Zona pellucida-like domain protein

Overview
NameZona pellucida-like domain protein
Smed IDSMED30004946
Length (bp)1770
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Zona pellucida-like domain protein (SMED30004946) t-SNE clustered cells

Violin plots show distribution of expression levels for Zona pellucida-like domain protein (SMED30004946) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Zona pellucida-like domain protein (SMED30004946) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Zona pellucida-like domain protein (SMED30004946) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004946

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30004946SMESG000052888.1 SMESG000001180.1 SmedASXL_015027SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
anterior sideSMED30004946SMESG000052888.1 SMESG000001180.1 dd_Smed_v4_17259_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Zona pellucida-like domain protein vs. Ensembl Zebrafish
Match: si:dkeyp-110a12.4 (si:dkeyp-110a12.4 [Source:ZFIN;Acc:ZDB-GENE-131121-498])

HSP 1 Score: 58.5362 bits (140), Expect = 8.962e-9
Identity = 68/309 (22.01%), Postives = 125/309 (40.45%), Query Frame = 1
Query:  826 EKSPQITCTHETI-----TIMWQNSTQPFINSTLVSISPGCQNATIRDTADGGVALSMLLGDCNPLIKDETDYVFYTYNIR--------RSYLPVGITLQNPANLVAQCRVIKRNQIANKLEYKKVTAASLTYKTK---LSVVIQLYTDGSFISPLKKENKVEFNKLIFVKININNPPKDVKLNLDRCMVSPDNNFSSSAVVYLVQNMCPNEQYDVQLTYL----NPYTIGFQFRPFNFVGKQNMQIYIRCETSKCYFPNDRFCGFCKP-------RSRPKRSILYNSNKSHTI--GPIATI*SNLRCN 1665
            E +  + CT++ I     ++ + N   P     L    P C+   + +  D   ++   L DC  ++  +  ++ +T +IR        RSY+ +    + P N + Q          N     +V   ++T  T+    SV + LY D  F         +     I+VK+ +   P ++ L +DRC  +P+N+  S+     +++ CP    D  L  +     P  + F+ + F FVG     +++ C    C+       G C+P        +R +R +      SHT+  GPI  +  N+  N
Sbjct:   34 ELNETVICTNDQIRVIIPSVFFLNKEPPVYVWDLHLNDPECRGVEVEN--DYVFSIKTNLTDCGTIMASDDTHIMFTNSIRNNETDVITRSYINITFGCRYPVNYMVQQE--------NGENLIRVDVRTITLNTEEGNFSVSMLLYKDEEFQDKWTTVPSLTLEDNIYVKVYM--IPANMFLRVDRCWATPNNDPYSNIQYTFIKDSCPVLWNDQTLAVMKNGQGPEAL-FRIQMFKFVGSSYTDVFLHCNVQICH----NTGGACQPNCSADDASARTRRDV----GSSHTVSYGPIRRLKDNMENN 321          
BLAST of Zona pellucida-like domain protein vs. Ensembl Zebrafish
Match: si:dkey-9l20.3 (si:dkey-9l20.3 [Source:ZFIN;Acc:ZDB-GENE-090313-369])

HSP 1 Score: 58.151 bits (139), Expect = 3.098e-8
Identity = 41/143 (28.67%), Postives = 67/143 (46.85%), Query Frame = 1
Query: 1216 YTDGSFISPLKKENKVEFNKLIFVKININN-PPKDVKLNLDRCMVSPDNNFSSSAVVYLVQNMCPN-EQYDVQ-LTYLNPYTIGFQFRPFNFVGKQNMQIYIRCETSKCYFPNDRFCGFCKP--RSRPKRSILYNSNKSHTIG 1629
            Y D  F  P + + +V+ N++++V + +     + +   LD C  +P N+        L+   CPN E   V+ L   N  T  F FR F F G  N +I++ C+   C   N +    C+P  + R +RS+ +    S TIG
Sbjct: 15015 YHDAQFTQPYEGDVEVQVNQMMYVAVEVEGVDRRQIATVLDNCWATPVNDIQHQTRWNLIVRECPNPEDGTVEILQNGNDTTSYFSFRTFTFTGASN-RIFLHCQVHLCLVQNGKCAQSCEPGCKRRRRRSLDFQHTASITIG 15156          
BLAST of Zona pellucida-like domain protein vs. Ensembl Zebrafish
Match: cuzd1.1 (CUB and zona pellucida-like domains 1, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-131122-16])

HSP 1 Score: 55.8398 bits (133), Expect = 1.038e-7
Identity = 58/228 (25.44%), Postives = 102/228 (44.74%), Query Frame = 1
Query:  970 VALSMLLGDCNPLIKDETDYVFYTYNIRRSYLPVG-ITLQNPANLVAQCRVIKRNQIANKLEYKKVTAASLTYKTKLSVVIQLYTDGSFISPL-KKENKVEFNKLIFVKININNPPKDVKLNLDRCMVSPDNNFSSSAVVYLVQNMCPNEQ-YDVQLTYLNPYTIGFQFRPFNFVGKQNMQIYIRCETSKCYFPNDRFCGFCKP--RSRPKRSILYNSNKSH-TIGPI 1635
            V     L  C    K    +V YT N+R S    G IT Q+   L   CR+     +    E K++   ++T   + +  I  YT   F   +     +V  N  +FV++ +      + L L+ C+ SP+ N        L++N CP +  +   +  ++ Y   F FR F F+ + +  ++++C+   C  P++ +   C+   + R KRS+  + N S  T+GPI
Sbjct:  356 VVFRFPLNTCGTAKKMMNSFVSYTNNVRASPSQSGVITRQSEFLLSVGCRMEPDTIVQIFYEAKEIPNGNITGTGRFNASIAFYTSRKFNQQIYDSPYEVFLNDDLFVQVKLTRFDASLDLFLETCVASPNPNDFKDHSYDLLRNGCPRDSTFQSYINGVDQYA-QFSFRAFKFL-QTHAFVHLQCKVIIC--PDNDYNSRCRKGCQYRRKRSLGSSYNSSTVTLGPI 579          
BLAST of Zona pellucida-like domain protein vs. Ensembl Zebrafish
Match: cuzd1.2 (CUB and zona pellucida-like domains 1, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-131119-30])

HSP 1 Score: 53.5286 bits (127), Expect = 5.668e-7
Identity = 56/228 (24.56%), Postives = 102/228 (44.74%), Query Frame = 1
Query:  970 VALSMLLGDCNPLIKDETDYVFYTYNIRRSYLPVG-ITLQNPANLVAQCRVIKRNQIANKLEYKKVTAASLTYKTKLSVVIQLYTDGSFISPL-KKENKVEFNKLIFVKININNPPKDVKLNLDRCMVSPDNNFSSSAVVYLVQNMCPNEQ-YDVQLTYLNPYTIGFQFRPFNFVGKQNMQIYIRCETSKCYFPNDRFCGFCKP--RSRPKRSILYNSNKSH-TIGPI 1635
            V     L  C    K    +V YT N+R S    G IT Q+   L   CR+     +    + +++   ++T   + +  I  YT   F   +     +V  N  +FV++ +      + L L+ C+ SP+ N        L++N CP +  +   +  ++ Y   F FR F F+ + +  ++++C+   C  P++ +   C+   + R KRS+  + N S  T+GPI
Sbjct:  490 VVFRFPLNTCGTAKKMMNSFVSYTNNVRASPSQSGVITRQSEFLLSVGCRMEPDTIVQIFYKAEEIPNGNITGTGRFNASIAFYTSRKFNQQIYDSPYEVYLNDDLFVQVKLTRFDASLDLFLETCVASPNPNDFKDYSYDLLRNGCPRDSTFQSYINGVDQYA-QFSFRAFKFL-QTHAYVHLQCQVIIC--PDNDYNSRCRKGCQYRRKRSLDSSYNTSTVTLGPI 713          
BLAST of Zona pellucida-like domain protein vs. Ensembl Zebrafish
Match: si:ch73-338o16.4 (si:ch73-338o16.4 [Source:ZFIN;Acc:ZDB-GENE-131119-14])

