RIB43A protein

Overview
NameRIB43A protein
Smed IDSMED30004949
Length (bp)1226
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RIB43A protein (SMED30004949) t-SNE clustered cells

Violin plots show distribution of expression levels for RIB43A protein (SMED30004949) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004949

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30004949SMESG000071493.1 SMESG000034930.1 Contig38165newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30004949SMESG000071493.1 SMESG000034930.1 Contig38165uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
testisSMED30004949SMESG000071493.1 PL06023B1A12ncbi_smed_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30004949SMESG000071493.1 Contig6395_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
early male germ cellSMED30004949SMESG000071493.1 Contig6395_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism asexual adult cDNA to DNA expression microarray evidence
testis primordiumSMED30004949SMESG000071493.1 Contig6395_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
neoblastSMED30004949SMESG000071493.1 SMED_13527_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30004949SMESG000071493.1 SMED_13527_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30004949SMESG000071493.1 SMED_33519_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30004949SMESG000071493.1 SMED_33519_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RIB43A protein vs. Ensembl Human
Match: RIBC2 (RIB43A domain with coiled-coils 2 [Source:HGNC Symbol;Acc:HGNC:13241])

HSP 1 Score: 236.498 bits (602), Expect = 1.160e-73
Identity = 161/374 (43.05%), Postives = 234/374 (62.57%), Query Frame = 2
Query:   77 LPVDQKEAAXXXXXXXXXXXXXXXIFNSKIRQIGIDKQALAQQVKDKKERECIERNVELAYAADAMRNDSIATLLGRRQLDDIRELNKILNEFRSLHQQPETRREWDLYDPDALKKDKPARVCDDDPRCGLASMQKFDGEDLNNKARNKYQKGQVNDWNERQMADKERAEQAQREADRLYDLKRREMDERACNLAAAEEACRRAMNIANSQYNLALAREMNERARLKNQQENDDTLTAIANALYSDLLTANPAQAISAFGPGRIVPDRFKGMTPEQLKEIFKEQEDQIKDNKRRQMEEDLRNKEWDRQRXXXXXXXXXXXXXXXXXXXXXXXHVADENLCLSKEQKLHQEFLNREVYTNQPTAAYFMQFNTTSR 1198
            LP D ++ A +  RR  E  RQ R+FN++ R IG D +A   QV D+K +E  E+     +AA+  +ND I  +L  R+  D + L + +N+F+   Q+PETRRE+DL DP ALKKD PAR  D+D R  ++ MQKF GEDLN   R K+Q+ Q  +W+ +Q  + + A   Q+ A+ LY   R + DE A +L   E   R+A+  +   +N + A E  ER + + +QE +D L  I N L  DLL+ NP QA S+FGP R+VPDR+KGMT EQL++I   Q+ QI++  R Q E+  R+ +WDR+R+  A+A L+ E+++ R+  +L + +   NL L+KEQ L ++++N EVYTNQPT  YF QFNT SR
Sbjct:   10 LPRDLRQDANLAKRRHAELCRQKRVFNARNRIIGGDTEAWDVQVHDQKIKEATEKARHETFAAEMRQNDKIMCILENRKKRDRKNLCRAINDFQQSFQKPETRREFDLSDPLALKKDLPARQSDNDVRNTISGMQKFMGEDLNFHERKKFQEEQNREWSLQQQREWKNARAEQKCAEALYTETRLQFDETAKHLQKLESTTRKAVCASVKDFNKSQAIESVERKKQEKKQEQEDNLAEITNLLRGDLLSENPQQAASSFGPHRVVPDRWKGMTQEQLEQIRLVQKQQIQEKLRLQEEKRQRDLDWDRRRIQGARATLLFERQQWRRQRDLRRALDSSNLSLAKEQHLQKKYMN-EVYTNQPTGDYFTQFNTGSR 382          
BLAST of RIB43A protein vs. Ensembl Human
Match: RIBC1 (RIB43A domain with coiled-coils 1 [Source:HGNC Symbol;Acc:HGNC:26537])

HSP 1 Score: 190.66 bits (483), Expect = 4.068e-56
Identity = 153/380 (40.26%), Postives = 212/380 (55.79%), Query Frame = 2
Query:   62 MYKLDLPVDQKEAAXXXXXXXXXXXXXXXIFNSKIRQIGIDKQALAQQVKDKKERECIERNVELAYAADAMRNDSIATLLGRRQLDDIRELNKILNEFRSLHQQPETRREWDLYDPDALKKDKPARVCDDDPRCGLASMQKFDGEDLNNKARNKYQKGQVNDWNERQMADKERAEQAQREADRLYDLKRREMDERACNLAAAEEACRRAMNIANSQYNLALAREMNERARLKNQQENDDTLTAIANALYSDLLTANPAQAISAFGPGRIVPDRFKGMTPEQLKEIFKEQEDQ-IKDNKRRQMEEDLRNKEWDRQRXXXXXXXXXXXXXXXXXXXXXXXHVADENLCLSKEQKLHQEFLNREVYTNQPTAAYFMQFNTTSR 1198
            MY +    D KEAA I  RR+RE++RQ+R FN + R +G+D QAL  QV D+K RE  ER+ E AY    ++ D +  +L + + D  R+L K + EFR   QQ +  RE+ L+DP  + K  P  +   +   G AS+Q F GEDL+   R + Q+GQ     ERQ  ++++A+  +   D L +  R  MD +A +LA  EE+CR AM  A +  N A A     R R + Q+E    L  I +   SDLLT NP  A     P R++P  +KGMTPEQ   I KEQE Q  K    RQ E+ L + EW  Q ++ A+A L LE++E        + +   N  L+ EQK  Q++LN  +YTNQPTA Y  QFNT+SR
Sbjct:    1 MYNIKQSTDTKEAAAIEARRNREKERQNRFFNVRNRVMGVDVQALNNQVGDRKRREAAERSKEAAYGTSQVQYDVVVQMLEKEEADRTRQLAKKVQEFREQKQQLKNGREFSLWDPGQVWKGLPTYLSYSNTYPGPASLQYFSGEDLDRDTRLRMQQGQFRYNLERQQQEQQQAKVDENYTDALSNQLRLAMDAQATHLARLEESCRAAMMCAMANANKAQAAVQAGRQRCERQREQKANLAEIQHQSTSDLLTENPQVAQHPMAPYRVLPYCWKGMTPEQQAAIRKEQEVQRSKKQAHRQAEKTL-DTEWKSQTMSSAQAVLELEEQERELCAVFQRGLGSFNQQLANEQKAQQDYLNSVIYTNQPTAQYHQQFNTSSR 379          
BLAST of RIB43A protein vs. Ensembl Human
Match: RIBC1 (RIB43A domain with coiled-coils 1 [Source:HGNC Symbol;Acc:HGNC:26537])

HSP 1 Score: 98.5969 bits (244), Expect = 9.091e-24
Identity = 65/160 (40.62%), Postives = 93/160 (58.13%), Query Frame = 2
Query:   62 MYKLDLPVDQKEAAXXXXXXXXXXXXXXXIFNSKIRQIGIDKQALAQQVKDKKERECIERNVELAYAADAMRNDSIATLLGRRQLDDIRELNKILNEFRSLHQQPETRREWDLYDPDALKKDKPARVCDDDPRCGLASMQKFDGEDLNNKARNKYQKGQV 541
            MY +    D KEAA I  RR+RE++RQ+R FN + R +G+D QAL  QV D+K RE  ER+ E AY    ++ D +  +L + + D  R+L K + EFR   QQ +  RE+ L+DP  + K  P  +   +   G AS+Q F GEDL+   R + Q+GQ 
Sbjct:    1 MYNIKQSTDTKEAAAIEARRNREKERQNRFFNVRNRVMGVDVQALNNQVGDRKRREAAERSKEAAYGTSQVQYDVVVQMLEKEEADRTRQLAKKVQEFREQKQQLKNGREFSLWDPGQVWKGLPTYLSYSNTYPGPASLQYFSGEDLDRDTRLRMQQGQF 160          
BLAST of RIB43A protein vs. Ensembl Human
Match: RIBC1 (RIB43A domain with coiled-coils 1 [Source:HGNC Symbol;Acc:HGNC:26537])

HSP 1 Score: 98.5969 bits (244), Expect = 1.552e-23
Identity = 65/160 (40.62%), Postives = 93/160 (58.13%), Query Frame = 2
Query:   62 MYKLDLPVDQKEAAXXXXXXXXXXXXXXXIFNSKIRQIGIDKQALAQQVKDKKERECIERNVELAYAADAMRNDSIATLLGRRQLDDIRELNKILNEFRSLHQQPETRREWDLYDPDALKKDKPARVCDDDPRCGLASMQKFDGEDLNNKARNKYQKGQV 541
            MY +    D KEAA I  RR+RE++RQ+R FN + R +G+D QAL  QV D+K RE  ER+ E AY    ++ D +  +L + + D  R+L K + EFR   QQ +  RE+ L+DP  + K  P  +   +   G AS+Q F GEDL+   R + Q+GQ 
Sbjct:    1 MYNIKQSTDTKEAAAIEARRNREKERQNRFFNVRNRVMGVDVQALNNQVGDRKRREAAERSKEAAYGTSQVQYDVVVQMLEKEEADRTRQLAKKVQEFREQKQQLKNGREFSLWDPGQVWKGLPTYLSYSNTYPGPASLQYFSGEDLDRDTRLRMQQGQF 160          
BLAST of RIB43A protein vs. Ensembl Human
Match: RIBC1 (RIB43A domain with coiled-coils 1 [Source:HGNC Symbol;Acc:HGNC:26537])

HSP 1 Score: 73.559 bits (179), Expect = 2.688e-14
Identity = 62/152 (40.79%), Postives = 79/152 (51.97%), Query Frame = 2
Query:  560 QMADKERAEQAQREADRLYDLK----RREMDERACNLAAAEEACRRAMNIANSQYNLALAREMNERARLKNQQENDDTLTAIANALYSDLLTANPAQAISAFGPGRIVPDRFKGMTPEQLKEIFKEQEDQ-IKDNKRRQMEEDLRNKEWDRQ 1000
            Q+ D++R E A+R  +  YD      R  MD +A +LA  EE+CR AM  A +  N A A     R R + Q+E    L  I +   SDLLT NP  A     P R++P  +KGMTPEQ   I KEQE Q  K    RQ E+ L + EW  Q
Sbjct:   48 QVGDRKRREAAERSKEAAYDALSNQLRLAMDAQATHLARLEESCRAAMMCAMANANKAQAAVQAGRQRCERQREQKANLAEIQHQSTSDLLTENPQVAQHPMAPYRVLPYCWKGMTPEQQAAIRKEQEVQRSKKQAHRQAEKTL-DTEWKSQ 198          

HSP 2 Score: 48.9062 bits (115), Expect = 5.893e-6
Identity = 42/88 (47.73%), Postives = 54/88 (61.36%), Query Frame = 2
Query:   62 MYKLDLPVDQKEAAXXXXXXXXXXXXXXXIFNSKIRQIGIDKQALAQQVKDKKERECIERNVELAYAADAMRN------DSIATLLGR 307
            MY +    D KEAA I  RR+RE++RQ+R FN + R +G+D QAL  QV D+K RE  ER+ E AY  DA+ N      D+ AT L R
Sbjct:    1 MYNIKQSTDTKEAAAIEARRNREKERQNRFFNVRNRVMGVDVQALNNQVGDRKRREAAERSKEAAY--DALSNQLRLAMDAQATHLAR 86          
BLAST of RIB43A protein vs. Ensembl Fly
Match: CG7264 (gene:FBgn0036214 transcript:FBtr0076035)

