Elongation factor 2

Overview
NameElongation factor 2
Smed IDSMED30004937
Length (bp)2949
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Elongation factor 2 (SMED30004937) t-SNE clustered cells

Violin plots show distribution of expression levels for Elongation factor 2 (SMED30004937) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Elongation factor 2 (SMED30004937) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Elongation factor 2 (SMED30004937) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004937

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30004937SMESG000042430.1 dd_Smed_v4_186_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30004937SMESG000042430.1 dd_Smed_v4_186_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30004937SMESG000042430.1 dd_Smed_v4_186_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30004937SMESG000042430.1 dd_Smed_v4_186_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30004937SMESG000042430.1 dd_Smed_v4_186_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004937SMESG000042430.1 dd_Smed_v4_186_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30004937SMESG000042430.1 dd_Smed_v4_186_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004937SMESG000042430.1 dd_Smed_v4_186_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30004937SMESG000042430.1 dd_Smed_v4_186_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30004937SMESG000042430.1 dd_Smed_v4_186_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30004937SMESG000042430.1 dd_Smed_v4_186_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004937SMESG000042430.1 Contig38997uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004937SMESG000042430.1 Contig38997newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 2 cellSMED30004937SMESG000042430.1 dd_Smed_v6_186_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Elongation factor 2 vs. Ensembl Human
Match: EEF2 (eukaryotic translation elongation factor 2 [Source:HGNC Symbol;Acc:HGNC:3214])

HSP 1 Score: 1202.19 bits (3109), Expect = 0.000e+0
Identity = 614/868 (70.74%), Postives = 709/868 (81.68%), Query Frame = 3
Query:  111 MVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELD-GPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSD-------------KLMKRLWGDNFFSEKSKKWCKRPD--EGV---RGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSEDIPPLDKFLDKL 2657
            MVNFT+DQIRA+M+KK NIRNMSVIAHVDHGKSTLTDSLV KAGIIA A+AG+ RFTDTRKDEQERCITIKSTAIS++ E++E+ L  +K       S DG     GFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVL MNKMD A+  LQ EPE+LYQ FQR++E+VNVII+ YGE + GPMG+I + P  GTVGFGSGL  WAFT+K FA+MY  KF    +              +MK+LWGD +F   + K+ K     EG    R F Q +L PI+ VF  +MN   E+ A+L +K+ +KLDSE+K  + K LLK +MR+WLPAGD LLQMI IHLPSP  +QKYR +LLYEGP DDE A+ +K+CDP G L+MYISKMVPTSDKGRFYAFGRVFSG V TG KVRIMGPNY  GKK+DLY K IQRTILMMGRYVE IEDVPCGNI GLVGVDQ+LVKTGTI+TF  AHN+RVMKFSVSPVVRVAVE KNPADLPKLVEGLKRLAKSDPMVQ  I+ESGE+IIAGAGELHLEICLKDLEE+HACIPIKKSDPVVSYRE+V++ S+ LCLSKSPNKHNRLYM A P  + LA DID G+++AR ++K+R R+L + Y+WDV+E+RKIWCFGPDG GPN++ D++KGVQYLNEIKDSVVA F WA+K+  LCEENMRGVRF++HDVTLHADAIHRGGGQIIPTARRC+YA+VLTA P L+EP+Y  EIQ PE  +GGIY  LN++RG +F E QVAGTP +VVKAYLPVNESF FT++LR+ TGGQAFPQCVFDHWQ+ PG+P D +++P   V +TRKRKGL E IP LD FLDKL
Sbjct:    1 MVNFTVDQIRAIMDKKANIRNMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLFYELSENDLNFIK------QSKDGA----GFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQRIVENVNVIISTYGEGESGPMGNIMIDPVLGTVGFGSGLHGWAFTLKQFAEMYVAKFAAKGEGQLGPAERAKKVEDMMKKLWGDRYFDPANGKFSKSATSPEGKKLPRTFCQLILDPIFKVFDAIMNFKKEETAKLIEKLDIKLDSEDKDKEGKPLLKAVMRRWLPAGDALLQMITIHLPSPVTAQKYRCELLYEGPPDDEAAMGIKSCDPKGPLMMYISKMVPTSDKGRFYAFGRVFSGLVSTGLKVRIMGPNYTPGKKEDLYLKPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQFLVKTGTITTFEHAHNMRVMKFSVSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHIIAGAGELHLEICLKDLEEDHACIPIKKSDPVVSYRETVSEESNVLCLSKSPNKHNRLYMKARPFPDGLAEDIDKGEVSARQELKQRARYLAEKYEWDVAEARKIWCFGPDGTGPNILTDITKGVQYLNEIKDSVVAGFQWATKEGALCEENMRGVRFDVHDVTLHADAIHRGGGQIIPTARRCLYASVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQVAGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPFDNSSRPSQVVAETRKRKGLKEGIPALDNFLDKL 858          
BLAST of Elongation factor 2 vs. Ensembl Human
Match: EFTUD2 (elongation factor Tu GTP binding domain containing 2 [Source:HGNC Symbol;Acc:HGNC:30858])

HSP 1 Score: 583.178 bits (1502), Expect = 0.000e+0
Identity = 316/874 (36.16%), Postives = 502/874 (57.44%), Query Frame = 3
Query:  105 LKMVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXX-XXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELDGPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKF-QMSSDKLMKRLWGDNFFSEKSKKWCKRP--DEGVRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAG---AHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVD------VSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLD---------PTTKPGIT---VRDTRKRKGLSEDIPPLDKFLD 2651
            L +  + +D +  LM+    IRN+++  H+ HGK+   D L+ +    I      D  +TD    EQER + IKST ++                  V L D   T  K +L N++D+PGHV+FS EVTA LR++DG ++ +D   GV + TE +++ A+ ER+   + +NK+D  +  L+  P D Y K + +++ VN +I+ Y   +    ++ ++P  G V F S   S  FT+ +FA +YA  F  ++  +  KRLWGD +F+ K++K+ K+       R F +F+L+P+Y +   V+            ++G+ L  EE  L  + LL+ + +K+       + M   H+PSP +  K + +  Y G +D ++  +M +CDP+G L+ + +KM  T D  +F+AFGRV SG +  GQ V+++G NY    ++D    ++ R  + + RY   +  VP GN   + GVDQ +VKT TI+   G   A   R +KF+ + V+++AVEP NP++LPK+++GL+++ KS P +   ++ESGE++I G GEL+L+  + DL + ++ I IK +DPVV++ E+V +TSS  C +++PNK N++ M A P+ + LA DI+   +    + K+ G F    YDWD+  +R IW FGPD  GPN++VD      V K +  L  +KDS+V  F W +++  LC+E +R V+F I D  +  + +HRGGGQIIPTARR +Y+  L A P L+EP Y  E+Q P   +  +Y+ L +RRG +  +  + G+P Y +KA++P  +SF F ++LR  T GQAF   VF HWQ+ PG+PLD         P   P +    +  TR+RKGLSED+  + KF D
Sbjct:   74 LPVTVYEMDFLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQDLCYTDILFTEQERGVGIKSTPVT------------------VVLPD---TKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTERLIKHAVQERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTDE----NLILSPLLGNVCFSSSQYSICFTLGSFAKIYADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKAPTSSSQRSFVEFILEPLYKILAQVVGDVDTSLPRTLDELGIHLTKEELKLNIRPLLRLVCKKFFGEFTGFVDMCVQHIPSPKVGAKPKIEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTKMYSTDDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIEVNRVPAGNWVLIEGVDQPIVKTATITEPRGNEEAQIFRPLKFNTTSVIKIAVEPVNPSELPKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCVMHDLRKMYSEIDIKVADPVVTFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQTKYDWDLLAARSIWAFGPDATGPNILVDDTLPSEVDKAL--LGSVKDSIVQGFQWGTREGPLCDELIRNVKFKILDAVVAQEPLHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFSLSVFHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDV-SISKFFD 919          
BLAST of Elongation factor 2 vs. Ensembl Human
Match: EFTUD2 (elongation factor Tu GTP binding domain containing 2 [Source:HGNC Symbol;Acc:HGNC:30858])

HSP 1 Score: 582.793 bits (1501), Expect = 0.000e+0
Identity = 316/874 (36.16%), Postives = 502/874 (57.44%), Query Frame = 3
Query:  105 LKMVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXX-XXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELDGPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKF-QMSSDKLMKRLWGDNFFSEKSKKWCKRP--DEGVRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAG---AHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVD------VSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLD---------PTTKPGIT---VRDTRKRKGLSEDIPPLDKFLD 2651
            L +  + +D +  LM+    IRN+++  H+ HGK+   D L+ +    I      D  +TD    EQER + IKST ++                  V L D   T  K +L N++D+PGHV+FS EVTA LR++DG ++ +D   GV + TE +++ A+ ER+   + +NK+D  +  L+  P D Y K + +++ VN +I+ Y   +    ++ ++P  G V F S   S  FT+ +FA +YA  F  ++  +  KRLWGD +F+ K++K+ K+       R F +F+L+P+Y +   V+            ++G+ L  EE  L  + LL+ + +K+       + M   H+PSP +  K + +  Y G +D ++  +M +CDP+G L+ + +KM  T D  +F+AFGRV SG +  GQ V+++G NY    ++D    ++ R  + + RY   +  VP GN   + GVDQ +VKT TI+   G   A   R +KF+ + V+++AVEP NP++LPK+++GL+++ KS P +   ++ESGE++I G GEL+L+  + DL + ++ I IK +DPVV++ E+V +TSS  C +++PNK N++ M A P+ + LA DI+   +    + K+ G F    YDWD+  +R IW FGPD  GPN++VD      V K +  L  +KDS+V  F W +++  LC+E +R V+F I D  +  + +HRGGGQIIPTARR +Y+  L A P L+EP Y  E+Q P   +  +Y+ L +RRG +  +  + G+P Y +KA++P  +SF F ++LR  T GQAF   VF HWQ+ PG+PLD         P   P +    +  TR+RKGLSED+  + KF D
Sbjct:  109 LPVTVYEMDFLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQDLCYTDILFTEQERGVGIKSTPVT------------------VVLPD---TKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTERLIKHAVQERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTDE----NLILSPLLGNVCFSSSQYSICFTLGSFAKIYADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKAPTSSSQRSFVEFILEPLYKILAQVVGDVDTSLPRTLDELGIHLTKEELKLNIRPLLRLVCKKFFGEFTGFVDMCVQHIPSPKVGAKPKIEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTKMYSTDDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIEVNRVPAGNWVLIEGVDQPIVKTATITEPRGNEEAQIFRPLKFNTTSVIKIAVEPVNPSELPKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCVMHDLRKMYSEIDIKVADPVVTFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQTKYDWDLLAARSIWAFGPDATGPNILVDDTLPSEVDKAL--LGSVKDSIVQGFQWGTREGPLCDELIRNVKFKILDAVVAQEPLHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFSLSVFHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDV-SISKFFD 954          
BLAST of Elongation factor 2 vs. Ensembl Human
Match: EFTUD2 (elongation factor Tu GTP binding domain containing 2 [Source:HGNC Symbol;Acc:HGNC:30858])

HSP 1 Score: 582.793 bits (1501), Expect = 0.000e+0
Identity = 316/874 (36.16%), Postives = 502/874 (57.44%), Query Frame = 3
Query:  105 LKMVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXX-XXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELDGPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKF-QMSSDKLMKRLWGDNFFSEKSKKWCKRP--DEGVRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAG---AHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVD------VSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLD---------PTTKPGIT---VRDTRKRKGLSEDIPPLDKFLD 2651
            L +  + +D +  LM+    IRN+++  H+ HGK+   D L+ +    I      D  +TD    EQER + IKST ++                  V L D   T  K +L N++D+PGHV+FS EVTA LR++DG ++ +D   GV + TE +++ A+ ER+   + +NK+D  +  L+  P D Y K + +++ VN +I+ Y   +    ++ ++P  G V F S   S  FT+ +FA +YA  F  ++  +  KRLWGD +F+ K++K+ K+       R F +F+L+P+Y +   V+            ++G+ L  EE  L  + LL+ + +K+       + M   H+PSP +  K + +  Y G +D ++  +M +CDP+G L+ + +KM  T D  +F+AFGRV SG +  GQ V+++G NY    ++D    ++ R  + + RY   +  VP GN   + GVDQ +VKT TI+   G   A   R +KF+ + V+++AVEP NP++LPK+++GL+++ KS P +   ++ESGE++I G GEL+L+  + DL + ++ I IK +DPVV++ E+V +TSS  C +++PNK N++ M A P+ + LA DI+   +    + K+ G F    YDWD+  +R IW FGPD  GPN++VD      V K +  L  +KDS+V  F W +++  LC+E +R V+F I D  +  + +HRGGGQIIPTARR +Y+  L A P L+EP Y  E+Q P   +  +Y+ L +RRG +  +  + G+P Y +KA++P  +SF F ++LR  T GQAF   VF HWQ+ PG+PLD         P   P +    +  TR+RKGLSED+  + KF D
Sbjct:  109 LPVTVYEMDFLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQDLCYTDILFTEQERGVGIKSTPVT------------------VVLPD---TKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTERLIKHAVQERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTDE----NLILSPLLGNVCFSSSQYSICFTLGSFAKIYADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKAPTSSSQRSFVEFILEPLYKILAQVVGDVDTSLPRTLDELGIHLTKEELKLNIRPLLRLVCKKFFGEFTGFVDMCVQHIPSPKVGAKPKIEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTKMYSTDDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIEVNRVPAGNWVLIEGVDQPIVKTATITEPRGNEEAQIFRPLKFNTTSVIKIAVEPVNPSELPKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCVMHDLRKMYSEIDIKVADPVVTFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQTKYDWDLLAARSIWAFGPDATGPNILVDDTLPSEVDKAL--LGSVKDSIVQGFQWGTREGPLCDELIRNVKFKILDAVVAQEPLHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFSLSVFHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDV-SISKFFD 954          
BLAST of Elongation factor 2 vs. Ensembl Human
Match: EFTUD2 (elongation factor Tu GTP binding domain containing 2 [Source:HGNC Symbol;Acc:HGNC:30858])

