

HSP 3 Score: 88.9669 bits (219), Expect = 9.216e-18
Identity = 39/77 (50.65%), Postives = 51/77 (66.23%), Query Frame = 1
Query:  655 RCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQ---RCPTISCDGSGHITGNYSSHRSLSGCPRASLER 876
            +CP PGCDG+GHV+  Y  HRSLSGCP   R  +  L + +   +CPT  C G GH+  N ++HRSLSGCP A+ E+
Sbjct:  365 KCPIPGCDGTGHVTGLYPHHRSLSGCPHKVRVPLEILAMHENVLKCPTPGCTGRGHVNSNRNTHRSLSGCPIAAAEK 441          

HSP 4 Score: 55.8398 bits (133), Expect = 4.266e-7
Identity = 25/62 (40.32%), Postives = 39/62 (62.90%), Query Frame = 1
Query:  640 KKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQRCPTISCDGSGHITGN 825
            K++L  CP PGC+G GHV+N +++HRSLSGCP  +   +  + + +   TI    +G I G+
Sbjct:  861 KQELPHCPLPGCNGLGHVNNVFVTHRSLSGCP-LNAQAIKKVKVSEELMTIKLKATGGIDGD 921          

HSP 5 Score: 55.8398 bits (133), Expect = 4.536e-7
Identity = 44/117 (37.61%), Postives = 63/117 (53.85%), Query Frame = 1
Query:  589 NRIVSGNKNKNQL-LSILK--KDLLRCPTPGCDGSGHVSNNYISHRSLSGCP-RADRSLVLSLHIEQ--RCPTISCDGSGH-------ITGNYSSHRSLSGCPRASLERKKHN-GKI 897
            +R +SG  +K ++ L IL   +++L+CPTPGC G GHV++N  +HRSLSGCP  A   L ++    Q     T  C    H       I  N+ SH   S  PRAS  +++   GK+
Sbjct:  384 HRSLSGCPHKVRVPLEILAMHENVLKCPTPGCTGRGHVNSNRNTHRSLSGCPIAAAEKLAMTQDKSQLDSSQTGQCPEQAHRVNLVKQIEFNFRSHAITS--PRASASKEQEKFGKV 498          

HSP 6 Score: 51.9878 bits (123), Expect = 7.545e-6
Identity = 25/50 (50.00%), Postives = 29/50 (58.00%), Query Frame = 1
Query:  733 PRADRSLVLSLHIEQRCPTISCDGSGHITGNYSSHRSLSGCP---RASLE 873
            PR +R        E +CP   CDG+GH+TG Y  HRSLSGCP   R  LE
Sbjct:  357 PRPERR-------EAKCPIPGCDGTGHVTGLYPHHRSLSGCPHKVRVPLE 399          
BLAST of SMED30004950 vs. UniProt/SwissProt
Match: sp|Q01538|MYT1_HUMAN (Myelin transcription factor 1 OS=Homo sapiens OX=9606 GN=MYT1 PE=1 SV=2)

HSP 1 Score: 127.487 bits (319), Expect = 9.799e-31
Identity = 56/79 (70.89%), Postives = 67/79 (84.81%), Query Frame = 1
Query:  637 LKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSL--VLSLH-IEQRCPTISCDGSGHITGNYSSHRSLSGCPRA 864
            +KK+LL CPTPGCDGSGH++ NY SHRSLSGCP AD+SL  +++ H  + +CPT  CDGSGHITGNY+SHRSLSGCPRA
Sbjct:  793 IKKELLTCPTPGCDGSGHITGNYASHRSLSGCPLADKSLRNLMAAHSADLKCPTPGCDGSGHITGNYASHRSLSGCPRA 871          

HSP 2 Score: 95.9005 bits (237), Expect = 5.040e-20
Identity = 44/85 (51.76%), Postives = 58/85 (68.24%), Query Frame = 1
Query:  631 SILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADR--SLVLSLHIEQ-RCPTISCDGSGHITGNYSSHRSLSGCPRASLER 876
            S  +K  ++CPTPGCDG+GHV+  Y  HRSLSGCP  DR    +L++H    +CPT  C G GH+  N ++HRSLSGCP A+ E+
Sbjct:  433 SRAEKREIKCPTPGCDGTGHVTGLYPHHRSLSGCPHKDRIPPEILAMHENVLKCPTPGCTGQGHVNSNRNTHRSLSGCPIAAAEK 517          

HSP 3 Score: 92.4337 bits (228), Expect = 6.288e-19
Identity = 49/100 (49.00%), Postives = 59/100 (59.00%), Query Frame = 1
Query:  646 DLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLV-----------LSLHIE-QRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHNGKITVKE 909
            +L++CP PGC G GH+S  Y SHRS SGCP A R               SL  E   CPT  CDGSGH  G++ +HRSLSGCPRA+   KK  GK++  E
Sbjct:  889 ELMKCPVPGCVGLGHISGKYASHRSASGCPLAARRQKEGSLNGSSFSWKSLKNEGPTCPTPGCDGSGHANGSFLTHRSLSGCPRATFAGKK--GKLSGDE 986          

HSP 4 Score: 59.3066 bits (142), Expect = 3.072e-8
Identity = 23/35 (65.71%), Postives = 29/35 (82.86%), Query Frame = 1
Query:  637 LKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRA 741
            LK +   CPTPGCDGSGH + ++++HRSLSGCPRA
Sbjct:  939 LKNEGPTCPTPGCDGSGHANGSFLTHRSLSGCPRA 973          

HSP 5 Score: 56.9954 bits (136), Expect = 1.708e-7
Identity = 27/67 (40.30%), Postives = 45/67 (67.16%), Query Frame = 1
Query:  589 NRIVSGNKNKNQL---LSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQR 780
            +R +SG  +K+++   +  + +++L+CPTPGC G GHV++N  +HRSLSGCP A    +   H +Q+
Sbjct:  460 HRSLSGCPHKDRIPPEILAMHENVLKCPTPGCTGQGHVNSNRNTHRSLSGCPIAAAEKLAKSHEKQQ 526          
BLAST of SMED30004950 vs. UniProt/SwissProt
Match: sp|O60284|ST18_HUMAN (Suppression of tumorigenicity 18 protein OS=Homo sapiens OX=9606 GN=ST18 PE=1 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 1.002e-30
Identity = 61/103 (59.22%), Postives = 77/103 (74.76%), Query Frame = 1
Query:  637 LKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRAD---RSLVLSLHIEQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHNGKITVKETEEECTDVK 936
            LKK+L+ CPTPGCDGSGHV+ NY SHRS+SGCP AD   +SL+ +   E +CPT  CDGSGH+TGNY+SHRSLSGCPRA    +K   K+T  + E+E  ++K
Sbjct:  717 LKKELITCPTPGCDGSGHVTGNYASHRSVSGCPLADKTLKSLMAANSQELKCPTPGCDGSGHVTGNYASHRSLSGCPRA----RKGGVKMTPTKEEKEDPELK 815          

HSP 2 Score: 109.383 bits (272), Expect = 1.211e-24
Identity = 57/115 (49.57%), Postives = 73/115 (63.48%), Query Frame = 1
Query:  577 NNIKNRIVSG----NKNKNQLLSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHI-------EQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHN 888
            N   +R VSG    +K    L++   ++L +CPTPGCDGSGHV+ NY SHRSLSGCPRA +  V            E +CP I CDG GHI+G Y+SHR+ SGCP A+ +R+K N
Sbjct:  738 NYASHRSVSGCPLADKTLKSLMAANSQEL-KCPTPGCDGSGHVTGNYASHRSLSGCPRARKGGVKMTPTKEEKEDPELKCPVIGCDGQGHISGKYTSHRTASGCPLAA-KRQKEN 850          

HSP 3 Score: 88.9669 bits (219), Expect = 9.306e-18
Identity = 39/77 (50.65%), Postives = 51/77 (66.23%), Query Frame = 1
Query:  655 RCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQ---RCPTISCDGSGHITGNYSSHRSLSGCPRASLER 876
            +CP PGCDG+GHV+  Y  HRSLSGCP   R  +  L + +   +CPT  C G GH+  N ++HRSLSGCP A+ E+
Sbjct:  367 KCPIPGCDGTGHVTGLYPHHRSLSGCPHKVRVPLEILAMHENVLKCPTPGCTGRGHVNSNRNTHRSLSGCPIAAAEK 443          

HSP 4 Score: 54.299 bits (129), Expect = 1.212e-6
Identity = 28/54 (51.85%), Postives = 40/54 (74.07%), Query Frame = 1
Query:  589 NRIVSGNKNKNQL-LSILK--KDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRA 741
            +R +SG  +K ++ L IL   +++L+CPTPGC G GHV++N  +HRSLSGCP A
Sbjct:  386 HRSLSGCPHKVRVPLEILAMHENVLKCPTPGCTGRGHVNSNRNTHRSLSGCPIA 439          