HSP 1 Score: 117.857 bits (294), Expect = 3.102e-29
Identity = 91/293 (31.06%), Postives = 157/293 (53.58%), Query Frame = 2
Query:  149 IFNSKIRQIGIDKQALAQQVKDKKERECIERNVELAYAADAMRNDSIATL----LGRRQLDDIRELNKILNEFRSLHQQPETRREWDLYDPDALKKDKPARVCDDDPRCGLASMQKFDGEDLNNKARNKYQKGQVNDWNERQMADKERAEQAQREADRLYDLKRREMDERACNLAAAEEACRRAMNIANS------QYNLALAREMN-ERARLKNQQENDDTLTAIANALYSDLLTANPAQAISAFGPGRIVPDRFKGMTPEQLKEIFKEQEDQIKDNKRRQMEEDLRNKEWD 994
            IFN+K R  G+D + L +Q+ +KK++   +   +  +         +       L ++Q    R ++  LN +R  +Q+ E RRE+DL DP+ LKK +P RV D+D   G++S Q F GEDL N  R + Q+ Q   W ++Q+ +++RAE A+++AD +       MD   C     +E  +    + N       Q+N+ +A++   +R R K ++  DD +  I N L SD+LT NP  A S   P + +   ++GMTPE+L+     Q+ Q++ + +R+ E  + +K+W+
Sbjct:   33 IFNAKQRLYGLDLEMLDRQILEKKKQRTAQMECDKKFEEQEQLQKRLILAQEMELEKKQ----RVVDSDLNYYRCRYQRKEQRREFDLNDPNFLKKARPTRVADNDISLGVSSAQIFQGEDLYNSDRKQRQREQQRAWLDQQVQERKRAEDARKQADNVL------MDNVGCRDKHLQEMAKSDHQMRNQVIQRVRQFNINMAKQKQLDREREKREKYEDD-MAEIYNMLSSDMLTENPDVAQSRTDPNKKIAFMYRGMTPEELRVFRLGQDQQLRLSIQRKTEAQMMDKQWE 314          
BLAST of RIB43A protein vs. Ensembl Fly
Match: CG7264 (gene:FBgn0036214 transcript:FBtr0332130)

HSP 1 Score: 117.857 bits (294), Expect = 3.102e-29
Identity = 91/293 (31.06%), Postives = 157/293 (53.58%), Query Frame = 2
Query:  149 IFNSKIRQIGIDKQALAQQVKDKKERECIERNVELAYAADAMRNDSIATL----LGRRQLDDIRELNKILNEFRSLHQQPETRREWDLYDPDALKKDKPARVCDDDPRCGLASMQKFDGEDLNNKARNKYQKGQVNDWNERQMADKERAEQAQREADRLYDLKRREMDERACNLAAAEEACRRAMNIANS------QYNLALAREMN-ERARLKNQQENDDTLTAIANALYSDLLTANPAQAISAFGPGRIVPDRFKGMTPEQLKEIFKEQEDQIKDNKRRQMEEDLRNKEWD 994
            IFN+K R  G+D + L +Q+ +KK++   +   +  +         +       L ++Q    R ++  LN +R  +Q+ E RRE+DL DP+ LKK +P RV D+D   G++S Q F GEDL N  R + Q+ Q   W ++Q+ +++RAE A+++AD +       MD   C     +E  +    + N       Q+N+ +A++   +R R K ++  DD +  I N L SD+LT NP  A S   P + +   ++GMTPE+L+     Q+ Q++ + +R+ E  + +K+W+
Sbjct:   33 IFNAKQRLYGLDLEMLDRQILEKKKQRTAQMECDKKFEEQEQLQKRLILAQEMELEKKQ----RVVDSDLNYYRCRYQRKEQRREFDLNDPNFLKKARPTRVADNDISLGVSSAQIFQGEDLYNSDRKQRQREQQRAWLDQQVQERKRAEDARKQADNVL------MDNVGCRDKHLQEMAKSDHQMRNQVIQRVRQFNINMAKQKQLDREREKREKYEDD-MAEIYNMLSSDMLTENPDVAQSRTDPNKKIAFMYRGMTPEELRVFRLGQDQQLRLSIQRKTEAQMMDKQWE 314          
BLAST of RIB43A protein vs. Ensembl Zebrafish
Match: ribc2 (RIB43A domain with coiled-coils 2 [Source:ZFIN;Acc:ZDB-GENE-050411-27])

HSP 1 Score: 176.407 bits (446), Expect = 5.745e-51
Identity = 132/350 (37.71%), Postives = 205/350 (58.57%), Query Frame = 2
Query:  149 IFNSKIRQIGIDKQALAQQVKDKKERECIERNVELAYAADAMRNDSIATLLGRRQLDDIRELNKILNEFRSLHQQPETRREWDLYDPDALKKDKPARVCDDDPRCGLASMQKFDGEDLNNKARNKYQKGQVNDWNERQMADKERAEQAQREADRLYDLKRREMDERACNLAAAEEACRRAMNIANSQYNLALAREMNERARLKNQQENDDTLTAIANALYSDLLTANPAQAISAFGPGRIVPDRFKGMTPEQLKEIFKEQEDQIKDNKRRQMEEDLRNKEWDRQRXXXXXXXXXXXXXXXXXXXXXXXHVADENLCLSKEQKLHQEFLNREVYTNQPTAAYFMQFNTTSR 1198
            IF+ K+R IG+D  AL QQ+K+++E+E  E N    YA D + +D IA +L +RQ  D R+LNK + +FR   QQ  +RRE+DL DP+ LKK +  R+    P  GL       GEDL  K R + Q+ Q+  W  +Q  + ERA+  +++ +  YD  R  +D RA  L   EE  +R + IA   +NLALA E+  R   ++++E ++  T I N L  DLL  NP Q +S  G  R+  D +KGM+P++L+   + Q  Q +D KR  ME+  ++ +  ++R++ A+AAL+LE+++ R   EL + + + N  L+      ++ L ++VYTN P   Y+ QFNT+SR
Sbjct:   30 IFSDKVRTIGVDIDALGQQIKERREKEQREANELKVYADDLLCSDGIACILEQRQKKDERQLNKDIVQFRQQFQQASSRREFDLNDPELLKKQEGQRIL---P--GLV------GEDLGQKNRLRKQQEQLYSWTTQQKEEVERAKLQRKQEENQYDQIRMSLDSRALELQKMEEQTKRDLLIATKDFNLALAAEITHRRLQEHREEEENNQTEIYNQLNGDLLMENPEQNVSVLGLSRLRRDCYKGMSPQELQTYTQYQRQQAEDRKRANMEQRQKDLQEHQERMSSARAALLLERQQARINKELRRAMDNSNSQLAHIHDARKKHL-QDVYTNIPDERYYSQFNTSSR 367          
BLAST of RIB43A protein vs. Ensembl Zebrafish
Match: ribc1 (RIB43A domain with coiled-coils 1 [Source:ZFIN;Acc:ZDB-GENE-081031-7])

HSP 1 Score: 147.902 bits (372), Expect = 4.394e-40
Identity = 131/388 (33.76%), Postives = 221/388 (56.96%), Query Frame = 2
Query:   62 MYKLDLPVDQKEAAXXXXXXXXXXXXXXXIFNSKIRQIGIDKQALAQQVKDKKERECIERNVELAYAADAMRNDSIATLLGRRQLDDIR-ELNKILNEFRSLHQQPETRREWDL-YDPDALKKDKPARVCDDDPRCGL--ASMQKFDGEDLNNKARNKYQKGQVNDWNER-QMADKERAEQAQREADRLYDLKRREMDERACNLAAAEEACRRAMNIANSQYNLALAREMNERARLKNQQENDDTLTAIANALYSDLLTANPAQAI----SAFGPGRIVPDRFKGMTPEQLKEIFKEQEDQIKDNKRRQMEEDLRNKEWDRQRXXXXXXXXXXXXXXXXXXXXXXXHVADENLCLSKEQKLHQEFLNREVYTNQPTAAYFMQFNTTSR 1198
            MYK+DLPVD+     +  RR+ E +R+SRIFN++ R IG+D +AL +Q  DK+ER+ +E+  +++Y    +  D +A +  +++ D++R EL + L +FR++HQ+ E  R+ D+ YD    +K  P   C+  P   L  ASMQ F GE +    + + Q  ++N+ N R Q  ++E+  + +++ + L      E D RA  L A EE C+R   +A S YN A A E  ER + +  +   + L  +   + SDLLT  P  A     S+    R++ DR+KGM+P+Q+ +I +++E+Q  + +R +  E  R   WD     Q++     E+++     E    +   N  L++EQ+ HQ+FL++++YTN+P+  YF QF+T+SR
Sbjct:    1 MYKVDLPVDESVRQAVERRRAAEAERKSRIFNTRTRVIGVDLRALHKQQGDKQERKEMEKQRDVSYDLLRLSLDEMA-MHQKKEEDEVRGELARDLVQFRAIHQRAEDSRDADINYD----RKGAPT-TCESVPDSALGPASMQVFLGEGIKEDEKKRSQM-ELNEKNLRAQKEEREQRVREEKKRELLTSRVLVEKDLRAVQLNALEEECKREAQVALSHYNQAQAEERMEREQQERMRREGEELAELRYMVTSDLLTERPEAAARTTESSPNAPRVLTDRWKGMSPQQISDIHRKREEQCFEKERLREREKRRELAWDYHLTEQSRQQERDERKDMELQRERRIQLDKYNQQLAREQQAHQQFLDKQLYTNRPSVQYFTQFSTSSR 381          
BLAST of RIB43A protein vs. Ensembl Zebrafish
Match: ribc2 (RIB43A domain with coiled-coils 2 [Source:ZFIN;Acc:ZDB-GENE-050411-27])

HSP 1 Score: 97.0561 bits (240), Expect = 8.859e-23
Identity = 67/189 (35.45%), Postives = 101/189 (53.44%), Query Frame = 2
Query:  149 IFNSKIRQIGIDKQALAQQVKDKKERECIERNVELAYAADAMRNDSIATLLGRRQLDDIRELNKILNEFRSLHQQPETRREWDLYDPDALKKDKPARVCDDDPRCGLASMQKFDGEDLNNKARNKYQKGQVNDWNERQMADKERAEQAQREADRLYDLKRREMDERACNLAAAEEACRRAMNIANSQYN 715
            IF+ K+R IG+D  AL QQ+K+++E+E  E N    YA D + +D IA +L +RQ  D R+LNK + +FR   QQ  +RRE+DL DP+ LKK +  R+       GL       GEDL  K R + Q+ Q+  W  +Q  + ERA+  +++ +         M +  C   A    CR+  N  +  Y+
Sbjct:   30 IFSDKVRTIGVDIDALGQQIKERREKEQREANELKVYADDLLCSDGIACILEQRQKKDERQLNKDIVQFRQQFQQASSRREFDLNDPELLKKQEGQRILP-----GLV------GEDLGQKNRLRKQQEQLYSWTTQQKEEVERAKLQRKQEE-------NNMTKSECLWTAELSNCRKWRNKPSETYS 200          
BLAST of RIB43A protein vs. Ensembl Xenopus
Match: ribc1 (RIB43A domain with coiled-coils 1 [Source:NCBI gene;Acc:100216275])

HSP 1 Score: 320.087 bits (819), Expect = 2.308e-106
Identity = 193/379 (50.92%), Postives = 253/379 (66.75%), Query Frame = 2
Query:   62 MYKLDLPVDQKEAAXXXXXXXXXXXXXXXIFNSKIRQIGIDKQALAQQVKDKKERECIERNVELAYAADAMRNDSIATLLGRRQLDDIRELNKILNEFRSLHQQPETRREWDLYDPDALKKDKPARVCDDDPRCGLASMQKFDGEDLNNKARNKYQKGQVNDWNERQMADKERAEQAQREADRLYDLKRREMDERACNLAAAEEACRRAMNIANSQYNLALAREMNERARLKNQQENDDTLTAIANALYSDLLTANPAQAISAFGPGRIVPDRFKGMTPEQLKEIFKEQEDQIKDNKRRQMEEDLRNKEWDRQRXXXXXXXXXXXXXXXXXXXXXXXHVADENLCLSKEQKLHQEFLNREVYTNQPTAAYFMQFNTTSR 1198
            MYK+DL  D K+ A I  RR++E+QRQSRIFN+K R IG+D Q L +QV++ K RE  E+    AY A+ + ND IA +L +RQ      L K + EFR  HQQP TRRE+DLYDP+ALKKD+PARV D+DPRCG AS+QK  GEDLN K R K Q      W   Q+ +++R +   + AD LYD KR E+DERA +L+  EE CR+A+++A   YN AL  E +E  RL+ QQE DD    I N L  D+LT +PA A S++GP R++PDR+KGM+PEQL+ I + QE Q ++  R + +E     EWD+QR   A+AA+ LE++E+    EL K +   N  LSKEQK H E+L +EVYTN PTA +F QFNTTSR
Sbjct:    1 MYKVDLLPDPKQIAAIERRRNQEQQRQSRIFNAKCRTIGVDVQKLDKQVQELKLRESTEKASNEAYDAERLLNDKIAQMLEQRQEQLAHSLEKDVQEFRDQHQQPHTRREFDLYDPEALKKDQPARVGDEDPRCGPASLQKLAGEDLNEKERKKMQMDLTKKWLSEQIEERQRIQHQAKYADNLYDRKRVELDERALHLSTMEEECRKAISLATKNYNEALGLEASEGKRLRKQQEQDDNFAEIYNHLTGDILTEDPAAASSSYGPHRVIPDRWKGMSPEQLQAIRETQEQQRQEKHRLKEQEKQLEAEWDQQRFLAARAAMTLEQQEQEMNKELRKRLDLYNQQLSKEQKAHLEYLEKEVYTNNPTAHFFTQFNTTSR 379          
BLAST of RIB43A protein vs. Ensembl Xenopus
Match: RIBC2 (RIB43A domain with coiled-coils 2 [Source:NCBI gene;Acc:100151719])