HSP 1 Score: 575.089 bits (1481), Expect = 0.000e+0
Identity = 314/873 (35.97%), Postives = 498/873 (57.04%), Query Frame = 3
Query:  105 LKMVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELDGPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKF-QMSSDKLMKRLWGDNFFSEKSKKWCKRP--DEGVRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAG---AHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVD------VSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLD---------PTTKPGIT---VRDTRKRKGLSEDIPPLDKFLD 2651
            L +  + +D +  LM+    IRN+++  H+ HGK+            I      D  +TD    EQER + IKST ++                  V L D   T  K +L N++D+PGHV+FS EVTA LR++DG ++ +D   GV + TE +++ A+ ER+   + +NK+D  +  L+  P D Y K + +++ VN +I+ Y   +    ++ ++P  G V F S   S  FT+ +FA +YA  F  ++  +  KRLWGD +F+ K++K+ K+       R F +F+L+P+Y +   V+            ++G+ L  EE  L  + LL+ + +K+       + M   H+PSP +  K + +  Y G +D ++  +M +CDP+G L+ + +KM  T D  +F+AFGRV SG +  GQ V+++G NY    ++D    ++ R  + + RY   +  VP GN   + GVDQ +VKT TI+   G   A   R +KF+ + V+++AVEP NP++LPK+++GL+++ KS P +   ++ESGE++I G GEL+L+  + DL + ++ I IK +DPVV++ E+V +TSS  C +++PNK N++ M A P+ + LA DI+   +    + K+ G F    YDWD+  +R IW FGPD  GPN++VD      V K +  L  +KDS+V  F W +++  LC+E +R V+F I D  +  + +HRGGGQIIPTARR +Y+  L A P L+EP Y  E+Q P   +  +Y+ L +RRG +  +  + G+P Y +KA++P  +SF F ++LR  T GQAF   VF HWQ+ PG+PLD         P   P +    +  TR+RKGLSED+  + KF D
Sbjct:  109 LPVTVYEMDFLADLMDNSELIRNVTLCGHLHHGKT---------HPEIRKRYDQDLCYTDILFTEQERGVGIKSTPVT------------------VVLPD---TKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTERLIKHAVQERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTDE----NLILSPLLGNVCFSSSQYSICFTLGSFAKIYADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKAPTSSSQRSFVEFILEPLYKILAQVVGDVDTSLPRTLDELGIHLTKEELKLNIRPLLRLVCKKFFGEFTGFVDMCVQHIPSPKVGAKPKIEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTKMYSTDDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIEVNRVPAGNWVLIEGVDQPIVKTATITEPRGNEEAQIFRPLKFNTTSVIKIAVEPVNPSELPKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCVMHDLRKMYSEIDIKVADPVVTFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQTKYDWDLLAARSIWAFGPDATGPNILVDDTLPSEVDKAL--LGSVKDSIVQGFQWGTREGPLCDELIRNVKFKILDAVVAQEPLHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFSLSVFHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDV-SISKFFD 944          
BLAST of Elongation factor 2 vs. Ensembl Celegans
Match: eef-2 (Elongation factor 2 [Source:UniProtKB/Swiss-Prot;Acc:P29691])

HSP 1 Score: 1237.25 bits (3200), Expect = 0.000e+0
Identity = 616/852 (72.30%), Postives = 710/852 (83.33%), Query Frame = 3
Query:  111 MVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVK-VVQPVALSDDGKTDE-KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELDGPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSDKLMKRLWGDNFFSEKSKKWCK-RPDEGVRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSEDIPPLDKFLDKL 2657
            MVNFT+D+IRALM++KRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAG+KAG+ RFTDTRKDEQERCITIKSTAIS++ E+ +  L  VK   Q   +  DGK ++  GFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLFMNKMD A+  LQ   E+L+Q FQR++E++NVIIA YG+ DGPMG I V P  G VGFGSGL  WAFT+K FA+MYA KF +  DKLMK LWGD FF  K+KKW   + DE  RGF QFVL PI+MVF  VMN   +  A L +K+G+KL ++EK L+ K L+K  MRKWLPAGDT+LQMI  HLPSP  +QKYR ++LYEGP DDE A+++K CDPNG L+MYISKMVPTSDKGRFYAFGRVFSGKV TG K RI GPNYV GKK+DLYEK+IQRTILMMGR++E IED+P GNI GLVGVDQYLVK GTI+T+  AHN+RVMKFSVSPVVRVAVE KNPADLPKLVEGLKRLAKSDPMVQ   +ESGE+IIAGAGELHLEICLKDLEE+HACIP+KKSDPVVSYRE+V   S+++CLSKSPNKHNRL+ TA PM + LA DI+ G + AR + K R + L + Y++DV+E+RKIWCFGPDG GPN+++DV+KGVQYLNEIKDSVVA F WA+++ +L +ENMRGVRFN+HDVTLHADAIHRGGGQIIPTARR  YA+VLTA P LLEPVY  EIQ PE A+GGIY  LN+RRG +F E QV GTP +VVKAYLPVNESF FT++LR+ TGGQAFPQCVFDHWQ+ PG+PL+  TKP   V DTRKRKGL E +P LD +LDK+
Sbjct:    1 MVNFTVDEIRALMDRKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGSKAGETRFTDTRKDEQERCITIKSTAISLFFELEKKDLEFVKGENQFETVEVDGKKEKYNGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLFMNKMDRALLELQLGAEELFQTFQRIVENINVIIATYGDDDGPMGPIMVDPSIGNVGFGSGLHGWAFTLKQFAEMYAGKFGVQVDKLMKNLWGDRFFDLKTKKWSSTQTDESKRGFCQFVLDPIFMVFDAVMNIKKDKTAALVEKLGIKLANDEKDLEGKPLMKVFMRKWLPAGDTMLQMIAFHLPSPVTAQKYRMEMLYEGPHDDEAAVAIKTCDPNGPLMMYISKMVPTSDKGRFYAFGRVFSGKVATGMKARIQGPNYVPGKKEDLYEKTIQRTILMMGRFIEPIEDIPSGNIAGLVGVDQYLVKGGTITTYKDAHNMRVMKFSVSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIFEESGEHIIAGAGELHLEICLKDLEEDHACIPLKKSDPVVSYRETVQSESNQICLSKSPNKHNRLHCTAQPMPDGLADDIEGGTVNARDEFKARAKILAEKYEYDVTEARKIWCFGPDGTGPNLLMDVTKGVQYLNEIKDSVVAGFQWATREGVLSDENMRGVRFNVHDVTLHADAIHRGGGQIIPTARRVFYASVLTAEPRLLEPVYLVEIQCPEAAVGGIYGVLNRRRGHVFEESQVTGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQVLPGDPLEAGTKPNQIVLDTRKRKGLKEGVPALDNYLDKM 852          
BLAST of Elongation factor 2 vs. Ensembl Celegans
Match: eef-2 (Elongation factor 2 [Source:UniProtKB/Swiss-Prot;Acc:P29691])

HSP 1 Score: 1237.25 bits (3200), Expect = 0.000e+0
Identity = 616/852 (72.30%), Postives = 710/852 (83.33%), Query Frame = 3
Query:  111 MVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVK-VVQPVALSDDGKTDE-KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELDGPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSDKLMKRLWGDNFFSEKSKKWCK-RPDEGVRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSEDIPPLDKFLDKL 2657
            MVNFT+D+IRALM++KRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAG+KAG+ RFTDTRKDEQERCITIKSTAIS++ E+ +  L  VK   Q   +  DGK ++  GFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLFMNKMD A+  LQ   E+L+Q FQR++E++NVIIA YG+ DGPMG I V P  G VGFGSGL  WAFT+K FA+MYA KF +  DKLMK LWGD FF  K+KKW   + DE  RGF QFVL PI+MVF  VMN   +  A L +K+G+KL ++EK L+ K L+K  MRKWLPAGDT+LQMI  HLPSP  +QKYR ++LYEGP DDE A+++K CDPNG L+MYISKMVPTSDKGRFYAFGRVFSGKV TG K RI GPNYV GKK+DLYEK+IQRTILMMGR++E IED+P GNI GLVGVDQYLVK GTI+T+  AHN+RVMKFSVSPVVRVAVE KNPADLPKLVEGLKRLAKSDPMVQ   +ESGE+IIAGAGELHLEICLKDLEE+HACIP+KKSDPVVSYRE+V   S+++CLSKSPNKHNRL+ TA PM + LA DI+ G + AR + K R + L + Y++DV+E+RKIWCFGPDG GPN+++DV+KGVQYLNEIKDSVVA F WA+++ +L +ENMRGVRFN+HDVTLHADAIHRGGGQIIPTARR  YA+VLTA P LLEPVY  EIQ PE A+GGIY  LN+RRG +F E QV GTP +VVKAYLPVNESF FT++LR+ TGGQAFPQCVFDHWQ+ PG+PL+  TKP   V DTRKRKGL E +P LD +LDK+
Sbjct:    1 MVNFTVDEIRALMDRKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGSKAGETRFTDTRKDEQERCITIKSTAISLFFELEKKDLEFVKGENQFETVEVDGKKEKYNGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLFMNKMDRALLELQLGAEELFQTFQRIVENINVIIATYGDDDGPMGPIMVDPSIGNVGFGSGLHGWAFTLKQFAEMYAGKFGVQVDKLMKNLWGDRFFDLKTKKWSSTQTDESKRGFCQFVLDPIFMVFDAVMNIKKDKTAALVEKLGIKLANDEKDLEGKPLMKVFMRKWLPAGDTMLQMIAFHLPSPVTAQKYRMEMLYEGPHDDEAAVAIKTCDPNGPLMMYISKMVPTSDKGRFYAFGRVFSGKVATGMKARIQGPNYVPGKKEDLYEKTIQRTILMMGRFIEPIEDIPSGNIAGLVGVDQYLVKGGTITTYKDAHNMRVMKFSVSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIFEESGEHIIAGAGELHLEICLKDLEEDHACIPLKKSDPVVSYRETVQSESNQICLSKSPNKHNRLHCTAQPMPDGLADDIEGGTVNARDEFKARAKILAEKYEYDVTEARKIWCFGPDGTGPNLLMDVTKGVQYLNEIKDSVVAGFQWATREGVLSDENMRGVRFNVHDVTLHADAIHRGGGQIIPTARRVFYASVLTAEPRLLEPVYLVEIQCPEAAVGGIYGVLNRRRGHVFEESQVTGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQVLPGDPLEAGTKPNQIVLDTRKRKGLKEGVPALDNYLDKM 852          
BLAST of Elongation factor 2 vs. Ensembl Celegans
Match: eef-2 (Elongation factor 2 [Source:UniProtKB/Swiss-Prot;Acc:P29691])