HSP 5 Score: 53.5286 bits (127), Expect = 2.277e-6
Identity = 20/32 (62.50%), Postives = 27/32 (84.38%), Query Frame = 1
Query:  640 KKDLLRCPTPGCDGSGHVSNNYISHRSLSGCP 735
            K++L  CP PGC+G GHV+N +++HRSLSGCP
Sbjct:  863 KQELPHCPLPGCNGLGHVNNVFVTHRSLSGCP 894          
BLAST of SMED30004950 vs. UniProt/SwissProt
Match: sp|Q8CFC2|MYT1_MOUSE (Myelin transcription factor 1 OS=Mus musculus OX=10090 GN=Myt1 PE=1 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 1.130e-30
Identity = 56/79 (70.89%), Postives = 67/79 (84.81%), Query Frame = 1
Query:  637 LKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSL--VLSLH-IEQRCPTISCDGSGHITGNYSSHRSLSGCPRA 864
            +KK+LL CPTPGCDGSGH++ NY SHRSLSGCP AD+SL  +++ H  + +CPT  CDGSGHITGNY+SHRSLSGCPRA
Sbjct:  795 IKKELLTCPTPGCDGSGHITGNYASHRSLSGCPLADKSLRNLMAAHSADLKCPTPGCDGSGHITGNYASHRSLSGCPRA 873          

HSP 2 Score: 96.6709 bits (239), Expect = 2.510e-20
Identity = 44/85 (51.76%), Postives = 59/85 (69.41%), Query Frame = 1
Query:  631 SILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADR--SLVLSLHIEQ-RCPTISCDGSGHITGNYSSHRSLSGCPRASLER 876
            S ++K  ++CPTPGCDG+GHV+  Y  HRSLSGCP  DR    +L++H    +CPT  C G GH+  N ++HRSLSGCP A+ E+
Sbjct:  435 SRVEKREIKCPTPGCDGTGHVTGLYPHHRSLSGCPHKDRIPPEILAMHENVLKCPTPGCTGQGHVNSNRNTHRSLSGCPIAAAEK 519          

HSP 3 Score: 92.4337 bits (228), Expect = 6.415e-19
Identity = 49/100 (49.00%), Postives = 59/100 (59.00%), Query Frame = 1
Query:  646 DLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLV-----------LSLHIE-QRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHNGKITVKE 909
            +L++CP PGC G GH+S  Y SHRS SGCP A R               SL  E   CPT  CDGSGH  G++ +HRSLSGCPRA+   KK  GK++  E
Sbjct:  891 ELMKCPVPGCVGLGHISGKYASHRSASGCPLAARRQKEGALNGSSFSWKSLKNEGPTCPTPGCDGSGHANGSFLTHRSLSGCPRATFAGKK--GKLSGDE 988          

HSP 4 Score: 59.3066 bits (142), Expect = 3.359e-8
Identity = 23/35 (65.71%), Postives = 29/35 (82.86%), Query Frame = 1
Query:  637 LKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRA 741
            LK +   CPTPGCDGSGH + ++++HRSLSGCPRA
Sbjct:  941 LKNEGPTCPTPGCDGSGHANGSFLTHRSLSGCPRA 975          

HSP 5 Score: 56.9954 bits (136), Expect = 1.710e-7
Identity = 27/67 (40.30%), Postives = 45/67 (67.16%), Query Frame = 1
Query:  589 NRIVSGNKNKNQL---LSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQR 780
            +R +SG  +K+++   +  + +++L+CPTPGC G GHV++N  +HRSLSGCP A    +   H +Q+
Sbjct:  462 HRSLSGCPHKDRIPPEILAMHENVLKCPTPGCTGQGHVNSNRNTHRSLSGCPIAAAEKLAKSHEKQQ 528          
BLAST of SMED30004950 vs. TrEMBL
Match: A0A0L8GT29 (MYT1 domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22028296mg PE=4 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 6.317e-34
Identity = 60/79 (75.95%), Postives = 69/79 (87.34%), Query Frame = 1
Query:  643 KDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERK 879
            ++L+ CPTPGCDGSGHVS NY SHRSLSGCP ADR+ VL+ H+EQ+CPT  CDGSGHITGNYSSHRSLSGCPRA+  +K
Sbjct:  448 RELIHCPTPGCDGSGHVSGNYASHRSLSGCPLADRATVLASHVEQKCPTPGCDGSGHITGNYSSHRSLSGCPRAAKLKK 526          
BLAST of SMED30004950 vs. TrEMBL
Match: A0A1I8HVT0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 8.499e-34
Identity = 61/75 (81.33%), Postives = 66/75 (88.00%), Query Frame = 1
Query:  640 KKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQRCPTISCDGSGHITGNYSSHRSLSGCPRA 864
            +K+LL CPTPGCDGSGHV  +Y SHRSLSGCPRADRSLVL  H+EQ+CPT  CDGSGH TGNYSSHRSLSGCPRA
Sbjct:  295 EKELLHCPTPGCDGSGHVLGSYSSHRSLSGCPRADRSLVLLHHVEQKCPTPGCDGSGHATGNYSSHRSLSGCPRA 369          

HSP 2 Score: 79.337 bits (194), Expect = 3.936e-12
Identity = 33/65 (50.77%), Postives = 40/65 (61.54%), Query Frame = 1
Query:  655 RCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHI---EQRCPTISCDGSGHITGNYSSHR 840
            +CP P CDGSGH +  Y  HRSLSGCPR D+S++  L       +CPT  C G GH+ G  S HR
Sbjct:    9 KCPNPACDGSGHSTGLYSRHRSLSGCPRKDKSVIQGLQSSAQSTKCPTEGCLGKGHVNGRRSHHR 73          

HSP 3 Score: 67.3958 bits (163), Expect = 3.138e-8
Identity = 29/51 (56.86%), Postives = 36/51 (70.59%), Query Frame = 1
Query:  589 NRIVSGNKNKNQLLSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRA 741
            +R +SG    ++ L +L     +CPTPGCDGSGH + NY SHRSLSGCPRA
Sbjct:  319 HRSLSGCPRADRSLVLLHHVEQKCPTPGCDGSGHATGNYSSHRSLSGCPRA 369          
BLAST of SMED30004950 vs. TrEMBL
Match: A0A564Y1U6 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS2128 PE=4 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 7.308e-33
Identity = 53/76 (69.74%), Postives = 64/76 (84.21%), Query Frame = 1
Query:  643 KDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQRCPTISCDGSGHITGNYSSHRSLSGCPRASL 870
            + LL+CP PGCDGS H S NY SHRS+SGCPRAD+++V + H+EQ+CPT  CDGSGH+T NY+SHRSLSGCPRA L
Sbjct:   20 RKLLQCPVPGCDGSSHASGNYASHRSISGCPRADKAMVQAFHVEQKCPTPGCDGSGHVTRNYTSHRSLSGCPRAHL 95          
BLAST of SMED30004950 vs. TrEMBL
Match: A0A564Y1T6 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS2128 PE=4 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 9.661e-33
Identity = 53/76 (69.74%), Postives = 64/76 (84.21%), Query Frame = 1
Query:  643 KDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQRCPTISCDGSGHITGNYSSHRSLSGCPRASL 870
            + LL+CP PGCDGS H S NY SHRS+SGCPRAD+++V + H+EQ+CPT  CDGSGH+T NY+SHRSLSGCPRA L
Sbjct:   20 RKLLQCPVPGCDGSSHASGNYASHRSISGCPRADKAMVQAFHVEQKCPTPGCDGSGHVTRNYTSHRSLSGCPRAHL 95          
BLAST of SMED30004950 vs. TrEMBL
Match: T1KM86 (Uncharacterized protein OS=Tetranychus urticae OX=32264 GN=107365589 PE=4 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 2.813e-32
Identity = 61/92 (66.30%), Postives = 73/92 (79.35%), Query Frame = 1
Query:  643 KDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHNGKITVKETEE 918
            ++LL+CPTPGCDG GHVS NY +HRSLSGCP ADRS V + H+E +CPT  CDGSGHITGNYSSHRSLSGCPRA+  +K    K ++ E +E
Sbjct:    5 RELLQCPTPGCDGMGHVSGNYATHRSLSGCPHADRSQVQAQHVELKCPTPGCDGSGHITGNYSSHRSLSGCPRANKPKKSSLIKKSIVERQE 96          

HSP 2 Score: 87.8113 bits (216), Expect = 2.912e-15
Identity = 53/132 (40.15%), Postives = 67/132 (50.76%), Query Frame = 1
Query:  577 NNIKNRIVSG--NKNKNQLLSILKKDL---------LRCPTPGCDGSGHVSNNYISHRSLSGCPRADRS-------------------------LVLSLHIEQRCPTISCDGSGHITGNYSSHRSLSGCPRA 864
            N   +R +SG    NK +  S++KK +         +RCP  GCDG+GH++  + SHRS SGCP A RS                            S H    CPT  CDGSGHITG++ +HRSLSGCPRA
Sbjct:   65 NYSSHRSLSGCPRANKPKKSSLIKKSIVERQEAEPNIRCPVTGCDGTGHITGKFSSHRSASGCPIAARSGRSRGESVSSMSPLGSGGESNDISETRSSKHEGLSCPTPGCDGSGHITGSFLTHRSLSGCPRA 196          