HSP 1 Score: 253.447 bits (646), Expect = 2.591e-80
Identity = 169/379 (44.59%), Postives = 249/379 (65.70%), Query Frame = 2
Query:   62 MYKLDLPVDQKEAAXXXXXXXXXXXXXXXIFNSKIRQIGIDKQALAQQVKDKKERECIERNVELAYAADAMRNDSIATLLGRRQLDDIRELNKILNEFRSLHQQPETRREWDLYDPDALKKDKPARVCDDDPRCGLASMQKFDGEDLNNKARNKYQKGQVNDWNERQMADKERAEQAQREADRLYDLKRREMDERACNLAAAEEACRRAMNIANSQYNLALAREMNERARLKNQQENDDTLTAIANALYSDLLTANPAQAISAFGPGRIVPDRFKGMTPEQLKEIFKEQEDQIKDNKRRQMEEDLRNKEWDRQRXXXXXXXXXXXXXXXXXXXXXXXHVADENLCLSKEQKLHQEFLNREVYTNQPTAAYFMQFNTTSR 1198
            MY+LDLP D++EA+++  +R+ E QR +RIF+S  R +G+DK AL  Q++DKK +E IE   + AYAA   +ND IA+ L  R   D+R+LNK ++EFR   Q+ E RRE+DL DP+ALKK+ P RV D DPRC ++ +Q+  GEDL   +R + Q+ Q+ +W+ +Q  ++ RA + QR  D  YD  R E+D++A  L   E   RRA+  A   +N A A E  ER +L+ +QE +D    I+N +  DLL+ +PAQA SAFGP R+VPDR+KGM+  QL+ I   Q+ QI++  R + EE +R  E  RQR+  A+A ++LE++++R+  EL K     NL L++ Q+  + +L++EV+TN PT  YF QFNT+SR
Sbjct:    1 MYRLDLPADRREASLLERKRTAELQRHNRIFSSHTRTVGVDKPALDTQIQDKKLQEEIENKRKEAYAAQMKQNDQIASALDERMQRDVRDLNKAIDEFRLTFQKKEDRREYDLSDPEALKKELPPRVSDGDPRCTVSGVQRLLGEDLTVDSRRQMQQEQLREWSLQQQEEQARALEEQRLRDGNYDKMRVELDQKAAELQQLELQTRRAVCAATKDFNRAQAEETTERKKLERKQEEEDNSVEISNLINGDLLSEDPAQAASAFGPHRVVPDRWKGMSSAQLEAINNVQQQQIQERMRLREEERVREAELYRQRVQAARAMVLLERQQKREEKELRKAQDHMNLQLAQAQRAQKTYLDKEVFTNNPTDRYFEQFNTSSR 379          
BLAST of RIB43A protein vs. Ensembl Xenopus
Match: RIBC2 (RIB43A domain with coiled-coils 2 [Source:NCBI gene;Acc:100151719])

HSP 1 Score: 231.491 bits (589), Expect = 3.345e-72
Identity = 131/285 (45.96%), Postives = 188/285 (65.96%), Query Frame = 2
Query:   62 MYKLDLPVDQKEAAXXXXXXXXXXXXXXXIFNSKIRQIGIDKQALAQQVKDKKERECIERNVELAYAADAMRNDSIATLLGRRQLDDIRELNKILNEFRSLHQQPETRREWDLYDPDALKKDKPARVCDDDPRCGLASMQKFDGEDLNNKARNKYQKGQVNDWNERQMADKERAEQAQREADRLYDLKRREMDERACNLAAAEEACRRAMNIANSQYNLALAREMNERARLKNQQENDDTLTAIANALYSDLLTANPAQAISAFGPGRIVPDRFKGMTPEQLKEI 916
            MY+LDLP D++EA+++  +R+ E QR +RIF+S  R +G+DK AL  Q++DKK +E IE   + AYAA   +ND IA+ L  R   D+R+LNK ++EFR   Q+ E RRE+DL DP+ALKK+ P RV D DPRC ++ +Q+  GEDL   +R + Q+ Q+ +W+ +Q  ++ RA + QR  D  YD  R E+D++A  L   E   RRA+  A   +N A A E  ER +L+ +QE +D    I+N +  DLL+ +PAQA SAFGP R+VPDR+KGM+  QL+ I
Sbjct:    1 MYRLDLPADRREASLLERKRTAELQRHNRIFSSHTRTVGVDKPALDTQIQDKKLQEEIENKRKEAYAAQMKQNDQIASALDERMQRDVRDLNKAIDEFRLTFQKKEDRREYDLSDPEALKKELPPRVSDGDPRCTVSGVQRLLGEDLTVDSRRQMQQEQLREWSLQQQEEQARALEEQRLRDGNYDKMRVELDQKAAELQQLELQTRRAVCAATKDFNRAQAEETTERKKLERKQEEEDNSVEISNLINGDLLSEDPAQAASAFGPHRVVPDRWKGMSSAQLEAI 285          
BLAST of RIB43A protein vs. Ensembl Mouse
Match: Ribc2 (RIB43A domain with coiled-coils 2 [Source:MGI Symbol;Acc:MGI:1914997])

HSP 1 Score: 207.994 bits (528), Expect = 5.917e-63
Identity = 135/350 (38.57%), Postives = 213/350 (60.86%), Query Frame = 2
Query:  149 IFNSKIRQIGIDKQALAQQVKDKKERECIERNVELAYAADAMRNDSIATLLGRRQLDDIRELNKILNEFRSLHQQPETRREWDLYDPDALKKDKPARVCDDDPRCGLASMQKFDGEDLNNKARNKYQKGQVNDWNERQMADKERAEQAQREADRLYDLKRREMDERACNLAAAEEACRRAMNIANSQYNLALAREMNERARLKNQQENDDTLTAIANALYSDLLTANPAQAISAFGPGRIVPDRFKGMTPEQLKEIFKEQEDQIKDNKRRQMEEDLRNKEWDRQRXXXXXXXXXXXXXXXXXXXXXXXHVADENLCLSKEQKLHQEFLNREVYTNQPTAAYFMQFNTTSR 1198
            IF+++ R IG D QA   QV+D+K +E  ++    A+AA+   ND +  +   R+    ++L + +N+F+   Q+PETRRE+DL DP AL+K+ PAR+ D+D R  ++ MQKF GEDLN + R ++QK Q  +W  +Q  ++E+A      A+ L+   R + DE A  L   E + R+ +  A   +N     E+ ER R + QQE +D +T I N L+ DLL+ NP    S+FG  R+V DR+KGM  EQL+EI+  Q+ QI++  R Q EE   + +WD +R+ +A A+L+ E++++R + E  + +   NL L+++Q L ++ +N    ++QPT  YF QFNT SR
Sbjct:   29 IFDARNRIIGGDTQAWDFQVRDQKIKEITDKARHEAFAAEMKHNDKVMCMAHDREQRHRKQLCRAINDFQQNFQKPETRREFDLSDPLALQKELPARISDNDMRNTISGMQKFMGEDLNFQERRRFQKEQSREWFLQQHGEREKARADHLLAEHLHTQTRLKFDETARELMKLEGSTRKEVCAAVKAFNKNQVVELTERKRQEKQQEQEDNMTEITNLLHGDLLSENPRPVASSFGSHRVVLDRWKGMNREQLEEIWFTQKRQIQEKLRLQEEERQHSMDWDLRRIRKAHASLLHERQQQRLLREQRRALDCSNLNLARQQYLQKKQMN-TASSSQPTEDYFSQFNTRSR 377          
BLAST of RIB43A protein vs. Ensembl Mouse
Match: Ribc1 (RIB43A domain with coiled-coils 1 [Source:MGI Symbol;Acc:MGI:1913861])

HSP 1 Score: 174.096 bits (440), Expect = 5.849e-50
Identity = 148/380 (38.95%), Postives = 217/380 (57.11%), Query Frame = 2
Query:   62 MYKLDLPVDQKEAAXXXXXXXXXXXXXXXIFNSKIRQIGIDKQALAQQVKDKKERECIERNVELAYAADAMRNDSIATLLGRRQLDDIRELNKILNEFR-SLHQQPETRREWDLYDPDALKKDKPARVCDDDPRCGLASMQKFDGEDLNNKARNKYQKGQVNDWNERQMADKERAEQAQREADRLYDLKRREMDERACNLAAAEEACRRAMNIANSQYNLALAREMNERARLKNQQENDDTLTAIANALYSDLLTANPAQAISAFGPGRIVPDRFKGMTPEQLKEIFKEQEDQIKDNKRRQMEEDLRNKEWDRQRXXXXXXXXXXXXXXXXXXXXXXXHVADENLCLSKEQKLHQEFLNREVYTNQPTAAYFMQFNTTSR 1198
            MYKLDL  D +E A I  RR+RE++RQSR FN + R +G+D +AL  QV+++K RE IERN ++AY       D +A +L + + +    L+K + +FR    QQ +   E+D +DPD  ++ +     + D   G ASMQ F GEDL   +  + Q+ Q+    E+Q+ +++ A + +  A  L D  R   D RA  LA  EE+CR AM  A +  N A A +   + R + Q++ +  LT +   + SDLLT NP  A  A  P R++P  +KGM+ EQ   I K QE Q ++ K ++  E L   EW RQ    A+AAL LE++E     E  + +   N  L+KEQ+  Q +LN  +YTNQPTA Y++QFNT+SR
Sbjct:    1 MYKLDLVSDPRELAAIEARRNREKERQSRFFNVRNRVMGVDVEALNYQVEERKFREAIERNKDIAYGTKHAHYDLVAQMLEKEEAERAYRLSKRVQDFREQRQQQYKNGHEFDFWDPDQFQEFRVP-YYEKDAYFGPASMQYFFGEDLERASHVRMQQEQMRYNLEKQLQEQQAAREEEARAALLSDQLRLAADTRAAELARLEESCRAAMRTAMANANKAQAAKQALQQRREQQRQQEANLTEVKKQVTSDLLTENPQVAQRANAPHRVLPYCWKGMSAEQRAAIRKTQETQRQEKKEQRQAEKLVEAEWGRQNKRLAEAALELEEQERELCAEFRRGLGSFNRELAKEQQAQQNYLNSVIYTNQPTAHYYLQFNTSSR 379          
BLAST of RIB43A protein vs. Ensembl Mouse
Match: Ribc2 (RIB43A domain with coiled-coils 2 [Source:MGI Symbol;Acc:MGI:1914997])

