SMED30004943

Overview
NameSMED30004943
Smed IDSMED30004943
Length (bp)2068
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30004943 (SMED30004943) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30004943 (SMED30004943) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30004943 (SMED30004943) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30004943 (SMED30004943) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004943

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30004943h1SMcG0016099 Contig6015uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30004943h1SMcG0016099 Contig6015newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
X1 cellSMED30004943h1SMcG0016099 SmedASXL_014832SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30004943h1SMcG0016099 SmedASXL_014832SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30004943h1SMcG0016099 SmedASXL_025037SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30004943h1SMcG0016099 SmedASXL_014833SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30004943h1SMcG0016099 SmedASXL_014833SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30004943h1SMcG0016099 dd_Smed_v4_9264_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004943h1SMcG0016099 dd_Smed_v4_9264_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30004943h1SMcG0016099 dd_Smed_v4_9264_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30004943 vs. Ensembl Human
Match: ZNF106 (zinc finger protein 106 [Source:HGNC Symbol;Acc:HGNC:12886])

HSP 1 Score: 65.0846 bits (157), Expect = 3.817e-10
Identity = 40/160 (25.00%), Postives = 78/160 (48.75%), Query Frame = 3
Query: 1032 EVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHEWIMDYKGHQSLIHCLLPTVHPVGVKRILSGGCDMALFVHDIDSGTILHRIADSSAILSICDLLDFVYYGTAEGKVATFSLEKNREMSSFHA-SDKGISCLTATKEGNVHLLFVGANTGEYSVWNA 1508
            E  +  +  +++F N L+  ++   +R Y+L + + I  ++GH S ++CLL T        + +G  D  +  +++ S   + ++     +L +      +Y G A G V TF+++ N+ +  F     + +SCL   +EG   LL VG+     SV +A
Sbjct: 1528 EGHQAAVNAIQIFGNLLYTCSADKTVRVYNLVSRKCIGVFEGHTSKVNCLLVTQTSGKNAALYTGSSDHTIRCYNVKSRECVEQLQLEDRVLCLHSRWRILYAGLANGTVVTFNIKNNKRLEIFECHGPRAVSCLATAQEGARKLLVVGSYDCTISVRDA 1687          
BLAST of SMED30004943 vs. Ensembl Human
Match: ZNF106 (zinc finger protein 106 [Source:HGNC Symbol;Acc:HGNC:12886])

HSP 1 Score: 65.0846 bits (157), Expect = 3.825e-10
Identity = 40/160 (25.00%), Postives = 78/160 (48.75%), Query Frame = 3
Query: 1032 EVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHEWIMDYKGHQSLIHCLLPTVHPVGVKRILSGGCDMALFVHDIDSGTILHRIADSSAILSICDLLDFVYYGTAEGKVATFSLEKNREMSSFHA-SDKGISCLTATKEGNVHLLFVGANTGEYSVWNA 1508
            E  +  +  +++F N L+  ++   +R Y+L + + I  ++GH S ++CLL T        + +G  D  +  +++ S   + ++     +L +      +Y G A G V TF+++ N+ +  F     + +SCL   +EG   LL VG+     SV +A
Sbjct: 1551 EGHQAAVNAIQIFGNLLYTCSADKTVRVYNLVSRKCIGVFEGHTSKVNCLLVTQTSGKNAALYTGSSDHTIRCYNVKSRECVEQLQLEDRVLCLHSRWRILYAGLANGTVVTFNIKNNKRLEIFECHGPRAVSCLATAQEGARKLLVVGSYDCTISVRDA 1710          
BLAST of SMED30004943 vs. Ensembl Human
Match: ZNF106 (zinc finger protein 106 [Source:HGNC Symbol;Acc:HGNC:12886])

HSP 1 Score: 61.6178 bits (148), Expect = 4.174e-9
Identity = 41/169 (24.26%), Postives = 82/169 (48.52%), Query Frame = 3
Query: 1032 EVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHEWIMDYKGHQSLIHCLLPTVHPVGVKRILSGGCDMALFVHDIDSGTILHRIADSSAILSICDLLDFVYYGTAEGKVATFSLEKNREMSSFHA-SDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKII 1535
            E  +  +  +++F N L+  ++   +R Y+L + + I  ++GH S ++CLL T        + +G  D  +  +++ S   + ++     +L +      +Y G A G V TF+++ N+ +  F     + +SCL   +EG   LL VG+     SV +A   + L+ +
Sbjct:  495 EGHQAAVNAIQIFGNLLYTCSADKTVRVYNLVSRKCIGVFEGHTSKVNCLLVTQTSGKNAALYTGSSDHTIRCYNVKSRECVEQLQLEDRVLCLHSRWRILYAGLANGTVVTFNIKNNKRLEIFECHGPRAVSCLATAQEGARKLLVVGSYDCTISVRDARNGLLLRTL 663          
BLAST of SMED30004943 vs. Ensembl Human
Match: ZNF106 (zinc finger protein 106 [Source:HGNC Symbol;Acc:HGNC:12886])

HSP 1 Score: 60.8474 bits (146), Expect = 8.886e-9
Identity = 41/169 (24.26%), Postives = 82/169 (48.52%), Query Frame = 3
Query: 1032 EVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHEWIMDYKGHQSLIHCLLPTVHPVGVKRILSGGCDMALFVHDIDSGTILHRIADSSAILSICDLLDFVYYGTAEGKVATFSLEKNREMSSFHA-SDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKII 1535
            E  +  +  +++F N L+  ++   +R Y+L + + I  ++GH S ++CLL T        + +G  D  +  +++ S   + ++     +L +      +Y G A G V TF+++ N+ +  F     + +SCL   +EG   LL VG+     SV +A   + L+ +
Sbjct:  756 EGHQAAVNAIQIFGNLLYTCSADKTVRVYNLVSRKCIGVFEGHTSKVNCLLVTQTSGKNAALYTGSSDHTIRCYNVKSRECVEQLQLEDRVLCLHSRWRILYAGLANGTVVTFNIKNNKRLEIFECHGPRAVSCLATAQEGARKLLVVGSYDCTISVRDARNGLLLRTL 924          
BLAST of SMED30004943 vs. Ensembl Human
Match: ZNF106 (zinc finger protein 106 [Source:HGNC Symbol;Acc:HGNC:12886])