HSP 1 Score: 1237.25 bits (3200), Expect = 0.000e+0
Identity = 616/852 (72.30%), Postives = 710/852 (83.33%), Query Frame = 3
Query:  111 MVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVK-VVQPVALSDDGKTDE-KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELDGPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSDKLMKRLWGDNFFSEKSKKWCK-RPDEGVRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSEDIPPLDKFLDKL 2657
            MVNFT+D+IRALM++KRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAG+KAG+ RFTDTRKDEQERCITIKSTAIS++ E+ +  L  VK   Q   +  DGK ++  GFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLFMNKMD A+  LQ   E+L+Q FQR++E++NVIIA YG+ DGPMG I V P  G VGFGSGL  WAFT+K FA+MYA KF +  DKLMK LWGD FF  K+KKW   + DE  RGF QFVL PI+MVF  VMN   +  A L +K+G+KL ++EK L+ K L+K  MRKWLPAGDT+LQMI  HLPSP  +QKYR ++LYEGP DDE A+++K CDPNG L+MYISKMVPTSDKGRFYAFGRVFSGKV TG K RI GPNYV GKK+DLYEK+IQRTILMMGR++E IED+P GNI GLVGVDQYLVK GTI+T+  AHN+RVMKFSVSPVVRVAVE KNPADLPKLVEGLKRLAKSDPMVQ   +ESGE+IIAGAGELHLEICLKDLEE+HACIP+KKSDPVVSYRE+V   S+++CLSKSPNKHNRL+ TA PM + LA DI+ G + AR + K R + L + Y++DV+E+RKIWCFGPDG GPN+++DV+KGVQYLNEIKDSVVA F WA+++ +L +ENMRGVRFN+HDVTLHADAIHRGGGQIIPTARR  YA+VLTA P LLEPVY  EIQ PE A+GGIY  LN+RRG +F E QV GTP +VVKAYLPVNESF FT++LR+ TGGQAFPQCVFDHWQ+ PG+PL+  TKP   V DTRKRKGL E +P LD +LDK+
Sbjct:    1 MVNFTVDEIRALMDRKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGSKAGETRFTDTRKDEQERCITIKSTAISLFFELEKKDLEFVKGENQFETVEVDGKKEKYNGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLFMNKMDRALLELQLGAEELFQTFQRIVENINVIIATYGDDDGPMGPIMVDPSIGNVGFGSGLHGWAFTLKQFAEMYAGKFGVQVDKLMKNLWGDRFFDLKTKKWSSTQTDESKRGFCQFVLDPIFMVFDAVMNIKKDKTAALVEKLGIKLANDEKDLEGKPLMKVFMRKWLPAGDTMLQMIAFHLPSPVTAQKYRMEMLYEGPHDDEAAVAIKTCDPNGPLMMYISKMVPTSDKGRFYAFGRVFSGKVATGMKARIQGPNYVPGKKEDLYEKTIQRTILMMGRFIEPIEDIPSGNIAGLVGVDQYLVKGGTITTYKDAHNMRVMKFSVSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIFEESGEHIIAGAGELHLEICLKDLEEDHACIPLKKSDPVVSYRETVQSESNQICLSKSPNKHNRLHCTAQPMPDGLADDIEGGTVNARDEFKARAKILAEKYEYDVTEARKIWCFGPDGTGPNLLMDVTKGVQYLNEIKDSVVAGFQWATREGVLSDENMRGVRFNVHDVTLHADAIHRGGGQIIPTARRVFYASVLTAEPRLLEPVYLVEIQCPEAAVGGIYGVLNRRRGHVFEESQVTGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQVLPGDPLEAGTKPNQIVLDTRKRKGLKEGVPALDNYLDKM 852          
BLAST of Elongation factor 2 vs. Ensembl Celegans
Match: eef-2 (Elongation factor 2 [Source:UniProtKB/Swiss-Prot;Acc:P29691])

HSP 1 Score: 1213.75 bits (3139), Expect = 0.000e+0
Identity = 606/840 (72.14%), Postives = 698/840 (83.10%), Query Frame = 3
Query:  147 MEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVK-VVQPVALSDDGKTDE-KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELDGPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSDKLMKRLWGDNFFSEKSKKWCK-RPDEGVRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSEDIPPLDKFLDKL 2657
            M++KRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAG+KAG+ RFTDTRKDEQERCITIKSTAIS++ E+ +  L  VK   Q   +  DGK ++  GFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLFMNKMD A+  LQ   E+L+Q FQR++E++NVIIA YG+ DGPMG I V P  G VGFGSGL  WAFT+K FA+MYA KF +  DKLMK LWGD FF  K+KKW   + DE  RGF QFVL PI+MVF  VMN   +  A L +K+G+KL ++EK L+ K L+K  MRKWLPAGDT+LQMI  HLPSP  +QKYR ++LYEGP DDE A+++K CDPNG L+MYISKMVPTSDKGRFYAFGRVFSGKV TG K RI GPNYV GKK+DLYEK+IQRTILMMGR++E IED+P GNI GLVGVDQYLVK GTI+T+  AHN+RVMKFSVSPVVRVAVE KNPADLPKLVEGLKRLAKSDPMVQ   +ESGE+IIAGAGELHLEICLKDLEE+HACIP+KKSDPVVSYRE+V   S+++CLSKSPNKHNRL+ TA PM + LA DI+ G + AR + K R + L + Y++DV+E+RKIWCFGPDG GPN+++DV+KGVQYLNEIKDSVVA F WA+++ +L +ENMRGVRFN+HDVTLHADAIHRGGGQIIPTARR  YA+VLTA P LLEPVY  EIQ PE A+GGIY  LN+RRG +F E QV GTP +VVKAYLPVNESF FT++LR+ TGGQAFPQCVFDHWQ+ PG+PL+  TKP   V DTRKRKGL E +P LD +LDK+
Sbjct:    1 MDRKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGSKAGETRFTDTRKDEQERCITIKSTAISLFFELEKKDLEFVKGENQFETVEVDGKKEKYNGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLFMNKMDRALLELQLGAEELFQTFQRIVENINVIIATYGDDDGPMGPIMVDPSIGNVGFGSGLHGWAFTLKQFAEMYAGKFGVQVDKLMKNLWGDRFFDLKTKKWSSTQTDESKRGFCQFVLDPIFMVFDAVMNIKKDKTAALVEKLGIKLANDEKDLEGKPLMKVFMRKWLPAGDTMLQMIAFHLPSPVTAQKYRMEMLYEGPHDDEAAVAIKTCDPNGPLMMYISKMVPTSDKGRFYAFGRVFSGKVATGMKARIQGPNYVPGKKEDLYEKTIQRTILMMGRFIEPIEDIPSGNIAGLVGVDQYLVKGGTITTYKDAHNMRVMKFSVSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIFEESGEHIIAGAGELHLEICLKDLEEDHACIPLKKSDPVVSYRETVQSESNQICLSKSPNKHNRLHCTAQPMPDGLADDIEGGTVNARDEFKARAKILAEKYEYDVTEARKIWCFGPDGTGPNLLMDVTKGVQYLNEIKDSVVAGFQWATREGVLSDENMRGVRFNVHDVTLHADAIHRGGGQIIPTARRVFYASVLTAEPRLLEPVYLVEIQCPEAAVGGIYGVLNRRRGHVFEESQVTGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQVLPGDPLEAGTKPNQIVLDTRKRKGLKEGVPALDNYLDKM 840          
BLAST of Elongation factor 2 vs. Ensembl Celegans
Match: eef-2 (Elongation factor 2 [Source:UniProtKB/Swiss-Prot;Acc:P29691])

HSP 1 Score: 1213.75 bits (3139), Expect = 0.000e+0
Identity = 606/840 (72.14%), Postives = 698/840 (83.10%), Query Frame = 3
Query:  147 MEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVK-VVQPVALSDDGKTDE-KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELDGPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSDKLMKRLWGDNFFSEKSKKWCK-RPDEGVRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSEDIPPLDKFLDKL 2657
            M++KRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAG+KAG+ RFTDTRKDEQERCITIKSTAIS++ E+ +  L  VK   Q   +  DGK ++  GFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLFMNKMD A+  LQ   E+L+Q FQR++E++NVIIA YG+ DGPMG I V P  G VGFGSGL  WAFT+K FA+MYA KF +  DKLMK LWGD FF  K+KKW   + DE  RGF QFVL PI+MVF  VMN   +  A L +K+G+KL ++EK L+ K L+K  MRKWLPAGDT+LQMI  HLPSP  +QKYR ++LYEGP DDE A+++K CDPNG L+MYISKMVPTSDKGRFYAFGRVFSGKV TG K RI GPNYV GKK+DLYEK+IQRTILMMGR++E IED+P GNI GLVGVDQYLVK GTI+T+  AHN+RVMKFSVSPVVRVAVE KNPADLPKLVEGLKRLAKSDPMVQ   +ESGE+IIAGAGELHLEICLKDLEE+HACIP+KKSDPVVSYRE+V   S+++CLSKSPNKHNRL+ TA PM + LA DI+ G + AR + K R + L + Y++DV+E+RKIWCFGPDG GPN+++DV+KGVQYLNEIKDSVVA F WA+++ +L +ENMRGVRFN+HDVTLHADAIHRGGGQIIPTARR  YA+VLTA P LLEPVY  EIQ PE A+GGIY  LN+RRG +F E QV GTP +VVKAYLPVNESF FT++LR+ TGGQAFPQCVFDHWQ+ PG+PL+  TKP   V DTRKRKGL E +P LD +LDK+
Sbjct:    1 MDRKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGSKAGETRFTDTRKDEQERCITIKSTAISLFFELEKKDLEFVKGENQFETVEVDGKKEKYNGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLFMNKMDRALLELQLGAEELFQTFQRIVENINVIIATYGDDDGPMGPIMVDPSIGNVGFGSGLHGWAFTLKQFAEMYAGKFGVQVDKLMKNLWGDRFFDLKTKKWSSTQTDESKRGFCQFVLDPIFMVFDAVMNIKKDKTAALVEKLGIKLANDEKDLEGKPLMKVFMRKWLPAGDTMLQMIAFHLPSPVTAQKYRMEMLYEGPHDDEAAVAIKTCDPNGPLMMYISKMVPTSDKGRFYAFGRVFSGKVATGMKARIQGPNYVPGKKEDLYEKTIQRTILMMGRFIEPIEDIPSGNIAGLVGVDQYLVKGGTITTYKDAHNMRVMKFSVSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIFEESGEHIIAGAGELHLEICLKDLEEDHACIPLKKSDPVVSYRETVQSESNQICLSKSPNKHNRLHCTAQPMPDGLADDIEGGTVNARDEFKARAKILAEKYEYDVTEARKIWCFGPDGTGPNLLMDVTKGVQYLNEIKDSVVAGFQWATREGVLSDENMRGVRFNVHDVTLHADAIHRGGGQIIPTARRVFYASVLTAEPRLLEPVYLVEIQCPEAAVGGIYGVLNRRRGHVFEESQVTGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQVLPGDPLEAGTKPNQIVLDTRKRKGLKEGVPALDNYLDKM 840          
BLAST of Elongation factor 2 vs. Ensembl Fly
Match: eEF2 (gene:FBgn0000559 transcript:FBtr0085911)

HSP 1 Score: 1235.32 bits (3195), Expect = 0.000e+0
Identity = 611/850 (71.88%), Postives = 714/850 (84.00%), Query Frame = 3
Query:  111 MVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELDGPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSDKLMKRLWGDNFFSEKSKKWCKRPD-EGVRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSEDIPPLDKFLDKL 2657
            MVNFT+D+IR LM+KKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGAKAG+ RFTDTRKDEQERCITIKSTAISMY E+ E  L  V +  P    D  + + KGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKP+LFMNKMD A+  LQ + E+LYQ FQR++E+VNVIIA Y +  GPMG+++V P  G+VGFGSGL  WAFT+K F++MY++KF++   KLM RLWG+NFF+ K+KKW K+ + +  R F  ++L PIY VF  +MN   E+   L +K+GV L  E+K    K LLK +MR WLPAG+ LLQMI IHLPSP ++QKYR ++LYEGP DDE AI++K+CDP+G L+MYISKMVPTSDKGRFYAFGRVF+GKV TGQK RIMGPNY  GKK+DLYEK+IQRTILMMGRYVEAIEDVP GNICGLVGVDQ+LVKTGTI+TF  AHN++VMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQ  I+ESGE+IIAGAGELHLEICLKDLEE+HACIP+KKSDPVVSYRE+V++ S ++CLSKSPNKHNRL M A PM + L  DID G ++A+ + K R R+L + YD+DV+E+RKIWCFGPDG GPN ++D +K VQYLNEIKDSVVA F WASK+ IL +EN+RGVRFNI+DVTLHADAIHRGGGQIIPT RRC+YA  +TA P L+EPVY CEIQ PE A+GGIY  LN+RRG +F E QV GTP +VVKAYLPVNESF FT++LR+ TGGQAFPQCVFDHWQ+ PG+P +P++KP   V+DTRKRKGL E +P L ++LDKL
Sbjct:    1 MVNFTVDEIRGLMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGAKAGETRFTDTRKDEQERCITIKSTAISMYFEVEEKDL--VFITHP----DQREKECKGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPILFMNKMDRALLELQLDAEELYQTFQRIVENVNVIIATYNDDGGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMYSEKFKIDVVKLMNRLWGENFFNAKTKKWQKQKEADNKRSFCMYILDPIYKVFDAIMNYKKEEIGTLLEKIGVTLKHEDKDKDGKALLKTVMRTWLPAGEALLQMIAIHLPSPVVAQKYRMEMLYEGPHDDEAAIAVKSCDPDGPLMMYISKMVPTSDKGRFYAFGRVFAGKVATGQKCRIMGPNYTPGKKEDLYEKAIQRTILMMGRYVEAIEDVPSGNICGLVGVDQFLVKTGTITTFKDAHNMKVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHIIAGAGELHLEICLKDLEEDHACIPLKKSDPVVSYRETVSEESDQMCLSKSPNKHNRLLMKALPMPDGLPEDIDNGDVSAKDEFKARARYLSEKYDYDVTEARKIWCFGPDGTGPNFILDCTKSVQYLNEIKDSVVAGFQWASKEGILADENLRGVRFNIYDVTLHADAIHRGGGQIIPTTRRCLYAAAITAKPRLMEPVYLCEIQCPEVAVGGIYGVLNRRRGHVFEENQVVGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQVLPGDPSEPSSKPYAIVQDTRKRKGLKEGLPDLSQYLDKL 844          
BLAST of Elongation factor 2 vs. Ensembl Fly
Match: eEF2 (gene:FBgn0000559 transcript:FBtr0085912)