HSP 1 Score: 117.857 bits (294), Expect = 2.731e-30
Identity = 70/189 (37.04%), Postives = 112/189 (59.26%), Query Frame = 2
Query:  149 IFNSKIRQIGIDKQALAQQVKDKKERECIERNVELAYAADAMRNDSIATLLGRRQLDDIRELNKILNEFRSLHQQPETRREWDLYDPDALKKDKPARVCDDDPRCGLASMQKFDGEDLNNKARNKYQKGQVNDWNERQMADKERAEQAQREADRLYDLKRREMDERACNLAAAEEACRRAMNIANSQYN 715
            IF+++ R IG D QA   QV+D+K +E  ++    A+AA+   ND +  +   R+    ++L + +N+F+   Q+PETRRE+DL DP AL+K+ PAR+ D+D R  ++ MQKF GEDLN + R ++QK Q  +W  +Q  ++E+A      A+ L+   R + DE A  L   E + R+ +  A   +N
Sbjct:   29 IFDARNRIIGGDTQAWDFQVRDQKIKEITDKARHEAFAAEMKHNDKVMCMAHDREQRHRKQLCRAINDFQQNFQKPETRREFDLSDPLALQKELPARISDNDMRNTISGMQKFMGEDLNFQERRRFQKEQSREWFLQQHGEREKARADHLLAEHLHTQTRLKFDETARELMKLEGSTRKEVCAAVKAFN 217          
BLAST of RIB43A protein vs. UniProt/SwissProt
Match: sp|Q9H4K1|RIBC2_HUMAN (RIB43A-like with coiled-coils protein 2 OS=Homo sapiens OX=9606 GN=RIBC2 PE=1 SV=2)

HSP 1 Score: 236.498 bits (602), Expect = 5.571e-73
Identity = 161/374 (43.05%), Postives = 234/374 (62.57%), Query Frame = 2
Query:   77 LPVDQKEAAXXXXXXXXXXXXXXXIFNSKIRQIGIDKQALAQQVKDKKERECIERNVELAYAADAMRNDSIATLLGRRQLDDIRELNKILNEFRSLHQQPETRREWDLYDPDALKKDKPARVCDDDPRCGLASMQKFDGEDLNNKARNKYQKGQVNDWNERQMADKERAEQAQREADRLYDLKRREMDERACNLAAAEEACRRAMNIANSQYNLALAREMNERARLKNQQENDDTLTAIANALYSDLLTANPAQAISAFGPGRIVPDRFKGMTPEQLKEIFKEQEDQIKDNKRRQMEEDLRNKEWDRQRXXXXXXXXXXXXXXXXXXXXXXXHVADENLCLSKEQKLHQEFLNREVYTNQPTAAYFMQFNTTSR 1198
            LP D ++ A +  RR  E  RQ R+FN++ R IG D +A   QV D+K +E  E+     +AA+  +ND I  +L  R+  D + L + +N+F+   Q+PETRRE+DL DP ALKKD PAR  D+D R  ++ MQKF GEDLN   R K+Q+ Q  +W+ +Q  + + A   Q+ A+ LY   R + DE A +L   E   R+A+  +   +N + A E  ER + + +QE +D L  I N L  DLL+ NP QA S+FGP R+VPDR+KGMT EQL++I   Q+ QI++  R Q E+  R+ +WDR+R+  A+A L+ E+++ R+  +L + +   NL L+KEQ L ++++N EVYTNQPT  YF QFNT SR
Sbjct:   10 LPRDLRQDANLAKRRHAELCRQKRVFNARNRIIGGDTEAWDVQVHDQKIKEATEKARHETFAAEMRQNDKIMCILENRKKRDRKNLCRAINDFQQSFQKPETRREFDLSDPLALKKDLPARQSDNDVRNTISGMQKFMGEDLNFHERKKFQEEQNREWSLQQQREWKNARAEQKCAEALYTETRLQFDETAKHLQKLESTTRKAVCASVKDFNKSQAIESVERKKQEKKQEQEDNLAEITNLLRGDLLSENPQQAASSFGPHRVVPDRWKGMTQEQLEQIRLVQKQQIQEKLRLQEEKRQRDLDWDRRRIQGARATLLFERQQWRRQRDLRRALDSSNLSLAKEQHLQKKYMN-EVYTNQPTGDYFTQFNTGSR 382          
BLAST of RIB43A protein vs. UniProt/SwissProt
Match: sp|Q32LJ7|RIBC2_BOVIN (RIB43A-like with coiled-coils protein 2 OS=Bos taurus OX=9913 GN=RIBC2 PE=2 SV=2)

HSP 1 Score: 219.164 bits (557), Expect = 1.804e-66
Identity = 146/350 (41.71%), Postives = 215/350 (61.43%), Query Frame = 2
Query:  149 IFNSKIRQIGIDKQALAQQVKDKKERECIERNVELAYAADAMRNDSIATLLGRRQLDDIRELNKILNEFRSLHQQPETRREWDLYDPDALKKDKPARVCDDDPRCGLASMQKFDGEDLNNKARNKYQKGQVNDWNERQMADKERAEQAQREADRLYDLKRREMDERACNLAAAEEACRRAMNIANSQYNLALAREMNERARLKNQQENDDTLTAIANALYSDLLTANPAQAISAFGPGRIVPDRFKGMTPEQLKEIFKEQEDQIKDNKRRQMEEDLRNKEWDRQRXXXXXXXXXXXXXXXXXXXXXXXHVADENLCLSKEQKLHQEFLNREVYTNQPTAAYFMQFNTTSR 1198
            IFN++ R IG D  A   QV D+  +   E+  + A+AA+  +ND IA L   R+  D + L K +N+F+   Q+PETRRE+DL DP ALKKD+PAR  D D R  ++ MQKF GEDLN   R K+Q+ Q  +W+ +Q  ++    + Q+ A+ LY   R + DE A +L   E A R+A+     ++N   A E  E+   + +QE +D L  I+N L  DLL+ NP QA S+FGP R+VPDR+KGM+ EQL+EI   Q  Q+++  R Q EE  R+ +WDR+R+ +A+A L+ E++++R    L + +   NL L++EQ L ++ + +E+ TN  T  YF QFNT SR
Sbjct:   29 IFNARNRIIGGDTTAWDAQVCDQNIKAATEKARDEAFAAEMRQNDKIACLSENRERRDRKNLCKAINDFQQSFQRPETRREFDLSDPLALKKDRPARQSDYDARNTISGMQKFMGEDLNFHLRKKFQEEQNREWSLQQQKEQMIGRENQKCAEDLYLKTRLQFDETAKHLQNLETATRKAVCATVKEFNKNQALESAEKKIQERKQEQEDNLAEISNMLRGDLLSENPQQAASSFGPHRVVPDRWKGMSQEQLEEIRLVQRQQVQEKLRLQEEERQRDMDWDRRRIQKARATLLFEQQQQRLQRGLRRALDCSNLSLAREQLLQKKHM-KELCTNHATEDYFTQFNTGSR 377          
BLAST of RIB43A protein vs. UniProt/SwissProt
Match: sp|Q6AXN9|RIBC2_RAT (RIB43A-like with coiled-coils protein 2 OS=Rattus norvegicus OX=10116 GN=Ribc2 PE=2 SV=2)

HSP 1 Score: 214.927 bits (546), Expect = 1.055e-64
Identity = 139/350 (39.71%), Postives = 213/350 (60.86%), Query Frame = 2
Query:  149 IFNSKIRQIGIDKQALAQQVKDKKERECIERNVELAYAADAMRNDSIATLLGRRQLDDIRELNKILNEFRSLHQQPETRREWDLYDPDALKKDKPARVCDDDPRCGLASMQKFDGEDLNNKARNKYQKGQVNDWNERQMADKERAEQAQREADRLYDLKRREMDERACNLAAAEEACRRAMNIANSQYNLALAREMNERARLKNQQENDDTLTAIANALYSDLLTANPAQAISAFGPGRIVPDRFKGMTPEQLKEIFKEQEDQIKDNKRRQMEEDLRNKEWDRQRXXXXXXXXXXXXXXXXXXXXXXXHVADENLCLSKEQKLHQEFLNREVYTNQPTAAYFMQFNTTSR 1198
            IF+++ R IG D QA   QV+++K +E  E+  +  +AA+   ND +  ++  R+L   ++L + +N+F+   Q+PETRRE+DL DP ALKK+ PARV D+D R  ++ MQKF GEDLN + R + QK Q  +W+ +Q  + ERA+   + A+ L+     + DE A +L   E   R+A+  A  ++N     E+ ER R   QQE +D ++ I N L+ DLL+ NP QA S FGP  ++ DR+KGM  EQL+EI+   + QI +  R Q EE   N +WD +R  +A A+L+ E++++R + E  + +   NL L+K+Q L +  L+    ++QPT  YF QFNT SR
Sbjct:   29 IFDARNRIIGGDTQAWDVQVRNQKIKEVTEKARDETFAAEMRHNDKVMCIMHDRELRHRKQLCRAINDFQQRFQKPETRREFDLSDPLALKKELPARVSDNDMRNTISGMQKFMGEDLNFQERKRIQKEQNREWSLQQHGEWERAQAEHKLAEHLHTQTELKFDEAARDLQRLEITTRKAVCAAVKEFNKKQVVELAERKRQVKQQEQEDNMSEITNLLHGDLLSENPQQAASNFGPRHVMLDRWKGMNREQLEEIWSTWKQQIHEKLRLQEEERQHNMDWDLRRTRKAHASLLQERQQQRLLREQRRALDCSNLSLAKQQYLQKRQLD-AAPSSQPTEDYFSQFNTRSR 377          
BLAST of RIB43A protein vs. UniProt/SwissProt
Match: sp|Q9D4Q1|RIBC2_MOUSE (RIB43A-like with coiled-coils protein 2 OS=Mus musculus OX=10090 GN=Ribc2 PE=2 SV=3)