HSP 1 Score: 60.4622 bits (145), Expect = 1.088e-8
Identity = 41/169 (24.26%), Postives = 82/169 (48.52%), Query Frame = 3
Query: 1032 EVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHEWIMDYKGHQSLIHCLLPTVHPVGVKRILSGGCDMALFVHDIDSGTILHRIADSSAILSICDLLDFVYYGTAEGKVATFSLEKNREMSSFHA-SDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKII 1535
            E  +  +  +++F N L+  ++   +R Y+L + + I  ++GH S ++CLL T        + +G  D  +  +++ S   + ++     +L +      +Y G A G V TF+++ N+ +  F     + +SCL   +EG   LL VG+     SV +A   + L+ +
Sbjct:  713 EGHQAAVNAIQIFGNLLYTCSADKTVRVYNLVSRKCIGVFEGHTSKVNCLLVTQTSGKNAALYTGSSDHTIRCYNVKSRECVEQLQLEDRVLCLHSRWRILYAGLANGTVVTFNIKNNKRLEIFECHGPRAVSCLATAQEGARKLLVVGSYDCTISVRDARNGLLLRTL 881          
BLAST of SMED30004943 vs. Ensembl Zebrafish
Match: znf106a (zinc finger protein 106a [Source:ZFIN;Acc:ZDB-GENE-040718-21])

HSP 1 Score: 64.6994 bits (156), Expect = 3.953e-10
Identity = 45/197 (22.84%), Postives = 93/197 (47.21%), Query Frame = 3
Query:  948 SLLVMVKADEQNGLYNAVEPKLSTITISEVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHEWIMDYKGHQSLIHCLLPTVHPVGVKRILSGGCDMALFVHDIDSGTILHRIADSSAILSICDLLDFVYYGTAEGKVATFSLEKNREMSSFHA-SDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKII 1535
            S   M+++   + + +  E +L T    E  +  +  M + N  L+  +    +R + L T + +  ++GH S ++CLL +      +R+ SG  D  +  + + +   + +++    +L + +    +Y G A G V T SL  N+++  F     + +SCL   +EG   +L VG+     SV +A + + L+ +
Sbjct: 1253 SASAMLESKVPSDMSDPGEEELPTEGDFEGHQEAVNGMHIHNGLLYTCSGDRTIRAFSLITRKCVAVFEGHSSKVNCLLVSCGGGLQQRLYSGSSDQTIRCYSLKTKECVEQLSLPDRVLCLHNRWKILYIGLANGSVITLSLRNNKQLDVFECHGPRAVSCLATAQEGARRILLVGSYDTTISVRDAKSGLLLRTL 1449          
BLAST of SMED30004943 vs. Ensembl Zebrafish
Match: znf106a (zinc finger protein 106a [Source:ZFIN;Acc:ZDB-GENE-040718-21])

HSP 1 Score: 64.6994 bits (156), Expect = 3.953e-10
Identity = 45/197 (22.84%), Postives = 93/197 (47.21%), Query Frame = 3
Query:  948 SLLVMVKADEQNGLYNAVEPKLSTITISEVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHEWIMDYKGHQSLIHCLLPTVHPVGVKRILSGGCDMALFVHDIDSGTILHRIADSSAILSICDLLDFVYYGTAEGKVATFSLEKNREMSSFHA-SDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKII 1535
            S   M+++   + + +  E +L T    E  +  +  M + N  L+  +    +R + L T + +  ++GH S ++CLL +      +R+ SG  D  +  + + +   + +++    +L + +    +Y G A G V T SL  N+++  F     + +SCL   +EG   +L VG+     SV +A + + L+ +
Sbjct: 1253 SASAMLESKVPSDMSDPGEEELPTEGDFEGHQEAVNGMHIHNGLLYTCSGDRTIRAFSLITRKCVAVFEGHSSKVNCLLVSCGGGLQQRLYSGSSDQTIRCYSLKTKECVEQLSLPDRVLCLHNRWKILYIGLANGSVITLSLRNNKQLDVFECHGPRAVSCLATAQEGARRILLVGSYDTTISVRDAKSGLLLRTL 1449          
BLAST of SMED30004943 vs. Ensembl Xenopus
Match: znf106 (zinc finger protein 106 [Source:NCBI gene;Acc:100145205])

HSP 1 Score: 53.9138 bits (128), Expect = 9.346e-7
Identity = 35/163 (21.47%), Postives = 73/163 (44.79%), Query Frame = 3
Query: 1050 ITDMKVFNNRLFVSASHGLLRQYHLGTHEWIMDYKGHQSLIHCLLPTVHPVGVKRILSGGCDMALFVHDIDSGTILHRIADSSAILSICDLLDFVYYGTAEGKVATFSLEKNREMSSFHA-SDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKII 1535
            +  +++    L+  ++   +R Y+L T + +  ++GH S ++CL+ T        + +G  D  +  + + +            +L        ++ G A G V TFSL+  ++   F     + +SC+   +EG+  LL VG+     SV +A   + L+ +
Sbjct: 1457 VNTVQIHQGLLYTCSADKTVRVYNLTTRQCVAVFEGHTSKVNCLVVTCTYKKSLAVFTGSSDHTIRCYSVKTREFQTAWNLGERVLCFHVRWKILFAGLANGNVVTFSLKSKKQTDVFECHGPRAVSCMATAQEGSRKLLLVGSYDCTISVRDACNGLLLRTL 1619          
BLAST of SMED30004943 vs. Ensembl Xenopus
Match: znf106 (zinc finger protein 106 [Source:NCBI gene;Acc:100145205])

HSP 1 Score: 53.9138 bits (128), Expect = 9.436e-7
Identity = 35/163 (21.47%), Postives = 73/163 (44.79%), Query Frame = 3
Query: 1050 ITDMKVFNNRLFVSASHGLLRQYHLGTHEWIMDYKGHQSLIHCLLPTVHPVGVKRILSGGCDMALFVHDIDSGTILHRIADSSAILSICDLLDFVYYGTAEGKVATFSLEKNREMSSFHA-SDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKII 1535
            +  +++    L+  ++   +R Y+L T + +  ++GH S ++CL+ T        + +G  D  +  + + +            +L        ++ G A G V TFSL+  ++   F     + +SC+   +EG+  LL VG+     SV +A   + L+ +
Sbjct: 1359 VNTVQIHQGLLYTCSADKTVRVYNLTTRQCVAVFEGHTSKVNCLVVTCTYKKSLAVFTGSSDHTIRCYSVKTREFQTAWNLGERVLCFHVRWKILFAGLANGNVVTFSLKSKKQTDVFECHGPRAVSCMATAQEGSRKLLLVGSYDCTISVRDACNGLLLRTL 1521          
BLAST of SMED30004943 vs. Ensembl Mouse
Match: Zfp106 (zinc finger protein 106 [Source:MGI Symbol;Acc:MGI:1270153])