HSP 1 Score: 52.373 bits (124), Expect = 1.537e-6
Identity = 41/182 (22.53%), Postives = 75/182 (41.21%), Query Frame = 1
Query: 1108 QCRVIKRNQIANKLE---YKKVTAASLTYKTKLSVVIQLYTDGSFISPLKKENKVEFNKLIFVKININN-PPKDVKLNLDRCMVSPDNNFSSSAVVYLVQNMCPNEQYDVQLTYLNPYTIG--FQFRPFNFVGKQNMQIYIRCETSKCYFPNDRFCGFCKPRSRPKRSILYNSNKSHTIGPI 1635
            Q + +  N   N LE   +K + A    Y+ ++      Y D  F  P       E ++ + V++ +     +   L +D C  +P N+  SS    L+ + CPN   +      N  ++   F FR F F    + ++Y+ C    C   ++     C    R +RS+    + S ++GP+
Sbjct: 1488 QAQALSMNMEINPLESIVHKSLPAGEGRYRVRMIP----YQDDEFTQPFNGSVDAELDQEMHVEVRVEGVDSRQFALVMDTCWATPVNDPDSSLRWDLIAHECPNPADETVDLLQNGVSMSSRFSFRMFVF-NANSSRLYLHCAVHLCLLSSNHCTPSCNSERRERRSLELQDSTSISMGPL 1664          
BLAST of Zona pellucida-like domain protein vs. TrEMBL
Match: A0A0X3PC76 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR125031 PE=4 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 7.219e-26
Identity = 136/547 (24.86%), Postives = 228/547 (41.68%), Query Frame = 1
Query:  115 VSDVKFLSNSSLFNDGRDGIVLLTLNTGEETTICNYKFSEIEAGIVCKSLGFPPHGFSLINSRQYHLGNVLIGNFQCK-----GNESHIKYCLHSGNKEYHG----LCGEHKMDVHVYCTEKKSHQEKMSTLTSCK----NMPGMT--FRNLPNKLNTGFLQLE--SNGKMSYICNDQLNFALDAANFYCHKMC---KHVKFARPLMFLDQTGFDIDSNSS-----FVSVSCRNG-----NCSSSR----VSSCDPTYVVGLKCGNE---PEIIEKSPQITCTHETITIMWQNSTQPFINSTLVSIS----PGCQNATIRDTADGGVALSMLLGDCNPLIKDETDY---VFYTYNIRRSYLPVGITLQNPANLVA-QCRVIKRNQIANKLEYKKV-TAASLTYKTKLSVVIQLYTDGSFISPLKKENKVEFNKLIFVKININNPPKDVKLNLDRCMVSPDNNFSSSAVVYLVQNMCPNEQYDVQLTYLNPYTIGFQFRPFNF-----VGKQNMQIYIRCETSKCY-FPNDRFC-GFCKPRSRPKRSI 1596
            +S V+  + S+LF  GRDG VL    +G+   +CN+ F  I A   C  LGFPP G  ++NSR      + + NF C      G  S     LH GN E+      +C  H+ DV + C E  +    M+T T  K      PG T   R +    + G +++     G    +C D   F ++ A   C  +C     + +A P+  +DQ  F++  +S+        ++C  G     +CS       V  C  +  VG+ C  +   P ++   PQ+ C      + +       ++  +++I+    P C        +D    + M        + + T     +F      RS L        P  L+   C V + + + + ++   V T   +      S ++  Y+D  F  P+ K   +   + I+ ++++     + KL L  C VS + N   S    L+ N CP +  DV+L   +   +GF F+   F     VG + +QI++ CET  C  F  D  C  FC+ R RP++ +
Sbjct:   24 ISSVRLATGSNLFPHGRDG-VLEVKYSGQWVAVCNFGFDHIAASTACYMLGFPPFGVPILNSRGRSSLKIGLSNFNCSERVSLGPNSPDPPSLHLGNCEFTSDPPRVCLTHERDVSIMCLE-PADVTSMTTATPFKFAPVTCPGNTTDIRLVGGTTSAGLVEVRHHKTGVWGTVCAD--GFGINEAKAICRMLCHSNDDLAYAHPV--IDQ--FELPESSADVPIHLARIACPPGATSLNDCSLGSGWGVVKGCLHSMDVGVICAPQEKTPPLVAP-PQLDCEASVAVVTFSKQHNEGLSPDMIAINGTRPPTCVINVTETDSDIVAVIPMEACGGTYELSNSTILALRIFLLIGTNRSRLG-----SKPQTLLPITCLVSRADSVISDVQAVSVSTLPPVVASWNTSAMLSFYSDVHFRVPISKPLNILPGQTIYARVSLGQQNINAKLVLRNCWVSAEENAPPSEKFTLITNGCPADP-DVRLIPRSRTVVGFSFKASQFDRARPVGGK-IQIFVGCETRLCAPFETDSDCVQFCR-RLRPQQRL 553          
BLAST of Zona pellucida-like domain protein vs. TrEMBL
Match: A0A0V0J4U1 (Neurotrypsin OS=Schistocephalus solidus OX=70667 GN=NETR PE=4 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 1.428e-25
Identity = 136/547 (24.86%), Postives = 228/547 (41.68%), Query Frame = 1
Query:  115 VSDVKFLSNSSLFNDGRDGIVLLTLNTGEETTICNYKFSEIEAGIVCKSLGFPPHGFSLINSRQYHLGNVLIGNFQCK-----GNESHIKYCLHSGNKEYHG----LCGEHKMDVHVYCTEKKSHQEKMSTLTSCK----NMPGMT--FRNLPNKLNTGFLQLE--SNGKMSYICNDQLNFALDAANFYCHKMC---KHVKFARPLMFLDQTGFDIDSNSS-----FVSVSCRNG-----NCSSSR----VSSCDPTYVVGLKCGNE---PEIIEKSPQITCTHETITIMWQNSTQPFINSTLVSIS----PGCQNATIRDTADGGVALSMLLGDCNPLIKDETDY---VFYTYNIRRSYLPVGITLQNPANLVA-QCRVIKRNQIANKLEYKKV-TAASLTYKTKLSVVIQLYTDGSFISPLKKENKVEFNKLIFVKININNPPKDVKLNLDRCMVSPDNNFSSSAVVYLVQNMCPNEQYDVQLTYLNPYTIGFQFRPFNF-----VGKQNMQIYIRCETSKCY-FPNDRFC-GFCKPRSRPKRSI 1596
            +S V+  + S+LF  GRDG VL    +G+   +CN+ F  I A   C  LGFPP G  ++NSR      + + NF C      G  S     LH GN E+      +C  H+ DV + C E  +    M+T T  K      PG T   R +    + G +++     G    +C D   F ++ A   C  +C     + +A P+  +DQ  F++  +S+        ++C  G     +CS       V  C  +  VG+ C  +   P ++   PQ+ C      + +       ++  +++I+    P C        +D    + M        + + T     +F      RS L        P  L+   C V + + + + ++   V T   +      S ++  Y+D  F  P+ K   +   + I+ ++++     + KL L  C VS + N   S    L+ N CP +  DV+L   +   +GF F+   F     VG + +QI++ CET  C  F  D  C  FC+ R RP++ +
Sbjct:   24 ISSVRLATGSNLFPHGRDG-VLEVKYSGQWVAVCNFGFDHIAASTACYMLGFPPFGVPILNSRGRSSLKIGLSNFNCSERVSLGPNSPDPPSLHLGNCEFTSDPPRVCLTHERDVSIMCLE-PADVTSMTTATPFKFAPVTCPGNTTDIRLVGGTTSAGLVEVRHHKTGVWGTVCAD--GFGINEAKAICRMLCHSNDDLAYAHPV--IDQ--FELPESSADVPIHLARIACPPGATSLNDCSLGSGWGVVKGCLHSMDVGVICAPQEKTPPLVAP-PQLDCEASVAVVTFSKQHNEGLSPDMIAINGTRPPTCVINVTETDSDIVAVIPMEACGGTYELSNSTILALRIFLLIGTNRSRLG-----SKPQTLLPITCLVSRADSVISDVQAVSVSTLPPVVASWNTSAMLSFYSDVHFRVPISKPLNILPGQTIYARVSLMQQNINAKLVLRNCWVSAEENAPPSEKFTLITNGCPADP-DVRLIPRSRTVVGFSFKASQFDRARPVGGK-IQIFVGCETRLCAPFETDSDCVQFCR-RLRPQQRL 553          
BLAST of Zona pellucida-like domain protein vs. TrEMBL
Match: A0A4S2M693 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002507 PE=4 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 1.217e-22
Identity = 116/529 (21.93%), Postives = 226/529 (42.72%), Query Frame = 1
Query:  115 VSDVKFLSNSSLFNDGRDGIVLLTLNTGEETTICNYKFSEIEAGIVCKSLGFPPHGFSLINSRQYHLGNVLIGNFQCKGN-----------ESHIKYCLHSGNKEYHGLCGEHKMDVHVYCTEKKSHQEKMSTLT-----------SCKNMPGMTFRNLPNKLNTGFLQLE--SNGKMSYICNDQLNFALDAANFYCHKMC---KHVKFARPLMF----LDQT------GFDIDSNSSFVSVSCRNGNCSSSRVSSCDPTYVVGLKCGNEPEIIEKS----PQITCTHETITIMWQNSTQPFINSTLVS----ISPGCQNATIRDTADGGVALSMLLGDCNPL-IKDETDYVFYTYNIRRSYLP-VGITLQNPANLVAQCRVIKRNQIANKLEYKKVTAASLTYKTK-LSVVIQLYTDGSFISPLKKENKVEFNKLIFVKININNPPKDVKLNLDRCMVSPDNNFSSSAVVYLVQNMCPNEQYD-VQLTYLNPYTIGFQFRPFNFVGK------QNMQIYIRCETSKCY 1536
            +  V+F S ++++ +GRDG++ +  N G   T+CN+ F E+ A + C  +G  P G +++NS +     +++ NF C G              H+  C  S   E    C +      + C +  +   KM+T T            C        R +      G +Q++    G+   IC D ++  + AA   C  +C    ++K+A+P+++    +D+T      G     +++ ++     G   ++R   C     VGL+C   P+II  S    PQ++CT     + +     P +N+++++    +  GCQ   + D      A+  L G    L + +E+D       +R    P  GI    P      C + + N+I +++         L   T+ ++  ++LY D  +   +++   +   + ++VK+++ +P    KL L  C  + +    S+    L+ N C    YD + +  +N   +GF F  F ++G        +  +Y+ C+T  C+
Sbjct:   27 IKSVRFASGTNIYEEGRDGVLEVNYN-GTWGTVCNFGFDELAASVACFMMGLTPRGVAILNSPRRSDSQMILSNFNCTGRLVLPSSSLSTATVHLGVC--SFTDEIPEGCQDGSRQTSIICLDAFT---KMTTTTPVPNYMTVAPVDCSRPSSSIIRLVGGTDREGLVQIQHPETGEWGTICADGVD--IYAARTLCRMLCTSADNLKYAQPVLYKHQEVDETVPIHLSGIRCPEHATDLNQCTLGGGWGATR--WCTHAMDVGLQCA-PPQIITPSISYAPQLSCTRTDARVTYDKQVNPDLNTSMITLVGQVPVGCQFRVV-DNGSHIQAIIPLEGCGGSLSLSNESDIAIKFELLRDFVAPSTGIISNLPVRFSVTCLIPRINRIPSEVIASPQVITDLVGATQAVAASLKLYQDPGYSISVRQGQSIRPGQSVYVKVSLVDPKPASKLILQDCWATINPERQSTPRQNLIINRC--IAYDGLTVHPINLTEVGFSFPAF-YLGTAGHTVPASASLYLHCDTRICH 540          
BLAST of Zona pellucida-like domain protein vs. TrEMBL
Match: A0A074ZAP8 (Uncharacterized protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=T265_15346 PE=4 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 4.196e-21
Identity = 112/526 (21.29%), Postives = 222/526 (42.21%), Query Frame = 1
Query:  115 VSDVKFLSNSSLFNDGRDGIVLLTLNTGEETTICNYKFSEIEAGIVCKSLGFPPHGFSLINSRQYHLGNVLIGNFQCKGN-----------ESHIKYCLHSGNKEYHGLCGEHKMDVHVYCTEKKSHQEKMSTL--------TSCKNMPGMTFRNLPNKLNTGFLQLE--SNGKMSYICNDQLNFALDAANFYCHKMC---KHVKFARPLMF----LDQT------GFDIDSNSSFVSVSCRNGNCSSSRVSSCDPTYVVGLKCGNEPEI----IEKSPQITCTHETITIMWQNSTQPFINSTLVS----ISPGCQNATIRDTADGGVALSMLLGDCNPL-IKDETDYVFYTYNIRRSYLP-VGITLQNPANLVAQCRVIKRNQIANKLEYKKVTAASLTYKTK-LSVVIQLYTDGSFISPLKKENKVEFNKLIFVKININNPPKDVKLNLDRCMVSPDNNFSSSAVVYLVQNMCPNEQYD-VQLTYLNPYTIGFQFRPFNFVGK------QNMQIYIRCETSKCY 1536
            +  V+F S ++++ +GRDG++ +  N G   T+CN+ F E+ A + C  +G  P G +++NS +     +++ NF C G              H+  C  S   E    C +      + C +        + +          C        R +      G +Q++    G+   IC D ++  + AA   C  +C    ++K+A+P+++    +D+T      G     +++ ++     G   ++R   C     VGL+C   P+I    I  +PQ++CT     + +     P +N+++++    +  GCQ   + D      A+  L G    L + +E+D       +R    P  GI    P      C + + N+I +++       A L   T+ +   ++LY D  +   +++   +   + ++VK+++ +P    KL L  C  + +    S+    L+ N C    YD + +  +N   +GF F  F ++G        +  +Y+ C+T  C+
Sbjct:   19 IQSVRFASGTNIYEEGRDGVLEVNYN-GTWGTVCNFGFDELAASVACFMMGMKPRGVAILNSPRRSDSQMILSNFNCTGRLVLPSFSLSTATVHLGVC--SFTDEIPEGCQDSNRQTSIICLDDFMEITTTTPVPNYMTVAPVDCSRPSSSIIRLVGGTDREGLVQIQHPETGEWGTICADGVD--IHAARTLCRMLCTSADNLKYAQPVLYKHQEVDETVPIHLSGIRCPEHATDLNQCTLGGGWGATR--WCTHAMDVGLQCA-PPQITAPSISYAPQLSCTRTDAHVTYDKQVNPDLNTSMITLVGQVPVGCQ-FRVADNGSHIEAIIPLEGCGGSLSLSNESDIAIKFELLRDFVAPSTGIISNLPVRFSVTCLIPRINRIPSEVIASPQVIADLVGATQEVEASLKLYQDPGYSISIRQGQFIRPGQNVYVKVSLVDPKPASKLILQDCWTTINPERQSTPRQNLIINRC--IAYDGLTVHPINLTEVGFSFPAF-YLGTAGHTVPASASLYLHCDTRICH 532          
BLAST of Zona pellucida-like domain protein vs. TrEMBL
Match: A0A4S2M5W8 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002507 PE=4 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 6.296e-21
Identity = 115/540 (21.30%), Postives = 226/540 (41.85%), Query Frame = 1
Query:  115 VSDVKFLSNSSLFNDGRDGIVLLTLNTGEETTICNYKFSEIEAGIVCKSLGFPPHGFSLINSRQYHLGNVLIGNFQCKGN-----------ESHIKYCLHSGNKEYHGLCGEHKMDVHVYCTEKKSHQEKMSTLT-----------SCKNMPGMTFRNLPNKLNTGFLQLE--SNGKMSYICNDQLNFALDAANFYCHKMC---KHVKFARPLMF----LDQT------GFDIDSNSSFVSVSCRNGNCSSSRVSSCDPTYVVGLKCGNEPEIIEKS----PQITCTHETITIMWQNSTQPFINSTLVS----ISPGCQNATIRDTADGGVALSML--LGDCNPLI----------KDETDYVFYTYNIRRSYLP-VGITLQNPANLVAQCRVIKRNQIANKLEYKKVTAASLTYKTK-LSVVIQLYTDGSFISPLKKENKVEFNKLIFVKININNPPKDVKLNLDRCMVSPDNNFSSSAVVYLVQNMCPNEQYD-VQLTYLNPYTIGFQFRPFNFVGK------QNMQIYIRCETSKCY 1536
            +  V+F S ++++ +GRDG++ +  N G   T+CN+ F E+ A + C  +G  P G +++NS +     +++ NF C G              H+  C  S   E    C +      + C +  +   KM+T T            C        R +      G +Q++    G+   IC D ++  + AA   C  +C    ++K+A+P+++    +D+T      G     +++ ++     G   ++R   C     VGL+C   P+II  S    PQ++CT     + +     P +N+++++    +  GCQ   +    D G  +  +  L  C   +           +E+D       +R    P  GI    P      C + + N+I +++         L   T+ ++  ++LY D  +   +++   +   + ++VK+++ +P    KL L  C  + +    S+    L+ N C    YD + +  +N   +GF F  F ++G        +  +Y+ C+T  C+
Sbjct:   27 IKSVRFASGTNIYEEGRDGVLEVNYN-GTWGTVCNFGFDELAASVACFMMGLTPRGVAILNSPRRSDSQMILSNFNCTGRLVLPSSSLSTATVHLGVC--SFTDEIPEGCQDGSRQTSIICLDAFT---KMTTTTPVPNYMTVAPVDCSRPSSSIIRLVGGTDREGLVQIQHPETGEWGTICADGVD--IYAARTLCRMLCTSADNLKYAQPVLYKHQEVDETVPIHLSGIRCPEHATDLNQCTLGGGWGATR--WCTHAMDVGLQCA-PPQIITPSISYAPQLSCTRTDARVTYDKQVNPDLNTSMITLVGQVPVGCQFRVV----DNGSHIQAIIPLEGCGGSLSLQTRKFGSKSNESDIAIKFELLRDFVAPSTGIISNLPVRFSVTCLIPRINRIPSEVIASPQVITDLVGATQAVAASLKLYQDPGYSISVRQGQSIRPGQSVYVKVSLVDPKPASKLILQDCWATINPERQSTPRQNLIINRC--IAYDGLTVHPINLTEVGFSFPAF-YLGTAGHTVPASASLYLHCDTRICH 548          
BLAST of Zona pellucida-like domain protein vs. Ensembl Cavefish
Match: cuzd1.2 (CUB and zona pellucida like domains 1 [Source:NCBI gene;Acc:103044438])