HSP 1 Score: 207.994 bits (528), Expect = 4.139e-62
Identity = 135/350 (38.57%), Postives = 213/350 (60.86%), Query Frame = 2
Query:  149 IFNSKIRQIGIDKQALAQQVKDKKERECIERNVELAYAADAMRNDSIATLLGRRQLDDIRELNKILNEFRSLHQQPETRREWDLYDPDALKKDKPARVCDDDPRCGLASMQKFDGEDLNNKARNKYQKGQVNDWNERQMADKERAEQAQREADRLYDLKRREMDERACNLAAAEEACRRAMNIANSQYNLALAREMNERARLKNQQENDDTLTAIANALYSDLLTANPAQAISAFGPGRIVPDRFKGMTPEQLKEIFKEQEDQIKDNKRRQMEEDLRNKEWDRQRXXXXXXXXXXXXXXXXXXXXXXXHVADENLCLSKEQKLHQEFLNREVYTNQPTAAYFMQFNTTSR 1198
            IF+++ R IG D QA   QV+D+K +E  ++    A+AA+   ND +  +   R+    ++L + +N+F+   Q+PETRRE+DL DP AL+K+ PAR+ D+D R  ++ MQKF GEDLN + R ++QK Q  +W  +Q  ++E+A      A+ L+   R + DE A  L   E + R+ +  A   +N     E+ ER R + QQE +D +T I N L+ DLL+ NP    S+FG  R+V DR+KGM  EQL+EI+  Q+ QI++  R Q EE   + +WD +R+ +A A+L+ E++++R + E  + +   NL L+++Q L ++ +N    ++QPT  YF QFNT SR
Sbjct:   29 IFDARNRIIGGDTQAWDFQVRDQKIKEITDKARHEAFAAEMKHNDKVMCMAHDREQRHRKQLCRAINDFQQNFQKPETRREFDLSDPLALQKELPARISDNDMRNTISGMQKFMGEDLNFQERRRFQKEQSREWFLQQHGEREKARADHLLAEHLHTQTRLKFDETARELMKLEGSTRKEVCAAVKAFNKNQVVELTERKRQEKQQEQEDNMTEITNLLHGDLLSENPRPVASSFGSHRVVLDRWKGMNREQLEEIWFTQKRQIQEKLRLQEEERQHSMDWDLRRIRKAHASLLHERQQQRLLREQRRALDCSNLNLARQQYLQKKQMN-TASSSQPTEDYFSQFNTRSR 377          
BLAST of RIB43A protein vs. UniProt/SwissProt
Match: sp|Q4R698|RIBC1_MACFA (RIB43A-like with coiled-coils protein 1 OS=Macaca fascicularis OX=9541 GN=RIBC1 PE=2 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 1.200e-55
Identity = 155/380 (40.79%), Postives = 214/380 (56.32%), Query Frame = 2
Query:   62 MYKLDLPVDQKEAAXXXXXXXXXXXXXXXIFNSKIRQIGIDKQALAQQVKDKKERECIERNVELAYAADAMRNDSIATLLGRRQLDDIRELNKILNEFRSLHQQPETRREWDLYDPDALKKDKPARVCDDDPRCGLASMQKFDGEDLNNKARNKYQKGQVNDWNERQMADKERAEQAQREADRLYDLKRREMDERACNLAAAEEACRRAMNIANSQYNLALAREMNERARLKNQQENDDTLTAIANALYSDLLTANPAQAISAFGPGRIVPDRFKGMTPEQLKEIFKEQEDQ-IKDNKRRQMEEDLRNKEWDRQRXXXXXXXXXXXXXXXXXXXXXXXHVADENLCLSKEQKLHQEFLNREVYTNQPTAAYFMQFNTTSR 1198
            MY ++   D KEAA I  RR+RE++RQ+R FN + R +G+D QAL  QV D+K RE  ER+ E AY    ++ D +  +L + + D  R L K + EFR   QQ +  RE+ L+DPD + K  P  +   +   G AS+Q F GEDL+   R + Q+GQ     ERQ  ++++A+  +  AD L +  R  MD +A +LA  EE+CR AM  A +  N A A     R R + Q+E    L  I +   SDLLT NP  A     P R++P  +KGMTPEQ   I KEQE Q  K    RQ E+ L + EW  Q ++ A+A L LE++E        + +   N  L+ EQK  Q++LN  +YTNQPTA Y  QFNT+SR
Sbjct:    1 MYNINQSTDTKEAAAIEARRNREKERQNRFFNVRNRVMGVDVQALNNQVGDRKLREAAERSKEAAYGTSQVQYDVVVQMLEKEEADRTRRLAKKVQEFREQKQQLKNGREFSLWDPDQVWKGLPTYLSYSNTYPGPASLQYFSGEDLDRATRLRMQQGQFRYNLERQQQEQQQAKVDENCADALSNQLRLAMDAQATHLARLEESCRAAMMCAMANANKAQAAVQAGRQRCERQREQKANLAEIRHQSTSDLLTENPQVAQHRTAPHRVLPYCWKGMTPEQRAAIRKEQEVQRSKKEAHRQAEKTL-DTEWKSQTMSSAQALLELEEQERELCAVFQRGLGSFNQQLANEQKAQQDYLNSVIYTNQPTAQYHRQFNTSSR 379          
BLAST of RIB43A protein vs. TrEMBL
Match: A0A2T7NT11 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_14772 PE=4 SV=1)

HSP 1 Score: 431.024 bits (1107), Expect = 9.256e-147
Identity = 245/379 (64.64%), Postives = 294/379 (77.57%), Query Frame = 2
Query:   62 MYKLDLPVDQKEAAXXXXXXXXXXXXXXXIFNSKIRQIGIDKQALAQQVKDKKERECIERNVELAYAADAMRNDSIATLLGRRQLDDIRELNKILNEFRSLHQQPETRREWDLYDPDALKKDKPARVCDDDPRCGLASMQKFDGEDLNNKARNKYQKGQVNDWNERQMADKERAEQAQREADRLYDLKRREMDERACNLAAAEEACRRAMNIANSQYNLALAREMNERARLKNQQENDDTLTAIANALYSDLLTANPAQAISAFGPGRIVPDRFKGMTPEQLKEIFKEQEDQIKDNKRRQMEEDLRNKEWDRQRXXXXXXXXXXXXXXXXXXXXXXXHVADENLCLSKEQKLHQEFLNREVYTNQPTAAYFMQFNTTSR 1198
            MYKLDLPVD KEAA I  RR  EE+R+SRIFN+K R IG+D+QA+ QQ+ DKK++E  E+    A+AADA+RND IA +L RRQ +DIR LN+  NEFR+LHQQP  RREWDLYDPDALKKDKPARV DDDPRCG +S+QKFDGEDLNNKAR KYQ+ Q   W   QM +KE+A+Q Q +A+RLY+LK RE+DERAC LA AEE CRRA+  A   +N A  RE  E+ RLK QQE DD +T IAN +Y D+LT NP+ A SA+GP R++PDR+KGMTP QL++I K QE Q  +N+R + EEDLRNKEWDRQR+A A+AAL+LE+  ERK  EL K  ADEN  LS EQ  HQEFL++EVYTN PTAAYFMQFNTT+R
Sbjct:    1 MYKLDLPVDYKEAAAIERRRQMEEERKSRIFNAKTRIIGVDRQAIDQQMFDKKQQEEFEQKRHEAFAADAVRNDLIAQMLERRQAEDIRALNRAENEFRALHQQPSCRREWDLYDPDALKKDKPARVHDDDPRCGTSSLQKFDGEDLNNKARTKYQQEQARQWLMEQMIEKEQAKQNQNKANRLYELKMRELDERACQLAKAEEECRRAIEAARKDFNAAQDRERKEKERLKKQQELDDNMTEIANHIYGDILTENPSVAHSAWGPHRVIPDRWKGMTPSQLEDIRKAQERQRLENERLRQEEDLRNKEWDRQRVANARAALLLERATERKRRELEKQQADENRRLSHEQHAHQEFLDKEVYTNPPTAAYFMQFNTTTR 379          
BLAST of RIB43A protein vs. TrEMBL
Match: A0A2C9JD92 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106054123 PE=4 SV=1)

HSP 1 Score: 428.328 bits (1100), Expect = 1.284e-145
Identity = 239/379 (63.06%), Postives = 298/379 (78.63%), Query Frame = 2
Query:   62 MYKLDLPVDQKEAAXXXXXXXXXXXXXXXIFNSKIRQIGIDKQALAQQVKDKKERECIERNVELAYAADAMRNDSIATLLGRRQLDDIRELNKILNEFRSLHQQPETRREWDLYDPDALKKDKPARVCDDDPRCGLASMQKFDGEDLNNKARNKYQKGQVNDWNERQMADKERAEQAQREADRLYDLKRREMDERACNLAAAEEACRRAMNIANSQYNLALAREMNERARLKNQQENDDTLTAIANALYSDLLTANPAQAISAFGPGRIVPDRFKGMTPEQLKEIFKEQEDQIKDNKRRQMEEDLRNKEWDRQRXXXXXXXXXXXXXXXXXXXXXXXHVADENLCLSKEQKLHQEFLNREVYTNQPTAAYFMQFNTTSR 1198
            MYKLDLPVD K+AA I  RR+ EE+R++RIFN+K+RQIGIDKQA+ QQ+ D+K+ E  ER    A+AADA+RND IA LL +RQ  DIR LN+ LNEFR+LHQQP  RREWDLYDPD LKKDKPARV DDDPRCG+AS+QKFDGEDLN+KAR K Q  Q   W+E QM ++ERA + Q EADRLY+LK+RE+DERA  L  AEE CR+A+++A + YN AL  E  ER RLK QQE DD +T IAN ++ D+LT NPA A SAFGP R++PDR+KGM+P+QL+EI KEQ  Q+ + +R + EE+LRN+E+DRQ  A A+AAL++EKE ERK  E+ K  ADEN  L++EQK H +FLN+EVYTN PT+AYFMQFNT++R
Sbjct:    1 MYKLDLPVDYKQAAAIERRRAMEEERKTRIFNAKVRQIGIDKQAIDQQIFDRKQMEDYERKRHEAFAADALRNDRIAVLLEKRQEQDIRALNEALNEFRALHQQPNQRREWDLYDPDGLKKDKPARVHDDDPRCGVASIQKFDGEDLNSKARKKLQNEQSRKWHEAQMRERERARRNQEEADRLYELKQRELDERAIQLQQAEEECRKAIDMATASYNDALKNEQRERERLKRQQEQDDNMTEIANHVFGDILTENPAVAQSAFGPHRVIPDRWKGMSPQQLEEIRKEQARQMAEAERLRQEEELRNREYDRQASANARAALLIEKELERKRKEIEKAQADENRRLAQEQKAHIDFLNKEVYTNSPTSAYFMQFNTSTR 379          
BLAST of RIB43A protein vs. TrEMBL
Match: A0A504YEC3 (RIB43A domain with coiled coils 1 OS=Fasciola gigantica OX=46835 GN=FGIG_09494 PE=4 SV=1)

HSP 1 Score: 423.32 bits (1087), Expect = 1.114e-143
Identity = 229/379 (60.42%), Postives = 305/379 (80.47%), Query Frame = 2
Query:   62 MYKLDLPVDQKEAAXXXXXXXXXXXXXXXIFNSKIRQIGIDKQALAQQVKDKKERECIERNVELAYAADAMRNDSIATLLGRRQLDDIRELNKILNEFRSLHQQPETRREWDLYDPDALKKDKPARVCDDDPRCGLASMQKFDGEDLNNKARNKYQKGQVNDWNERQMADKERAEQAQREADRLYDLKRREMDERACNLAAAEEACRRAMNIANSQYNLALAREMNERARLKNQQENDDTLTAIANALYSDLLTANPAQAISAFGPGRIVPDRFKGMTPEQLKEIFKEQEDQIKDNKRRQMEEDLRNKEWDRQRXXXXXXXXXXXXXXXXXXXXXXXHVADENLCLSKEQKLHQEFLNREVYTNQPTAAYFMQFNTTSR 1198
            MYKLDLP+D KEAAII+ RR RE+ RQSRIFN+++RQIG+D++AL QQ ++++++E +E+  ELAYA+DA+RND I  +L  RQ  D RE+N+ LN FRSLHQQPE+RRE+DLYDP+ALKKD+PARV DDDPRCG++S+QKFDGEDLN +AR +YQ+ Q+ +W ERQ+ ++ RAE+ Q+EA+RL  LKRRE+D+RAC LA AEE CRRA+N+A  ++N AL  E  +R   K +QE DD +T I NA+Y D+LT NPAQAISA GP R+VPDRFKGM+ EQL EI +EQ++Q+++ +R + EE LR++EWD+QR+  AK  L+LE+E ER   E+SK +ADENL L+++QK  +++L+ EVYTNQPTA YF QFNTTSR
Sbjct:    1 MYKLDLPIDHKEAAIIDARRKREQARQSRIFNARVRQIGVDEEALKQQAEERRKKELLEKERELAYASDAIRNDKIVCILQARQERDQREINQALNTFRSLHQQPESRREFDLYDPEALKKDRPARVSDDDPRCGVSSLQKFDGEDLNQQARCQYQREQMQNWFERQIEERRRAEEVQKEAERLNALKRRELDQRACELAKAEEDCRRAINMAVQRFNDALRVEQEQRRLQKAKQEQDDNMTEICNAIYGDMLTENPAQAISALGPNRVVPDRFKGMSKEQLAEIHREQQEQMREKERLRAEEKLRDEEWDQQRVKSAKLGLLLEREIERSSKEISKRLADENLKLAEDQKAFRDYLDHEVYTNQPTADYFTQFNTTSR 379          
BLAST of RIB43A protein vs. TrEMBL
Match: A0A5K4F881 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 418.313 bits (1074), Expect = 9.659e-142
Identity = 230/379 (60.69%), Postives = 296/379 (78.10%), Query Frame = 2
Query:   62 MYKLDLPVDQKEAAXXXXXXXXXXXXXXXIFNSKIRQIGIDKQALAQQVKDKKERECIERNVELAYAADAMRNDSIATLLGRRQLDDIRELNKILNEFRSLHQQPETRREWDLYDPDALKKDKPARVCDDDPRCGLASMQKFDGEDLNNKARNKYQKGQVNDWNERQMADKERAEQAQREADRLYDLKRREMDERACNLAAAEEACRRAMNIANSQYNLALAREMNERARLKNQQENDDTLTAIANALYSDLLTANPAQAISAFGPGRIVPDRFKGMTPEQLKEIFKEQEDQIKDNKRRQMEEDLRNKEWDRQRXXXXXXXXXXXXXXXXXXXXXXXHVADENLCLSKEQKLHQEFLNREVYTNQPTAAYFMQFNTTSR 1198
            MYKLDLP+D KEAA I  RR RE++RQ RIF+S+IRQIGID +AL  QV++KK RE +E+  +L YAADA RND IA LL +RQ DD REL K LNEFRS+HQQPE+RRE+DLYDP+A K D+PARV DDDPRCG+AS+QKFDGEDLN KAR KYQ+ Q+ +W +RQ+ ++ RAE A++EADRLYDLKRRE+D+RAC L  AEE CRRA+N+A  +YN  L  E +++A LK +Q  DD +T I NA+Y D L+ NPAQAISAFG  RI+P+R+KGMT EQ+K+I K QE+QIK+ +R+   E   ++EWD Q L  A+  L++E+E ER   E+++ VA++NL L++EQK  Q++LN+E+YTNQPT  YF QFNTTSR
Sbjct:    1 MYKLDLPIDTKEAAAIELRRRREKERQERIFDSRIRQIGIDDEALKHQVEEKKLRELVEKQRDLVYAADAARNDRIACLLEKRQHDDERELAKNLNEFRSIHQQPESRREFDLYDPNAFKLDRPARVSDDDPRCGVASLQKFDGEDLNLKARMKYQREQLQNWFDRQIEERNRAENAKKEADRLYDLKRRELDQRACELQKAEEECRRAINVAMQRYNKLLKEESDQKALLKAKQTEDDNMTEICNAIYGDFLSENPAQAISAFGINRIIPERYKGMTLEQIKDIRKYQEEQIKEKQRQLAREKQGDEEWDNQILKSARLGLLIEREIERSTREINRKVAEKNLQLAQEQKSFQDYLNKELYTNQPTGQYFTQFNTTSR 379          
BLAST of RIB43A protein vs. TrEMBL
Match: A0A1S3JND9 (RIB43A-like with coiled-coils protein 2 OS=Lingula unguis OX=7574 GN=LOC106174590 PE=4 SV=1)