HSP 3 Score: 63.5438 bits (153), Expect = 2.743e-7
Identity = 25/40 (62.50%), Postives = 33/40 (82.50%), Query Frame = 1
Query:  640 KKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVL 759
            K + L CPTPGCDGSGH++ ++++HRSLSGCPRA+ S V 
Sbjct:  163 KHEGLSCPTPGCDGSGHITGSFLTHRSLSGCPRANSSHVY 202          
BLAST of SMED30004950 vs. Ensembl Cavefish
Match: myt1b (myelin transcription factor 1 [Source:NCBI gene;Acc:103034264])

HSP 1 Score: 128.257 bits (321), Expect = 7.130e-32
Identity = 57/78 (73.08%), Postives = 66/78 (84.62%), Query Frame = 1
Query:  640 KKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSL--VLSLH-IEQRCPTISCDGSGHITGNYSSHRSLSGCPRA 864
            KK+LL CPTPGCDGSGH++ NY SHRSLSGCP AD+SL  +++ H  E +CPT  CDGSGHITGNY+SHRSLSGCPRA
Sbjct:  814 KKELLMCPTPGCDGSGHITGNYASHRSLSGCPLADKSLRSLMAAHTAELKCPTPGCDGSGHITGNYTSHRSLSGCPRA 891          

HSP 2 Score: 96.2857 bits (238), Expect = 4.018e-21
Identity = 43/82 (52.44%), Postives = 57/82 (69.51%), Query Frame = 1
Query:  640 KKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADR--SLVLSLHIEQ-RCPTISCDGSGHITGNYSSHRSLSGCPRASLER 876
            +K  ++CPTPGCDG+GHV+  Y  HRSLSGCP  DR    +L++H    +CPT  C G GH+  N ++HRSLSGCP A+ E+
Sbjct:  438 EKREIKCPTPGCDGTGHVTGLYPHHRSLSGCPHKDRIPPEILAMHENVLKCPTPGCTGQGHVNSNRNTHRSLSGCPIAAAEK 519          

HSP 3 Score: 94.3597 bits (233), Expect = 1.684e-20
Identity = 45/91 (49.45%), Postives = 53/91 (58.24%), Query Frame = 1
Query:  646 DLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSL------------HIEQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKK 882
            +LL+CP PGCD  GH+S  Y +HRS  GCP A R     L                 CPT  CDGSGH  G++ +HRSLSGCPRASL +KK
Sbjct:  909 ELLKCPVPGCDSLGHISGKYATHRSAYGCPLAARRQKEGLLNGTPFSWKAFKTEGPTCPTPGCDGSGHANGSFLTHRSLSGCPRASLAKKK 999          

HSP 4 Score: 58.151 bits (139), Expect = 1.041e-8
Identity = 28/69 (40.58%), Postives = 45/69 (65.22%), Query Frame = 1
Query:  589 NRIVSGNKNKNQL---LSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQRCP 786
            +R +SG  +K+++   +  + +++L+CPTPGC G GHV++N  +HRSLSGCP A    +   H +Q  P
Sbjct:  462 HRSLSGCPHKDRIPPEILAMHENVLKCPTPGCTGQGHVNSNRNTHRSLSGCPIAAAEKLSKSHDKQHLP 530          
BLAST of SMED30004950 vs. Ensembl Cavefish
Match: myt1b (myelin transcription factor 1 [Source:NCBI gene;Acc:103034264])

HSP 1 Score: 127.872 bits (320), Expect = 1.006e-31
Identity = 57/78 (73.08%), Postives = 66/78 (84.62%), Query Frame = 1
Query:  640 KKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSL--VLSLH-IEQRCPTISCDGSGHITGNYSSHRSLSGCPRA 864
            KK+LL CPTPGCDGSGH++ NY SHRSLSGCP AD+SL  +++ H  E +CPT  CDGSGHITGNY+SHRSLSGCPRA
Sbjct:  835 KKELLMCPTPGCDGSGHITGNYASHRSLSGCPLADKSLRSLMAAHTAELKCPTPGCDGSGHITGNYTSHRSLSGCPRA 912          

HSP 2 Score: 95.9005 bits (237), Expect = 5.274e-21
Identity = 43/82 (52.44%), Postives = 57/82 (69.51%), Query Frame = 1
Query:  640 KKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADR--SLVLSLHIEQ-RCPTISCDGSGHITGNYSSHRSLSGCPRASLER 876
            +K  ++CPTPGCDG+GHV+  Y  HRSLSGCP  DR    +L++H    +CPT  C G GH+  N ++HRSLSGCP A+ E+
Sbjct:  459 EKREIKCPTPGCDGTGHVTGLYPHHRSLSGCPHKDRIPPEILAMHENVLKCPTPGCTGQGHVNSNRNTHRSLSGCPIAAAEK 540          

HSP 3 Score: 93.9745 bits (232), Expect = 2.210e-20
Identity = 45/91 (49.45%), Postives = 53/91 (58.24%), Query Frame = 1
Query:  646 DLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSL------------HIEQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKK 882
            +LL+CP PGCD  GH+S  Y +HRS  GCP A R     L                 CPT  CDGSGH  G++ +HRSLSGCPRASL +KK
Sbjct:  930 ELLKCPVPGCDSLGHISGKYATHRSAYGCPLAARRQKEGLLNGTPFSWKAFKTEGPTCPTPGCDGSGHANGSFLTHRSLSGCPRASLAKKK 1020          

HSP 4 Score: 57.7658 bits (138), Expect = 1.131e-8
Identity = 28/69 (40.58%), Postives = 45/69 (65.22%), Query Frame = 1
Query:  589 NRIVSGNKNKNQL---LSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQRCP 786
            +R +SG  +K+++   +  + +++L+CPTPGC G GHV++N  +HRSLSGCP A    +   H +Q  P
Sbjct:  483 HRSLSGCPHKDRIPPEILAMHENVLKCPTPGCTGQGHVNSNRNTHRSLSGCPIAAAEKLSKSHDKQHLP 551          
BLAST of SMED30004950 vs. Ensembl Cavefish
Match: myt1b (myelin transcription factor 1 [Source:NCBI gene;Acc:103034264])

HSP 1 Score: 127.487 bits (319), Expect = 1.128e-31
Identity = 57/78 (73.08%), Postives = 66/78 (84.62%), Query Frame = 1
Query:  640 KKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSL--VLSLH-IEQRCPTISCDGSGHITGNYSSHRSLSGCPRA 864
            KK+LL CPTPGCDGSGH++ NY SHRSLSGCP AD+SL  +++ H  E +CPT  CDGSGHITGNY+SHRSLSGCPRA
Sbjct:  877 KKELLMCPTPGCDGSGHITGNYASHRSLSGCPLADKSLRSLMAAHTAELKCPTPGCDGSGHITGNYTSHRSLSGCPRA 954          

HSP 2 Score: 95.9005 bits (237), Expect = 5.684e-21
Identity = 43/82 (52.44%), Postives = 57/82 (69.51%), Query Frame = 1
Query:  640 KKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADR--SLVLSLHIEQ-RCPTISCDGSGHITGNYSSHRSLSGCPRASLER 876
            +K  ++CPTPGCDG+GHV+  Y  HRSLSGCP  DR    +L++H    +CPT  C G GH+  N ++HRSLSGCP A+ E+
Sbjct:  501 EKREIKCPTPGCDGTGHVTGLYPHHRSLSGCPHKDRIPPEILAMHENVLKCPTPGCTGQGHVNSNRNTHRSLSGCPIAAAEK 582          

HSP 3 Score: 93.9745 bits (232), Expect = 2.338e-20
Identity = 45/91 (49.45%), Postives = 53/91 (58.24%), Query Frame = 1
Query:  646 DLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSL------------HIEQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKK 882
            +LL+CP PGCD  GH+S  Y +HRS  GCP A R     L                 CPT  CDGSGH  G++ +HRSLSGCPRASL +KK
Sbjct:  972 ELLKCPVPGCDSLGHISGKYATHRSAYGCPLAARRQKEGLLNGTPFSWKAFKTEGPTCPTPGCDGSGHANGSFLTHRSLSGCPRASLAKKK 1062          

HSP 4 Score: 57.7658 bits (138), Expect = 1.201e-8
Identity = 28/69 (40.58%), Postives = 45/69 (65.22%), Query Frame = 1
Query:  589 NRIVSGNKNKNQL---LSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQRCP 786
            +R +SG  +K+++   +  + +++L+CPTPGC G GHV++N  +HRSLSGCP A    +   H +Q  P
Sbjct:  525 HRSLSGCPHKDRIPPEILAMHENVLKCPTPGCTGQGHVNSNRNTHRSLSGCPIAAAEKLSKSHDKQHLP 593          
BLAST of SMED30004950 vs. Ensembl Cavefish
Match: myt1a (myelin transcription factor 1-like [Source:NCBI gene;Acc:103040531])