HSP 1 Score: 51.9878 bits (123), Expect = 1.730e-6
Identity = 71/334 (21.26%), Postives = 138/334 (41.32%), Query Frame = 1
Query:  697 DIDSNSSFVSVSCRNGNCSSSR-----VSSCDPTYVVGLKCGNEPEIIEKSPQITCTHETITIMWQN------STQPFINSTLVSISPGCQNATIRDTADGGVALSMLLGDCNPLIKDETDYVFYTYNIRRSYLPVGITLQNPANLV--AQCRVIKRNQIANKLEYKKVTAASLTYKTKLSVVIQLYTDGSFISP-LKKENKVEFNKLIFVKININNPPKDVKLNLDRCMVSPDNNFSSSAVVYLVQNMCPNEQYDVQLTYLNPYTIGFQFRPFNFVGKQNMQIYIRCETSKCYFPNDRFCGFCKPR--SRPKRSILYNSNKSH-----TIGPI 1635
            D  S+SS+++V  R+     +R      SS  P+    +KC ++  IIE         E++ I W N        +P  NS  VS                    +  +G C    K     V Y  N+R +    G   +     +    C + +        + K++  +++T   + +  +  +   SF  P L+   +V+ N+ ++V++ +      + + L+ C  SP++NF +  V  L++N C  ++    LT    Y   F F+ F F+ + +  ++++C    C   ++ +   C+    +R KRS+    + +H     T+GPI
Sbjct:  472 DFHSSSSYLTVLFRSDYSVVARGFKASYSSSLPSNTARVKCSSDRMIIEIRRSYL---ESLGISWHNLYVDDHRCRPSANSYEVS-------------------FNFPVGQCGTNKKFYNGRVVYNNNVRAAPSQSGEITRTIDEFLLNVTCHMEQDTTAGTVYKAKELVNSTITGTGRFNATMSFFPSPSFSYPILEHPYEVKINQNLYVQVQLTRADNTLDVFLETCEASPNHNFDAR-VYTLLRNGCEQDKTVEILTNGRHYYAQFSFKAFKFL-RTHAFVFLQCRVLVC--ADNDYGSRCRRGCLNRTKRSL----DSAHHTEVVTLGPI 775          
BLAST of Zona pellucida-like domain protein vs. Ensembl Cavefish
Match: cuzd1.2 (CUB and zona pellucida like domains 1 [Source:NCBI gene;Acc:103044438])