HSP 1 Score: 65.0846 bits (157), Expect = 2.874e-10
Identity = 42/161 (26.09%), Postives = 80/161 (49.69%), Query Frame = 3
Query: 1032 EVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHEWIMDYKGHQSLIHCLLPTVHPVGVKRIL-SGGCDMALFVHDIDSGTILHRIADSSAILSICDLLDFVYYGTAEGKVATFSLEKNREMSSFHA-SDKGISCLTATKEGNVHLLFVGANTGEYSVWNA 1508
            E  +  +  +++F N L+  ++   +R Y+L + + +  ++GH S ++CLL T H  G   +L +G  D  +  ++I +   + ++     +L + +    +Y G A G V TF ++ N+    F     + +SCL   +EG   LL VG+     SV +A
Sbjct: 1510 EGHQAAVNAIQIFGNFLYTCSADTTVRVYNLVSRKCVGVFEGHTSKVNCLLVT-HTSGKSSVLYTGSSDHTIRCYNIKTRECMEQLQLEDRVLCLHNRWRTLYAGLANGTVVTFDIKNNKRQEIFECHGPRAVSCLATAQEGARKLLVVGSYDCTISVRDA 1669          
BLAST of SMED30004943 vs. Ensembl Mouse
Match: Zfp106 (zinc finger protein 106 [Source:MGI Symbol;Acc:MGI:1270153])

HSP 1 Score: 65.0846 bits (157), Expect = 2.879e-10
Identity = 42/161 (26.09%), Postives = 80/161 (49.69%), Query Frame = 3
Query: 1032 EVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHEWIMDYKGHQSLIHCLLPTVHPVGVKRIL-SGGCDMALFVHDIDSGTILHRIADSSAILSICDLLDFVYYGTAEGKVATFSLEKNREMSSFHA-SDKGISCLTATKEGNVHLLFVGANTGEYSVWNA 1508
            E  +  +  +++F N L+  ++   +R Y+L + + +  ++GH S ++CLL T H  G   +L +G  D  +  ++I +   + ++     +L + +    +Y G A G V TF ++ N+    F     + +SCL   +EG   LL VG+     SV +A
Sbjct: 1533 EGHQAAVNAIQIFGNFLYTCSADTTVRVYNLVSRKCVGVFEGHTSKVNCLLVT-HTSGKSSVLYTGSSDHTIRCYNIKTRECMEQLQLEDRVLCLHNRWRTLYAGLANGTVVTFDIKNNKRQEIFECHGPRAVSCLATAQEGARKLLVVGSYDCTISVRDA 1692          
BLAST of SMED30004943 vs. UniProt/SwissProt
Match: sp|Q9H2Y7|ZN106_HUMAN (Zinc finger protein 106 OS=Homo sapiens OX=9606 GN=ZNF106 PE=1 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 1.833e-9
Identity = 40/160 (25.00%), Postives = 78/160 (48.75%), Query Frame = 3
Query: 1032 EVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHEWIMDYKGHQSLIHCLLPTVHPVGVKRILSGGCDMALFVHDIDSGTILHRIADSSAILSICDLLDFVYYGTAEGKVATFSLEKNREMSSFHA-SDKGISCLTATKEGNVHLLFVGANTGEYSVWNA 1508
            E  +  +  +++F N L+  ++   +R Y+L + + I  ++GH S ++CLL T        + +G  D  +  +++ S   + ++     +L +      +Y G A G V TF+++ N+ +  F     + +SCL   +EG   LL VG+     SV +A
Sbjct: 1528 EGHQAAVNAIQIFGNLLYTCSADKTVRVYNLVSRKCIGVFEGHTSKVNCLLVTQTSGKNAALYTGSSDHTIRCYNVKSRECVEQLQLEDRVLCLHSRWRILYAGLANGTVVTFNIKNNKRLEIFECHGPRAVSCLATAQEGARKLLVVGSYDCTISVRDA 1687          
BLAST of SMED30004943 vs. UniProt/SwissProt
Match: sp|O88466|ZN106_MOUSE (Zinc finger protein 106 OS=Mus musculus OX=10090 GN=Znf106 PE=1 SV=3)