HSP 1 Score: 124.79 bits (312), Expect = 1.151e-30
Identity = 63/104 (60.58%), Postives = 75/104 (72.12%), Query Frame = 1
Query:  640 KKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSL--VLSLHI-EQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHNGKITVKETEEECTDVKTI 942
            KKDLL CPTPGCDGSGH++ NY SHRSLSGCP AD+SL  +++ H  E +CPT  CDGSGHITGNY+SHRSLSGCPRA        G I    T+++  D + I
Sbjct:  901 KKDLLLCPTPGCDGSGHITGNYASHRSLSGCPLADKSLRTLMAAHTGELKCPTPGCDGSGHITGNYASHRSLSGCPRAK------KGAIKTTPTKDDKEDSELI 998          

HSP 2 Score: 91.6633 bits (226), Expect = 1.469e-19
Identity = 42/79 (53.16%), Postives = 56/79 (70.89%), Query Frame = 1
Query:  640 KKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADR--SLVLSLHIE-QRCPTISCDGSGHITGNYSSHRSLSGCPRAS 867
            +K  ++CPTPGCDG+GHV+  Y  HRSLSGCP  DR    +L++H    +CPT  C+G GH+  N ++HRSLSGCP A+
Sbjct:  533 EKREIKCPTPGCDGTGHVTGLYPHHRSLSGCPHKDRVPPEILAMHENVLKCPTPGCNGQGHVNSNRNTHRSLSGCPIAA 611          

HSP 3 Score: 87.8113 bits (216), Expect = 2.588e-18
Identity = 44/91 (48.35%), Postives = 53/91 (58.24%), Query Frame = 1
Query:  646 DLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLV-----------LSLHIE-QRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKK 882
            +L+RCP PGCD  GH+S  Y +HRS  GCP A R               S   E   CPT  CDGSGH  G++ +HRSLSGCPRAS  +K+
Sbjct:  996 ELIRCPVPGCDSLGHISGKYATHRSAYGCPLAARRQKEGLLNGTPFSWKSFKTEGPTCPTPGCDGSGHANGSFLTHRSLSGCPRASANKKR 1086          

HSP 4 Score: 55.4546 bits (132), Expect = 7.548e-8
Identity = 25/54 (46.30%), Postives = 41/54 (75.93%), Query Frame = 1
Query:  589 NRIVSGNKNKNQL---LSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRA 741
            +R +SG  +K+++   +  + +++L+CPTPGC+G GHV++N  +HRSLSGCP A
Sbjct:  557 HRSLSGCPHKDRVPPEILAMHENVLKCPTPGCNGQGHVNSNRNTHRSLSGCPIA 610          

HSP 5 Score: 49.2914 bits (116), Expect = 6.165e-6
Identity = 20/30 (66.67%), Postives = 21/30 (70.00%), Query Frame = 1
Query:  658 CPTPGCDGSGHVSNNYISHRSLSGCPRADR 747
            CPTPGCDG GHVS  Y  HRS  GCP A +
Sbjct:   69 CPTPGCDGLGHVSGKYARHRSALGCPLAKK 98          
BLAST of SMED30004950 vs. Ensembl Cavefish
Match: myt1a (myelin transcription factor 1-like [Source:NCBI gene;Acc:103040531])

HSP 1 Score: 124.79 bits (312), Expect = 1.163e-30
Identity = 63/104 (60.58%), Postives = 75/104 (72.12%), Query Frame = 1
Query:  640 KKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSL--VLSLHI-EQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHNGKITVKETEEECTDVKTI 942
            KKDLL CPTPGCDGSGH++ NY SHRSLSGCP AD+SL  +++ H  E +CPT  CDGSGHITGNY+SHRSLSGCPRA        G I    T+++  D + I
Sbjct:  868 KKDLLLCPTPGCDGSGHITGNYASHRSLSGCPLADKSLRTLMAAHTGELKCPTPGCDGSGHITGNYASHRSLSGCPRAK------KGAIKTTPTKDDKEDSELI 965          

HSP 2 Score: 91.6633 bits (226), Expect = 1.472e-19
Identity = 42/79 (53.16%), Postives = 56/79 (70.89%), Query Frame = 1
Query:  640 KKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADR--SLVLSLHIE-QRCPTISCDGSGHITGNYSSHRSLSGCPRAS 867
            +K  ++CPTPGCDG+GHV+  Y  HRSLSGCP  DR    +L++H    +CPT  C+G GH+  N ++HRSLSGCP A+
Sbjct:  494 EKREIKCPTPGCDGTGHVTGLYPHHRSLSGCPHKDRVPPEILAMHENVLKCPTPGCNGQGHVNSNRNTHRSLSGCPIAA 572          

HSP 3 Score: 87.8113 bits (216), Expect = 2.592e-18
Identity = 44/91 (48.35%), Postives = 53/91 (58.24%), Query Frame = 1
Query:  646 DLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLV-----------LSLHIE-QRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKK 882
            +L+RCP PGCD  GH+S  Y +HRS  GCP A R               S   E   CPT  CDGSGH  G++ +HRSLSGCPRAS  +K+
Sbjct:  963 ELIRCPVPGCDSLGHISGKYATHRSAYGCPLAARRQKEGLLNGTPFSWKSFKTEGPTCPTPGCDGSGHANGSFLTHRSLSGCPRASANKKR 1053          

HSP 4 Score: 55.0694 bits (131), Expect = 7.576e-8
Identity = 25/54 (46.30%), Postives = 41/54 (75.93%), Query Frame = 1
Query:  589 NRIVSGNKNKNQL---LSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRA 741
            +R +SG  +K+++   +  + +++L+CPTPGC+G GHV++N  +HRSLSGCP A
Sbjct:  518 HRSLSGCPHKDRVPPEILAMHENVLKCPTPGCNGQGHVNSNRNTHRSLSGCPIA 571          

HSP 5 Score: 49.2914 bits (116), Expect = 6.138e-6
Identity = 20/30 (66.67%), Postives = 21/30 (70.00%), Query Frame = 1
Query:  658 CPTPGCDGSGHVSNNYISHRSLSGCPRADR 747
            CPTPGCDG GHVS  Y  HRS  GCP A +
Sbjct:   30 CPTPGCDGLGHVSGKYARHRSALGCPLAKK 59          
BLAST of SMED30004950 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001257.1 (pep scaffold:Pmarinus_7.0:GL476337:60091:77467:1 gene:ENSPMAG00000001124.1 transcript:ENSPMAT00000001257.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 128.257 bits (321), Expect = 5.160e-33
Identity = 65/108 (60.19%), Postives = 77/108 (71.30%), Query Frame = 1
Query:  610 KNKNQLLSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRS---LVLSLHIEQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHNGKIT-VKETEEE 921
            K K  L    +K+LL CPTPGCDGSGHV+ NY SHRSLSGCP AD+S   ++ S   E +CPT  CDGSGHITGNY+SHRSLSGCPRA    KK   K+  +KE +E+
Sbjct:  203 KAKCGLAKEARKELLACPTPGCDGSGHVTGNYASHRSLSGCPLADKSIRNMMASSTQELKCPTPGCDGSGHITGNYTSHRSLSGCPRA----KKSGIKVVPIKEDKED 306          

HSP 2 Score: 96.2857 bits (238), Expect = 5.323e-22
Identity = 50/104 (48.08%), Postives = 65/104 (62.50%), Query Frame = 1
Query:  643 KDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADR--------SLVLSLHIEQ----RCPTISCDGSGHITGNYSSHRSLSGCPRA--SLERKKHNGK--ITVK 906
            ++ +RCP PGC G GHV+  Y SHRS SGCP A R        SL  S    +    +CPT  CDGSGH +G + SHRSLSGCPRA  +++R K +G+  +T+K
Sbjct:  307 QESIRCPVPGCAGQGHVTGKYTSHRSASGCPLAARRQREGSLPSLPFSWKGSKVEGAQCPTPGCDGSGHASGTFLSHRSLSGCPRATSAMKRAKLSGEEMMTIK 410          
BLAST of SMED30004950 vs. Ensembl Sea Lamprey
Match: myt1la (myelin transcription factor 1-like, a [Source:ZFIN;Acc:ZDB-GENE-041001-172])

HSP 1 Score: 92.8189 bits (229), Expect = 8.326e-21
Identity = 43/77 (55.84%), Postives = 54/77 (70.13%), Query Frame = 1
Query:  655 RCPTPGCDGSGHVSNNYISHRSLSGCPRADR--SLVLSLHIEQ-RCPTISCDGSGHITGNYSSHRSLSGCPRASLER 876
            +CPTPGCDG+GH +  Y  HRSLSGCP  DR    +L+LH    +CPT  C+G GH+  N +SHRSLSGCP A+ E+
Sbjct:  364 KCPTPGCDGTGHATGLYPHHRSLSGCPHKDRVPPEILALHENVLKCPTPGCNGRGHVNSNRNSHRSLSGCPIAAAEK 440          