HSP 1 Score: 51.9878 bits (123), Expect = 1.730e-6
Identity = 71/334 (21.26%), Postives = 138/334 (41.32%), Query Frame = 1
Query:  697 DIDSNSSFVSVSCRNGNCSSSR-----VSSCDPTYVVGLKCGNEPEIIEKSPQITCTHETITIMWQN------STQPFINSTLVSISPGCQNATIRDTADGGVALSMLLGDCNPLIKDETDYVFYTYNIRRSYLPVGITLQNPANLV--AQCRVIKRNQIANKLEYKKVTAASLTYKTKLSVVIQLYTDGSFISP-LKKENKVEFNKLIFVKININNPPKDVKLNLDRCMVSPDNNFSSSAVVYLVQNMCPNEQYDVQLTYLNPYTIGFQFRPFNFVGKQNMQIYIRCETSKCYFPNDRFCGFCKPR--SRPKRSILYNSNKSH-----TIGPI 1635
            D  S+SS+++V  R+     +R      SS  P+    +KC ++  IIE         E++ I W N        +P  NS  VS                    +  +G C    K     V Y  N+R +    G   +     +    C + +        + K++  +++T   + +  +  +   SF  P L+   +V+ N+ ++V++ +      + + L+ C  SP++NF +  V  L++N C  ++    LT    Y   F F+ F F+ + +  ++++C    C   ++ +   C+    +R KRS+    + +H     T+GPI
Sbjct:  472 DFHSSSSYLTVLFRSDYSVVARGFKASYSSSLPSNTARVKCSSDRMIIEIRRSYL---ESLGISWHNLYVDDHRCRPSANSYEVS-------------------FNFPVGQCGTNKKFYNGRVVYNNNVRAAPSQSGEITRTIDEFLLNVTCHMEQDTTAGTVYKAKELVNSTITGTGRFNATMSFFPSPSFSYPILEHPYEVKINQNLYVQVQLTRADNTLDVFLETCEASPNHNFDAR-VYTLLRNGCEQDKTVEILTNGRHYYAQFSFKAFKFL-RTHAFVFLQCRVLVC--ADNDYGSRCRRGCLNRTKRSL----DSAHHTEVVTLGPI 775          
BLAST of Zona pellucida-like domain protein vs. Ensembl Cavefish
Match: cuzd1.2 (CUB and zona pellucida like domains 1 [Source:NCBI gene;Acc:103044438])

HSP 1 Score: 51.6026 bits (122), Expect = 1.968e-6
Identity = 71/334 (21.26%), Postives = 138/334 (41.32%), Query Frame = 1
Query:  697 DIDSNSSFVSVSCRNGNCSSSR-----VSSCDPTYVVGLKCGNEPEIIEKSPQITCTHETITIMWQN------STQPFINSTLVSISPGCQNATIRDTADGGVALSMLLGDCNPLIKDETDYVFYTYNIRRSYLPVGITLQNPANLV--AQCRVIKRNQIANKLEYKKVTAASLTYKTKLSVVIQLYTDGSFISP-LKKENKVEFNKLIFVKININNPPKDVKLNLDRCMVSPDNNFSSSAVVYLVQNMCPNEQYDVQLTYLNPYTIGFQFRPFNFVGKQNMQIYIRCETSKCYFPNDRFCGFCKPR--SRPKRSILYNSNKSH-----TIGPI 1635
            D  S+SS+++V  R+     +R      SS  P+    +KC ++  IIE         E++ I W N        +P  NS  VS                    +  +G C    K     V Y  N+R +    G   +     +    C + +        + K++  +++T   + +  +  +   SF  P L+   +V+ N+ ++V++ +      + + L+ C  SP++NF +  V  L++N C  ++    LT    Y   F F+ F F+ + +  ++++C    C   ++ +   C+    +R KRS+    + +H     T+GPI
Sbjct:  473 DFHSSSSYLTVLFRSDYSVVARGFKASYSSSLPSNTARVKCSSDRMIIEIRRSYL---ESLGISWHNLYVDDHRCRPSANSYEVS-------------------FNFPVGQCGTNKKFYNGRVVYNNNVRAAPSQSGEITRTIDEFLLNVTCHMEQDTTAGTVYKAKELVNSTITGTGRFNATMSFFPSPSFSYPILEHPYEVKINQNLYVQVQLTRADNTLDVFLETCEASPNHNFDAR-VYTLLRNGCEQDKTVEILTNGRHYYAQFSFKAFKFL-RTHAFVFLQCRVLVC--ADNDYGSRCRRGCLNRTKRSL----DSAHHTEVVTLGPI 776          
BLAST of Zona pellucida-like domain protein vs. Ensembl Cavefish
Match: cuzd1.2 (CUB and zona pellucida like domains 1 [Source:NCBI gene;Acc:103044438])

HSP 1 Score: 51.6026 bits (122), Expect = 1.968e-6
Identity = 71/334 (21.26%), Postives = 138/334 (41.32%), Query Frame = 1
Query:  697 DIDSNSSFVSVSCRNGNCSSSR-----VSSCDPTYVVGLKCGNEPEIIEKSPQITCTHETITIMWQN------STQPFINSTLVSISPGCQNATIRDTADGGVALSMLLGDCNPLIKDETDYVFYTYNIRRSYLPVGITLQNPANLV--AQCRVIKRNQIANKLEYKKVTAASLTYKTKLSVVIQLYTDGSFISP-LKKENKVEFNKLIFVKININNPPKDVKLNLDRCMVSPDNNFSSSAVVYLVQNMCPNEQYDVQLTYLNPYTIGFQFRPFNFVGKQNMQIYIRCETSKCYFPNDRFCGFCKPR--SRPKRSILYNSNKSH-----TIGPI 1635
            D  S+SS+++V  R+     +R      SS  P+    +KC ++  IIE         E++ I W N        +P  NS  VS                    +  +G C    K     V Y  N+R +    G   +     +    C + +        + K++  +++T   + +  +  +   SF  P L+   +V+ N+ ++V++ +      + + L+ C  SP++NF +  V  L++N C  ++    LT    Y   F F+ F F+ + +  ++++C    C   ++ +   C+    +R KRS+    + +H     T+GPI
Sbjct:  473 DFHSSSSYLTVLFRSDYSVVARGFKASYSSSLPSNTARVKCSSDRMIIEIRRSYL---ESLGISWHNLYVDDHRCRPSANSYEVS-------------------FNFPVGQCGTNKKFYNGRVVYNNNVRAAPSQSGEITRTIDEFLLNVTCHMEQDTTAGTVYKAKELVNSTITGTGRFNATMSFFPSPSFSYPILEHPYEVKINQNLYVQVQLTRADNTLDVFLETCEASPNHNFDAR-VYTLLRNGCEQDKTVEILTNGRHYYAQFSFKAFKFL-RTHAFVFLQCRVLVC--ADNDYGSRCRRGCLNRTKRSL----DSAHHTEVVTLGPI 776          
BLAST of Zona pellucida-like domain protein vs. Ensembl Cavefish
Match: cuzd1.2 (CUB and zona pellucida like domains 1 [Source:NCBI gene;Acc:103044438])