HSP 1 Score: 65.0846 bits (157), Expect = 2.014e-9
Identity = 42/161 (26.09%), Postives = 80/161 (49.69%), Query Frame = 3
Query: 1032 EVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHEWIMDYKGHQSLIHCLLPTVHPVGVKRIL-SGGCDMALFVHDIDSGTILHRIADSSAILSICDLLDFVYYGTAEGKVATFSLEKNREMSSFHA-SDKGISCLTATKEGNVHLLFVGANTGEYSVWNA 1508
            E  +  +  +++F N L+  ++   +R Y+L + + +  ++GH S ++CLL T H  G   +L +G  D  +  ++I +   + ++     +L + +    +Y G A G V TF ++ N+    F     + +SCL   +EG   LL VG+     SV +A
Sbjct: 1533 EGHQAAVNAIQIFGNFLYTCSADTTVRVYNLVSRKCVGVFEGHTSKVNCLLVT-HTSGKSSVLYTGSSDHTIRCYNIKTRECMEQLQLEDRVLCLHNRWRTLYAGLANGTVVTFDIKNNKRQEIFECHGPRAVSCLATAQEGARKLLVVGSYDCTISVRDA 1692          
BLAST of SMED30004943 vs. TrEMBL
Match: A0A1A8DCZ2 (WD_REPEATS_REGION domain-containing protein (Fragment) OS=Nothobranchius kadleci OX=1051664 GN=WDR86 PE=4 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.432e-11
Identity = 57/246 (23.17%), Postives = 115/246 (46.75%), Query Frame = 3
Query:  828 SIKICKLCNQYMIKCIFPDNIPKCVDTCFLLGS---------AQTDLPNSLLVMVKADEQNGLYNAVEPKLSTITISEVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHEWIMDYKGHQSLIHCLLPTVHPVGVKRILSGGCDMALFVHDIDSGTILHRIADSSAILSICDLLDFVYYGTAEGKVATFSLEKNREMSSFHA-SDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKII 1535
            S+++   C Q+ I        P+ +  C  L S         +++DLP  L V +  +  +   +  + +L T  + +  +  +  +++ N  L+  +    +R + L +HE +  ++GH S + CLL +  P   +R+ S  CD  +  + + +  +  + +    +L +      +Y G A G V TF+L  N++M  F     +G+SCL +++EG   +L VG++    SV  A   + L+ +
Sbjct: 1071 SMEVTTACQQHQIPAPPSTMEPQSL-ACNKLSSTSDMDVCKSSESDLP--LAVTLPKNSSDVFSDQCDDELPTEGVFDGHREVVNALQIQNGLLYTCSGDRTVRAFDLVSHECVGVFEGHSSKVTCLLISTAPSLYRRLYSASCDQTIRCYSLKTQELEQQFSLPDRVLCLHSRWKTLYAGLANGTVVTFNLRTNKQMDVFECHGPRGVSCLASSQEGAQRILLVGSSDSTISVRAAKHGLLLRTL 1313          
BLAST of SMED30004943 vs. TrEMBL
Match: A0A1A8CW20 (WD_REPEATS_REGION domain-containing protein OS=Nothobranchius kadleci OX=1051664 GN=WDR86 PE=4 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.907e-11
Identity = 50/205 (24.39%), Postives = 102/205 (49.76%), Query Frame = 3
Query:  924 SAQTDLPNSLLVMVKADEQNGLYNAVEPKLSTITISEVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHEWIMDYKGHQSLIHCLLPTVHPVGVKRILSGGCDMALFVHDIDSGTILHRIADSSAILSICDLLDFVYYGTAEGKVATFSLEKNREMSSFHA-SDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKII 1535
            S+++DLP  L V +  +  +   +  + +L T  + +  +  +  +++ N  L+  +    +R + L +HE +  ++GH S + CLL +  P   +R+ S  CD  +  + + +  +  + +    +L +      +Y G A G V TF+L  N++M  F     +G+SCL +++EG   +L VG++    SV  A   + L+ +
Sbjct: 1234 SSESDLP--LAVTLPKNSSDVFSDQCDDELPTEGVFDGHREVVNALQIQNGLLYTCSGDRTVRAFDLVSHECVGVFEGHSSKVTCLLISTAPSLYRRLYSASCDQTIRCYSLKTQELEQQFSLPDRVLCLHSRWKTLYAGLANGTVVTFNLRTNKQMDVFECHGPRGVSCLASSQEGAQRILLVGSSDSTISVRAAKHGLLLRTL 1436          
BLAST of SMED30004943 vs. TrEMBL
Match: A0A1A8V6G1 (WD_REPEATS_REGION domain-containing protein OS=Nothobranchius furzeri OX=105023 GN=WDR86 PE=4 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 4.349e-11
Identity = 49/205 (23.90%), Postives = 101/205 (49.27%), Query Frame = 3
Query:  924 SAQTDLPNSLLVMVKADEQNGLYNAVEPKLSTITISEVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHEWIMDYKGHQSLIHCLLPTVHPVGVKRILSGGCDMALFVHDIDSGTILHRIADSSAILSICDLLDFVYYGTAEGKVATFSLEKNREMSSFHA-SDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKII 1535
            S+++DLP    V +  +  +   +  + +L T  + +  +  +  +++ N  L+  +    +R + L +HE +  ++GH S + CLL +  P   +R+ S  CD  +  + + +  +  + +    +L +      +Y G A G V TF+L  N++M  F     +G+SCL +++EG   +L VG++    SV  A   + L+ +
Sbjct: 1257 SSESDLP--FAVTLPKNSSDVFSDQCDDELPTEGVFDGHREVVNALQIQNGLLYTCSGDRTVRAFDLVSHECVGVFEGHSSKVTCLLISTAPSLYRRLYSASCDQTIRCYSLKTQELEQQFSLPDRVLCLHSRWKTLYAGLANGTVVTFNLRTNKQMDVFECHGPRGVSCLASSQEGAQRILLVGSSDSTISVRAAKHGLLLRTL 1459          
BLAST of SMED30004943 vs. TrEMBL
Match: A0A1A8B927 (WD_REPEATS_REGION domain-containing protein OS=Nothobranchius furzeri OX=105023 GN=WDR86 PE=4 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 5.748e-11
Identity = 49/205 (23.90%), Postives = 101/205 (49.27%), Query Frame = 3
Query:  924 SAQTDLPNSLLVMVKADEQNGLYNAVEPKLSTITISEVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHEWIMDYKGHQSLIHCLLPTVHPVGVKRILSGGCDMALFVHDIDSGTILHRIADSSAILSICDLLDFVYYGTAEGKVATFSLEKNREMSSFHA-SDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKII 1535
            S+++DLP    V +  +  +   +  + +L T  + +  +  +  +++ N  L+  +    +R + L +HE +  ++GH S + CLL +  P   +R+ S  CD  +  + + +  +  + +    +L +      +Y G A G V TF+L  N++M  F     +G+SCL +++EG   +L VG++    SV  A   + L+ +
Sbjct: 1234 SSESDLP--FAVTLPKNSSDVFSDQCDDELPTEGVFDGHREVVNALQIQNGLLYTCSGDRTVRAFDLVSHECVGVFEGHSSKVTCLLISTAPSLYRRLYSASCDQTIRCYSLKTQELEQQFSLPDRVLCLHSRWKTLYAGLANGTVVTFNLRTNKQMDVFECHGPRGVSCLASSQEGAQRILLVGSSDSTISVRAAKHGLLLRTL 1436          
BLAST of SMED30004943 vs. TrEMBL
Match: A0A1A8F2X8 (WD_REPEATS_REGION domain-containing protein OS=Nothobranchius korthausae OX=1143690 GN=WDR86 PE=4 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 6.784e-11
Identity = 50/205 (24.39%), Postives = 100/205 (48.78%), Query Frame = 3
Query:  924 SAQTDLPNSLLVMVKADEQNGLYNAVEPKLSTITISEVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHEWIMDYKGHQSLIHCLLPTVHPVGVKRILSGGCDMALFVHDIDSGTILHRIADSSAILSICDLLDFVYYGTAEGKVATFSLEKNREMSSFHA-SDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKII 1535
            S+++DLP    V +  +  +   +  + +L T  + +  +  +  +++ N  L+  +    +R + L +HE +  ++GH S + CLL +  P    R+ S  CD  +  + + +  +  + +    +L +      +Y G A G V TF+L  N++M  F     +G+SCL +T+EG   +L VG++    SV  A   + L+ +
Sbjct: 1257 SSESDLP--FAVTLPKNSSDVFSDQCDDELPTEGVFDGHREVVNALQIQNGLLYTCSGDRTVRAFDLVSHECVGVFEGHSSKVTCLLISTAPSLYHRLYSASCDQTIRCYSLKTQELEQQFSLPDRVLCLHSRWKTLYAGLANGTVVTFNLRTNKQMDVFECHGPRGVSCLASTQEGAQRILLVGSSDSTISVRAAKHGLLLRTL 1459          
BLAST of SMED30004943 vs. Ensembl Nematostella
Match: EDO42888 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S023])

HSP 1 Score: 47.7506 bits (112), Expect = 7.109e-6
Identity = 52/280 (18.57%), Postives = 113/280 (40.36%), Query Frame = 3
Query: 1110 RQYHLGTHEWIMDYKGHQSLIHCLLPTVHPVGVKRILSGGCDMALFVHDIDSGTILHRIADSSAILSICDLLDFVYYGTAEGKVATFSLEKNREMSSFHASD-KGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKIITPVSHVEVPYEFIV--LQKQRLLAYTRNNVHFIQYTKIRSTSTFNHFDTISTLCLTRNYAIVGGVNGKLSIYKIKGSCIHKTPIRTITNSNSPVVSLTFYNNTIITGDKTGKIYFNRL*IK-YNIVVLLMANLIYQI 1937
            + + + T   +  Y GH + ++CL  +       R+ +G  D  +  +++ +    H+      ++ + +  D ++ G   G V    L+KN  +   H  D +G+SCL    EG   LL  G+     S+ ++     ++     S + V   FI       ++LA+  N    ++  K        H  ++S L +     +   ++  +  Y +  +      ++        + S+  +N  I +G + GK+   +L ++ Y+  +    NL Y +
Sbjct:   10 KAFDIQTGNCVKVYDGHHNAVNCLEISEDRT---RLFTGSNDQTVRSYNVKTAVCTHKFTFHGRVMCLHNAFDLLFVGLNTGIVTLVDLKKNACVERLHCHDPRGVSCLATATEGQRKLLCTGSFDATISIRDSTVSCAIRRDHVRSLINVVENFIYSGAADNQVLAHNLNTGELVRSYK-------GHTLSVSGLQVVGRVLVSSCLDKLIRCYDLASA----ELLQVYGGHKEMIFSVHMFNGKIYSGARDGKVVSVKLDLRVYHQCLWKDCNLKYGV 275          
BLAST of SMED30004943 vs. Ensembl Medaka
Match: znf106a (zinc finger protein 106 [Source:NCBI gene;Acc:101165188])