HSP 1 Score: 1235.32 bits (3195), Expect = 0.000e+0
Identity = 611/850 (71.88%), Postives = 714/850 (84.00%), Query Frame = 3
Query:  111 MVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELDGPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSDKLMKRLWGDNFFSEKSKKWCKRPD-EGVRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSEDIPPLDKFLDKL 2657
            MVNFT+D+IR LM+KKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGAKAG+ RFTDTRKDEQERCITIKSTAISMY E+ E  L  V +  P    D  + + KGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKP+LFMNKMD A+  LQ + E+LYQ FQR++E+VNVIIA Y +  GPMG+++V P  G+VGFGSGL  WAFT+K F++MY++KF++   KLM RLWG+NFF+ K+KKW K+ + +  R F  ++L PIY VF  +MN   E+   L +K+GV L  E+K    K LLK +MR WLPAG+ LLQMI IHLPSP ++QKYR ++LYEGP DDE AI++K+CDP+G L+MYISKMVPTSDKGRFYAFGRVF+GKV TGQK RIMGPNY  GKK+DLYEK+IQRTILMMGRYVEAIEDVP GNICGLVGVDQ+LVKTGTI+TF  AHN++VMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQ  I+ESGE+IIAGAGELHLEICLKDLEE+HACIP+KKSDPVVSYRE+V++ S ++CLSKSPNKHNRL M A PM + L  DID G ++A+ + K R R+L + YD+DV+E+RKIWCFGPDG GPN ++D +K VQYLNEIKDSVVA F WASK+ IL +EN+RGVRFNI+DVTLHADAIHRGGGQIIPT RRC+YA  +TA P L+EPVY CEIQ PE A+GGIY  LN+RRG +F E QV GTP +VVKAYLPVNESF FT++LR+ TGGQAFPQCVFDHWQ+ PG+P +P++KP   V+DTRKRKGL E +P L ++LDKL
Sbjct:    1 MVNFTVDEIRGLMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGAKAGETRFTDTRKDEQERCITIKSTAISMYFEVEEKDL--VFITHP----DQREKECKGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPILFMNKMDRALLELQLDAEELYQTFQRIVENVNVIIATYNDDGGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMYSEKFKIDVVKLMNRLWGENFFNAKTKKWQKQKEADNKRSFCMYILDPIYKVFDAIMNYKKEEIGTLLEKIGVTLKHEDKDKDGKALLKTVMRTWLPAGEALLQMIAIHLPSPVVAQKYRMEMLYEGPHDDEAAIAVKSCDPDGPLMMYISKMVPTSDKGRFYAFGRVFAGKVATGQKCRIMGPNYTPGKKEDLYEKAIQRTILMMGRYVEAIEDVPSGNICGLVGVDQFLVKTGTITTFKDAHNMKVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHIIAGAGELHLEICLKDLEEDHACIPLKKSDPVVSYRETVSEESDQMCLSKSPNKHNRLLMKALPMPDGLPEDIDNGDVSAKDEFKARARYLSEKYDYDVTEARKIWCFGPDGTGPNFILDCTKSVQYLNEIKDSVVAGFQWASKEGILADENLRGVRFNIYDVTLHADAIHRGGGQIIPTTRRCLYAAAITAKPRLMEPVYLCEIQCPEVAVGGIYGVLNRRRGHVFEENQVVGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQVLPGDPSEPSSKPYAIVQDTRKRKGLKEGLPDLSQYLDKL 844          
BLAST of Elongation factor 2 vs. Ensembl Fly
Match: eEF2 (gene:FBgn0000559 transcript:FBtr0332966)

HSP 1 Score: 1235.32 bits (3195), Expect = 0.000e+0
Identity = 611/850 (71.88%), Postives = 714/850 (84.00%), Query Frame = 3
Query:  111 MVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELDGPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSDKLMKRLWGDNFFSEKSKKWCKRPD-EGVRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSEDIPPLDKFLDKL 2657
            MVNFT+D+IR LM+KKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGAKAG+ RFTDTRKDEQERCITIKSTAISMY E+ E  L  V +  P    D  + + KGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKP+LFMNKMD A+  LQ + E+LYQ FQR++E+VNVIIA Y +  GPMG+++V P  G+VGFGSGL  WAFT+K F++MY++KF++   KLM RLWG+NFF+ K+KKW K+ + +  R F  ++L PIY VF  +MN   E+   L +K+GV L  E+K    K LLK +MR WLPAG+ LLQMI IHLPSP ++QKYR ++LYEGP DDE AI++K+CDP+G L+MYISKMVPTSDKGRFYAFGRVF+GKV TGQK RIMGPNY  GKK+DLYEK+IQRTILMMGRYVEAIEDVP GNICGLVGVDQ+LVKTGTI+TF  AHN++VMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQ  I+ESGE+IIAGAGELHLEICLKDLEE+HACIP+KKSDPVVSYRE+V++ S ++CLSKSPNKHNRL M A PM + L  DID G ++A+ + K R R+L + YD+DV+E+RKIWCFGPDG GPN ++D +K VQYLNEIKDSVVA F WASK+ IL +EN+RGVRFNI+DVTLHADAIHRGGGQIIPT RRC+YA  +TA P L+EPVY CEIQ PE A+GGIY  LN+RRG +F E QV GTP +VVKAYLPVNESF FT++LR+ TGGQAFPQCVFDHWQ+ PG+P +P++KP   V+DTRKRKGL E +P L ++LDKL
Sbjct:    1 MVNFTVDEIRGLMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGAKAGETRFTDTRKDEQERCITIKSTAISMYFEVEEKDL--VFITHP----DQREKECKGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPILFMNKMDRALLELQLDAEELYQTFQRIVENVNVIIATYNDDGGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMYSEKFKIDVVKLMNRLWGENFFNAKTKKWQKQKEADNKRSFCMYILDPIYKVFDAIMNYKKEEIGTLLEKIGVTLKHEDKDKDGKALLKTVMRTWLPAGEALLQMIAIHLPSPVVAQKYRMEMLYEGPHDDEAAIAVKSCDPDGPLMMYISKMVPTSDKGRFYAFGRVFAGKVATGQKCRIMGPNYTPGKKEDLYEKAIQRTILMMGRYVEAIEDVPSGNICGLVGVDQFLVKTGTITTFKDAHNMKVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHIIAGAGELHLEICLKDLEEDHACIPLKKSDPVVSYRETVSEESDQMCLSKSPNKHNRLLMKALPMPDGLPEDIDNGDVSAKDEFKARARYLSEKYDYDVTEARKIWCFGPDGTGPNFILDCTKSVQYLNEIKDSVVAGFQWASKEGILADENLRGVRFNIYDVTLHADAIHRGGGQIIPTTRRCLYAAAITAKPRLMEPVYLCEIQCPEVAVGGIYGVLNRRRGHVFEENQVVGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQVLPGDPSEPSSKPYAIVQDTRKRKGLKEGLPDLSQYLDKL 844          
BLAST of Elongation factor 2 vs. Ensembl Fly
Match: CG4849 (gene:FBgn0039566 transcript:FBtr0085257)

HSP 1 Score: 569.696 bits (1467), Expect = 0.000e+0
Identity = 309/879 (35.15%), Postives = 505/879 (57.45%), Query Frame = 3
Query:  102 ELKMVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXX-XXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELDGPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQ-MSSDKLMKRLWGDNFFSEKSKKWCKRP--DEGVRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNL---RVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVD------VSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVR----------------DTRKRKGLSEDIPPLDKFLD 2651
            +++   + ++ +  LM+    IRN++++ H+ HGK+T  D L+ +        +    R+TDT   EQER  +IK+T +++             V+Q V         +K +L+N+ D+PGHV+FS E TAA+R++DG ++ +D   GV + TE +L+ A+ ER    + +NK+D  +  L+  P+D Y K + ++E VN +++ YG    P  ++ V+P  G V F S L  + FT+K+FA +YA  ++ ++     KRLWGD +F+ K++K+ K+   +   R F +F+L+P+Y +   V+       ++   ++ V++  EE     + LL+ +  +++      + M   H+ SP  + K + D +Y GP + +I   M +C+  G L+++ SKM P  D   F    R+ SG +  GQ+VR++G NY    ++D     + R  +   RY   +  VP GN   + G+DQ +VKT TI       +L   R +KF+   ++++AVEP NP++LPK+++GL+++ KS P++   ++ESGE++I G GEL+L+  + DL + ++ I IK +DPVV++ E+V +TSS  C +++PNK N++ M + P+ + LA DI+ G +    + K  G F    YDWD+  +R IW FGPD  GPN++VD      V K +  L  +KDS+V  F W +++  LCEE +R V+F I D  +  +A+HRGGGQIIPTARR  Y+  L A P L+EP    E+Q P   +  +Y+ L +RRG +  +  V+G+P Y +KA++P  +SF F ++LR  T GQAF   VF HWQ+ PG+PLD +    I +R                 TR+RKGLSED+  ++KF D
Sbjct:  110 DMQETTYDMEFMADLMDTPPLIRNVALVGHLHHGKTTFVDCLIRQTHPQFETMEERQLRYTDTLFTEQERGCSIKATPVTL-------------VLQDVK--------QKSYLLNIFDTPGHVNFSDEATAAMRMSDGVVLFIDAAEGVMLNTERLLKHAVQERQAITVCINKIDRLILELKLPPQDAYFKLKHIVEEVNGLLSTYG---APDDNLLVSPILGNVCFASSLYGFCFTLKSFAKLYADTYEGVAYLDFAKRLWGDMYFNSKTRKFSKKQPHNSAQRSFVEFILEPMYKLIAQVVGDVDTTLSDTLAELNVRVSKEEMKSNIRPLLRLVCNRFMGDCSGFVDMCVEHIKSPLENAKRKVDHIYTGPKEGDIYRDMISCNQYGTLMVHSSKMYPNDDCTFFQVLARIVSGTLHAGQEVRVLGENYTLQDEEDSRILQVGRLWVFESRYKVELNRVPAGNWVLIEGIDQCIVKTSTIVDINVPEDLYIFRPLKFNTQSIIKIAVEPVNPSELPKMLDGLRKVNKSYPLLSTRVEESGEHVILGTGELYLDCVMHDLRKMYSEIDIKVADPVVAFCETVVETSSLKCFAETPNKKNKITMISEPLEKGLAEDIENGTVCINWNKKRIGEFFQVNYDWDLLAARSIWAFGPDSTGPNILVDDTLPSEVDKNL--LTAVKDSIVQGFQWGTREGPLCEEPIRNVKFKILDGVIANEALHRGGGQIIPTARRVAYSAFLMATPRLMEPYLFVEVQAPADCVSAVYTVLARRRGHVTQDAPVSGSPIYTIKAFIPAIDSFGFETDLRTHTQGQAFCLSVFHHWQIVPGDPLDKS----IIIRPLEPQQASHLAREFMIKTRRRKGLSEDV-SINKFFD 957          
BLAST of Elongation factor 2 vs. Ensembl Fly
Match: CG33158 (gene:FBgn0053158 transcript:FBtr0075390)

HSP 1 Score: 231.106 bits (588), Expect = 1.624e-62
Identity = 155/418 (37.08%), Postives = 233/418 (55.74%), Query Frame = 3
Query:  144 LMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVII---------------------AQYGELDGPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSDKLMKRLWGDNFFSEKSKKWCKRPDEGVRG--FNQFVLKPIYMVFQTV-MNKSLEDAAELAKKMGVKLDSEEKAL-QPKQLLKCIMRKWLPAGDTLLQMICIHLPSP-AISQKYRTDLLYEGPLD--------DEIAISMKNCDPN-GHLVMYISKMVP 1292
            L  +++ +RN+ ++AHVDHGK+TL DSLV+  GII+   AG  R+ D R DEQER IT+KS++IS+Y +  E+                G  D   +LINLIDSPGHVDFSSEV+ A+R+ DGA+VVVD V GV  QT   LRQ   E++KPVL +NK+D  +   Q +P D Y    +V+E VN ++                     +   E+D    ++  +P +G V F S    WAF+V++FA MYAK+ +MS   L   LWGD +++ K K+      E  +   F QFVL+ I+ ++  + + K  +    +A+K+G+KL + +  L  PK  +K ++ +WLP   ++L M+  H+P P  IS +    LLY   +D         E+  S  +CD N  +++ ++SKM P
Sbjct:   12 LQRRRQQVRNICILAHVDHGKTTLADSLVASNGIISQRMAGKLRYLDNRSDEQERGITMKSSSISLYYQEAEEMA--------------GNPD---YLINLIDSPGHVDFSSEVSTAVRLCDGAIVVVDVVEGVGPQTRACLRQIYEEQLKPVLVLNKLDRLILEKQMDPLDAYFHLCQVLEQVNAVLGSIFASDILAKEDITKKDNYESALEEVDD--SELYFSPSSGNVIFCSAYDGWAFSVRDFAAMYAKRLEMSRKDLENVLWGDFYYNSKKKEALPGAQEKAKKPMFVQFVLENIWSLYDIIAIRKDKDKLPGIAEKLGLKLATRDLRLTDPKLQIKAVLGQWLPIDKSVLHMVIQHVPPPHKISDERAQRLLYPANVDLSSLPPETLELKESFTSCDANSSNVIAFVSKMTP 410          