HSP 1 Score: 51.6026 bits (122), Expect = 1.968e-6
Identity = 71/334 (21.26%), Postives = 138/334 (41.32%), Query Frame = 1
Query:  697 DIDSNSSFVSVSCRNGNCSSSR-----VSSCDPTYVVGLKCGNEPEIIEKSPQITCTHETITIMWQN------STQPFINSTLVSISPGCQNATIRDTADGGVALSMLLGDCNPLIKDETDYVFYTYNIRRSYLPVGITLQNPANLV--AQCRVIKRNQIANKLEYKKVTAASLTYKTKLSVVIQLYTDGSFISP-LKKENKVEFNKLIFVKININNPPKDVKLNLDRCMVSPDNNFSSSAVVYLVQNMCPNEQYDVQLTYLNPYTIGFQFRPFNFVGKQNMQIYIRCETSKCYFPNDRFCGFCKPR--SRPKRSILYNSNKSH-----TIGPI 1635
            D  S+SS+++V  R+     +R      SS  P+    +KC ++  IIE         E++ I W N        +P  NS  VS                    +  +G C    K     V Y  N+R +    G   +     +    C + +        + K++  +++T   + +  +  +   SF  P L+   +V+ N+ ++V++ +      + + L+ C  SP++NF +  V  L++N C  ++    LT    Y   F F+ F F+ + +  ++++C    C   ++ +   C+    +R KRS+    + +H     T+GPI
Sbjct:  473 DFHSSSSYLTVLFRSDYSVVARGFKASYSSSLPSNTARVKCSSDRMIIEIRRSYL---ESLGISWHNLYVDDHRCRPSANSYEVS-------------------FNFPVGQCGTNKKFYNGRVVYNNNVRAAPSQSGEITRTIDEFLLNVTCHMEQDTTAGTVYKAKELVNSTITGTGRFNATMSFFPSPSFSYPILEHPYEVKINQNLYVQVQLTRADNTLDVFLETCEASPNHNFDAR-VYTLLRNGCEQDKTVEILTNGRHYYAQFSFKAFKFL-RTHAFVFLQCRVLVC--ADNDYGSRCRRGCLNRTKRSL----DSAHHTEVVTLGPI 776          
BLAST of Zona pellucida-like domain protein vs. Ensembl Sea Lamprey
Match: loxl3a (lysyl oxidase-like 3a [Source:NCBI gene;Acc:568839])

HSP 1 Score: 50.0618 bits (118), Expect = 1.502e-6
Identity = 43/157 (27.39%), Postives = 71/157 (45.22%), Query Frame = 1
Query:  133 LSNSSLFNDGRDGIVLLTLNTGEETTICNYKFSEIEAGIVCKSLGFPPHGFSLINSRQYH-LGNVLIGNFQCKGNESHIKYCLHSGNKEYHGLCGEHKMDVHVYCT------EKKSHQEKMSTLTSCKNMPGMTF-----RNLPNKLNTGFLQLESN 567
            L   ++  +GR    +     GE  T+C+ ++S + A +VC+ LGF     +L + R    +G + +   QC G E  I  C H GN   HG CG H+ D  V C       EK++ ++      +  N   +       R L + L+ G+  LE++
Sbjct:  360 LKGGAMTGEGR----VEVQRGGEWGTVCDQRWSTVSASVVCRELGFGSAKEALTSGRMGQAMGPIHMAMVQCTGQERSIFDCPH-GNASDHG-CGHHE-DAAVRCHVPAMGFEKRNFRQCAKGFHNSWNWVDVNLGFCPVRELDSGLSEGWGMLEAS 509          
BLAST of Zona pellucida-like domain protein vs. Ensembl Nematostella
Match: EDO42813 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0C9])

HSP 1 Score: 53.5286 bits (127), Expect = 1.151e-7
Identity = 36/147 (24.49%), Postives = 68/147 (46.26%), Query Frame = 1
Query: 1159 KVTAASLTYKTKLSVVIQLYTDGSFISPLKK-ENKVEFNKLIFVKININNPPKDVKLNLDRCMVSPDNNFSSSAVVYLVQNMCPNEQYDVQLTYLNPYTIGFQFRPFNFVGK-QNMQIYIRCETSKCYFPND--RFCGFCKPRSRPK 1587
            K+ A         S  + ++  G + SP  K   +V   + +F+KI +     D+ L LD+C  +P  + +S     +++N CP ++  +   Y       F F+ F F+ + ++ ++Y+ CE   C+  N+  R    C P  RP+
Sbjct:  105 KIIARPRVRTGNFSFKMDMFQTGKYFSPYTKFPVRVRVGERVFLKIKVKTNASDLVLFLDQCKATPTPDVNSEKSYLVLKNGCPIDR-SMDYKYTKDREQRFSFKAFRFINQGESSEVYLHCEVILCHKANNASRCNQACTPGERPR 250          
BLAST of Zona pellucida-like domain protein vs. Ensembl Nematostella
Match: EDO30371 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0Z9])

HSP 1 Score: 51.2174 bits (121), Expect = 2.094e-7
Identity = 58/227 (25.55%), Postives = 93/227 (40.97%), Query Frame = 1
Query:  196 GEETTICNYKFSEIEAGIVCKSLGF-PPHGFSLINSRQYHLGNVLIGNFQCKGNESHIKYCLHSGNKEYHGLCGEHKMDVHVYCTEKKSHQEKMSTLTSCKNMPGMTFRNLPNKLNTGFLQLESNGKMSYICNDQLNFALDAANFYCHKMCKHVKFARPLMFLDQTGFDIDSNSSFVSVSCRNGNCSSSRVSSCDPTYVVGLKC-GNEPEIIEKSPQITCTHETITI 870
            G   T+CN  +S+  A +VCKSLGF   HG   +       G +L+ +  C GNE+ +  C H G       C EH+ DV V C        K+ T     N+P           + G +++ ++G    +C+D  +   DA     H +C+ + F        Q   D  S++ F   +               P ++ G++C G+E  ++E      C H  I I
Sbjct:   19 GRWGTVCNDLWSDTNANVVCKSLGFGESHGLGFMFGAGS--GPILMDDVICSGNEASLVDCSHRGWGVED--C-EHREDVGVVC------NNKLRTRLVAGNIP-----------SEGRVEVLNDGVWGTVCDDLWSME-DA-----HVVCRSLGF--------QGARDYKSHAFFGRGT--------------GPIWLDGVRCRGSEESVLE------CEHRGIGI 189          
BLAST of Zona pellucida-like domain protein vs. Ensembl Nematostella
Match: EDO34781 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SND8])

HSP 1 Score: 48.1358 bits (113), Expect = 2.198e-6
Identity = 29/83 (34.94%), Postives = 45/83 (54.22%), Query Frame = 1
Query:  208 TICNYKFSEIEAGIVCKSLGFPPHGFSLINSRQYHL----GNVLIGNFQCKGNESHIKYCLHSGNKEYHGLCGEHKMDVHVYC 444
            TIC+Y++  ++A +VC+ LG+P    +L   R+       GN+ + + QCKG ES+I  C  S   E+   C +H  D  V C
Sbjct:  130 TICDYQWGILDANVVCRQLGYPG---ALAAKREAFFGQGKGNIWLTDVQCKGRESNIGLCRRS-FLEHQQTC-QHSEDAGVIC 207          
BLAST of Zona pellucida-like domain protein vs. Ensembl Nematostella
Match: EDO39811 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8Y4])