HSP 1 Score: 71.633 bits (174), Expect = 2.037e-12
Identity = 46/196 (23.47%), Postives = 91/196 (46.43%), Query Frame = 3
Query:  960 MVKADEQNGLYNAVEPKLSTITISE------VKKTF------ITDMKVFNNRLFVSASHGLLRQYHLGTHEWIMDYKGHQSLIHCLLPTVHPVGVKRILSGGCDMALFVHDIDSGTILHRIADSSAILSICDLLDFVYYGTAEGKVATFSLEKNREMSSFHASD-KGISCLTATKEGNVHLLFVGANTGEYSVWNA 1508
            + K+ E +  ++ V P+ S+++          +  F      +  M + +  L+  +    +R + L TH+ +   +GH S + CLL +  P    R+ SG  D ++  + + +  +  +   S  +L +      +Y G A G V TF L+ N++M  +     +G+SCL  ++EG   +L VG+     +V +A
Sbjct: 1528 LCKSSESDFPFSVVHPRNSSVSSDHGGDQGPTEGAFSGHQEAVNGMDIHDGLLYTCSGDRTVRVFDLVTHQCVGVMEGHASKVTCLLVSASPSLPHRLYSGSSDQSIRCYSLQTRELEQQFVVSERVLCLHSRWTLLYAGLANGSVVTFDLKTNKQMDVWDCHGLRGVSCLATSQEGACRILLVGSYDSTITVRDA 1723          
BLAST of SMED30004943 vs. Ensembl Medaka
Match: znf106a (zinc finger protein 106 [Source:NCBI gene;Acc:101165188])

HSP 1 Score: 71.633 bits (174), Expect = 2.039e-12
Identity = 46/196 (23.47%), Postives = 91/196 (46.43%), Query Frame = 3
Query:  960 MVKADEQNGLYNAVEPKLSTITISE------VKKTF------ITDMKVFNNRLFVSASHGLLRQYHLGTHEWIMDYKGHQSLIHCLLPTVHPVGVKRILSGGCDMALFVHDIDSGTILHRIADSSAILSICDLLDFVYYGTAEGKVATFSLEKNREMSSFHASD-KGISCLTATKEGNVHLLFVGANTGEYSVWNA 1508
            + K+ E +  ++ V P+ S+++          +  F      +  M + +  L+  +    +R + L TH+ +   +GH S + CLL +  P    R+ SG  D ++  + + +  +  +   S  +L +      +Y G A G V TF L+ N++M  +     +G+SCL  ++EG   +L VG+     +V +A
Sbjct: 1539 LCKSSESDFPFSVVHPRNSSVSSDHGGDQGPTEGAFSGHQEAVNGMDIHDGLLYTCSGDRTVRVFDLVTHQCVGVMEGHASKVTCLLVSASPSLPHRLYSGSSDQSIRCYSLQTRELEQQFVVSERVLCLHSRWTLLYAGLANGSVVTFDLKTNKQMDVWDCHGLRGVSCLATSQEGACRILLVGSYDSTITVRDA 1734          
BLAST of SMED30004943 vs. Ensembl Medaka
Match: ENSORLT00000015533.2 (zinc finger protein 106-like [Source:NCBI gene;Acc:101157503])

HSP 1 Score: 64.3142 bits (155), Expect = 3.266e-10
Identity = 41/160 (25.62%), Postives = 81/160 (50.62%), Query Frame = 3
Query: 1059 MKVFNNRLFVSASHGLLRQYHLGTHEWIMDYKGHQSLIHCLLPTVHPVGVKRILSGGCDMALFVHDIDSGTILHRIADSSAILSICDLLDFVYYGTAEGKVATFSLEKNREMSSFHA-SDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKII 1535
            +++ +  L+  ++    R Y+L T E    ++GH + ++CLL ++ P    R+ +G  D  +  + + S   L +I+    +L +    + +Y G A G V ++ L+  +E+  F     +G+SCL   +EG   LL VG+     SV +A + + L+ +
Sbjct:  977 LQIHDGILYTCSADNTARAYNLVTRECQAVFQGHTNKVNCLLVSIVPYLPARLYTGSSDQTIRCYSLKSKRCLQQISLPDRVLCLHVAWNILYAGLASGSVFSYDLKTLKELDVFECHGPRGVSCLGTAQEGARRLLLVGSYDSTISVRDAKSGLLLRSL 1136          
BLAST of SMED30004943 vs. Ensembl Medaka
Match: ENSORLT00000034363.1 (zinc finger protein 106-like [Source:NCBI gene;Acc:101157503])

HSP 1 Score: 63.929 bits (154), Expect = 4.685e-10
Identity = 41/160 (25.62%), Postives = 81/160 (50.62%), Query Frame = 3
Query: 1059 MKVFNNRLFVSASHGLLRQYHLGTHEWIMDYKGHQSLIHCLLPTVHPVGVKRILSGGCDMALFVHDIDSGTILHRIADSSAILSICDLLDFVYYGTAEGKVATFSLEKNREMSSFHA-SDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKII 1535
            +++ +  L+  ++    R Y+L T E    ++GH + ++CLL ++ P    R+ +G  D  +  + + S   L +I+    +L +    + +Y G A G V ++ L+  +E+  F     +G+SCL   +EG   LL VG+     SV +A + + L+ +
Sbjct:  942 LQIHDGILYTCSADNTARAYNLVTRECQAVFQGHTNKVNCLLVSIVPYLPARLYTGSSDQTIRCYSLKSKRCLQQISLPDRVLCLHVAWNILYAGLASGSVFSYDLKTLKELDVFECHGPRGVSCLGTAQEGARRLLLVGSYDSTISVRDAKSGLLLRSL 1101          
BLAST of SMED30004943 vs. Planmine SMEST
Match: SMESG000069576.1 (SMESG000069576.1)