HSP 2 Score: 206.453 bits (524), Expect = 2.175e-54
Identity = 145/535 (27.10%), Postives = 236/535 (44.11%), Query Frame = 3
Query: 1311 FYAFGRVFSGKVGTGQKVRIMGPNY--------VSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVT-------------------QTSSELCLSKSPNKHNRLYMTAAPMGEE------------------------------LASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQ-------------------YLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHA---DAIHRG--GGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPL----------------DPTTKPGITVRDTRKRKGLSED 2624
            F AF RVFSG +  G ++  + P +          G+       +I    + MG  ++ +++VP GNI G+ G++ ++VKT T+S+     +   +    +P++RVA+EP  P D+PKLV+GLK L ++D  VQ+S+  +GE++I   GE+H+E C+ DLE+ +A I +  S P+VS+RE++                      S ++ + ++ NK   L + A P+  E                              L + I    I A  D++  G   +   +       +IW  GP   G N+++++S   Q                      +   S+V  F   S    LCEE M+GV F + + ++ +   D   RG   GQ++  A+             L+ P+Y C I      LG +Y+ + +R G I S     G+  + V   LPV ESFNF  E+R QT G A PQ +F HW++   +P                 D   +  + +   R+RKGL  D
Sbjct:  486 FIAFARVFSGTLKRGMELFNLSPKHDPRQPTHRKEGEAPYASRVTIGDLYMFMGGELQLLDEVPAGNIVGIGGLESHIVKTATLSSSLDCTSFSELSVMATPILRVAIEPVQPQDMPKLVKGLKLLNQADACVQVSVAPTGEHVITTLGEVHVEKCVHDLEQSYAKIKVNVSKPIVSFRETIVPAATVDMVNEAIVKTAEDKDVSKKIAVQQTLNKLGTLKVIAVPLPAEAVELLETHSEFFKELAAIPRNQLLSEKWTALLASIKVKLIAALKDLQLFGLSTLSPEEL----VNRIWALGPRNCGTNILLNLSDYEQPDFWSSHAKSDTDIRSKTDPRKDFNSSLVNGFQITSVAGPLCEEPMQGVCFAVLEWSIQSEGEDLNSRGPFSGQVLTAAKEVCRQAFQNQPQRLVTPMYSCNIVVNAEMLGKMYAVIGRRHGKILSGDLTQGSGNFAVTCLLPVIESFNFAQEMRKQTSGLACPQLMFSHWEVIDIDPFWLPTTEEELMHFGEKADSANRAKVYMDSVRRRKGLFVD 1016          
BLAST of Elongation factor 2 vs. Ensembl Zebrafish
Match: eef2l2 (eukaryotic translation elongation factor 2, like 2 [Source:ZFIN;Acc:ZDB-GENE-030131-8112])

HSP 1 Score: 1200.27 bits (3104), Expect = 0.000e+0
Identity = 604/871 (69.35%), Postives = 700/871 (80.37%), Query Frame = 3
Query:  111 MVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELD-GPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSDK----------------LMKRLWGDNFFSEKSKKWCKRPDEG-----VRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSEDIPPLDKFLDKL 2657
            MVNFT+DQIR +M+KK NIRNMSVIAHVDHGKSTLTDSLV KAGIIA A+AG+ RFTDTRKDEQERCITIKSTAIS+Y E++E+  A +K  +          D  GFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVL MNKMD A+  LQ EP++L+Q FQR++E+VNVII+ YGE + GPMG+I V P  GTVGFGSGL  WAFT+K FA+MY  KF    DK                +MK+LWGD +F     K+ K  +        R F Q VL PI+ VF  +MN   E+  +L +K+ VKLD+E+K  + K LLK +MR+WLPAGD LLQMI IHLPSP  +Q+YR +LLYEGP DDE A+ +KNCDP   L+MYISKMVPT+DKGRFYAFGRVFSG V TGQKVRIMGPN+  GKK+DLY K IQRTILMMGRYVE IEDVPCGNI GLVGVDQ+LVKTGTI+TF  +HN+RVMKFSVSPVVRVAVE KNPADLPKLVEGLKRLAKSDPMVQ  I+ESGE+I+AGAGELHLEICLKDLEE+HACIP+KKSDPVVSYRE+V+  S ++CLSKSPNKHNRLYM + P  + LA DID G +++R ++K R R+L + Y+W+V+E+RKIWCFGPDG GPN++VD++KGVQYLNEIKDSVVA F WA+K+  LCEENMR VRF+IHDVTLHADAIHRGGGQIIPTARR +YA+VLTA P L+EP+Y  EIQ PE  +GGIY  LN++RG +F E QVAGTP +VVKAYLPVNESF FT++LR+ TGGQAFPQCVFDHWQ+ PG+P D  +KP   V DTRKRKGL E IP LD FLDKL
Sbjct:    1 MVNFTVDQIREIMDKKSNIRNMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLYYELSENDSAFIKQCK----------DGSGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLMMNKMDRALLELQLEPDELFQTFQRIVENVNVIISTYGEGEHGPMGNIMVDPVIGTVGFGSGLHGWAFTLKQFAEMYVAKFAAKGDKKKGDLPPAERAKKVEEMMKKLWGDKYFDPSCGKFSKTANNADGKKLPRTFCQLVLDPIFKVFDAIMNFKKEETQKLIEKLEVKLDAEDKEKEGKPLLKAVMRRWLPAGDALLQMITIHLPSPVTAQRYRCELLYEGPGDDEAAMGIKNCDPKAPLMMYISKMVPTTDKGRFYAFGRVFSGIVSTGQKVRIMGPNFTPGKKEDLYLKPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQFLVKTGTITTFENSHNMRVMKFSVSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHIVAGAGELHLEICLKDLEEDHACIPLKKSDPVVSYRETVSDESDQVCLSKSPNKHNRLYMKSRPFPDGLAEDIDKGDVSSRQELKLRARYLAEKYEWEVAEARKIWCFGPDGTGPNILVDITKGVQYLNEIKDSVVAGFQWATKEGALCEENMRAVRFDIHDVTLHADAIHRGGGQIIPTARRVLYASVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQVAGTPIFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPYDVNSKPSQIVADTRKRKGLKEGIPALDNFLDKL 861          
BLAST of Elongation factor 2 vs. Ensembl Zebrafish
Match: eef2b (eukaryotic translation elongation factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5128])

HSP 1 Score: 1197.96 bits (3098), Expect = 0.000e+0
Identity = 603/870 (69.31%), Postives = 699/870 (80.34%), Query Frame = 3
Query:  114 VNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELD-GPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSDK----------------LMKRLWGDNFFSEKSKKWCKRPDEG-----VRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSEDIPPLDKFLDKL 2657
            VNFT+DQIR +M+KK NIRNMSVIAHVDHGKSTLTDSLV KAGIIA A+AG+ RFTDTRKDEQERCITIKSTAIS+Y E++E+  A +K  +          D  GFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVL MNKMD A+  LQ EP++L+Q FQR++E+VNVII+ YGE + GPMG+I V P  GTVGFGSGL  WAFT+K FA+MY  KF    DK                +MK+LWGD +F     K+ K  +        R F Q VL PI+ VF  +MN   E+  +L +K+ VKLD+E+K  + K LLK +MR+WLPAGD LLQMI IHLPSP  +Q+YR +LLYEGP DDE A+ +KNCDP   L+MYISKMVPT+DKGRFYAFGRVFSG V TGQKVRIMGPN+  GKK+DLY K IQRTILMMGRYVE IEDVPCGNI GLVGVDQ+LVKTGTI+TF  +HN+RVMKFSVSPVVRVAVE KNPADLPKLVEGLKRLAKSDPMVQ  I+ESGE+I+AGAGELHLEICLKDLEE+HACIP+KKSDPVVSYRE+V+  S ++CLSKSPNKHNRLYM + P  + LA DID G +++R ++K R R+L + Y+W+V+E+RKIWCFGPDG GPN++VD++KGVQYLNEIKDSVVA F WA+K+  LCEENMR VRF+IHDVTLHADAIHRGGGQIIPTARR +YA+VLTA P L+EP+Y  EIQ PE  +GGIY  LN++RG +F E QVAGTP +VVKAYLPVNESF FT++LR+ TGGQAFPQCVFDHWQ+ PG+P D  +KP   V DTRKRKGL E IP LD FLDKL
Sbjct:    1 VNFTVDQIREIMDKKSNIRNMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLYYELSENDSAFIKQCK----------DGSGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLMMNKMDRALLELQLEPDELFQTFQRIVENVNVIISTYGEGEHGPMGNIMVDPVIGTVGFGSGLHGWAFTLKQFAEMYVAKFAAKGDKKKGDLPPAERAKKVEEMMKKLWGDKYFDPSCGKFSKTANNADGKKLPRTFCQLVLDPIFKVFDAIMNFKKEETQKLIEKLEVKLDAEDKEKEGKPLLKAVMRRWLPAGDALLQMITIHLPSPVTAQRYRCELLYEGPGDDEAAMGIKNCDPKAPLMMYISKMVPTTDKGRFYAFGRVFSGIVSTGQKVRIMGPNFTPGKKEDLYLKPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQFLVKTGTITTFENSHNMRVMKFSVSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHIVAGAGELHLEICLKDLEEDHACIPLKKSDPVVSYRETVSDESDQVCLSKSPNKHNRLYMKSRPFPDGLAEDIDKGDVSSRQELKLRARYLAEKYEWEVAEARKIWCFGPDGTGPNILVDITKGVQYLNEIKDSVVAGFQWATKEGALCEENMRAVRFDIHDVTLHADAIHRGGGQIIPTARRVLYASVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQVAGTPIFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPYDVNSKPSQIVADTRKRKGLKEGIPALDNFLDKL 860          
BLAST of Elongation factor 2 vs. Ensembl Zebrafish
Match: eef2b (eukaryotic translation elongation factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5128])

HSP 1 Score: 1196.03 bits (3093), Expect = 0.000e+0
Identity = 615/868 (70.85%), Postives = 704/868 (81.11%), Query Frame = 3
Query:  111 MVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELDG-PMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKF------QMSS-------DKLMKRLWGDNFFSEKSKKWCKR---PD--EGVRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSEDIPPLDKFLDKL 2657
            MVNFT+DQIRA+M+KK NIRNMSVIAHVDHGKSTLTDSLVSKAGIIA A+AG+ RFTDTRKDEQERCITIKSTAISMY E+TE+ LA +K  +          D  GFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVL MNKMD A+  LQ EPE+LYQ FQR++E+VNVII+ YGE +G PMG+I + P  GTVGFGSGL  WAFT+K FA+MY  KF      Q+S        + +MK+LWGD +F     K+ K    PD  +  R F Q +L PI+ VF  +MN   E+ A+L +K+ +KLD+E+K  + K LLK +MR+WLPAG+ LLQMI IHLPSP  +QKYR +LLYEGP DDE A+ +KNCDP G L+MYISKMVPT+DKGRFYAFGRVFSG V TG KVRIMGPNY  GKK+DLY K IQRTILMMGRYVE IEDVPCGNI GLVGVDQ+LVKTGTI+TF  AHN+RVMKFSVSPVVRVAVE KNPADLPKLVEGLKRLAKSDPMVQ  I+ESGE+IIAGAGELHLEICLKDLEE+HACIP+KKSDPVVSYRE+V+  S ++CLSKSPNKHNRLYM A P  + LA DID G +++R ++K R R+L D Y+W+V+E+RKIWCFGPDG GPNM+VDV+KGVQYLNEIKDSVVA F WA+K+  LCEENMR VRF+IHDVTLH DAIHRGGGQIIPTARR +YA  LTA P L+EP+Y  EIQ PE  +GGIY  LN++RG +F E QV GTP +VVKAYLPVNESF FT++LR+ TGGQAFPQCVFDHWQ+ PG+P D  +KP   V DTRKRKGL E IP LD FLDKL
Sbjct:    1 MVNFTVDQIRAIMDKKSNIRNMSVIAHVDHGKSTLTDSLVSKAGIIASARAGETRFTDTRKDEQERCITIKSTAISMYYELTENDLAFIKQCK----------DGSGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQRIVENVNVIISTYGEDEGGPMGNIMIDPVIGTVGFGSGLHGWAFTLKQFAEMYVAKFASKGEAQLSPADRCKKVEDMMKKLWGDRYFDPAGGKFTKTANGPDGKKYPRTFAQLILDPIFKVFDAIMNFKKEETAKLIEKLDIKLDTEDKDKEGKPLLKAVMRRWLPAGEALLQMITIHLPSPVTAQKYRCELLYEGPGDDEAAMGIKNCDPKGPLMMYISKMVPTTDKGRFYAFGRVFSGVVSTGLKVRIMGPNYTPGKKEDLYLKPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQFLVKTGTITTFDQAHNMRVMKFSVSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHIIAGAGELHLEICLKDLEEDHACIPLKKSDPVVSYRETVSAESDQMCLSKSPNKHNRLYMKARPFPDGLAEDIDKGDVSSRQELKTRARYLADKYEWEVTEARKIWCFGPDGTGPNMLVDVTKGVQYLNEIKDSVVAGFQWATKEGALCEENMRAVRFDIHDVTLHTDAIHRGGGQIIPTARRVLYACQLTAEPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQVMGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPKDAASKPCQIVADTRKRKGLKEGIPALDNFLDKL 858          
BLAST of Elongation factor 2 vs. Ensembl Zebrafish
Match: eef2a.1 (eukaryotic translation elongation factor 2a, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-050522-500])