HSP 1 Score: 46.595 bits (109), Expect = 7.340e-6
Identity = 39/174 (22.41%), Postives = 73/174 (41.95%), Query Frame = 1
Query:  133 LSNSSLFNDGRDGIVLLTLNTGEETTICNYKFSEIEAGIVCKSLGFPPHGFSLINSRQYHL----GNVLIGNFQCKGNESHIKYCLHSGNKEYHGLCGEHKMDVHVYCTEKKSHQEKMSTLTSCKNMPGMTFRNLPNKLNTGFLQLESNGKMSYICNDQLNFALDAANFYCHKM 642
            L N S FN+GR    +   + G   T+C+  +   +A +VC+ LG+P    ++ +  + H     G + + +  C G E  +  C   G   ++ +   H  D  V C  + +        T+    P     N  +  N G +++  NG    +C+D  +  +  A   CH++
Sbjct:    3 LVNGSSFNEGR----VEIYHNGTWGTVCDDSWDISDAQVVCRQLGYPG---AVSSPGRAHFGRGNGQIWMDDVHCMGYERSLDSCYFPGWGRHNCI---HSEDAGVVCQTRNT--------TAIPPRPTTWLVN-GSSFNEGRVEIYHNGTWGTVCDDSWD--ISDAQVVCHQL 155          
BLAST of Zona pellucida-like domain protein vs. Ensembl Nematostella
Match: EDO26980 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAJ1])

HSP 1 Score: 46.595 bits (109), Expect = 8.242e-6
Identity = 41/174 (23.56%), Postives = 71/174 (40.80%), Query Frame = 1
Query:  133 LSNSSLFNDGRDGIVLLTLNTGEETTICNYKFSEIEAGIVCKSLGFPP----HGFSLINSRQYHLGNVLIGNFQCKGNESHIKYCLHSGNKEYHGLCGEHKMDVHVYCTEKKSHQEKMSTLTSCKNMPGMTFRNLPNKLNTGFLQLESNGKMSYICNDQLNFALDAANFYCHKM 642
            L N S +N+GR    +     G   ++C+  +S  +A +VC+ LGF      HG +         G + + + QC G E  +  C   G   ++  C  H  D  V C  + +        T+    P     N  +  N G +++  NG    +C+D  +  +  A   CH++
Sbjct:   10 LVNGSRYNEGR----VEIFKYGNWGSVCDDSWSREDANVVCRQLGFEGAVSWHGSARFGES---CGPIWMDDVQCMGYERSLDSCYFPGWGRHN--C-RHSEDAGVVCQTRNT--------TAIPPRPTTWLVN-GSSFNEGRVEIYHNGTWGTVCDDSWD--ISDAQVVCHQL 162          
BLAST of Zona pellucida-like domain protein vs. Ensembl Medaka
Match: oit3 (oncoprotein induced transcript 3 [Source:NCBI gene;Acc:101165704])

HSP 1 Score: 53.1434 bits (126), Expect = 5.760e-7
Identity = 27/144 (18.75%), Postives = 66/144 (45.83%), Query Frame = 1
Query: 1207 IQLYTDGSFISPLKKENKVEFNKLIFVKININNPPKDVKLNLDRCMVSPDNNFSSSAVVYLVQNMCPNEQYDVQLTYLNPYTIGFQFRPFNFVGKQNMQIYIRCETSKCYFPNDRFCGFCKPRSRPK-RSILYNSNKSHTIGPI 1635
            ++L+    F+ P +   ++  +  +F  +   +  + +   ++ C  +P      +   +L+++ C +++   Q +  +  +  +Q   F FVG+ N Q+Y+ C    C   + R    C+ R+R + R+      ++ + GPI
Sbjct:  391 LELFKSAEFLEPYRSPPQLRLHDSLFFGVEPKDRVEGLSALVESCFATPGPTADQALKYFLIKDGCISDETVTQYSSKDQLSKHYQVPVFKFVGRDNRQVYLHCRVLVCGAGDGRCSQRCRGRARREVRTGGSQERRTLSSGPI 534          
BLAST of Zona pellucida-like domain protein vs. Ensembl Medaka
Match: oit3 (oncoprotein induced transcript 3 [Source:NCBI gene;Acc:101165704])

HSP 1 Score: 52.7582 bits (125), Expect = 7.152e-7
Identity = 27/144 (18.75%), Postives = 66/144 (45.83%), Query Frame = 1
Query: 1207 IQLYTDGSFISPLKKENKVEFNKLIFVKININNPPKDVKLNLDRCMVSPDNNFSSSAVVYLVQNMCPNEQYDVQLTYLNPYTIGFQFRPFNFVGKQNMQIYIRCETSKCYFPNDRFCGFCKPRSRPK-RSILYNSNKSHTIGPI 1635
            ++L+    F+ P +   ++  +  +F  +   +  + +   ++ C  +P      +   +L+++ C +++   Q +  +  +  +Q   F FVG+ N Q+Y+ C    C   + R    C+ R+R + R+      ++ + GPI
Sbjct:  416 LELFKSAEFLEPYRSPPQLRLHDSLFFGVEPKDRVEGLSALVESCFATPGPTADQALKYFLIKDGCISDETVTQYSSKDQLSKHYQVPVFKFVGRDNRQVYLHCRVLVCGAGDGRCSQRCRGRARREVRTGGSQERRTLSSGPI 559          
BLAST of Zona pellucida-like domain protein vs. Planmine SMEST
Match: SMESG000052888.1 (SMESG000052888.1)

HSP 1 Score: 530.791 bits (1366), Expect = 0.000e+0
Identity = 257/258 (99.61%), Postives = 258/258 (100.00%), Query Frame = 1
Query:  871 MWQNSTQPFINSTLVSISPGCQNATIRDTADGGVALSMLLGDCNPLIKDETDYVFYTYNIRRSYLPVGITLQNPANLVAQCRVIKRNQIANKLEYKKVTAASLTYKTKLSVVIQLYTDGSFISPLKKENKVEFNKLIFVKININNPPKDVKLNLDRCMVSPDNNFSSSAVVYLVQNMCPNEQYDVQLTYLNPYTIGFQFRPFNFVGKQNMQIYIRCETSKCYFPNDRFCGFCKPRSRPKRSILYNSNKSHTIGPIATI 1644
            MWQNSTQPFINSTLVSISPGCQNATIRDTADGGVALSMLLGDCNPLIKDETDYVFYTYNIRRSYLPVGITLQNPANLVAQCRVIKRNQIANKLE+KKVTAASLTYKTKLSVVIQLYTDGSFISPLKKENKVEFNKLIFVKININNPPKDVKLNLDRCMVSPDNNFSSSAVVYLVQNMCPNEQYDVQLTYLNPYTIGFQFRPFNFVGKQNMQIYIRCETSKCYFPNDRFCGFCKPRSRPKRSILYNSNKSHTIGPIATI
Sbjct:    1 MWQNSTQPFINSTLVSISPGCQNATIRDTADGGVALSMLLGDCNPLIKDETDYVFYTYNIRRSYLPVGITLQNPANLVAQCRVIKRNQIANKLEFKKVTAASLTYKTKLSVVIQLYTDGSFISPLKKENKVEFNKLIFVKININNPPKDVKLNLDRCMVSPDNNFSSSAVVYLVQNMCPNEQYDVQLTYLNPYTIGFQFRPFNFVGKQNMQIYIRCETSKCYFPNDRFCGFCKPRSRPKRSILYNSNKSHTIGPIATI 258          
BLAST of Zona pellucida-like domain protein vs. Planmine SMEST
Match: SMESG000001180.1 (SMESG000001180.1)

HSP 1 Score: 362.073 bits (928), Expect = 3.771e-123
Identity = 176/177 (99.44%), Postives = 177/177 (100.00%), Query Frame = 1
Query:  871 MWQNSTQPFINSTLVSISPGCQNATIRDTADGGVALSMLLGDCNPLIKDETDYVFYTYNIRRSYLPVGITLQNPANLVAQCRVIKRNQIANKLEYKKVTAASLTYKTKLSVVIQLYTDGSFISPLKKENKVEFNKLIFVKININNPPKDVKLNLDRCMVSPDNNFSSSAVVYLVQNM 1401
            MWQNSTQPFINSTLVSISPGCQNATIRDTADGGVALSMLLGDCNPLIKDETDYVFYTYNIRRSYLPVGITLQNPANLVAQCRVIKRNQIANKLEYKKVTAASLTYKTKLSVVIQLYTDGSFISPLKKENKVEFNKLIFVKININNPPKDVKLNLDRCMVSPDNNFSSSAVVYLVQN+
Sbjct:    1 MWQNSTQPFINSTLVSISPGCQNATIRDTADGGVALSMLLGDCNPLIKDETDYVFYTYNIRRSYLPVGITLQNPANLVAQCRVIKRNQIANKLEYKKVTAASLTYKTKLSVVIQLYTDGSFISPLKKENKVEFNKLIFVKININNPPKDVKLNLDRCMVSPDNNFSSSAVVYLVQNI 177          
BLAST of Zona pellucida-like domain protein vs. Planmine SMEST
Match: SMESG000001180.1 (SMESG000001180.1)