HSP 2 Score: 59.6918 bits (143), Expect = 5.695e-10
Identity = 30/68 (44.12%), Postives = 48/68 (70.59%), Query Frame = 1
Query:  589 NRIVSGNKNKNQL---LSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCP-RADRSLVLSLHIEQR 780
            +R +SG  +K+++   +  L +++L+CPTPGC+G GHV++N  SHRSLSGCP  A   L  + H++Q+
Sbjct:  383 HRSLSGCPHKDRVPPEILALHENVLKCPTPGCNGRGHVNSNRNSHRSLSGCPIAAAEKLAKTHHVKQQ 450          
BLAST of SMED30004950 vs. Ensembl Sea Lamprey
Match: myt1la (myelin transcription factor 1-like, a [Source:ZFIN;Acc:ZDB-GENE-041001-172])

HSP 1 Score: 92.8189 bits (229), Expect = 8.340e-21
Identity = 44/82 (53.66%), Postives = 56/82 (68.29%), Query Frame = 1
Query:  640 KKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADR--SLVLSLHIEQ-RCPTISCDGSGHITGNYSSHRSLSGCPRASLER 876
            K+   +CPTPGCDG+GH +  Y  HRSLSGCP  DR    +L+LH    +CPT  C+G GH+  N +SHRSLSGCP A+ E+
Sbjct:  411 KRRESKCPTPGCDGTGHATGLYPHHRSLSGCPHKDRVPPEILALHENVLKCPTPGCNGRGHVNSNRNSHRSLSGCPIAAAEK 492          

HSP 2 Score: 59.6918 bits (143), Expect = 5.997e-10
Identity = 30/68 (44.12%), Postives = 48/68 (70.59%), Query Frame = 1
Query:  589 NRIVSGNKNKNQL---LSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCP-RADRSLVLSLHIEQR 780
            +R +SG  +K+++   +  L +++L+CPTPGC+G GHV++N  SHRSLSGCP  A   L  + H++Q+
Sbjct:  435 HRSLSGCPHKDRVPPEILALHENVLKCPTPGCNGRGHVNSNRNSHRSLSGCPIAAAEKLAKTHHVKQQ 502          

HSP 3 Score: 46.2098 bits (108), Expect = 9.512e-6
Identity = 17/20 (85.00%), Postives = 18/20 (90.00%), Query Frame = 1
Query:  658 CPTPGCDGSGHVSNNYISHR 717
            CPTPGCDGSGHV+ NY SHR
Sbjct:  807 CPTPGCDGSGHVTGNYASHR 826          
BLAST of SMED30004950 vs. Ensembl Nematostella
Match: EDO41350 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4M8])

HSP 1 Score: 89.7373 bits (221), Expect = 1.604e-19
Identity = 45/84 (53.57%), Postives = 55/84 (65.48%), Query Frame = 1
Query:  646 DLLRCPTPGCDGSGHVSNNYISHRSLSGCPR---ADRSLVLSLHIEQ---RCPTISCDGSGHITGNYSSHRSLSGCPRASLERK 879
            D  RCPT GCDGSGH S  + SHRSL GCPR    D+        ++   RCPT  CDG+GH TG Y+SHRSLSGCP A+ +++
Sbjct:  247 DKPRCPTSGCDGSGHKSGLFASHRSLYGCPRRLSTDKDKEGKGSGDENNVRCPTPGCDGTGHRTGLYTSHRSLSGCPIAAAQKQ 330          

HSP 2 Score: 87.4261 bits (215), Expect = 1.053e-18
Identity = 50/122 (40.98%), Postives = 66/122 (54.10%), Query Frame = 1
Query:  643 KDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSL-----HIE-----QRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHNGKITVKETEEEC-------TDVKTIMQTNH 957
            ++L+ CPTP CDG GHV+  + SHRS+ GCP A+++           IE      RCPT  CDGSGH +G ++SHRSL GCPR     K   GK +  E    C       T  +T + T+H
Sbjct:  195 QELIGCPTPRCDGKGHVNGRFASHRSVYGCPNANKATRRMRTDSGDQIEVDSDKPRCPTSGCDGSGHKSGLFASHRSLYGCPRRLSTDKDKEGKGSGDENNVRCPTPGCDGTGHRTGLYTSH 316          

HSP 3 Score: 54.299 bits (129), Expect = 4.621e-8
Identity = 22/35 (62.86%), Postives = 26/35 (74.29%), Query Frame = 1
Query:  637 LKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRA 741
            + K L  CPTP CDG+GHV+  + SHR LSGCPRA
Sbjct:  618 IGKVLTGCPTPDCDGTGHVNGRFASHRRLSGCPRA 652          

HSP 4 Score: 52.373 bits (124), Expect = 2.160e-7
Identity = 19/28 (67.86%), Postives = 23/28 (82.14%), Query Frame = 1
Query:  781 CPTISCDGSGHITGNYSSHRSLSGCPRA 864
            CPT  CDG+GH+ G ++SHR LSGCPRA
Sbjct:  625 CPTPDCDGTGHVNGRFASHRRLSGCPRA 652          
BLAST of SMED30004950 vs. Ensembl Medaka
Match: myt1b (myelin transcription factor 1 [Source:NCBI gene;Acc:101163170])

HSP 1 Score: 129.798 bits (325), Expect = 1.895e-32
Identity = 62/97 (63.92%), Postives = 74/97 (76.29%), Query Frame = 1
Query:  640 KKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSL--VLSLHI-EQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHNGKITVKETEEE 921
            KK+LL CPTPGCDGSGH++ NY SHRSLSGCP AD+SL  +++ H  E +CPT  CDGSGHITGNY+SHRSLSGCPRA    KK   K   K+ +E+
Sbjct:  870 KKELLSCPTPGCDGSGHITGNYASHRSLSGCPLADKSLRSLMAAHTPELKCPTPGCDGSGHITGNYASHRSLSGCPRA----KKSGIKTPTKDNQED 962          

HSP 2 Score: 100.908 bits (250), Expect = 1.177e-22
Identity = 53/127 (41.73%), Postives = 74/127 (58.27%), Query Frame = 1
Query:  553 HNRNFQLKNNIKNRIVSGNKNKNQLLSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADR--SLVLSLHIEQ-RCPTISCDGSGHITGNYSSHRSLSGCPRASLER--KKHNGKITVKETEE 918
            H R F L++  K+  +      ++  S  +K  ++CPTPGCDG+GHV+  Y  HRSLSGCP  DR    +L++H    +CPT  C G GH+  N ++HRSLSGCP A+ E+  K H+       T E
Sbjct:  469 HQRYFTLEDRPKHLDIIRKSYFSKESSRPEKREIKCPTPGCDGTGHVTGLYPHHRSLSGCPHKDRIPPEILAMHENVLKCPTPGCTGQGHVNSNRNTHRSLSGCPIAAAEKLSKTHDKPAVAPPTSE 595          

HSP 3 Score: 90.1225 bits (222), Expect = 4.383e-19
Identity = 43/91 (47.25%), Postives = 51/91 (56.04%), Query Frame = 1
Query:  646 DLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSL------------HIEQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKK 882
            +LL+CP PGCD  GH+S  Y +HRS  GCP A R     L                 CPT  CDGSGH  G++ +HRSLSGCPRA   +KK
Sbjct:  964 ELLKCPVPGCDSLGHISGKYATHRSAYGCPLAARRQKEGLLNGTPFNWKAFKTEGPTCPTPGCDGSGHANGSFLTHRSLSGCPRALYAKKK 1054          
BLAST of SMED30004950 vs. Ensembl Medaka
Match: myt1b (myelin transcription factor 1 [Source:NCBI gene;Acc:101163170])

HSP 1 Score: 129.413 bits (324), Expect = 2.723e-32
Identity = 62/97 (63.92%), Postives = 74/97 (76.29%), Query Frame = 1
Query:  640 KKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSL--VLSLHI-EQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHNGKITVKETEEE 921
            KK+LL CPTPGCDGSGH++ NY SHRSLSGCP AD+SL  +++ H  E +CPT  CDGSGHITGNY+SHRSLSGCPRA    KK   K   K+ +E+
Sbjct:  891 KKELLSCPTPGCDGSGHITGNYASHRSLSGCPLADKSLRSLMAAHTPELKCPTPGCDGSGHITGNYASHRSLSGCPRA----KKSGIKTPTKDNQED 983          

HSP 2 Score: 100.523 bits (249), Expect = 1.665e-22
Identity = 53/127 (41.73%), Postives = 74/127 (58.27%), Query Frame = 1
Query:  553 HNRNFQLKNNIKNRIVSGNKNKNQLLSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADR--SLVLSLHIEQ-RCPTISCDGSGHITGNYSSHRSLSGCPRASLER--KKHNGKITVKETEE 918
            H R F L++  K+  +      ++  S  +K  ++CPTPGCDG+GHV+  Y  HRSLSGCP  DR    +L++H    +CPT  C G GH+  N ++HRSLSGCP A+ E+  K H+       T E
Sbjct:  490 HQRYFTLEDRPKHLDIIRKSYFSKESSRPEKREIKCPTPGCDGTGHVTGLYPHHRSLSGCPHKDRIPPEILAMHENVLKCPTPGCTGQGHVNSNRNTHRSLSGCPIAAAEKLSKTHDKPAVAPPTSE 616          