HSP 1 Score: 417.927 bits (1073), Expect = 1.465e-141
Identity = 230/378 (60.85%), Postives = 295/378 (78.04%), Query Frame = 2
Query:   65 YKLDLPVDQKEAAXXXXXXXXXXXXXXXIFNSKIRQIGIDKQALAQQVKDKKERECIERNVELAYAADAMRNDSIATLLGRRQLDDIRELNKILNEFRSLHQQPETRREWDLYDPDALKKDKPARVCDDDPRCGLASMQKFDGEDLNNKARNKYQKGQVNDWNERQMADKERAEQAQREADRLYDLKRREMDERACNLAAAEEACRRAMNIANSQYNLALAREMNERARLKNQQENDDTLTAIANALYSDLLTANPAQAISAFGPGRIVPDRFKGMTPEQLKEIFKEQEDQIKDNKRRQMEEDLRNKEWDRQRXXXXXXXXXXXXXXXXXXXXXXXHVADENLCLSKEQKLHQEFLNREVYTNQPTAAYFMQFNTTSR 1198
            YKLDLP+D KEAA I  RR+ EE+R+SRIFN+K+R IGID+QA+ QQV+D+KE E +ER    A+AADA+R D IA LL +RQ  DIR+LN  LNEFR LHQQP  RREWDLYDPD+LKKDKPARV DDDPRCG++ +QKFDGEDLNNKAR KYQ+ Q+ +W+ERQ  ++E+AE+ QR+ADRLY+LK RE+DERA  L  AEEACRRA+N A   +N ALA E  E+ RL  QQE DD  T +AN +Y D+LT NPA A SA+GP R++ DR+KGM+P+QL +I K Q+ Q K+N+R + EEDLRNKEWD  R+A A+A +++E+E +R+  E+ K  A+EN  L+ EQK  +++L +EVYTN PTA+YFMQFNT++R
Sbjct:    3 YKLDLPIDLKEAASIERRRNMEEERKSRIFNAKVRLIGIDRQAVEQQVRDRKEMEEMERRRHEAFAADAVRCDRIAELLTKRQEHDIRQLNHALNEFRQLHQQPSNRREWDLYDPDSLKKDKPARVSDDDPRCGISGLQKFDGEDLNNKARTKYQQEQLREWSERQKKEREQAEENQRKADRLYELKMRELDERAMELQKAEEACRRAINHAQKDFNHALAAEQAEKRRLNKQQEEDDNATELANHIYGDVLTENPAVAQSAWGPHRVITDRWKGMSPKQLDDIKKTQDRQRKENERLRQEEDLRNKEWDAHRVAHARAGMLIERELDRQKKEILKQQAEENRRLASEQKASKDYLYKEVYTNPPTASYFMQFNTSTR 380          
BLAST of RIB43A protein vs. Ensembl Cavefish
Match: ribc2 (RIB43A domain with coiled-coils 2 [Source:NCBI gene;Acc:103029086])

HSP 1 Score: 158.303 bits (399), Expect = 3.040e-44
Identity = 141/379 (37.20%), Postives = 219/379 (57.78%), Query Frame = 2
Query:   62 MYKLDLPVDQKEAAXXXXXXXXXXXXXXXIFNSKIRQIGIDKQALAQQVKDKKERECIERNVELAYAADAMRNDSIATLLGRRQLDDIRELNKILNEFRSLHQQPETRREWDLYDPDALKKDKPARVCDDDPRCGLASMQKFDGEDLNNKARNKYQKGQVNDWNERQMADKERAEQAQREADRLYDLKRREMDERACNLAAAEEACRRAMNIANSQYNLALAREMNERARLKNQQENDDTLTAIANALYSDLLTANPAQAISAFGPGRIVPDRFKGMTPEQLKEIFKEQEDQIKDNKRRQMEEDLRNKEWDRQRXXXXXXXXXXXXXXXXXXXXXXXHVADENLCLSKEQKLHQEFLNREVYTNQPTAAYFMQFNTTSR 1198
            M  + LP D+  AA ++ R++RE  R+ R+FN+K+R IG+DK+AL  QVK+++++E  E      YA   +R+D  A +L  RQ  D R L + + +FRS  Q P +RRE+DL D + LKK    R+       GLA      GEDL ++ R + Q  Q+ DW+ +Q  + E+ E+ Q++ D  YD  R  +D RA  L   EE  +RA  IA   +NLALA E +E+   + ++E ++    I N L  +LL  +  Q+    G  R+  D +KGMTP+QL      Q+ Q +D +R ++E+   + + DR+RLA A+AAL+LE+++ R   EL + + + N  L++ Q   ++ L +EV+ N P   YF QFNT+SR
Sbjct:    1 MNPVQLPSDRLSAAHLDQRQTRELLRKERVFNAKLRTIGVDKEALELQVKERRDKEQAEARALKEYADKLIRSDQTACVLEHRQKKDERLLEEAIVQFRSRFQHPSSRREFDLNDSEFLKKQDGVRIL-----PGLA------GEDLASRDRAQRQSEQLRDWSIQQQQELEQTEEQQKQEDLQYDQSRVALDSRAVELQKMEEEHKRANTIAIKNFNLALAAERSEQRERQRREEEENNQVEILNQLQGELLNESIEQSSRVPGRPRLRRDCYKGMTPQQLLHYSNYQKQQAEDRRRVRLEQQEEDLQQDRERLASARAALLLERQQARISKELRRSLDNTNALLAQAQHAQRKHLEKEVFINVPNERYFSQFNTSSR 368          
BLAST of RIB43A protein vs. Ensembl Cavefish
Match: ribc1 (RIB43A domain with coiled-coils 1 [Source:NCBI gene;Acc:103021611])

HSP 1 Score: 155.992 bits (393), Expect = 3.007e-43
Identity = 125/388 (32.22%), Postives = 213/388 (54.90%), Query Frame = 2
Query:   62 MYKLDLPVDQKEAAXXXXXXXXXXXXXXXIFNSKIRQIGIDKQALAQQVKDKKERECIERNVELAYAADAMRNDSIATLLGRRQLDDIRELNKILNEFRSLHQQPETRREWDLYDPDALKKDKPARVCDDDPRCGLASMQKFDGEDLNNKARNKYQKGQVNDWNER----QMADKERAEQAQREADRLYDLKRREMDERACNLAAAEEACRRAMNIANSQYNLALAREMNERARLKNQQENDDTLTAIANALYSDLLTANPAQAI-----SAFGPGRIVPDRFKGMTPEQLKEIFKEQEDQIKDNKRRQMEEDLRNKEWDRQRXXXXXXXXXXXXXXXXXXXXXXXHVADENLCLSKEQKLHQEFLNREVYTNQPTAAYFMQFNTTSR 1198
            M+KLD+PVD +    +  RR+ E  R  RIF+++ R IG+D   L QQV +++ RE +E+  +L      +  D +     + +    REL + L ++R+L Q+PE  R+ D+   +   +  P+     +   G ASMQ F GE +  + + ++Q     + NER    Q  +++R E+ ++  D L D++  + +     L A EE C+RA  +A   YN A   E  ER R +  ++  + +  + + + SDLLT +P  A      SA  P R++PDR+KGM+P+QL  I++++E+Q  + + ++  E  R   W  Q+L +A+  +  E+       E    +   N  L++EQ++HQ++LN+++YTN+PTA YF QFNT+SR
Sbjct:    1 MFKLDMPVDSRVVQAVERRRAAEAARHERIFSTRSRVIGVDMIVLEQQVAERRNREEVEKQQDLELDTLRVSIDHMVLEQVKEEEQRRRELAQELQQYRALCQRPEDSRDADI---NYKHQGAPSVYLPSEESLGPASMQVFQGEGIGEEEKKRFQM----ELNERTFRAQREERDRQEKEKKHKDMLRDMELMQRNLIDVQLDALEEECKRAARMALKSYNQAQVDERRERERQEKLRQEGEGMKEVWHMVTSDLLTESPEAAAREGERSAEAP-RVLPDRWKGMSPKQLSAIYRQREEQRAEKEAQRQLEKHRELAWGLQQLEEAREQVEEERRLREMERERRLQLDKYNQQLAQEQQIHQQYLNKQIYTNRPTARYFSQFNTSSR 380          
BLAST of RIB43A protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000123.1 (pep scaffold:Pmarinus_7.0:GL480403:15296:26482:1 gene:ENSPMAG00000000109.1 transcript:ENSPMAT00000000123.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.6254 bits (161), Expect = 2.107e-13
Identity = 52/150 (34.67%), Postives = 75/150 (50.00%), Query Frame = 2
Query:  149 IFNSKIRQIGIDKQALAQQVKDKKERECIERNVELAYAADAMRNDSIATLLGRRQLDDIRELNKILNEFRSLHQQPETRREWDLYDPDALKKDKPARVCDDDPRCGLASMQKFDGEDLNNKARNKYQKGQVNDWNERQMADKERAEQAQR 598
            IFN K+R IG+D   L +QV+ ++ RE  E+  E A+A  A+R+D IA LL  RQ ++ R L++ L ++ +  Q    R +     P  +       V D+    GL S   F GEDL    R   QK Q   W   Q  +K RA+  +R
Sbjct:   26 IFNPKVRTIGVDLDGLNEQVEQRRFREQQEKTREEAFADAAIRHDRIAILLDERQREESRALDRSLAQYWARCQSASDRSQ----PPAGVVGGDSDVVADEGAVSGLRS---FAGEDLEAGERRGLQKEQQRRWLLEQQEEKRRAQDERR 168          
BLAST of RIB43A protein vs. Ensembl Nematostella
Match: EDO49672 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFW4])