HSP 1 Score: 1065.83 bits (2755), Expect = 0.000e+0
Identity = 533/858 (62.12%), Postives = 656/858 (76.46%), Query Frame = 3
Query:  129 DQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELD-GPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSS-----------DKLMKRLWGDNFFSEKSKKWCKR---PD--EGVRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSEDIPPLDKFLD 2651
            DQIRA M+KK NIRNMSVI   DHGKSTLTD LVSKAGI++ A+AG+ RF DTR+DEQERCITIKST IS++ E+ E  LA +K  +          D  GFL+NLIDSPGHVDFSSEVTAALR+TDGAL+VVDCVSGVC+QTETVLRQAI ERIKPVL +NKMD A+  LQ  PE+LYQ FQR++E VNV I+ Y E + GPMG++ + P  G + FGSGL  WAFT+K FA++Y KKF   +           + ++KRLWGD++F   + K+ +    PD  +  R F   VL PI+ VF  +MN   E+  +L +KMG+KLD E+K  + K LLK +MR WLPAG+ LLQMI IHLPSP  +Q YR +LLYEGP DDE A+ +KNCDP   L+MYISKM+PTSDKG FYAFGRVFSG V TG  VRIMGPN+  GK++DLY K IQRT+LMMGRYVE IEDVPCGNI GL+GVDQ+LVKTGTI+TF  A+N+RVMKFSVSP VRV+VE  +PADLPKLVEGLK LAKSDPM+Q  I+++GE+IIAGAGELHLEICLKDLEE+HACIP+KKSDP  SYRE+V+  S +LCL+K+PNKH+RL+M A P+ + LA DID G++TA  ++  R ++L + Y W+V+E+RKIWCFGP+G GPN++VD++K VQYLNEIKDSV+A F WA+++ +LC ENMRG+RF IHD TL + AIHRG GQII   RR +Y   LTA P L EP+Y  E+Q P++ +G IY  L +RRG++FSE QV GTP Y++KAYLPV+ESF FT++LR  T GQAF QCVFDHWQ+ PG+PLDPT+K    + D RK KGL E IP L  +LD
Sbjct:    1 DQIRATMDKKSNIRNMSVIGAFDHGKSTLTDWLVSKAGIVSSARAGETRFMDTRRDEQERCITIKSTTISIFYELAEKDLAFIKECK----------DGSGFLLNLIDSPGHVDFSSEVTAALRITDGALLVVDCVSGVCLQTETVLRQAIGERIKPVLMINKMDRALLELQLVPEELYQIFQRIVEKVNVTISTYAEDEKGPMGNVMIDPVIGNLAFGSGLHGWAFTLKQFAELYVKKFAGKAQLGPEEYIKKVEDMIKRLWGDSYFDSTTGKFSESATSPDGKKLPRTFVHLVLDPIFKVFDAIMNFKKEETVKLIEKMGIKLDVEDKEKEGKILLKAVMRCWLPAGEALLQMITIHLPSPVTAQIYRCELLYEGPGDDEAAMGIKNCDPKAPLMMYISKMIPTSDKGCFYAFGRVFSGCVSTGLNVRIMGPNFTPGKEEDLYLKPIQRTVLMMGRYVEPIEDVPCGNIVGLLGVDQFLVKTGTITTFTKAYNMRVMKFSVSPAVRVSVEVMDPADLPKLVEGLKHLAKSDPMLQCIIEDTGEHIIAGAGELHLEICLKDLEEDHACIPLKKSDPFASYRETVSDGSKQLCLAKTPNKHSRLFMKACPLADGLAEDIDKGRVTASQEMNARAQYLAENYKWEVTEARKIWCFGPEGTGPNILVDLTKRVQYLNEIKDSVIAGFQWATREGVLCAENMRGIRFEIHDATLTSTAIHRGPGQIIVATRRVLYGCQLTAEPRLSEPIYLVEMQCPKSVIGNIYGELVRRRGVVFSESQVMGTPVYLLKAYLPVSESFGFTADLRFYTSGQAFSQCVFDHWQILPGDPLDPTSKAAHIMADIRKSKGLDEAIPALHCYLD 848          
BLAST of Elongation factor 2 vs. Ensembl Zebrafish
Match: eef2a.1 (eukaryotic translation elongation factor 2a, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-050522-500])

HSP 1 Score: 1056.2 bits (2730), Expect = 0.000e+0
Identity = 538/864 (62.27%), Postives = 663/864 (76.74%), Query Frame = 3
Query:  111 MVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELD-GPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSS-----------DKLMKRLWGDNFFSEKSKKWCKR---PD--EGVRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSEDIPPLDKFLD 2651
            M NF +DQIRA M+KK NIRNMSVI   DHGKSTLTD LVS+AGI++ A+AG+ RF DTR+DEQERCITIKSTAIS++ E+ E  LA +K  +          D  GFL+NLIDSPGHVDFSSEVTAALR+TDGAL+VVDCVSGVC+QTETVLRQAI ERIKPVL +NKMD A+  LQ  PE+LYQ FQR++E VNV I+ Y E + GPMG++ + P  G + FGSGL  WAFT+K FA++Y KKF   +           + ++KRLWGD++F   + K+ +    PD  +  R F   VL PI+ VF  +MN   E+  +L +KMG+KLD E+K  + K LLK +MR WLPAG+ LLQMI IHLPSP  +Q YR +LLYEGP DDE A+ +KNCDP   L+MYISKM+PTSDKG FYAFGRVFSG V TG  VRIMGPN+  GKKDDLY K IQRT+LMMGRYVE IEDVPCGNI GL+GVDQ+LVKTGTI+TF  A+N+RVMKFSVSPVVRV+VE  +PADLPKLVEGLK LAKSDPM+Q  I+++GE+IIAGAGELHLEICLKDLEE+HACIP+KKSDP  SYRE+V+  S +LCL+K+PNKH+RL+M A P+ + LA DID G++TA  ++  R ++L + Y W+V+E+RKIWCFGP+G GPN++VD++K VQYLNEIKDSV+A F WA+++ +LC ENMRG+RF+IHD TL + AIHRG GQII   RR +Y   LTA P L EP+Y  E+Q PE+ +G +Y  L +RRG++FSE QV GTP Y++KAYLPV+ESF FT++L A T GQAF QCVFDHWQ+ PG+P+DPT+K    + D RK KGL E IP L  +LD
Sbjct:    1 MENFNVDQIRATMDKKSNIRNMSVIGAFDHGKSTLTDWLVSEAGIVSSARAGETRFMDTRRDEQERCITIKSTAISIFYELAEKDLAFIKECK----------DGSGFLLNLIDSPGHVDFSSEVTAALRITDGALLVVDCVSGVCLQTETVLRQAIGERIKPVLMINKMDRALLELQLVPEELYQIFQRIVEKVNVTISTYAEDEKGPMGNVMIDPVIGNLAFGSGLHGWAFTLKQFAELYVKKFAGKAQLGPEEYIKKVEDMIKRLWGDSYFDSTTGKFSESATSPDGKKLPRTFVHLVLDPIFKVFDAIMNFKKEETVKLIEKMGIKLDVEDKEKEGKILLKAVMRCWLPAGEALLQMITIHLPSPVTAQIYRCELLYEGPGDDEAAMGIKNCDPKAPLMMYISKMIPTSDKGCFYAFGRVFSGCVSTGLNVRIMGPNFTPGKKDDLYLKPIQRTVLMMGRYVEPIEDVPCGNIVGLLGVDQFLVKTGTITTFTKAYNMRVMKFSVSPVVRVSVEVMDPADLPKLVEGLKHLAKSDPMLQCIIEDTGEHIIAGAGELHLEICLKDLEEDHACIPLKKSDPFASYRETVSDGSKQLCLAKTPNKHSRLFMKACPLADGLAEDIDKGRVTASQEMNARAQYLAENYKWEVTEARKIWCFGPEGTGPNILVDLTKRVQYLNEIKDSVIAGFQWATREGVLCAENMRGIRFDIHDATLTSTAIHRGPGQIIVATRRVLYGCQLTAEPRLSEPIYLVEMQCPESVIGNVYGELVRRRGVVFSESQVMGTPVYLLKAYLPVSESFGFTADLCANTSGQAFSQCVFDHWQILPGDPMDPTSKVAHIMADIRKSKGLDEAIPALHCYLD 854          
BLAST of Elongation factor 2 vs. Ensembl Xenopus
Match: eef2.2 (eukaryotic translation elongation factor 2, gene 2 [Source:NCBI gene;Acc:548502])

HSP 1 Score: 1206.43 bits (3120), Expect = 0.000e+0
Identity = 610/854 (71.43%), Postives = 711/854 (83.26%), Query Frame = 3
Query:  114 VNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELD-GPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSDKLMKRLWGDNFFSEKSKKWCKRPD--EGV---RGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSEDIPPLDKFLDKL 2657
            VNFT+DQIRA+M+KK NIRNMSVIAHVDHGKSTLTDSLV KAGIIA A+AG+ RFTDTRKDEQERCITIKSTAIS+Y E++E+ LA +K  +          +  GFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVL MNKMD A+  LQ EPE+LY  FQR++E+VNVII+ YGE + GPMG+I + P  GTVGFGSGL  WAFT+K FA+MY  KF++  + +MK+LWGD +F   + K+ K     EG    R F+Q +L PI+ +F  +MN   E+ A+L +K+ +KLD+E+K  + K LLK +MR+WLPAGD LLQMI IHLPSP  +QKYR +LLYEGP DDE A+ +K+CDP G LVMYISKMVPTSDKGRFYAFGRVFSG V TGQKVRIMGPNY  GKK+DLY K IQRTILMMGRYVE IEDVPCGNI GLVGVDQ+LVKTGTI+TF  AHN+RVMKFSVSPVVRVAVE KNPADLPKLVEGLKRLAKSDPMVQ  I+ESGE+IIAGAGELHLEICLKDLEE+HACIP+KKSDPVVSYRE+V++ SS+LCLSKSPNKHNRL+M A P  + LA DID G +++R ++K+R R+L + Y+WDV+E+RKIWCFGPDG GPN++VDV+KGVQYLNEIKDSVVA F WA+K+ +LCEEN+RG RF+IHDVTLHADAIHRGGGQIIPTARR +YA+ LTA P L+EP+Y  EIQ PE  +GGIY  LN++RG +F E QVAGTP +VVKAYLPVNESF FT++LR+ TGGQAFPQCVFDHWQ+ PG+P D T++P   V +TRKRKGL E IPPLD FLDKL
Sbjct:    5 VNFTVDQIRAIMDKKSNIRNMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLYYELSENDLAFIKQCK----------EGSGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYLTFQRIVENVNVIISTYGEGESGPMGNIMIDPVIGTVGFGSGLHGWAFTLKQFAEMYVAKFKV--EDMMKKLWGDKYFDPSTGKFSKTATNAEGKKLPRTFSQLILDPIFKIFDAIMNFKKEETAKLIEKLDIKLDTEDKEKEGKPLLKAVMRRWLPAGDALLQMITIHLPSPVTAQKYRCELLYEGPPDDEAALGVKSCDPKGPLVMYISKMVPTSDKGRFYAFGRVFSGIVSTGQKVRIMGPNYTPGKKEDLYLKPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQFLVKTGTITTFEHAHNMRVMKFSVSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHIIAGAGELHLEICLKDLEEDHACIPLKKSDPVVSYRETVSEESSQLCLSKSPNKHNRLFMKARPFPDGLAEDIDKGDVSSRQELKQRARYLAEKYEWDVAEARKIWCFGPDGTGPNILVDVTKGVQYLNEIKDSVVAGFQWATKEGVLCEENLRGARFDIHDVTLHADAIHRGGGQIIPTARRVLYASALTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQVAGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPFDSTSRPSQVVGETRKRKGLKEGIPPLDNFLDKL 846          
BLAST of Elongation factor 2 vs. Ensembl Xenopus
Match: eef2.2 (eukaryotic translation elongation factor 2, gene 2 [Source:NCBI gene;Acc:548502])