HSP 3 Score: 89.7373 bits (221), Expect = 6.065e-19
Identity = 43/91 (47.25%), Postives = 51/91 (56.04%), Query Frame = 1
Query:  646 DLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSL------------HIEQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKK 882
            +LL+CP PGCD  GH+S  Y +HRS  GCP A R     L                 CPT  CDGSGH  G++ +HRSLSGCPRA   +KK
Sbjct:  985 ELLKCPVPGCDSLGHISGKYATHRSAYGCPLAARRQKEGLLNGTPFNWKAFKTEGPTCPTPGCDGSGHANGSFLTHRSLSGCPRALYAKKK 1075          

HSP 4 Score: 51.6026 bits (122), Expect = 9.630e-7
Identity = 20/30 (66.67%), Postives = 23/30 (76.67%), Query Frame = 1
Query:  652 LRCPTPGCDGSGHVSNNYISHRSLSGCPRA 741
            L CPTPGC+GSGH+S  Y  HRS+ GCP A
Sbjct:   29 LSCPTPGCNGSGHISGRYSRHRSILGCPIA 58          

HSP 5 Score: 49.6766 bits (117), Expect = 4.431e-6
Identity = 21/35 (60.00%), Postives = 24/35 (68.57%), Query Frame = 1
Query:  772 EQRCPTISCDGSGHITGNYSSHRSLSGCPRASLER 876
            E  CPT  C+GSGHI+G YS HRS+ GCP A   R
Sbjct:   28 ELSCPTPGCNGSGHISGRYSRHRSILGCPIARKRR 62          
BLAST of SMED30004950 vs. Ensembl Medaka
Match: myt1b (myelin transcription factor 1 [Source:NCBI gene;Acc:101163170])

HSP 1 Score: 129.413 bits (324), Expect = 2.733e-32
Identity = 62/97 (63.92%), Postives = 74/97 (76.29%), Query Frame = 1
Query:  640 KKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSL--VLSLHI-EQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHNGKITVKETEEE 921
            KK+LL CPTPGCDGSGH++ NY SHRSLSGCP AD+SL  +++ H  E +CPT  CDGSGHITGNY+SHRSLSGCPRA    KK   K   K+ +E+
Sbjct:  803 KKELLSCPTPGCDGSGHITGNYASHRSLSGCPLADKSLRSLMAAHTPELKCPTPGCDGSGHITGNYASHRSLSGCPRA----KKSGIKTPTKDNQED 895          

HSP 2 Score: 100.523 bits (249), Expect = 1.642e-22
Identity = 53/127 (41.73%), Postives = 74/127 (58.27%), Query Frame = 1
Query:  553 HNRNFQLKNNIKNRIVSGNKNKNQLLSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADR--SLVLSLHIEQ-RCPTISCDGSGHITGNYSSHRSLSGCPRASLER--KKHNGKITVKETEE 918
            H R F L++  K+  +      ++  S  +K  ++CPTPGCDG+GHV+  Y  HRSLSGCP  DR    +L++H    +CPT  C G GH+  N ++HRSLSGCP A+ E+  K H+       T E
Sbjct:  415 HQRYFTLEDRPKHLDIIRKSYFSKESSRPEKREIKCPTPGCDGTGHVTGLYPHHRSLSGCPHKDRIPPEILAMHENVLKCPTPGCTGQGHVNSNRNTHRSLSGCPIAAAEKLSKTHDKPAVAPPTSE 541          

HSP 3 Score: 89.7373 bits (221), Expect = 5.516e-19
Identity = 43/91 (47.25%), Postives = 51/91 (56.04%), Query Frame = 1
Query:  646 DLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSL------------HIEQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKK 882
            +LL+CP PGCD  GH+S  Y +HRS  GCP A R     L                 CPT  CDGSGH  G++ +HRSLSGCPRA   +KK
Sbjct:  897 ELLKCPVPGCDSLGHISGKYATHRSAYGCPLAARRQKEGLLNGTPFNWKAFKTEGPTCPTPGCDGSGHANGSFLTHRSLSGCPRALYAKKK 987          
BLAST of SMED30004950 vs. Ensembl Medaka
Match: myt1a (myelin transcription factor 1 [Source:NCBI gene;Acc:101167938])

HSP 1 Score: 128.257 bits (321), Expect = 6.047e-32
Identity = 56/78 (71.79%), Postives = 66/78 (84.62%), Query Frame = 1
Query:  640 KKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSL--VLSLH-IEQRCPTISCDGSGHITGNYSSHRSLSGCPRA 864
            KKD++ CPTPGCDGSGH++ NY SHRSLSGCP AD+SL  +++ H  E +CPT  CDGSGHITGNY+SHRSLSGCPRA
Sbjct:  818 KKDIIVCPTPGCDGSGHITGNYASHRSLSGCPLADKSLRTLMAAHSAELKCPTPGCDGSGHITGNYASHRSLSGCPRA 895          

HSP 2 Score: 94.3597 bits (233), Expect = 1.660e-20
Identity = 42/79 (53.16%), Postives = 55/79 (69.62%), Query Frame = 1
Query:  640 KKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADR--SLVLSLHIEQ-RCPTISCDGSGHITGNYSSHRSLSGCPRAS 867
            +K  ++CPTPGCDG+GHV+  Y  HRSLSGCP  DR    +L++H    +CPT  C G GH+  N ++HRSLSGCP A+
Sbjct:  455 EKKEVKCPTPGCDGTGHVTGLYPHHRSLSGCPHKDRIPPEILAMHENVLKCPTPGCSGQGHVNSNRNTHRSLSGCPIAA 533          

HSP 3 Score: 92.4337 bits (228), Expect = 6.692e-20
Identity = 44/91 (48.35%), Postives = 52/91 (57.14%), Query Frame = 1
Query:  646 DLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSL------------HIEQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKK 882
            +LL+CP PGCD  GH+S  Y +HRS  GCP A R     L                 CPT  CDGSGH  G++ +HRSLSGCPRAS  +KK
Sbjct:  913 ELLKCPVPGCDSLGHISGKYATHRSAYGCPLAARRQKEGLLNGTPFSWKAFKTEGPTCPTPGCDGSGHANGSFLTHRSLSGCPRASANKKK 1003          

HSP 4 Score: 56.9954 bits (136), Expect = 2.038e-8
Identity = 26/60 (43.33%), Postives = 43/60 (71.67%), Query Frame = 1
Query:  589 NRIVSGNKNKNQL---LSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVL 759
            +R +SG  +K+++   +  + +++L+CPTPGC G GHV++N  +HRSLSGCP A  S ++
Sbjct:  479 HRSLSGCPHKDRIPPEILAMHENVLKCPTPGCSGQGHVNSNRNTHRSLSGCPIAASSKLI 538          

HSP 5 Score: 54.299 bits (129), Expect = 1.686e-7
Identity = 23/51 (45.10%), Postives = 29/51 (56.86%), Query Frame = 1
Query:  637 LKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQRCPT 789
            +K +L  CPTPGCDG GHVS  Y  HRS+ GCP   +  +     E+  P 
Sbjct:   28 MKLELSTCPTPGCDGKGHVSGRYSRHRSVLGCPIVKKRKLEEAEAEENQPA 78          
BLAST of SMED30004950 vs. Ensembl Medaka
Match: ENSORLT00000027296.1 (ST18 C2H2C-type zinc finger transcription factor [Source:NCBI gene;Acc:101174462])

HSP 1 Score: 124.79 bits (312), Expect = 9.607e-31
Identity = 57/83 (68.67%), Postives = 66/83 (79.52%), Query Frame = 1
Query:  625 LLSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRAD---RSLVLSLHIEQRCPTISCDGSGHITGNYSSHRSLSGCPRA 864
            LL   KK+LL CPTPGCDGSGHV+ NY SHRS+SGCP AD   +SL+ +   E +CPT  CDGSGH+TGNY+SHRSLSGCPRA
Sbjct:  777 LLRDSKKELLSCPTPGCDGSGHVTGNYASHRSVSGCPLADKTLKSLMAANSQELKCPTPGCDGSGHVTGNYASHRSLSGCPRA 859          

HSP 2 Score: 104.76 bits (260), Expect = 5.142e-24
Identity = 56/114 (49.12%), Postives = 70/114 (61.40%), Query Frame = 1
Query:  577 NNIKNRIVSG----NKNKNQLLSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSL--------HIEQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKK 882
            N   +R VSG    +K    L++   ++L +CPTPGCDGSGHV+ NY SHRSLSGCPRA R   L L          E +CP I CDG GHI+G Y+SHRS   CP A+  +K+
Sbjct:  802 NYASHRSVSGCPLADKTLKSLMAANSQEL-KCPTPGCDGSGHVTGNYASHRSLSGCPRA-RKGGLKLTPNKDDKDEQELKCPVIGCDGQGHISGKYTSHRSAGSCPLAAKRQKE 913          