HSP 1 Score: 703.36 bits (1814), Expect = 0.000e+0
Identity = 340/341 (99.71%), Postives = 341/341 (100.00%), Query Frame = 3
Query:  861 MIKCIFPDNIPKCVDTCFLLGSAQTDLPNSLLVMVKADEQNGLYNAVEPKLSTITISEVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHEWIMDYKGHQSLIHCLLPTVHPVGVKRILSGGCDMALFVHDIDSGTILHRIADSSAILSICDLLDFVYYGTAEGKVATFSLEKNREMSSFHASDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKIITPVSHVEVPYEFIVLQKQRLLAYTRNNVHFIQYTKIRSTSTFNHFDTISTLCLTRNYAIVGGVNGKLSIYKIKGSCIHKTPIRTITNSNSPVVSLTFYNNTIITGDKTGKIYFNRL 1883
            MIKCIFPDNIP+CVDTCFLLGSAQTDLPNSLLVMVKADEQNGLYNAVEPKLSTITISEVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHEWIMDYKGHQSLIHCLLPTVHPVGVKRILSGGCDMALFVHDIDSGTILHRIADSSAILSICDLLDFVYYGTAEGKVATFSLEKNREMSSFHASDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKIITPVSHVEVPYEFIVLQKQRLLAYTRNNVHFIQYTKIRSTSTFNHFDTISTLCLTRNYAIVGGVNGKLSIYKIKGSCIHKTPIRTITNSNSPVVSLTFYNNTIITGDKTGKIYFNRL
Sbjct:    1 MIKCIFPDNIPECVDTCFLLGSAQTDLPNSLLVMVKADEQNGLYNAVEPKLSTITISEVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHEWIMDYKGHQSLIHCLLPTVHPVGVKRILSGGCDMALFVHDIDSGTILHRIADSSAILSICDLLDFVYYGTAEGKVATFSLEKNREMSSFHASDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKIITPVSHVEVPYEFIVLQKQRLLAYTRNNVHFIQYTKIRSTSTFNHFDTISTLCLTRNYAIVGGVNGKLSIYKIKGSCIHKTPIRTITNSNSPVVSLTFYNNTIITGDKTGKIYFNRL 341          
BLAST of SMED30004943 vs. Planmine SMEST
Match: SMESG000069576.1 (SMESG000069576.1)

HSP 1 Score: 697.967 bits (1800), Expect = 0.000e+0
Identity = 332/334 (99.40%), Postives = 334/334 (100.00%), Query Frame = 3
Query:  882 DNIPKCVDTCFLLGSAQTDLPNSLLVMVKADEQNGLYNAVEPKLSTITISEVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHEWIMDYKGHQSLIHCLLPTVHPVGVKRILSGGCDMALFVHDIDSGTILHRIADSSAILSICDLLDFVYYGTAEGKVATFSLEKNREMSSFHASDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKIITPVSHVEVPYEFIVLQKQRLLAYTRNNVHFIQYTKIRSTSTFNHFDTISTLCLTRNYAIVGGVNGKLSIYKIKGSCIHKTPIRTITNSNSPVVSLTFYNNTIITGDKTGKIYFNRL 1883
            +NIP+CVDTCFLLGSAQTDLPNSLLVMVKADEQNGLYNAVEPKLSTITISEVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHEWIMDYKGHQSLIHCLLPTVHPVGVKRILSGGCDMALFVHDIDSGTILHRIADSSAILSICDLLDFVYYGTAEGKVATFSLEKNREMSSFHASDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKIITPVSHVEVPYEFIVLQKQRLLAYTRNNVHFIQYTKIRSTSTFNHFDTISTLCLTRNYAIVGGVNGKLSIYKIKGSCIHKTPIRTITNSNSPVVSLTFYNNTIITGDKTGKIYFNRL
Sbjct:  461 NNIPECVDTCFLLGSAQTDLPNSLLVMVKADEQNGLYNAVEPKLSTITISEVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHEWIMDYKGHQSLIHCLLPTVHPVGVKRILSGGCDMALFVHDIDSGTILHRIADSSAILSICDLLDFVYYGTAEGKVATFSLEKNREMSSFHASDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKIITPVSHVEVPYEFIVLQKQRLLAYTRNNVHFIQYTKIRSTSTFNHFDTISTLCLTRNYAIVGGVNGKLSIYKIKGSCIHKTPIRTITNSNSPVVSLTFYNNTIITGDKTGKIYFNRL 794          
BLAST of SMED30004943 vs. Planmine SMEST
Match: SMESG000069576.1 (SMESG000069576.1)

HSP 1 Score: 669.848 bits (1727), Expect = 0.000e+0
Identity = 320/320 (100.00%), Postives = 320/320 (100.00%), Query Frame = 3
Query:  924 SAQTDLPNSLLVMVKADEQNGLYNAVEPKLSTITISEVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHEWIMDYKGHQSLIHCLLPTVHPVGVKRILSGGCDMALFVHDIDSGTILHRIADSSAILSICDLLDFVYYGTAEGKVATFSLEKNREMSSFHASDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKIITPVSHVEVPYEFIVLQKQRLLAYTRNNVHFIQYTKIRSTSTFNHFDTISTLCLTRNYAIVGGVNGKLSIYKIKGSCIHKTPIRTITNSNSPVVSLTFYNNTIITGDKTGKIYFNRL 1883
            SAQTDLPNSLLVMVKADEQNGLYNAVEPKLSTITISEVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHEWIMDYKGHQSLIHCLLPTVHPVGVKRILSGGCDMALFVHDIDSGTILHRIADSSAILSICDLLDFVYYGTAEGKVATFSLEKNREMSSFHASDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKIITPVSHVEVPYEFIVLQKQRLLAYTRNNVHFIQYTKIRSTSTFNHFDTISTLCLTRNYAIVGGVNGKLSIYKIKGSCIHKTPIRTITNSNSPVVSLTFYNNTIITGDKTGKIYFNRL
Sbjct:  462 SAQTDLPNSLLVMVKADEQNGLYNAVEPKLSTITISEVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHEWIMDYKGHQSLIHCLLPTVHPVGVKRILSGGCDMALFVHDIDSGTILHRIADSSAILSICDLLDFVYYGTAEGKVATFSLEKNREMSSFHASDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKIITPVSHVEVPYEFIVLQKQRLLAYTRNNVHFIQYTKIRSTSTFNHFDTISTLCLTRNYAIVGGVNGKLSIYKIKGSCIHKTPIRTITNSNSPVVSLTFYNNTIITGDKTGKIYFNRL 781          
BLAST of SMED30004943 vs. Planmine SMEST
Match: SMESG000052755.1 (SMESG000052755.1)