HSP 1 Score: 346.28 bits (887), Expect = 2.948e-117
Identity = 217/379 (57.26%), Postives = 274/379 (72.30%), Query Frame = 2
Query:   62 MYKLDLPVDQKEAAXXXXXXXXXXXXXXXIFNSKIRQIGIDKQALAQQVKDKKERECIERNVELAYAADAMRNDSIATLLGRRQLDDIRELNKILNEFRSLHQQPETRREWDLYDPDALKKDKPARVCDDDPRCGLASMQKFDGEDLNNKARNKYQKGQVNDWNERQMADKERAEQAQREADRLYDLKRREMDERACNLAAAEEACRRAMNIANSQYNLALAREMNERARLKNQQENDDTLTAIANALYSDLLTANPAQAISAFGPGRIVPDRFKGMTPEQLKEIFKEQEDQIKDNKRRQMEEDLRNKEWDRQRXXXXXXXXXXXXXXXXXXXXXXXHVADENLCLSKEQKLHQEFLNREVYTNQPTAAYFMQFNTTSR 1198
            MYKLDLPVD KE A I  RR+RE QRQSRIFN+++R IGID QAL  QV D+K +E  E+    A+AAD  RND I  L+ +RQ  DIRELNK +N FR  HQ+PE  REW+L DPD LKKDKPARV DDDPRCG++S+QKF GEDLN+K+R K Q+ Q+ +W ++Q  +K + +  Q  AD LYDLK RE+D+RAC LA AE  CRRA+N A   +NLAL +E   +  L+ QQE DD +T I+N ++ D+LT NP  A SAFG  R++ DR+KGM+P QL EI   Q+ Q+K+ +R + EE+ R KE+ R  L QAKA +++E+E ERK  +L K  A ENL LS EQK HQE++N+EVYTN PTAAYFMQFNTTSR
Sbjct:    1 MYKLDLPVDMKETAAIERRRNRELQRQSRIFNARVRTIGIDLQALETQVADRKRQEVEEQRRHNAFAADMKRNDMICALMQQRQEHDIRELNKEVNTFRQEHQRPEDTREWELNDPDCLKKDKPARVSDDDPRCGISSLQKFVGEDLNSKSRRKLQEEQMREWVKQQSNEKNQDKANQSYADYLYDLKARELDQRACELAQAESDCRRAINQATKDFNLALMKERQAKEDLEKQQELDDNMTEISNHVFGDMLTENPDVAQSAFGGHRVITDRWKGMSPAQLAEIRYIQQQQLKEKERLKQEEEEREKEYQRLLLTQAKAGILMERELERKRKQLEKDQAQENLRLSAEQKSHQEYVNKEVYTNPPTAAYFMQFNTTSR 379          
BLAST of RIB43A protein vs. Ensembl Nematostella
Match: EDO27826 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T868])

HSP 1 Score: 154.451 bits (389), Expect = 6.977e-46
Identity = 89/140 (63.57%), Postives = 105/140 (75.00%), Query Frame = 2
Query:   62 MYKLDLPVDQKEAAXXXXXXXXXXXXXXXIFNSKIRQIGIDKQALAQQVKDKKERECIERNVELAYAADAMRNDSIATLLGRRQLDDIRELNKILNEFRSLHQQPETRREWDLYDPDALKKDKPARVCDDDPRCGLASMQ 481
            MYKLDLPVD KE A I  RR+RE QRQSRIFN+++R IGID QAL  QV D+K +E  E+    A+AAD  RND I  L+ +RQ  DIRELNK +N FR  HQ+PE  REW+L DPD LKKDKPARV DDDPRCG++S+Q
Sbjct:    1 MYKLDLPVDMKETAAIERRRNRELQRQSRIFNARVRTIGIDLQALETQVADRKRQEVEEQRRHNAFAADMKRNDMICALMQQRQEHDIRELNKEVNTFRQEHQRPEDTREWELNDPDCLKKDKPARVSDDDPRCGISSLQ 140          
BLAST of RIB43A protein vs. Ensembl Medaka
Match: ribc1 (RIB43A domain with coiled-coils 1 [Source:NCBI gene;Acc:101166625])

HSP 1 Score: 114.775 bits (286), Expect = 3.885e-28
Identity = 119/393 (30.28%), Postives = 206/393 (52.42%), Query Frame = 2
Query:   62 MYKLDLPVDQKEAAXXXXXXXXXXXXXXXIFNSKIRQIGIDKQALAQQVKDKKERECIERNVELAYAADAMRNDSIATLLGR--RQLDDIRELNKILNEFRSLHQQPET---------RREWDLYDPDALKKDKPARVCDDDPRCGLASMQKFDGEDLNNKARNKYQKGQVNDWNERQMADKERAEQAQREADRLYDLKRREMDERACNLAAAEEACRRAMNIANSQYNLALAREMNERARLKNQQENDDTLTAIANALYSDLLT--ANPAQA-ISAFGPGRIVPDRFKGMTPEQLKEIFKEQEDQIKDNKRRQMEEDLRNKEWDRQRXXXXXXXXXXXXXXXXXXXXXXXHVADENLCLSKEQKLHQEFLNREVYTNQPTAAYFMQFNTTSR 1198
            M+K D   DQ     +  RRS E  R++RIFN+++R +G+D  AL QQVK+K ++E +E+    + A + ++      LL +   + +  R L K L  + +  Q+ +T         +  +D+  P+A              + G ASMQ+F GED N K   + Q        + QM +  R ++ +   D L   +    ++   + AA EE  R+A  IA   +N A A E  E  + ++++E  + L  + + + SD+LT  A+  +  +    P +I+PDR+KG+ PEQL+   +++E Q +  +R+     +++  W+ ++L  ++ A   E+ +  KM EL   +   N+ L++EQ  HQE+LN+++YTN+PT  YF QFNT+SR
Sbjct:    1 MFKGDARQDQSLTKAVEGRRSAEAARKARIFNTRLRVMGLDLDALNQQVKEKLQQENLEKLQ--SNALETLKKSQDEALLQQDNNEKEKRRALQKDLTHYWATQQRLDTQNAGLQNGLKGAFDITTPEA--------------KLGPASMQRFQGEDANWKQMRREQIRMTERALKGQMDENIRRQERENHKDMLEKQELLHQNQEQLHKAAMEEERRKAARIALHSFNQAQAAERAESLKEQHRREETENLAEMWHTMTSDMLTECADAGERDVGGGKPPQILPDRWKGIRPEQLRSFQRDREQQCQQKQRQCDAGKIQDAAWNLEQLTLSRKAEEEERRKAEKMRELRIQMDQYNMQLAREQSAHQEYLNKKLYTNKPTKDYFYQFNTSSR 377          
BLAST of RIB43A protein vs. Ensembl Medaka
Match: ribc2 (RIB43A-like with coiled-coils protein 2 [Source:NCBI gene;Acc:101155347])

HSP 1 Score: 100.908 bits (250), Expect = 2.863e-23
Identity = 105/352 (29.83%), Postives = 174/352 (49.43%), Query Frame = 2
Query:  149 IFNSKIRQIGIDKQALAQQVKDKKERECIERNVELAYAADAMRNDSIATLLGRRQLDDIRELNKILNEFRSLHQQPETRREWDLYDPDALKKDKPARVCDDDPRCGLASMQKFDGEDLNNKARNKYQKGQVNDWNERQMADKERAEQAQREADRLYDLKRREMDERACNLAAAEEACRRAMNIANSQYNLALAREMNERARLKNQQEND-DTLTAIANALYSDLLTANPAQAISAFGPGRIV-PDRFKGMTPEQLKEIFKEQEDQIKDNKRRQMEEDLRNKEWDRQRXXXXXXXXXXXXXXXXXXXXXXXHVADENLCLSKEQKLHQEFLNREVYTNQPTAAYFMQFNTTSR 1198
            +F+ K+R +G+D + L  QV++KK +E   +  + A+ AD +     A +L  RQ      L K L  FRS +QQP+TRRE+DL DPD+ KK         D +  L  +    GED    +R + QK Q+ +W  +Q A+ + +   Q E ++ ++  R E   RA      +   R+   +A   YNLA+   + E+ R K Q + D D  TA                A+  F P   V P       PE ++++ + Q+ QI++ KR +ME+   ++  +R RL  A+AAL++E+ + R   +L + +   N  L++  K  +  + R     Q   ++F++FNT SR
Sbjct:   29 VFDDKLRTMGVDTEVLDAQVQEKKRQEGKAKQEQAAFDADVLHQSKAAAVLQNRQTKQKLALQKALETFRSQNQQPQTRREFDLNDPDSWKK-----TDQSDAQMILPGL---VGEDPTKSSREQRQKEQLREWLIQQQAELDASRSQQEEEEQRHNRSREETLNRAGEHLHLQAERRKEAAVATQNYNLAM---IEEKHRRKQQNDPDYDQETA----------------AVPGFSPSADVRP------PPETVQQVIQFQKYQIQEKKRIEMEKKQEDERHERVRLDSARAALLMERRQARLGKQLRQQLDSANGQLAQTHKQQKPDIER----GQIDESFFLKFNTCSR 343          
BLAST of RIB43A protein vs. Ensembl Medaka
Match: ribc2 (RIB43A-like with coiled-coils protein 2 [Source:NCBI gene;Acc:101155347])

HSP 1 Score: 63.1586 bits (152), Expect = 1.177e-10
Identity = 61/215 (28.37%), Postives = 99/215 (46.05%), Query Frame = 2
Query:  149 IFNSKIRQIGIDKQALAQQVKDKKERECIERNVELAY---AADAMRNDSIATLLGRRQLDDIRELNKILNEFRSLHQQPETRREWDLYDPDALKKDKPARVCDDDPRCGLASMQKFDGEDLNNKARNKYQKGQVNDWNERQMA--DKERAEQAQREADRLYDLKRRE--MDERACNLAAAEEACRRAMNIANSQY------NLALAREMNERARL 754
            +F+ K+R +G+   A  +            R++ L Y    AD +     A +L  RQ      L K L  FRS +QQP+TRRE+DL DPD+ KK   +      P  GL       GED    +R + QK Q+ +W  +Q A  D  R ++  R+   L   +R+E  +  +  NLA   + C+  + ++   Y      ++ L R + E +++
Sbjct:   30 VFDDKLRTMGVSFPASGR-----------TRHLRLLYEQSYADVLHQSKAAAVLQNRQTKQKLALQKALETFRSQNQQPQTRREFDLNDPDSWKKTDQSDAQMILP--GLV------GEDPTKSSREQRQKEQLREWLIQQQAELDASRKQRHNRKHLHLQAERRKEAAVATQNYNLAMVNKKCQDFVQVSTCFYLVNFCFSIRLKRNIGESSKM 225          
BLAST of RIB43A protein vs. Planmine SMEST
Match: SMESG000071493.1 (SMESG000071493.1)

HSP 1 Score: 661.759 bits (1706), Expect = 0.000e+0
Identity = 378/379 (99.74%), Postives = 378/379 (99.74%), Query Frame = 2
Query:   62 MYKLDLPVDQKEAAXXXXXXXXXXXXXXXIFNSKIRQIGIDKQALAQQVKDKKERECIERNVELAYAADAMRNDSIATLLGRRQLDDIRELNKILNEFRSLHQQPETRREWDLYDPDALKKDKPARVCDDDPRCGLASMQKFDGEDLNNKARNKYQKGQVNDWNERQMADKERAEQAQREADRLYDLKRREMDERACNLAAAEEACRRAMNIANSQYNLALAREMNERARLKNQQENDDTLTAIANALYSDLLTANPAQAISAFGPGRIVPDRFKGMTPEQLKEIFKEQEDQIKDNKRRQMEEDLRNKEWDRQRXXXXXXXXXXXXXXXXXXXXXXXHVADENLCLSKEQKLHQEFLNREVYTNQPTAAYFMQFNTTSR 1198
            MYKLDLPVDQKEAAIINNRRSREEQRQSRIFNSKIRQIGIDKQALAQQVKDKKERECIERNVELAYAADAMRNDSIATLLGRRQLDDIRELNKILNEFRSLHQQPETRREWDLYDPDALKKDKPARVCDDDPRCGLASMQKFDGEDLNNKARNKYQKGQVNDWNERQMADKERAEQAQREADRLYDLKRREMDERACNLAAAEEACRRAMNIANSQYNLALAREMNERARLKNQQENDDTLTAIANALYSDLLT NPAQAISAFGPGRIVPDRFKGMTPEQLKEIFKEQEDQIKDNKRRQMEEDLRNKEWDRQRLAQAKAALVLEKEEERKMLELSKHVADENLCLSKEQKLHQEFLNREVYTNQPTAAYFMQFNTTSR
Sbjct:    1 MYKLDLPVDQKEAAIINNRRSREEQRQSRIFNSKIRQIGIDKQALAQQVKDKKERECIERNVELAYAADAMRNDSIATLLGRRQLDDIRELNKILNEFRSLHQQPETRREWDLYDPDALKKDKPARVCDDDPRCGLASMQKFDGEDLNNKARNKYQKGQVNDWNERQMADKERAEQAQREADRLYDLKRREMDERACNLAAAEEACRRAMNIANSQYNLALAREMNERARLKNQQENDDTLTAIANALYSDLLTENPAQAISAFGPGRIVPDRFKGMTPEQLKEIFKEQEDQIKDNKRRQMEEDLRNKEWDRQRLAQAKAALVLEKEEERKMLELSKHVADENLCLSKEQKLHQEFLNREVYTNQPTAAYFMQFNTTSR 379          
BLAST of RIB43A protein vs. Planmine SMEST
Match: SMESG000037028.1 (SMESG000037028.1)