HSP 3 Score: 91.2781 bits (225), Expect = 1.830e-19
Identity = 44/79 (55.70%), Postives = 55/79 (69.62%), Query Frame = 1
Query:  640 KKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADR--SLVLSLHIEQ-RCPTISCDGSGHITGNYSSHRSLSGCPRAS 867
            KKD+ +CPTPGCDG+GHV+  Y  HRSLSGCP   R    +L++H    +CPT  C G GH+  N S+HRSLSGCP A+
Sbjct:  444 KKDV-KCPTPGCDGTGHVTGLYPHHRSLSGCPHKVRVPPEILAMHENVLKCPTPGCTGRGHVNSNRSTHRSLSGCPIAA 521          

HSP 4 Score: 53.9138 bits (128), Expect = 1.750e-7
Identity = 25/54 (46.30%), Postives = 39/54 (72.22%), Query Frame = 1
Query:  589 NRIVSGNKNKNQL---LSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRA 741
            +R +SG  +K ++   +  + +++L+CPTPGC G GHV++N  +HRSLSGCP A
Sbjct:  467 HRSLSGCPHKVRVPPEILAMHENVLKCPTPGCTGRGHVNSNRSTHRSLSGCPIA 520          

HSP 5 Score: 50.447 bits (119), Expect = 2.698e-6
Identity = 19/32 (59.38%), Postives = 25/32 (78.12%), Query Frame = 1
Query:  640 KKDLLRCPTPGCDGSGHVSNNYISHRSLSGCP 735
            K++L  CP PGC+G GH +N + +HRSLSGCP
Sbjct:  927 KQELPHCPLPGCNGLGHANNVFATHRSLSGCP 958          
BLAST of SMED30004950 vs. Planmine SMEST
Match: SMESG000068540.1 (SMESG000068540.1)

HSP 1 Score: 647.121 bits (1668), Expect = 0.000e+0
Identity = 333/335 (99.40%), Postives = 335/335 (100.00%), Query Frame = 1
Query:    7 MNDSLLTTSRFQFQSIHQNTIERKDNDILNLIRSDSMLDTRNYSLKIPNNLEIGXXXXXXXXXXXXXXXXXLIGKEDWASSDQTNNLLPGEFSIFTAQPMKNLFNNFMNSTNFVDASRNFPDKDQITILDQTLDSMNLFMNSVKWNFLFPWNDIFDVKSKSFASTVHRVEPLDLSVDKNNKSHNRNFQLKNNIKNRIVSGNKNKNQLLSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHNGKITVKETEEECTDVKTIMQTNHAISTQKKITKFLTEDFIS 1011
            MNDSLLTTSRFQFQSIHQNTIERKDNDILNLIRSDSMLDTRNYSLKIPNNLEIGSKFEENANSEFESSSTSLIGKEDWASSDQTNNLLPGEFSIFTAQPMKNLFNNFMNSTNFVDASRNFPDKDQITILDQTLDSMNLFMNSVKWNFLFPWNDIFDVKSKSFASTVHRVEPLDLSVDKNNKSHNRNFQLKNNIKNRIVSGNKNKNQLLSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHNGKITVKETEEECTDVKTI++TNHAISTQKKITKFLTEDFIS
Sbjct:    1 MNDSLLTTSRFQFQSIHQNTIERKDNDILNLIRSDSMLDTRNYSLKIPNNLEIGSKFEENANSEFESSSTSLIGKEDWASSDQTNNLLPGEFSIFTAQPMKNLFNNFMNSTNFVDASRNFPDKDQITILDQTLDSMNLFMNSVKWNFLFPWNDIFDVKSKSFASTVHRVEPLDLSVDKNNKSHNRNFQLKNNIKNRIVSGNKNKNQLLSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHNGKITVKETEEECTDVKTIIETNHAISTQKKITKFLTEDFIS 335          
BLAST of SMED30004950 vs. Planmine SMEST
Match: SMESG000027385.1 (SMESG000027385.1)

HSP 1 Score: 124.79 bits (312), Expect = 6.803e-32
Identity = 51/80 (63.75%), Postives = 62/80 (77.50%), Query Frame = 1
Query:  643 KDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKK 882
            K+LL+CP  GCDG+GH++ NY +HRS SGCPRAD+    +LHIEQ+CPT  CDGSGH TGNY SHRS SGCP  S  ++K
Sbjct:  223 KELLQCPILGCDGTGHITGNYATHRSASGCPRADKRTAQALHIEQKCPTRGCDGSGHATGNYVSHRSESGCPLVSKNKRK 302          
BLAST of SMED30004950 vs. Planmine SMEST
Match: SMESG000027385.1 (SMESG000027385.1)

HSP 1 Score: 125.561 bits (314), Expect = 2.234e-31
Identity = 51/80 (63.75%), Postives = 62/80 (77.50%), Query Frame = 1
Query:  643 KDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKK 882
            K+LL+CP  GCDG+GH++ NY +HRS SGCPRAD+    +LHIEQ+CPT  CDGSGH TGNY SHRS SGCP  S  ++K
Sbjct:  223 KELLQCPILGCDGTGHITGNYATHRSASGCPRADKRTAQALHIEQKCPTRGCDGSGHATGNYVSHRSESGCPLVSKNKRK 302          
BLAST of SMED30004950 vs. Planmine SMEST
Match: SMESG000006070.1 (SMESG000006070.1)

HSP 1 Score: 98.5969 bits (244), Expect = 9.024e-23
Identity = 42/74 (56.76%), Postives = 51/74 (68.92%), Query Frame = 1
Query:  655 RCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQ---RCPTISCDGSGHITGNYSSHRSLSGCPRAS 867
            +CPTPGCDG GH +  Y  HRSLSGCPR D+ L   L +     +CPT+ C G GH+ GN +SHRSLSGCP A+
Sbjct:   55 KCPTPGCDGVGHATGLYSHHRSLSGCPRKDKILFSELGLTSSSLKCPTVGCTGRGHVNGNRTSHRSLSGCPIAA 128          
BLAST of SMED30004950 vs. Planmine SMEST
Match: SMESG000006070.1 (SMESG000006070.1)