HSP 1 Score: 587.415 bits (1513), Expect = 0.000e+0
Identity = 277/334 (82.93%), Postives = 307/334 (91.92%), Query Frame = 3
Query:  882 DNIPKCVDTCFLLGSAQTDLPNSLLVMVKADEQNGLYNAVEPKLSTITISEVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHEWIMDYKGHQSLIHCLLPTVHPVGVKRILSGGCDMALFVHDIDSGTILHRIADSSAILSICDLLDFVYYGTAEGKVATFSLEKNREMSSFHASDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKIITPVSHVEVPYEFIVLQKQRLLAYTRNNVHFIQYTKIRSTSTFNHFDTISTLCLTRNYAIVGGVNGKLSIYKIKGSCIHKTPIRTITNSNSPVVSLTFYNNTIITGDKTGKIYFNRL 1883
            + IP+CVDT F+L + QTDL ++L VM+KAD +NGL++A+EPKL+TI IS+ +KTFITD+KVFNNRLF SASHGLLRQYHLGTHE IMDYKGHQSLIHCLLPTVHPVGVKRILSGG D  LFVHDIDSG IL +I + SAILSICD L+FVYYGTAEG VATFSLEK++ MSSF ASDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKIITPVSH+E+P +FIVLQKQRLLAYTRNNVHFIQY K +STSTFNHFD+IS+LCLTRNY I+GGV GK+S+YKIKGSCIHKTPIRTITNSNSPVVSLTFYNNTIITGDKTGK+YFNRL
Sbjct:  445 NRIPECVDTSFMLETPQTDLSSNLHVMMKADGENGLFHAIEPKLNTIIISDEEKTFITDIKVFNNRLFASASHGLLRQYHLGTHECIMDYKGHQSLIHCLLPTVHPVGVKRILSGGFDKTLFVHDIDSGAILQKIENDSAILSICDQLEFVYYGTAEGLVATFSLEKDKRMSSFRASDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKIITPVSHLEIPIDFIVLQKQRLLAYTRNNVHFIQYVKTKSTSTFNHFDSISSLCLTRNYVIIGGVCGKVSVYKIKGSCIHKTPIRTITNSNSPVVSLTFYNNTIITGDKTGKVYFNRL 778          
BLAST of SMED30004943 vs. Planmine SMEST
Match: SMESG000052755.1 (SMESG000052755.1)