HSP 1 Score: 1202.96 bits (3111), Expect = 0.000e+0
Identity = 611/868 (70.39%), Postives = 710/868 (81.80%), Query Frame = 3
Query:  114 VNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELD-GPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSDK--------------LMKRLWGDNFFSEKSKKWCKRPD--EGV---RGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSEDIPPLDKFLDKL 2657
            VNFT+DQIRA+M+KK NIRNMSVIAHVDHGKSTLTDSLV KAGIIA A+AG+ RFTDTRKDEQERCITIKSTAIS+Y E++E+ LA +K  +          +  GFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVL MNKMD A+  LQ EPE+LY  FQR++E+VNVII+ YGE + GPMG+I + P  GTVGFGSGL  WAFT+K FA+MY  KF    +K              +MK+LWGD +F   + K+ K     EG    R F+Q +L PI+ +F  +MN   E+ A+L +K+ +KLD+E+K  + K LLK +MR+WLPAGD LLQMI IHLPSP  +QKYR +LLYEGP DDE A+ +K+CDP G LVMYISKMVPTSDKGRFYAFGRVFSG V TGQKVRIMGPNY  GKK+DLY K IQRTILMMGRYVE IEDVPCGNI GLVGVDQ+LVKTGTI+TF  AHN+RVMKFSVSPVVRVAVE KNPADLPKLVEGLKRLAKSDPMVQ  I+ESGE+IIAGAGELHLEICLKDLEE+HACIP+KKSDPVVSYRE+V++ SS+LCLSKSPNKHNRL+M A P  + LA DID G +++R ++K+R R+L + Y+WDV+E+RKIWCFGPDG GPN++VDV+KGVQYLNEIKDSVVA F WA+K+ +LCEEN+RG RF+IHDVTLHADAIHRGGGQIIPTARR +YA+ LTA P L+EP+Y  EIQ PE  +GGIY  LN++RG +F E QVAGTP +VVKAYLPVNESF FT++LR+ TGGQAFPQCVFDHWQ+ PG+P D T++P   V +TRKRKGL E IPPLD FLDKL
Sbjct:    8 VNFTVDQIRAIMDKKSNIRNMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLYYELSENDLAFIKQCK----------EGSGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYLTFQRIVENVNVIISTYGEGESGPMGNIMIDPVIGTVGFGSGLHGWAFTLKQFAEMYVAKFASKGEKTKLNPADRAKKVEDMMKKLWGDKYFDPSTGKFSKTATNAEGKKLPRTFSQLILDPIFKIFDAIMNFKKEETAKLIEKLDIKLDTEDKEKEGKPLLKAVMRRWLPAGDALLQMITIHLPSPVTAQKYRCELLYEGPPDDEAALGVKSCDPKGPLVMYISKMVPTSDKGRFYAFGRVFSGIVSTGQKVRIMGPNYTPGKKEDLYLKPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQFLVKTGTITTFEHAHNMRVMKFSVSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHIIAGAGELHLEICLKDLEEDHACIPLKKSDPVVSYRETVSEESSQLCLSKSPNKHNRLFMKARPFPDGLAEDIDKGDVSSRQELKQRARYLAEKYEWDVAEARKIWCFGPDGTGPNILVDVTKGVQYLNEIKDSVVAGFQWATKEGVLCEENLRGARFDIHDVTLHADAIHRGGGQIIPTARRVLYASALTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQVAGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPFDSTSRPSQVVGETRKRKGLKEGIPPLDNFLDKL 865          
BLAST of Elongation factor 2 vs. Ensembl Xenopus
Match: eef2.2 (eukaryotic translation elongation factor 2, gene 2 [Source:NCBI gene;Acc:548502])

HSP 1 Score: 1202.96 bits (3111), Expect = 0.000e+0
Identity = 611/868 (70.39%), Postives = 710/868 (81.80%), Query Frame = 3
Query:  114 VNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELD-GPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSDK--------------LMKRLWGDNFFSEKSKKWCKRPD--EGV---RGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSEDIPPLDKFLDKL 2657
            VNFT+DQIRA+M+KK NIRNMSVIAHVDHGKSTLTDSLV KAGIIA A+AG+ RFTDTRKDEQERCITIKSTAIS+Y E++E+ LA +K  +          +  GFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVL MNKMD A+  LQ EPE+LY  FQR++E+VNVII+ YGE + GPMG+I + P  GTVGFGSGL  WAFT+K FA+MY  KF    +K              +MK+LWGD +F   + K+ K     EG    R F+Q +L PI+ +F  +MN   E+ A+L +K+ +KLD+E+K  + K LLK +MR+WLPAGD LLQMI IHLPSP  +QKYR +LLYEGP DDE A+ +K+CDP G LVMYISKMVPTSDKGRFYAFGRVFSG V TGQKVRIMGPNY  GKK+DLY K IQRTILMMGRYVE IEDVPCGNI GLVGVDQ+LVKTGTI+TF  AHN+RVMKFSVSPVVRVAVE KNPADLPKLVEGLKRLAKSDPMVQ  I+ESGE+IIAGAGELHLEICLKDLEE+HACIP+KKSDPVVSYRE+V++ SS+LCLSKSPNKHNRL+M A P  + LA DID G +++R ++K+R R+L + Y+WDV+E+RKIWCFGPDG GPN++VDV+KGVQYLNEIKDSVVA F WA+K+ +LCEEN+RG RF+IHDVTLHADAIHRGGGQIIPTARR +YA+ LTA P L+EP+Y  EIQ PE  +GGIY  LN++RG +F E QVAGTP +VVKAYLPVNESF FT++LR+ TGGQAFPQCVFDHWQ+ PG+P D T++P   V +TRKRKGL E IPPLD FLDKL
Sbjct:    5 VNFTVDQIRAIMDKKSNIRNMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLYYELSENDLAFIKQCK----------EGSGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYLTFQRIVENVNVIISTYGEGESGPMGNIMIDPVIGTVGFGSGLHGWAFTLKQFAEMYVAKFASKGEKTKLNPADRAKKVEDMMKKLWGDKYFDPSTGKFSKTATNAEGKKLPRTFSQLILDPIFKIFDAIMNFKKEETAKLIEKLDIKLDTEDKEKEGKPLLKAVMRRWLPAGDALLQMITIHLPSPVTAQKYRCELLYEGPPDDEAALGVKSCDPKGPLVMYISKMVPTSDKGRFYAFGRVFSGIVSTGQKVRIMGPNYTPGKKEDLYLKPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQFLVKTGTITTFEHAHNMRVMKFSVSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHIIAGAGELHLEICLKDLEEDHACIPLKKSDPVVSYRETVSEESSQLCLSKSPNKHNRLFMKARPFPDGLAEDIDKGDVSSRQELKQRARYLAEKYEWDVAEARKIWCFGPDGTGPNILVDVTKGVQYLNEIKDSVVAGFQWATKEGVLCEENLRGARFDIHDVTLHADAIHRGGGQIIPTARRVLYASALTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQVAGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPFDSTSRPSQVVGETRKRKGLKEGIPPLDNFLDKL 862          
BLAST of Elongation factor 2 vs. Ensembl Xenopus
Match: eef2.2 (eukaryotic translation elongation factor 2, gene 2 [Source:NCBI gene;Acc:548502])

HSP 1 Score: 1201.42 bits (3107), Expect = 0.000e+0
Identity = 611/868 (70.39%), Postives = 710/868 (81.80%), Query Frame = 3
Query:  114 VNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELD-GPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSDK--------------LMKRLWGDNFFSEKSKKWCKRPD--EG---VRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSEDIPPLDKFLDKL 2657
            VNFT+DQIRA+M+KK NIRNMSVIAHVDHGKSTLTDSLV KAGIIA A+AG+ RFTDTRKDEQERCITIKSTAIS+Y E++E+ LA +K  +          +  GFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVL MNKMD A+  LQ EPE+LY  FQR++E+VNVII+ YGE + GPMG+I + P  GTVGFGSGL  WAFT+K FA+MY  KF    +K              +MK+LWGD +F   + K+ K     EG    R F+Q +L PI+ +F  +MN   E+ A+L +K+ +KLD+E+K  + K LLK +MR+WLPAGD LLQMI IHLPSP  +QKYR +LLYEGP DDE A+ +K+CDP G LVMYISKMVPTSDKGRFYAFGRVFSG V TGQKVRIMGPNY  GKK+DLY K IQRTILMMGRYVE IEDVPCGNI GLVGVDQ+LVKTGTI+TF  AHN+RVMKFSVSPVVRVAVE KNPADLPKLVEGLKRLAKSDPMVQ  I+ESGE+IIAGAGELHLEICLKDLEE+HACIP+KKSDPVVSYRE+V++ SS+LCLSKSPNKHNRL+M A P  + LA DID G +++R ++K+R R+L + Y+WDV+E+RKIWCFGPDG GPN++VDV+KGVQYLNEIKDSVVA F WA+K+ +LCEEN+RG RF+IHDVTLHADAIHRGGGQIIPTARR +YA+ LTA P L+EP+Y  EIQ PE  +GGIY  LN++RG +F E QVAGTP +VVKAYLPVNESF FT++LR+ TGGQAFPQCVFDHWQ+ PG+P D T++P   V +TRKRKGL E IPPLD FLDKL
Sbjct:   66 VNFTVDQIRAIMDKKSNIRNMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLYYELSENDLAFIKQCK----------EGSGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYLTFQRIVENVNVIISTYGEGESGPMGNIMIDPVIGTVGFGSGLHGWAFTLKQFAEMYVAKFASKGEKTKLNPADRAKKVEDMMKKLWGDKYFDPSTGKFSKTATNAEGKKLPRTFSQLILDPIFKIFDAIMNFKKEETAKLIEKLDIKLDTEDKEKEGKPLLKAVMRRWLPAGDALLQMITIHLPSPVTAQKYRCELLYEGPPDDEAALGVKSCDPKGPLVMYISKMVPTSDKGRFYAFGRVFSGIVSTGQKVRIMGPNYTPGKKEDLYLKPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQFLVKTGTITTFEHAHNMRVMKFSVSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHIIAGAGELHLEICLKDLEEDHACIPLKKSDPVVSYRETVSEESSQLCLSKSPNKHNRLFMKARPFPDGLAEDIDKGDVSSRQELKQRARYLAEKYEWDVAEARKIWCFGPDGTGPNILVDVTKGVQYLNEIKDSVVAGFQWATKEGVLCEENLRGARFDIHDVTLHADAIHRGGGQIIPTARRVLYASALTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQVAGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPFDSTSRPSQVVGETRKRKGLKEGIPPLDNFLDKL 923          
BLAST of Elongation factor 2 vs. Ensembl Xenopus
Match: eef2.1 (eukaryotic translation elongation factor 2, gene 1 [Source:NCBI gene;Acc:394866])

HSP 1 Score: 1190.64 bits (3079), Expect = 0.000e+0
Identity = 605/868 (69.70%), Postives = 706/868 (81.34%), Query Frame = 3
Query:  111 MVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELD-GPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSD-------------KLMKRLWGDNFFSEKSKKWCKRPDEG-----VRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSEDIPPLDKFLDKL 2657
            MVNFT+DQIR++M+KK NIRNMSVIAHVDHGKSTLTDSLV KAGIIA A+AG+ RFTDTRKDEQERCITIKSTAIS++ E++E+ LA +K       S DG     GFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERI+PVL MNKMD A+  LQ EPE+LYQ FQR++E+VNVII+ YGE + GPMG+I + P  GTVGFGSGL  WAFT+K FA+MY  KF    +              +MK+LWGD +F   + K+ K           R F Q VL PI+ VF  +MN   E+ A+L +K+ +KLDSE+K  + KQLLK +MR+WLPAG+ LLQMI IHLPSP  +QKYR +LLYEGP DDE A+ +KNCDP G L+MYISKMVPT+DKGRFYAFGRVFSG V TG KVRIMGPN+  GKK+DLY K IQRTILMMGRYVE IEDVPCGNI GLVGVDQ+LVKTGTI+TF  +HN+RVMKFSVSPVVRVAVE KNPADLPKLVEGLKRLAKSDPMVQ  I+ESGE+IIAGAGELHLEICLKDLEE+HACIPIKKSDPVVSYRE+V++ S+++CLSKSPNKHNRL+M   P  + LA DID G ++AR ++K R R+L + Y+WDV+E+RKIWCFGPDG+GPN++ DV+KGVQYLNEIKDSVVA F WA+K+ +LCEEN+RGVRF++HDVTLHADAIHRGGGQIIPTARR +YA VLTA P L+EP+Y  EIQ PE  +GGIY  LN++RG +F E QVAGTP +VVKAYLPVNESF FT++LR+ TGGQAFPQCVFDHWQ+ PG+P D +T+P   V +TRKRKGL E +  LD FLDKL
Sbjct:    1 MVNFTVDQIRSIMDKKANIRNMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLFYELSENDLAFIK------QSKDGC----GFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIRPVLMMNKMDRALLELQLEPEELYQTFQRIVENVNVIISTYGEGETGPMGNIMIDPVLGTVGFGSGLHGWAFTLKQFAEMYVAKFAAKGEGQLAPAERAKKVEDMMKKLWGDRYFDPANGKFSKSATNADGKKLPRTFCQLVLDPIFKVFDAIMNFKKEETAKLVEKLDIKLDSEDKDKEGKQLLKAVMRRWLPAGEALLQMITIHLPSPVTAQKYRCELLYEGPPDDEAAMGIKNCDPKGPLMMYISKMVPTTDKGRFYAFGRVFSGVVSTGLKVRIMGPNFTPGKKEDLYLKPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQFLVKTGTITTFEHSHNMRVMKFSVSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHIIAGAGELHLEICLKDLEEDHACIPIKKSDPVVSYRETVSEESNQMCLSKSPNKHNRLFMKCRPFPDGLAEDIDKGDVSARQELKTRARYLAEKYEWDVTEARKIWCFGPDGSGPNILTDVTKGVQYLNEIKDSVVAGFQWATKEGVLCEENLRGVRFDVHDVTLHADAIHRGGGQIIPTARRVLYACVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQVAGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPFDNSTRPFQVVAETRKRKGLKEGVQALDNFLDKL 858          
BLAST of Elongation factor 2 vs. Ensembl Mouse
Match: Eef2 (eukaryotic translation elongation factor 2 [Source:MGI Symbol;Acc:MGI:95288])