HSP 1 Score: 375.941 bits (964), Expect = 1.424e-128
Identity = 220/387 (56.85%), Postives = 288/387 (74.42%), Query Frame = 2
Query:   62 MYKLDLPVDQKEAAXXXXXXXXXXXXXXXIFNSKIRQIGIDKQALAQQVKDKKERECIERNVELAYAADAMRNDSIATLLGRRQLDDIRELNKILNEFRSLHQQPETRREWDLYDPDALKKDKPARVCDDDPRCGLASMQKFDGEDLNNKARNKYQKGQVNDWNERQMADKERAEQAQREADRLYDLKRREMDERACNLAAAEEACRRAMNIANSQYNLALAREMNERARLKNQQENDDTLTAIANALYSDLLTANPAQAISAFGPGRIVPDRFKGMTPEQLKEIFKEQEDQ-----IKDNKRRQMEEDLRNKEWDRQRXXXXXXXXXXXXXXXXXXXXXXXHVADENLCLSKEQKLHQE---FLNREVYTNQPTAAYFMQFNTTSR 1198
            MYKLDLPVD KEA  I  RR +EE R+SRIFNSKIRQIG+D  AL QQ+ +K+ +E ++   +  YAA A+R D I  L+ +RQLDD++ELNK LNEFR LHQ+PE RRE+DLYDP+ LKKDKPARV DDDPRCG++S+QKFDGEDLN K RN  Q+ Q+  W E QM +K+ A +A + A RL+DLK+ E+D+RAC+L  +EE CR+A+N+A S YN AL +E   + RLK+QQE DD  T I+NAL SDLLT NP Q++SAFG  RI+PDRFKGM+ EQL++I   Q+ Q     ++  K RQ+ +DL    +D+QR+AQA++ L++E+E  R+  ++ K +A+EN+ LSK+   HQE   +LN+EVYTNQPTA YFMQFNT SR
Sbjct:    1 MYKLDLPVDLKEANQIEQRRIKEESRKSRIFNSKIRQIGVDTNALDQQINEKRSKEKLQNEFDHLYAAAAIRMDKICQLMEKRQLDDLKELNKALNEFRQLHQRPEQRREFDLYDPNGLKKDKPARVSDDDPRCGISSIQKFDGEDLNGKGRNAVQRDQMKRWLELQMNEKQNALEAGKRAQRLHDLKQIELDQRACDLLQSEEDCRKAINLALSNYNEALRQERIVKERLKHQQEEDDRKTHISNALMSDLLTENPNQSMSAFGSHRIIPDRFKGMSKEQLQQILDTQQRQRMEKMLELEKERQL-KDL----FDKQRIAQARSGLLIEREISRQKNQIDKQLAEENIKLSKD---HQEIINYLNKEVYTNQPTADYFMQFNTCSR 379          
The following BLAST results are available for this feature:
BLAST of RIB43A protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RIBC21.160e-7343.05RIB43A domain with coiled-coils 2 [Source:HGNC Sym... [more]
RIBC14.068e-5640.26RIB43A domain with coiled-coils 1 [Source:HGNC Sym... [more]
RIBC19.091e-2440.63RIB43A domain with coiled-coils 1 [Source:HGNC Sym... [more]
RIBC11.552e-2340.63RIB43A domain with coiled-coils 1 [Source:HGNC Sym... [more]
RIBC12.688e-1440.79RIB43A domain with coiled-coils 1 [Source:HGNC Sym... [more]
back to top
BLAST of RIB43A protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RIB43A protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG72643.102e-2931.06gene:FBgn0036214 transcript:FBtr0076035[more]
CG72643.102e-2931.06gene:FBgn0036214 transcript:FBtr0332130[more]
back to top
BLAST of RIB43A protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ribc25.745e-5137.71RIB43A domain with coiled-coils 2 [Source:ZFIN;Acc... [more]
ribc14.394e-4033.76RIB43A domain with coiled-coils 1 [Source:ZFIN;Acc... [more]
ribc28.859e-2335.45RIB43A domain with coiled-coils 2 [Source:ZFIN;Acc... [more]
back to top
BLAST of RIB43A protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ribc12.308e-10650.92RIB43A domain with coiled-coils 1 [Source:NCBI gen... [more]
RIBC22.591e-8044.59RIB43A domain with coiled-coils 2 [Source:NCBI gen... [more]
RIBC23.345e-7245.96RIB43A domain with coiled-coils 2 [Source:NCBI gen... [more]
back to top
BLAST of RIB43A protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Ribc25.917e-6338.57RIB43A domain with coiled-coils 2 [Source:MGI Symb... [more]
Ribc15.849e-5038.95RIB43A domain with coiled-coils 1 [Source:MGI Symb... [more]
Ribc22.731e-3037.04RIB43A domain with coiled-coils 2 [Source:MGI Symb... [more]
back to top
BLAST of RIB43A protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9H4K1|RIBC2_HUMAN5.571e-7343.05RIB43A-like with coiled-coils protein 2 OS=Homo sa... [more]
sp|Q32LJ7|RIBC2_BOVIN1.804e-6641.71RIB43A-like with coiled-coils protein 2 OS=Bos tau... [more]
sp|Q6AXN9|RIBC2_RAT1.055e-6439.71RIB43A-like with coiled-coils protein 2 OS=Rattus ... [more]
sp|Q9D4Q1|RIBC2_MOUSE4.139e-6238.57RIB43A-like with coiled-coils protein 2 OS=Mus mus... [more]
sp|Q4R698|RIBC1_MACFA1.200e-5540.79RIB43A-like with coiled-coils protein 1 OS=Macaca ... [more]
back to top
BLAST of RIB43A protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7NT119.256e-14764.64Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A2C9JD921.284e-14563.06Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A504YEC31.114e-14360.42RIB43A domain with coiled coils 1 OS=Fasciola giga... [more]
A0A5K4F8819.659e-14260.69Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A1S3JND91.465e-14160.85RIB43A-like with coiled-coils protein 2 OS=Lingula... [more]
back to top
BLAST of RIB43A protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ribc23.040e-4437.20RIB43A domain with coiled-coils 2 [Source:NCBI gen... [more]
ribc13.007e-4332.22RIB43A domain with coiled-coils 1 [Source:NCBI gen... [more]
back to top
BLAST of RIB43A protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000000123.12.107e-1334.67pep scaffold:Pmarinus_7.0:GL480403:15296:26482:1 g... [more]
back to top
BLAST of RIB43A protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RIB43A protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO496722.948e-11757.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO278266.977e-4663.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RIB43A protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ribc13.885e-2830.28RIB43A domain with coiled-coils 1 [Source:NCBI gen... [more]
ribc22.863e-2329.83RIB43A-like with coiled-coils protein 2 [Source:NC... [more]
ribc21.177e-1028.37RIB43A-like with coiled-coils protein 2 [Source:NC... [more]
back to top
BLAST of RIB43A protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000071493.10.000e+099.74SMESG000071493.1[more]
SMESG000037028.11.424e-12856.85SMESG000037028.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004949 ID=SMED30004949|Name=RIB43A protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1226bp
ATTTGTTTAATTGTATCATTTACTAAAATATTGGAAACCGTTTAAAAGAA
GTTTTTTAAATATGTATAAATTAGATCTTCCCGTTGATCAAAAAGAAGCT
GCTATAATTAATAACCGTAGATCACGGGAAGAGCAACGACAAAGTCGCAT
TTTTAATAGTAAAATACGACAAATCGGAATTGATAAACAAGCTCTTGCCC
AGCAAGTAAAAGACAAAAAAGAAAGAGAATGTATAGAAAGAAATGTGGAA
TTGGCATATGCTGCCGATGCAATGCGAAATGACTCCATTGCAACTTTACT
CGGAAGGCGTCAACTGGATGATATTCGAGAACTGAATAAAATTTTAAATG
AATTCCGTTCCTTGCATCAACAGCCTGAGACTCGCCGCGAGTGGGATTTA
TATGACCCAGATGCGTTGAAAAAAGATAAACCTGCGAGAGTTTGTGACGA
TGATCCGCGATGTGGATTGGCAAGCATGCAAAAGTTTGATGGAGAAGACT
TAAATAATAAAGCTAGAAATAAATATCAAAAAGGCCAAGTGAATGATTGG
AATGAAAGACAAATGGCAGACAAAGAACGCGCAGAACAAGCTCAAAGAGA
AGCAGATAGACTTTACGATTTAAAGAGAAGAGAAATGGATGAGCGGGCTT
GTAATTTAGCTGCTGCTGAAGAGGCATGTCGTAGAGCAATGAATATAGCA
AACAGCCAATACAATTTAGCTTTAGCTAGAGAAATGAATGAAAGAGCAAG
ATTAAAGAATCAACAAGAGAATGACGATACCTTAACTGCTATAGCAAATG
CGCTATATAGTGATTTATTAACAGCGAATCCTGCTCAAGCTATTTCTGCT
TTTGGTCCGGGAAGAATTGTTCCTGATCGATTCAAAGGAATGACGCCCGA
ACAGTTAAAAGAAATATTTAAAGAACAGGAAGATCAAATTAAGGATAATA
AAAGACGACAAATGGAAGAAGATTTAAGAAATAAAGAGTGGGATCGCCAG
AGACTGGCCCAAGCTAAAGCAGCATTAGTGCTAGAAAAGGAAGAAGAAAG
AAAAATGTTGGAACTTTCTAAACATGTTGCAGATGAAAATTTGTGTTTGA
GCAAGGAGCAGAAACTTCATCAGGAATTTTTAAATCGTGAAGTTTACACA
AATCAGCCAACCGCAGCTTATTTTATGCAGTTTAATACAACTAGTAGATA
GTTTTCAAATAAATTAAACTCAGGGA
back to top

protein sequence of SMED30004949-orf-1

>SMED30004949-orf-1 ID=SMED30004949-orf-1|Name=SMED30004949-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=380bp
MYKLDLPVDQKEAAIINNRRSREEQRQSRIFNSKIRQIGIDKQALAQQVK
DKKERECIERNVELAYAADAMRNDSIATLLGRRQLDDIRELNKILNEFRS
LHQQPETRREWDLYDPDALKKDKPARVCDDDPRCGLASMQKFDGEDLNNK
ARNKYQKGQVNDWNERQMADKERAEQAQREADRLYDLKRREMDERACNLA
AAEEACRRAMNIANSQYNLALAREMNERARLKNQQENDDTLTAIANALYS
DLLTANPAQAISAFGPGRIVPDRFKGMTPEQLKEIFKEQEDQIKDNKRRQ
MEEDLRNKEWDRQRLAQAKAALVLEKEEERKMLELSKHVADENLCLSKEQ
KLHQEFLNREVYTNQPTAAYFMQFNTTSR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005634nucleus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
PLANA:0000429neoblast
PLANA:0002030early male germ cell
PLANA:0002089reproductive organ
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR008805RIB43A
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 214..239
NoneNo IPR availableCOILSCoilCoilcoord: 298..318
NoneNo IPR availableCOILSCoilCoilcoord: 160..194
IPR008805RIB43APFAMPF05914RIB43Acoord: 4..379
e-value: 3.7E-139
score: 463.6
IPR008805RIB43APANTHERPTHR14517RIB43A-RELATEDcoord: 1..379