HSP 1 Score: 587.415 bits (1513), Expect = 0.000e+0
Identity = 277/334 (82.93%), Postives = 307/334 (91.92%), Query Frame = 3
Query:  882 DNIPKCVDTCFLLGSAQTDLPNSLLVMVKADEQNGLYNAVEPKLSTITISEVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHEWIMDYKGHQSLIHCLLPTVHPVGVKRILSGGCDMALFVHDIDSGTILHRIADSSAILSICDLLDFVYYGTAEGKVATFSLEKNREMSSFHASDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKIITPVSHVEVPYEFIVLQKQRLLAYTRNNVHFIQYTKIRSTSTFNHFDTISTLCLTRNYAIVGGVNGKLSIYKIKGSCIHKTPIRTITNSNSPVVSLTFYNNTIITGDKTGKIYFNRL 1883
            + IP+CVDT F+L + QTDL ++L VM+KAD +NGL++A+EPKL+TI IS+ +KTFITD+KVFNNRLF SASHGLLRQYHLGTHE IMDYKGHQSLIHCLLPTVHPVGVKRILSGG D  LFVHDIDSG IL +I + SAILSICD L+FVYYGTAEG VATFSLEK++ MSSF ASDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKIITPVSH+E+P +FIVLQKQRLLAYTRNNVHFIQY K +STSTFNHFD+IS+LCLTRNY I+GGV GK+S+YKIKGSCIHKTPIRTITNSNSPVVSLTFYNNTIITGDKTGK+YFNRL
Sbjct:  449 NRIPECVDTSFMLETPQTDLSSNLHVMMKADGENGLFHAIEPKLNTIIISDEEKTFITDIKVFNNRLFASASHGLLRQYHLGTHECIMDYKGHQSLIHCLLPTVHPVGVKRILSGGFDKTLFVHDIDSGAILQKIENDSAILSICDQLEFVYYGTAEGLVATFSLEKDKRMSSFRASDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKIITPVSHLEIPIDFIVLQKQRLLAYTRNNVHFIQYVKTKSTSTFNHFDSISSLCLTRNYVIIGGVCGKVSVYKIKGSCIHKTPIRTITNSNSPVVSLTFYNNTIITGDKTGKVYFNRL 782          
The following BLAST results are available for this feature:
BLAST of SMED30004943 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZNF1063.817e-1025.00zinc finger protein 106 [Source:HGNC Symbol;Acc:HG... [more]
ZNF1063.825e-1025.00zinc finger protein 106 [Source:HGNC Symbol;Acc:HG... [more]
ZNF1064.174e-924.26zinc finger protein 106 [Source:HGNC Symbol;Acc:HG... [more]
ZNF1068.886e-924.26zinc finger protein 106 [Source:HGNC Symbol;Acc:HG... [more]
ZNF1061.088e-824.26zinc finger protein 106 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of SMED30004943 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004943 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004943 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
znf106a3.953e-1022.84zinc finger protein 106a [Source:ZFIN;Acc:ZDB-GENE... [more]
znf106a3.953e-1022.84zinc finger protein 106a [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of SMED30004943 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
znf1069.346e-721.47zinc finger protein 106 [Source:NCBI gene;Acc:1001... [more]
znf1069.436e-721.47zinc finger protein 106 [Source:NCBI gene;Acc:1001... [more]
back to top
BLAST of SMED30004943 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Zfp1062.874e-1026.09zinc finger protein 106 [Source:MGI Symbol;Acc:MGI... [more]
Zfp1062.879e-1026.09zinc finger protein 106 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of SMED30004943 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q9H2Y7|ZN106_HUMAN1.833e-925.00Zinc finger protein 106 OS=Homo sapiens OX=9606 GN... [more]
sp|O88466|ZN106_MOUSE2.014e-926.09Zinc finger protein 106 OS=Mus musculus OX=10090 G... [more]
back to top
BLAST of SMED30004943 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1A8DCZ21.432e-1123.17WD_REPEATS_REGION domain-containing protein (Fragm... [more]
A0A1A8CW201.907e-1124.39WD_REPEATS_REGION domain-containing protein OS=Not... [more]
A0A1A8V6G14.349e-1123.90WD_REPEATS_REGION domain-containing protein OS=Not... [more]
A0A1A8B9275.748e-1123.90WD_REPEATS_REGION domain-containing protein OS=Not... [more]
A0A1A8F2X86.784e-1124.39WD_REPEATS_REGION domain-containing protein OS=Not... [more]
back to top
BLAST of SMED30004943 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004943 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004943 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004943 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO428887.109e-618.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30004943 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
znf106a2.037e-1223.47zinc finger protein 106 [Source:NCBI gene;Acc:1011... [more]
znf106a2.039e-1223.47zinc finger protein 106 [Source:NCBI gene;Acc:1011... [more]
ENSORLT00000015533.23.266e-1025.63zinc finger protein 106-like [Source:NCBI gene;Acc... [more]
ENSORLT00000034363.14.685e-1025.63zinc finger protein 106-like [Source:NCBI gene;Acc... [more]
back to top
BLAST of SMED30004943 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069576.10.000e+099.71SMESG000069576.1[more]
SMESG000069576.10.000e+099.40SMESG000069576.1[more]
SMESG000069576.10.000e+0100.00SMESG000069576.1[more]
SMESG000052755.10.000e+082.93SMESG000052755.1[more]
SMESG000052755.10.000e+082.93SMESG000052755.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004943 ID=SMED30004943|Name=SMED30004943|organism=Schmidtea mediterranea sexual|type=transcript|length=2068bp
GCAATCGCCCAATGGTTTTTATTTATATTGAGAATTTATGGATAAAAAAT
AACTTTTATACCGGTCTGTACTCGATATGAACTAATTGACGTTTAGTGGC
AATGTGAGACTTCACTTAAGTCCAACTGATTTTTTTATTTTAAAGGTTAA
ATCAACTGACATGGACAGTATTTGTAGATTGGTTTTTAATTATGACTAAA
TTTGTTTGTCCGACCGACCCGTGAAAAACTCTGATTTCCAACCTTTTTTA
AATGGTATTACAAAAACACAAAAAGTTACCACATCATCATCTCTTTATAA
TTTAAATCGTTTTTTAAATATTTCTTATTAATACATTATTTACTAATATT
TAAGTTCGTTGGAATAAAAGTAGGGTGCAAGTAATAAGCAAATTTTGATG
ACTATTATAGATATCTAGAATAAAAAATGTCATATTCTGGGACACAGTTA
GCTTCTCAATTTTAATTATAAGTCGAGAAATGTTTTACTAAATTTGAGGA
CTTTATTCAATTTGACTTCTACACGGCTCATACAAAAATGATTATTTTTT
TTAAAAAAACTTTATCAAGTTAATTACTTTATATTTTTTACAAAATTTGA
CTATGAATCAGGTTTATTTAAGAAAATATTTAAAAATTATTAGTTTTAGA
ACTCTGTATACATCAACATTTCCGTAAAAGATTGAAACAATATGCTGGAT
AATAATTAATAATAATTTCACAGCTTAATTCTCCTAGTGTTTTCTCATAC
CAAAAGAGATAATAGAAATAAATTAATAAAATTAATCATTCAATAATGAA
ATCAATTGAAATAAAAATGTTATATTGTCGATTAAAATATGCAAATTATG
CAATCAATATATGATAAAATGTATATTTCCAGACAATATTCCCAAATGCG
TTGACACTTGTTTTTTGCTAGGAAGCGCTCAAACAGATTTGCCCAATAGT
TTACTTGTAATGGTAAAAGCCGATGAACAAAACGGCCTATATAATGCCGT
TGAACCGAAATTGAGCACGATAACCATAAGTGAAGTGAAGAAAACCTTCA
TTACAGATATGAAAGTGTTCAACAATCGGTTGTTTGTCAGTGCATCTCAC
GGGTTACTGAGGCAGTACCACCTGGGCACCCATGAATGGATTATGGATTA
TAAAGGCCACCAATCATTGATCCATTGCCTGTTACCGACAGTCCACCCGG
TCGGTGTCAAGCGGATTCTCAGCGGGGGCTGCGACATGGCACTGTTCGTT
CACGATATCGACTCCGGCACCATTTTGCACAGAATCGCAGACAGCAGCGC
AATCCTATCGATCTGTGACCTATTGGATTTCGTCTACTACGGAACCGCCG
AGGGAAAGGTCGCGACTTTCTCACTGGAAAAGAATAGAGAGATGAGCAGT
TTCCACGCGTCAGATAAGGGGATTTCCTGCCTGACCGCAACAAAGGAGGG
CAATGTCCATCTGCTGTTTGTCGGTGCAAACACCGGCGAATACAGCGTCT
GGAACGCAATCACGTATATCAAACTGAAGATCATCACTCCAGTGTCCCAT
GTAGAAGTCCCCTATGAATTCATAGTTCTCCAGAAGCAGCGGCTGCTGGC
ATACACAAGGAATAATGTCCATTTCATTCAATATACCAAAATAAGGTCCA
CTTCTACGTTCAATCATTTCGATACAATCAGTACTTTGTGTCTGACTAGA
AATTACGCAATTGTCGGAGGGGTGAATGGGAAACTTTCGATATATAAAAT
AAAAGGCTCCTGCATACATAAAACTCCAATCCGAACGATTACCAACTCGA
ATTCTCCTGTAGTTTCATTGACATTCTACAACAACACAATCATAACCGGG
GATAAGACTGGGAAAATCTATTTCAATCGATTGTAAATAAAATATAATAT
TGTTGTCTTATTAATGGCCAATTTGATTTATCAAATTGGTGATTCTCGTC
TGGTGAATATTGTGAAATAAATTGTAATCTCGTGTGATTGGTGGGAAATT
TTTTGTTTTAATGCATCAAGATAAAACTCGTGTTGATCACTCCAAACCCA
AATCTCCTATCGGCAGCC
back to top

protein sequence of SMED30004943-orf-1

>SMED30004943-orf-1 ID=SMED30004943-orf-1|Name=SMED30004943-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=120bp
MYAGAFYFIYRKFPIHPSDNCVISSQTQSTDCIEMIERRSGPYFGILNEM
DIIPCVCQQPLLLENYEFIGDFYMGHWSDDLQFDIRDCVPDAVFAGVCTD
KQQMDIALLCCGQAGNPLI*
back to top

protein sequence of SMED30004943-orf-2

>SMED30004943-orf-2 ID=SMED30004943-orf-2|Name=SMED30004943-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=342bp
MIKCIFPDNIPKCVDTCFLLGSAQTDLPNSLLVMVKADEQNGLYNAVEPK
LSTITISEVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHEWIMDYKGH
QSLIHCLLPTVHPVGVKRILSGGCDMALFVHDIDSGTILHRIADSSAILS
ICDLLDFVYYGTAEGKVATFSLEKNREMSSFHASDKGISCLTATKEGNVH
LLFVGANTGEYSVWNAITYIKLKIITPVSHVEVPYEFIVLQKQRLLAYTR
NNVHFIQYTKIRSTSTFNHFDTISTLCLTRNYAIVGGVNGKLSIYKIKGS
CIHKTPIRTITNSNSPVVSLTFYNNTIITGDKTGKIYFNRL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003676nucleic acid binding
GO:0008270zinc ion binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 303..340
e-value: 15.0
score: 9.5
coord: 90..132
e-value: 28.0
score: 7.9
coord: 174..215
e-value: 13.0
score: 10.0
coord: 260..296
e-value: 13.0
score: 9.9
NoneNo IPR availablePANTHERPTHR13720WD-40 REPEAT PROTEINcoord: 44..220
NoneNo IPR availablePANTHERPTHR13720:SF46coord: 44..220
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 62..338