HSP 1 Score: 362.073 bits (928), Expect = 3.984e-123
Identity = 176/177 (99.44%), Postives = 177/177 (100.00%), Query Frame = 1
Query:  871 MWQNSTQPFINSTLVSISPGCQNATIRDTADGGVALSMLLGDCNPLIKDETDYVFYTYNIRRSYLPVGITLQNPANLVAQCRVIKRNQIANKLEYKKVTAASLTYKTKLSVVIQLYTDGSFISPLKKENKVEFNKLIFVKININNPPKDVKLNLDRCMVSPDNNFSSSAVVYLVQNM 1401
            MWQNSTQPFINSTLVSISPGCQNATIRDTADGGVALSMLLGDCNPLIKDETDYVFYTYNIRRSYLPVGITLQNPANLVAQCRVIKRNQIANKLEYKKVTAASLTYKTKLSVVIQLYTDGSFISPLKKENKVEFNKLIFVKININNPPKDVKLNLDRCMVSPDNNFSSSAVVYLVQN+
Sbjct:    1 MWQNSTQPFINSTLVSISPGCQNATIRDTADGGVALSMLLGDCNPLIKDETDYVFYTYNIRRSYLPVGITLQNPANLVAQCRVIKRNQIANKLEYKKVTAASLTYKTKLSVVIQLYTDGSFISPLKKENKVEFNKLIFVKININNPPKDVKLNLDRCMVSPDNNFSSSAVVYLVQNI 177          
BLAST of Zona pellucida-like domain protein vs. Planmine SMEST
Match: SMESG000019122.1 (SMESG000019122.1)

HSP 1 Score: 124.79 bits (312), Expect = 3.706e-30
Identity = 118/482 (24.48%), Postives = 207/482 (42.95%), Query Frame = 1
Query:  160 GRDGIVLLTLNTGEETTICNYKFSEIEAGIVCKSLGFPPHGFSLINSR-------QYHLGNVLIGNFQCKGNESHIKYCL-HSGNKEYHGLCGEHKMDVHVYCTEKKSHQE-KMSTLTSCKNMPGMTFRNLPNKLNTGFLQLESNGKMSYICNDQLNFALDAANFYCHKMC-KHVKFARPLMFLDQTGFDIDSNSSFVSVSCRNG-----NCSSS---RVSSCDPTYVVGLKCGNEPEIIEKSPQITCTHETITIMWQNSTQPFINST---LVSISPGCQNATIRDTADGGVALSMLLGDCNPLIKDETDYVFYTYNIRRSYLPVG-ITLQNPANLVAQCRVIKRNQIA--NKLEYKKVTAASLTYKTKLSVVIQLYTDGSFISPLKKENKVEFNKLIFVKININNPPKDVKLNLDRCMVSPDNNFSSSAVVYLVQNMCPNEQYDVQLTYLNPYTIGFQFRPFNFVGKQNMQIYIRCETSKC 1533
            G +G+V+L LN G + TIC    S  +A + C+S+ +     +   S        +  L      N QC G+E  ++ C  +  +      C  +  D+ + C    S    KM +    K  P  T +        GFLQ  +NG + Y C  +  F+ + A  +C  +C ++    R +  ++ T         F ++SC        +CS++   +   C P+  +G+ C     + +  P   C + T+ ++W  +  P I  T   +V ++  C N  I+      + LS+ L DCN  +  +   V Y++  +R++  +  I +++       C  I RN I        K  +    T  T ++V + ++ D +F++ L   N       +FV+I+ +NPP ++ L L  C V+  N       VYL+QN CP     VQ+  ++     F F  F+  G  N  +   C+TSKC
Sbjct:   28 GSNGVVILELNNGIKATICLNSSSVKDAQVACRSMNYTSSQKTSSASSFAFISSVKTKLAKTYFQNLQCNGDEDSLEKCPGYKFSNPVDFKCQNNNQDLSISCLYDYSFSNIKMPS----KKCPTATLQ----VDQYGFLQFNNNGSLIYFCGSRNIFSTNEAQLFCKLLCAENSTSPRIIQGINMTSLQNIPIGGFNNLSCPANATSLDDCSNAFPFQSDQCTPSDNIGVACSVSSLVQDPLPIAVCENNTLKLLWNRTIHPTILPTDVDIVYLNASCNNV-IKSNLSDVLILSVSLNDCNGDVTGDLYNVIYSFGAKRTFPKINNIQIKDDQIFSPNCY-ITRNYIVIQGPFSIKATSITDGTGSTDVTVSLGIFLDSNFVTVLPNLNLASKGTTVFVRISFDNPPVNLVLVLVECYVTDGN-----TKVYLIQNRCP-VLSTVQINPISDSVSSFNFVSFSISGSSNQNLV--CQTSKC 491          
BLAST of Zona pellucida-like domain protein vs. Planmine SMEST
Match: SMESG000019122.1 (SMESG000019122.1)