HSP 1 Score: 98.5969 bits (244), Expect = 9.155e-23
Identity = 42/74 (56.76%), Postives = 51/74 (68.92%), Query Frame = 1
Query:  655 RCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLVLSLHIEQ---RCPTISCDGSGHITGNYSSHRSLSGCPRAS 867
            +CPTPGCDG GH +  Y  HRSLSGCPR D+ L   L +     +CPT+ C G GH+ GN +SHRSLSGCP A+
Sbjct:   48 KCPTPGCDGVGHATGLYSHHRSLSGCPRKDKILFSELGLTSSSLKCPTVGCTGRGHVNGNRTSHRSLSGCPIAA 121          
The following BLAST results are available for this feature:
BLAST of SMED30004950 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MYT1L1.147e-3160.58myelin transcription factor 1 like [Source:HGNC Sy... [more]
MYT12.040e-3170.89myelin transcription factor 1 [Source:HGNC Symbol;... [more]
MYT12.040e-3170.89myelin transcription factor 1 [Source:HGNC Symbol;... [more]
MYT12.040e-3170.89myelin transcription factor 1 [Source:HGNC Symbol;... [more]
ST182.086e-3159.22ST18 C2H2C-type zinc finger transcription factor [... [more]
back to top
BLAST of SMED30004950 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ztf-119.790e-2449.09Zinc finger putative Transcription Factor family ... [more]
ztf-111.559e-2349.09Zinc finger putative Transcription Factor family ... [more]
back to top
BLAST of SMED30004950 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG436891.672e-2256.79gene:FBgn0263772 transcript:FBtr0310493[more]
CG436891.680e-2256.79gene:FBgn0263772 transcript:FBtr0310492[more]
CG436891.905e-2256.79gene:FBgn0263772 transcript:FBtr0310491[more]
CG436892.330e-2256.79gene:FBgn0263772 transcript:FBtr0310495[more]
CG436892.349e-2256.79gene:FBgn0263772 transcript:FBtr0339681[more]
back to top
BLAST of SMED30004950 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myt1b1.284e-3275.64myelin transcription factor 1b [Source:ZFIN;Acc:ZD... [more]
myt1a1.650e-3272.15myelin transcription factor 1a [Source:ZFIN;Acc:ZD... [more]
myt1a1.650e-3272.15myelin transcription factor 1a [Source:ZFIN;Acc:ZD... [more]
myt1a1.847e-3272.15myelin transcription factor 1a [Source:ZFIN;Acc:ZD... [more]
myt1a1.847e-3272.15myelin transcription factor 1a [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of SMED30004950 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dpysl59.467e-3267.78dihydropyrimidinase like 5 [Source:Xenbase;Acc:XB-... [more]
dpysl51.305e-3167.78dihydropyrimidinase like 5 [Source:Xenbase;Acc:XB-... [more]
cecr23.387e-3162.24CECR2, histone acetyl-lysine reader [Source:Xenbas... [more]
cecr23.750e-3162.24CECR2, histone acetyl-lysine reader [Source:Xenbas... [more]
cecr24.294e-3162.24CECR2, histone acetyl-lysine reader [Source:Xenbas... [more]
back to top
BLAST of SMED30004950 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Myt11.251e-3170.89myelin transcription factor 1 [Source:MGI Symbol;A... [more]
St181.391e-3162.38suppression of tumorigenicity 18 [Source:MGI Symbo... [more]
St181.391e-3162.38suppression of tumorigenicity 18 [Source:MGI Symbo... [more]
St181.391e-3162.38suppression of tumorigenicity 18 [Source:MGI Symbo... [more]
St181.391e-3162.38suppression of tumorigenicity 18 [Source:MGI Symbo... [more]
back to top
BLAST of SMED30004950 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P70047|MYT1_XENLA7.607e-3171.79Myelin transcription factor 1 OS=Xenopus laevis OX... [more]
sp|Q80TY4|ST18_MOUSE9.733e-3162.38Suppression of tumorigenicity 18 protein OS=Mus mu... [more]
sp|Q01538|MYT1_HUMAN9.799e-3170.89Myelin transcription factor 1 OS=Homo sapiens OX=9... [more]
sp|O60284|ST18_HUMAN1.002e-3059.22Suppression of tumorigenicity 18 protein OS=Homo s... [more]
sp|Q8CFC2|MYT1_MOUSE1.130e-3070.89Myelin transcription factor 1 OS=Mus musculus OX=1... [more]
back to top
BLAST of SMED30004950 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0L8GT296.317e-3475.95MYT1 domain-containing protein OS=Octopus bimaculo... [more]
A0A1I8HVT08.499e-3481.33Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A564Y1U67.308e-3369.74Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A564Y1T69.661e-3369.74Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
T1KM862.813e-3266.30Uncharacterized protein OS=Tetranychus urticae OX=... [more]
back to top
BLAST of SMED30004950 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myt1b7.130e-3273.08myelin transcription factor 1 [Source:NCBI gene;Ac... [more]
myt1b1.006e-3173.08myelin transcription factor 1 [Source:NCBI gene;Ac... [more]
myt1b1.128e-3173.08myelin transcription factor 1 [Source:NCBI gene;Ac... [more]
myt1a1.151e-3060.58myelin transcription factor 1-like [Source:NCBI ge... [more]
myt1a1.163e-3060.58myelin transcription factor 1-like [Source:NCBI ge... [more]
back to top
BLAST of SMED30004950 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000001257.15.160e-3360.19pep scaffold:Pmarinus_7.0:GL476337:60091:77467:1 g... [more]
myt1la8.326e-2155.84myelin transcription factor 1-like, a [Source:ZFIN... [more]
myt1la8.340e-2153.66myelin transcription factor 1-like, a [Source:ZFIN... [more]
back to top
BLAST of SMED30004950 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004950 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO413501.604e-1953.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30004950 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myt1b1.895e-3263.92myelin transcription factor 1 [Source:NCBI gene;Ac... [more]
myt1b2.723e-3263.92myelin transcription factor 1 [Source:NCBI gene;Ac... [more]
myt1b2.733e-3263.92myelin transcription factor 1 [Source:NCBI gene;Ac... [more]
myt1a6.047e-3271.79myelin transcription factor 1 [Source:NCBI gene;Ac... [more]
ENSORLT00000027296.19.607e-3168.67ST18 C2H2C-type zinc finger transcription factor [... [more]
back to top
BLAST of SMED30004950 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068540.10.000e+099.40SMESG000068540.1[more]
SMESG000027385.16.803e-3263.75SMESG000027385.1[more]
SMESG000027385.12.234e-3163.75SMESG000027385.1[more]
SMESG000006070.19.024e-2356.76SMESG000006070.1[more]
SMESG000006070.19.155e-2356.76SMESG000006070.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004950 ID=SMED30004950|Name=SMED30004950|organism=Schmidtea mediterranea sexual|type=transcript|length=1128bp
TAAAAAATGAATGATTCATTATTAACGACTTCACGGTTTCAATTTCAATC
AATTCATCAAAATACCATCGAAAGAAAAGATAACGACATATTAAATCTTA
TCCGATCTGATTCCATGCTGGATACTAGAAACTATTCATTGAAAATACCA
AACAATTTAGAAATAGGATCAAAATTTGAAGAAAATGCAAATTCAGAATT
TGAATCCAGTTCCACCAGTCTCATCGGAAAAGAAGATTGGGCATCATCTG
ATCAGACCAATAATTTATTACCCGGCGAGTTCTCAATATTCACTGCACAA
CCAATGAAAAACTTATTCAATAACTTCATGAATTCCACGAATTTCGTGGA
TGCTTCTCGGAATTTCCCCGATAAAGATCAAATTACGATTCTCGATCAAA
CACTAGATTCAATGAATTTATTTATGAATTCTGTGAAATGGAATTTTTTA
TTTCCTTGGAATGATATTTTTGACGTCAAAAGTAAATCATTTGCTTCAAC
TGTACATCGTGTAGAGCCTCTCGATTTATCAGTGGACAAAAATAATAAAT
CACACAACAGAAATTTTCAGTTAAAAAATAACATAAAAAATCGGATAGTG
AGTGGAAATAAAAATAAAAATCAGTTACTGTCTATACTGAAGAAAGATTT
ACTTCGCTGTCCAACGCCAGGATGTGATGGATCTGGTCATGTATCAAACA
ATTACATTTCTCACAGAAGTCTCTCTGGGTGCCCAAGAGCTGATCGTTCA
CTTGTGTTATCCCTACATATTGAACAACGCTGTCCGACTATTAGTTGTGA
TGGATCTGGTCACATTACTGGAAATTATTCCAGCCATCGAAGCTTATCCG
GATGTCCAAGGGCCTCATTGGAAAGAAAAAAACATAACGGAAAAATCACC
GTCAAAGAAACTGAAGAAGAATGTACGGATGTAAAGACAATAATGCAAAC
CAATCATGCGATATCAACTCAGAAAAAGATTACCAAATTTCTCACTGAAG
ATTTCATCTCATGATATAACTTTGTGATTTTTATTTGATTGTGTATAATA
ATGTGATTAAATAATTTAATTATTTGTACTAATTCACCAGTTATACTAGG
GTAGAACCCTATTAAAATTAACTCTGAG
back to top

protein sequence of SMED30004950-orf-1

>SMED30004950-orf-1 ID=SMED30004950-orf-1|Name=SMED30004950-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=336bp
MNDSLLTTSRFQFQSIHQNTIERKDNDILNLIRSDSMLDTRNYSLKIPNN
LEIGSKFEENANSEFESSSTSLIGKEDWASSDQTNNLLPGEFSIFTAQPM
KNLFNNFMNSTNFVDASRNFPDKDQITILDQTLDSMNLFMNSVKWNFLFP
WNDIFDVKSKSFASTVHRVEPLDLSVDKNNKSHNRNFQLKNNIKNRIVSG
NKNKNQLLSILKKDLLRCPTPGCDGSGHVSNNYISHRSLSGCPRADRSLV
LSLHIEQRCPTISCDGSGHITGNYSSHRSLSGCPRASLERKKHNGKITVK
ETEEECTDVKTIMQTNHAISTQKKITKFLTEDFIS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0000419prepharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR036060Znf_C2H2C_sf
IPR002515Znf_C2H2C
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0006351transcription, DNA-templated
GO:0007275multicellular organism development
GO:0007399nervous system development
GO:0030154cell differentiation
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0003677DNA binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 285..305
NoneNo IPR availablePANTHERPTHR10816MYELIN TRANSCRIPTION FACTOR 1-RELATEDcoord: 201..292
coord: 258..291
NoneNo IPR availablePANTHERPTHR10816:SF15FINGER PUTATIVE TRANSCRIPTION FACTOR FAMILY-RELATEDcoord: 258..291
NoneNo IPR availablePANTHERPTHR10816:SF15FINGER PUTATIVE TRANSCRIPTION FACTOR FAMILY-RELATEDcoord: 201..292
IPR002515Zinc finger, C2H2C-typePFAMPF01530zf-C2HCcoord: 258..286
e-value: 8.2E-14
score: 51.5
coord: 217..245
e-value: 3.2E-14
score: 52.8
IPR002515Zinc finger, C2H2C-typePROSITEPS51802ZF_CCHHCcoord: 256..293
score: 9.113
IPR002515Zinc finger, C2H2C-typePROSITEPS51802ZF_CCHHCcoord: 209..252
score: 17.646
IPR036060Zinc finger, C2H2C-type superfamilySUPERFAMILYSSF103637CCHHC domaincoord: 256..292
IPR036060Zinc finger, C2H2C-type superfamilySUPERFAMILYSSF103637CCHHC domaincoord: 216..250