HSP 1 Score: 124.405 bits (311), Expect = 4.163e-30
Identity = 118/482 (24.48%), Postives = 207/482 (42.95%), Query Frame = 1
Query:  160 GRDGIVLLTLNTGEETTICNYKFSEIEAGIVCKSLGFPPHGFSLINSR-------QYHLGNVLIGNFQCKGNESHIKYCL-HSGNKEYHGLCGEHKMDVHVYCTEKKSHQE-KMSTLTSCKNMPGMTFRNLPNKLNTGFLQLESNGKMSYICNDQLNFALDAANFYCHKMC-KHVKFARPLMFLDQTGFDIDSNSSFVSVSCRNG-----NCSSS---RVSSCDPTYVVGLKCGNEPEIIEKSPQITCTHETITIMWQNSTQPFINST---LVSISPGCQNATIRDTADGGVALSMLLGDCNPLIKDETDYVFYTYNIRRSYLPVG-ITLQNPANLVAQCRVIKRNQIA--NKLEYKKVTAASLTYKTKLSVVIQLYTDGSFISPLKKENKVEFNKLIFVKININNPPKDVKLNLDRCMVSPDNNFSSSAVVYLVQNMCPNEQYDVQLTYLNPYTIGFQFRPFNFVGKQNMQIYIRCETSKC 1533
            G +G+V+L LN G + TIC    S  +A + C+S+ +     +   S        +  L      N QC G+E  ++ C  +  +      C  +  D+ + C    S    KM +    K  P  T +        GFLQ  +NG + Y C  +  F+ + A  +C  +C ++    R +  ++ T         F ++SC        +CS++   +   C P+  +G+ C     + +  P   C + T+ ++W  +  P I  T   +V ++  C N  I+      + LS+ L DCN  +  +   V Y++  +R++  +  I +++       C  I RN I        K  +    T  T ++V + ++ D +F++ L   N       +FV+I+ +NPP ++ L L  C V+  N       VYL+QN CP     VQ+  ++     F F  F+  G  N  +   C+TSKC
Sbjct:   37 GSNGVVILELNNGIKATICLNSSSVKDAQVACRSMNYTSSQKTSSASSFAFISSVKTKLAKTYFQNLQCNGDEDSLEKCPGYKFSNPVDFKCQNNNQDLSISCLYDYSFSNIKMPS----KKCPTATLQ----VDQYGFLQFNNNGSLIYFCGSRNIFSTNEAQLFCKLLCAENSTSPRIIQGINMTSLQNIPIGGFNNLSCPANATSLDDCSNAFPFQSDQCTPSDNIGVACSVSSLVQDPLPIAVCENNTLKLLWNRTIHPTILPTDVDIVYLNASCNNV-IKSNLSDVLILSVSLNDCNGDVTGDLYNVIYSFGAKRTFPKINNIQIKDDQIFSPNCY-ITRNYIVIQGPFSIKATSITDGTGSTDVTVSLGIFLDSNFVTVLPNLNLASKGTTVFVRISFDNPPVNLVLVLVECYVTDGN-----TKVYLIQNRCP-VLSTVQINPISDSVSSFNFVSFSISGSSNQNLV--CQTSKC 500          
The following BLAST results are available for this feature:
BLAST of Zona pellucida-like domain protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zona pellucida-like domain protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zona pellucida-like domain protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zona pellucida-like domain protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkeyp-110a12.48.962e-922.01si:dkeyp-110a12.4 [Source:ZFIN;Acc:ZDB-GENE-131121... [more]
si:dkey-9l20.33.098e-828.67si:dkey-9l20.3 [Source:ZFIN;Acc:ZDB-GENE-090313-36... [more]
cuzd1.11.038e-725.44CUB and zona pellucida-like domains 1, tandem dupl... [more]
cuzd1.25.668e-724.56CUB and zona pellucida-like domains 1, tandem dupl... [more]
si:ch73-338o16.41.537e-622.53si:ch73-338o16.4 [Source:ZFIN;Acc:ZDB-GENE-131119-... [more]
back to top
BLAST of Zona pellucida-like domain protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zona pellucida-like domain protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zona pellucida-like domain protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zona pellucida-like domain protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3PC767.219e-2624.86Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A0V0J4U11.428e-2524.86Neurotrypsin OS=Schistocephalus solidus OX=70667 G... [more]
A0A4S2M6931.217e-2221.93Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A074ZAP84.196e-2121.29Uncharacterized protein (Fragment) OS=Opisthorchis... [more]
A0A4S2M5W86.296e-2121.30Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of Zona pellucida-like domain protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cuzd1.21.730e-621.26CUB and zona pellucida like domains 1 [Source:NCBI... [more]
cuzd1.21.730e-621.26CUB and zona pellucida like domains 1 [Source:NCBI... [more]
cuzd1.21.968e-621.26CUB and zona pellucida like domains 1 [Source:NCBI... [more]
cuzd1.21.968e-621.26CUB and zona pellucida like domains 1 [Source:NCBI... [more]
cuzd1.21.968e-621.26CUB and zona pellucida like domains 1 [Source:NCBI... [more]
back to top
BLAST of Zona pellucida-like domain protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
loxl3a1.502e-627.39lysyl oxidase-like 3a [Source:NCBI gene;Acc:568839... [more]
back to top
BLAST of Zona pellucida-like domain protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zona pellucida-like domain protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO428131.151e-724.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303712.094e-725.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO347812.198e-634.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO398117.340e-622.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO269808.242e-623.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Zona pellucida-like domain protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
oit35.760e-718.75oncoprotein induced transcript 3 [Source:NCBI gene... [more]
oit37.152e-718.75oncoprotein induced transcript 3 [Source:NCBI gene... [more]
back to top
BLAST of Zona pellucida-like domain protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000052888.10.000e+099.61SMESG000052888.1[more]
SMESG000001180.13.771e-12399.44SMESG000001180.1[more]
SMESG000001180.13.984e-12399.44SMESG000001180.1[more]
SMESG000019122.13.706e-3024.48SMESG000019122.1[more]
SMESG000019122.14.163e-3024.48SMESG000019122.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004946 ID=SMED30004946|Name=Zona pellucida-like domain protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1770bp
TTTGTTTAATTATATTCGTTGTCATAGAGAAAAGCTCTATTTTCAAAGGA
TAAAATTATGCTACTATATTTTTTATTTGTTAATTTATTTTTTTTACAAA
TAAACCCACAAATAGTTTCAGATGTAAAATTTTTATCAAATTCTAGTCTA
TTCAATGATGGAAGAGATGGGATAGTTCTTCTTACTTTGAATACAGGTGA
GGAAACCACAATTTGCAATTACAAATTTTCAGAAATAGAAGCTGGTATAG
TCTGCAAAAGCCTTGGATTTCCACCTCATGGATTTTCTTTAATAAACTCT
CGTCAATATCATTTGGGAAACGTTTTAATTGGAAATTTTCAATGTAAAGG
GAATGAATCTCACATTAAATATTGCTTACATTCCGGTAATAAAGAGTATC
ATGGATTATGTGGTGAGCATAAAATGGATGTACATGTTTACTGTACTGAG
AAAAAATCGCACCAAGAGAAAATGAGTACATTAACTTCATGTAAGAATAT
GCCAGGAATGACTTTTAGAAATCTCCCAAATAAACTGAATACAGGTTTTC
TTCAGTTAGAATCAAATGGGAAAATGAGTTATATTTGCAACGATCAGCTT
AATTTTGCTCTCGATGCTGCTAATTTTTATTGTCATAAAATGTGCAAACA
TGTAAAATTTGCACGACCACTCATGTTTTTAGATCAAACCGGATTCGACA
TTGATTCTAACTCCAGTTTTGTGTCAGTTTCTTGTAGAAATGGAAACTGT
TCAAGTTCTCGAGTTAGCAGTTGTGATCCGACGTATGTTGTCGGTTTGAA
ATGTGGAAATGAGCCAGAAATAATTGAAAAATCACCCCAAATTACTTGCA
CTCATGAAACCATAACAATTATGTGGCAGAACTCTACTCAACCTTTTATC
AATTCAACATTGGTCTCGATTTCACCTGGCTGTCAAAACGCTACAATCCG
TGATACTGCCGACGGTGGCGTTGCATTATCAATGCTTCTCGGAGACTGCA
ATCCGTTGATTAAAGATGAAACAGATTATGTCTTCTACACGTACAATATA
CGTCGATCATATTTACCTGTTGGGATTACATTGCAAAATCCCGCCAATCT
CGTCGCACAATGTCGAGTTATTAAACGCAATCAGATAGCCAATAAACTGG
AATATAAAAAAGTAACTGCAGCCTCTTTGACCTATAAAACAAAATTATCA
GTAGTAATACAACTCTATACAGATGGCAGTTTCATCAGTCCATTGAAGAA
AGAAAATAAAGTTGAATTTAACAAATTAATTTTTGTTAAAATTAATATAA
ATAATCCACCGAAAGACGTCAAGCTCAACCTTGACAGATGCATGGTTTCG
CCAGATAATAACTTCAGCTCTTCAGCTGTTGTATACTTAGTTCAAAATAT
GTGCCCCAACGAACAATATGATGTGCAATTGACTTATTTGAATCCTTACA
CTATTGGCTTTCAATTTCGACCTTTCAACTTTGTTGGTAAGCAAAATATG
CAAATTTATATTAGATGTGAAACAAGTAAGTGCTATTTTCCTAATGATCG
GTTTTGTGGATTCTGCAAGCCACGGTCGAGGCCGAAACGCTCAATATTAT
ACAATAGCAATAAATCTCATACAATTGGACCGATAGCCACAATTTAAAGC
AATCTTCGGTGCAATCTAGTCCAAAAATATTTTTTCTAGTTGCTAATCAA
TTTTTAGAAATTACTTCAATTTTATATTTTGTGATTATTTGAATTTTTTG
AATAAATATATTTTTTTATA
back to top

protein sequence of SMED30004946-orf-1

>SMED30004946-orf-1 ID=SMED30004946-orf-1|Name=SMED30004946-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=530bp
MLLYFLFVNLFFLQINPQIVSDVKFLSNSSLFNDGRDGIVLLTLNTGEET
TICNYKFSEIEAGIVCKSLGFPPHGFSLINSRQYHLGNVLIGNFQCKGNE
SHIKYCLHSGNKEYHGLCGEHKMDVHVYCTEKKSHQEKMSTLTSCKNMPG
MTFRNLPNKLNTGFLQLESNGKMSYICNDQLNFALDAANFYCHKMCKHVK
FARPLMFLDQTGFDIDSNSSFVSVSCRNGNCSSSRVSSCDPTYVVGLKCG
NEPEIIEKSPQITCTHETITIMWQNSTQPFINSTLVSISPGCQNATIRDT
ADGGVALSMLLGDCNPLIKDETDYVFYTYNIRRSYLPVGITLQNPANLVA
QCRVIKRNQIANKLEYKKVTAASLTYKTKLSVVIQLYTDGSFISPLKKEN
KVEFNKLIFVKININNPPKDVKLNLDRCMVSPDNNFSSSAVVYLVQNMCP
NEQYDVQLTYLNPYTIGFQFRPFNFVGKQNMQIYIRCETSKCYFPNDRFC
GFCKPRSRPKRSILYNSNKSHTIGPIATI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006897endocytosis
GO:0006898receptor-mediated endocytosis
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036772SRCR-like_dom_sf
IPR017448SRCR-like_dom
IPR001507ZP_dom
IPR001190SRCR
IPR017977ZP_dom_CS
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0005044scavenger receptor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR017448SRCR-like domainSMARTSM00202SR_3coord: 29..130
e-value: 1.2E-5
score: 27.6
IPR001507Zona pellucida domainSMARTSM00241zp_4coord: 263..506
e-value: 5.9E-5
score: -12.6
IPR001507Zona pellucida domainPFAMPF00100Zona_pellucidacoord: 264..493
e-value: 5.8E-21
score: 75.4
IPR001507Zona pellucida domainPROSITEPS51034ZP_2coord: 263..510
score: 15.16
IPR001190SRCR domainPFAMPF00530SRCRcoord: 38..130
e-value: 2.0E-12
score: 47.5
IPR001190SRCR domainPROSITEPS50287SRCR_2coord: 23..130
score: 13.443
IPR036772SRCR-like domain superfamilyGENE3DG3DSA:3.10.250.10coord: 26..138
e-value: 1.3E-13
score: 52.8
IPR036772SRCR-like domain superfamilySUPERFAMILYSSF56487SRCR-likecoord: 37..132
NoneNo IPR availableGENE3DG3DSA:2.60.40.4100coord: 379..529
e-value: 2.9E-14
score: 55.0
NoneNo IPR availablePANTHERPTHR19331LYSYL OXIDASE-RELATEDcoord: 39..196
NoneNo IPR availablePANTHERPTHR19331:SF424SCAVENGER RECEPTOR CLASS A MEMBER 5coord: 39..196
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..21
score: 0.618
IPR017977Zona pellucida domain, conserved sitePROSITEPS00682ZP_1coord: 409..449