HSP 1 Score: 1203.35 bits (3112), Expect = 0.000e+0
Identity = 616/868 (70.97%), Postives = 713/868 (82.14%), Query Frame = 3
Query:  111 MVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELD-GPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKF------QMSS-------DKLMKRLWGDNFFSEKSKKWCKR---PD--EGVRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSEDIPPLDKFLDKL 2657
            MVNFT+DQIRA+M+KK NIRNMSVIAHVDHGKSTLTDSLV KAGIIA A+AG+ RFTDTRKDEQERCITIKSTAIS++ E++E+ L  +K       S DG     GFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVL MNKMD A+  LQ EPE+LYQ FQR++E+VNVII+ YGE + GPMG+I + P  GTVGFGSGL  WAFT+K FA+MY  KF      Q+S+       + +MK+LWGD +F   + K+ K    PD  +  R F Q +L PI+ VF  +MN   E+ A+L +K+ +KLDSE+K  + K LLK +MR+WLPAGD LLQMI IHLPSP  +QKYR +LLYEGP DDE A+ +K+CDP G L+MYISKMVPTSDKGRFYAFGRVFSG V TG KVRIMGPNY  GKK+DLY K IQRTILMMGRYVE IEDVPCGNI GLVGVDQ+LVKTGTI+TF  AHN+RVMKFSVSPVVRVAVE KNPADLPKLVEGLKRLAKSDPMVQ  I+ESGE+IIAGAGELHLEICLKDLEE+HACIPIKKSDPVVSYRE+V++ S+ LCLSKSPNKHNRLYM A P  + LA DID G+++AR ++K R R+L + Y+WDV+E+RKIWCFGPDG GPN++ D++KGVQYLNEIKDSVVA F WA+K+  LCEENMRGVRF++HDVTLHADAIHRGGGQIIPTARRC+YA+VLTA P L+EP+Y  EIQ PE  +GGIY  LN++RG +F E QVAGTP +VVKAYLPVNESF FT++LR+ TGGQAFPQCVFDHWQ+ PG+P D +++P   V +TRKRKGL E IP LD FLDKL
Sbjct:    1 MVNFTVDQIRAIMDKKANIRNMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLFYELSENDLNFIK------QSKDGS----GFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQRIVENVNVIISTYGEGESGPMGNIMIDPVLGTVGFGSGLHGWAFTLKQFAEMYVAKFAAKGEGQLSAAERAKKVEDMMKKLWGDRYFDPANGKFSKSANSPDGKKLPRTFCQLILDPIFKVFDAIMNFRKEETAKLIEKLDIKLDSEDKDKEGKPLLKAVMRRWLPAGDALLQMITIHLPSPVTAQKYRCELLYEGPPDDEAAMGIKSCDPKGPLMMYISKMVPTSDKGRFYAFGRVFSGVVSTGLKVRIMGPNYTPGKKEDLYLKPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQFLVKTGTITTFEHAHNMRVMKFSVSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHIIAGAGELHLEICLKDLEEDHACIPIKKSDPVVSYRETVSEESNVLCLSKSPNKHNRLYMKARPFPDGLAEDIDKGEVSARQELKARARYLAEKYEWDVAEARKIWCFGPDGTGPNILTDITKGVQYLNEIKDSVVAGFQWATKEGALCEENMRGVRFDVHDVTLHADAIHRGGGQIIPTARRCLYASVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQVAGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPFDNSSRPSQVVAETRKRKGLKEGIPALDNFLDKL 858          
BLAST of Elongation factor 2 vs. Ensembl Mouse
Match: Eftud2 (elongation factor Tu GTP binding domain containing 2 [Source:MGI Symbol;Acc:MGI:1336880])

HSP 1 Score: 583.178 bits (1502), Expect = 0.000e+0
Identity = 316/874 (36.16%), Postives = 502/874 (57.44%), Query Frame = 3
Query:  105 LKMVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXX-XXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELDGPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKF-QMSSDKLMKRLWGDNFFSEKSKKWCKRP--DEGVRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAG---AHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVD------VSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLD---------PTTKPGIT---VRDTRKRKGLSEDIPPLDKFLD 2651
            L +  + +D +  LM+    IRN+++  H+ HGK+   D L+ +    I      D  +TD    EQER + IKST ++                  V L D   T  K +L N++D+PGHV+FS EVTA LR++DG ++ +D   GV + TE +++ A+ ER+   + +NK+D  +  L+  P D Y K + +++ VN +I+ Y   +    ++ ++P  G V F S   S  FT+ +FA +YA  F  ++  +  KRLWGD +F+ K++K+ K+       R F +F+L+P+Y +   V+            ++G+ L  EE  L  + LL+ + +K+       + M   H+PSP +  K + +  Y G +D ++  +M +CDP+G L+ + +KM  T D  +F+AFGRV SG +  GQ V+++G NY    ++D    ++ R  + + RY   +  VP GN   + GVDQ +VKT TI+   G   A   R +KF+ + V+++AVEP NP++LPK+++GL+++ KS P +   ++ESGE++I G GEL+L+  + DL + ++ I IK +DPVV++ E+V +TSS  C +++PNK N++ M A P+ + LA DI+   +    + K+ G F    YDWD+  +R IW FGPD  GPN++VD      V K +  L  +KDS+V  F W +++  LC+E +R V+F I D  +  + +HRGGGQIIPTARR +Y+  L A P L+EP Y  E+Q P   +  +Y+ L +RRG +  +  + G+P Y +KA++P  +SF F ++LR  T GQAF   VF HWQ+ PG+PLD         P   P +    +  TR+RKGLSED+  + KF D
Sbjct:  108 LPVTVYEMDFLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQDLCYTDILFTEQERGVGIKSTPVT------------------VVLPD---TKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTERLIKHAVQERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTDE----NLILSPLLGNVCFSSSQYSICFTLGSFAKIYADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKAPSSSSQRSFVEFILEPLYKILAQVVGDVDTSLPRTLDELGIHLTKEELKLNIRPLLRLVCKKFFGEFTGFVDMCVQHIPSPKVGAKPKIEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTKMYSTDDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIEVNRVPAGNWVLIEGVDQPIVKTATITEPRGNEEAQIFRPLKFNTTSVIKIAVEPVNPSELPKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCVMHDLRKMYSEIDIKVADPVVTFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQTKYDWDLLAARSIWAFGPDATGPNILVDDTLPSEVDKAL--LGSVKDSIVQGFQWGTREGPLCDELIRNVKFKILDAVVAQEPLHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFSLSVFHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDV-SISKFFD 953          
BLAST of Elongation factor 2 vs. Ensembl Mouse
Match: Eftud2 (elongation factor Tu GTP binding domain containing 2 [Source:MGI Symbol;Acc:MGI:1336880])

HSP 1 Score: 583.178 bits (1502), Expect = 0.000e+0
Identity = 316/874 (36.16%), Postives = 502/874 (57.44%), Query Frame = 3
Query:  105 LKMVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXX-XXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELDGPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKF-QMSSDKLMKRLWGDNFFSEKSKKWCKRP--DEGVRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAG---AHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVD------VSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLD---------PTTKPGIT---VRDTRKRKGLSEDIPPLDKFLD 2651
            L +  + +D +  LM+    IRN+++  H+ HGK+   D L+ +    I      D  +TD    EQER + IKST ++                  V L D   T  K +L N++D+PGHV+FS EVTA LR++DG ++ +D   GV + TE +++ A+ ER+   + +NK+D  +  L+  P D Y K + +++ VN +I+ Y   +    ++ ++P  G V F S   S  FT+ +FA +YA  F  ++  +  KRLWGD +F+ K++K+ K+       R F +F+L+P+Y +   V+            ++G+ L  EE  L  + LL+ + +K+       + M   H+PSP +  K + +  Y G +D ++  +M +CDP+G L+ + +KM  T D  +F+AFGRV SG +  GQ V+++G NY    ++D    ++ R  + + RY   +  VP GN   + GVDQ +VKT TI+   G   A   R +KF+ + V+++AVEP NP++LPK+++GL+++ KS P +   ++ESGE++I G GEL+L+  + DL + ++ I IK +DPVV++ E+V +TSS  C +++PNK N++ M A P+ + LA DI+   +    + K+ G F    YDWD+  +R IW FGPD  GPN++VD      V K +  L  +KDS+V  F W +++  LC+E +R V+F I D  +  + +HRGGGQIIPTARR +Y+  L A P L+EP Y  E+Q P   +  +Y+ L +RRG +  +  + G+P Y +KA++P  +SF F ++LR  T GQAF   VF HWQ+ PG+PLD         P   P +    +  TR+RKGLSED+  + KF D
Sbjct:  109 LPVTVYEMDFLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQDLCYTDILFTEQERGVGIKSTPVT------------------VVLPD---TKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTERLIKHAVQERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTDE----NLILSPLLGNVCFSSSQYSICFTLGSFAKIYADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKAPSSSSQRSFVEFILEPLYKILAQVVGDVDTSLPRTLDELGIHLTKEELKLNIRPLLRLVCKKFFGEFTGFVDMCVQHIPSPKVGAKPKIEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTKMYSTDDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIEVNRVPAGNWVLIEGVDQPIVKTATITEPRGNEEAQIFRPLKFNTTSVIKIAVEPVNPSELPKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCVMHDLRKMYSEIDIKVADPVVTFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQTKYDWDLLAARSIWAFGPDATGPNILVDDTLPSEVDKAL--LGSVKDSIVQGFQWGTREGPLCDELIRNVKFKILDAVVAQEPLHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFSLSVFHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDV-SISKFFD 954          
BLAST of Elongation factor 2 vs. Ensembl Mouse
Match: Eftud2 (elongation factor Tu GTP binding domain containing 2 [Source:MGI Symbol;Acc:MGI:1336880])

HSP 1 Score: 575.474 bits (1482), Expect = 0.000e+0
Identity = 314/873 (35.97%), Postives = 498/873 (57.04%), Query Frame = 3
Query:  105 LKMVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELDGPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKF-QMSSDKLMKRLWGDNFFSEKSKKWCKRP--DEGVRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAG---AHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVD------VSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLD---------PTTKPGIT---VRDTRKRKGLSEDIPPLDKFLD 2651
            L +  + +D +  LM+    IRN+++  H+ HGK+            I      D  +TD    EQER + IKST ++                  V L D   T  K +L N++D+PGHV+FS EVTA LR++DG ++ +D   GV + TE +++ A+ ER+   + +NK+D  +  L+  P D Y K + +++ VN +I+ Y   +    ++ ++P  G V F S   S  FT+ +FA +YA  F  ++  +  KRLWGD +F+ K++K+ K+       R F +F+L+P+Y +   V+            ++G+ L  EE  L  + LL+ + +K+       + M   H+PSP +  K + +  Y G +D ++  +M +CDP+G L+ + +KM  T D  +F+AFGRV SG +  GQ V+++G NY    ++D    ++ R  + + RY   +  VP GN   + GVDQ +VKT TI+   G   A   R +KF+ + V+++AVEP NP++LPK+++GL+++ KS P +   ++ESGE++I G GEL+L+  + DL + ++ I IK +DPVV++ E+V +TSS  C +++PNK N++ M A P+ + LA DI+   +    + K+ G F    YDWD+  +R IW FGPD  GPN++VD      V K +  L  +KDS+V  F W +++  LC+E +R V+F I D  +  + +HRGGGQIIPTARR +Y+  L A P L+EP Y  E+Q P   +  +Y+ L +RRG +  +  + G+P Y +KA++P  +SF F ++LR  T GQAF   VF HWQ+ PG+PLD         P   P +    +  TR+RKGLSED+  + KF D
Sbjct:  109 LPVTVYEMDFLADLMDNSELIRNVTLCGHLHHGKT---------HPEIRKRYDQDLCYTDILFTEQERGVGIKSTPVT------------------VVLPD---TKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTERLIKHAVQERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTDE----NLILSPLLGNVCFSSSQYSICFTLGSFAKIYADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKAPSSSSQRSFVEFILEPLYKILAQVVGDVDTSLPRTLDELGIHLTKEELKLNIRPLLRLVCKKFFGEFTGFVDMCVQHIPSPKVGAKPKIEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTKMYSTDDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIEVNRVPAGNWVLIEGVDQPIVKTATITEPRGNEEAQIFRPLKFNTTSVIKIAVEPVNPSELPKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCVMHDLRKMYSEIDIKVADPVVTFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQTKYDWDLLAARSIWAFGPDATGPNILVDDTLPSEVDKAL--LGSVKDSIVQGFQWGTREGPLCDELIRNVKFKILDAVVAQEPLHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFSLSVFHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDV-SISKFFD 944          
BLAST of Elongation factor 2 vs. Ensembl Mouse
Match: Efl1 (elongation factor like GTPase 1 [Source:MGI Symbol;Acc:MGI:2141969])

HSP 1 Score: 224.172 bits (570), Expect = 8.487e-60
Identity = 168/588 (28.57%), Postives = 256/588 (43.54%), Query Frame = 3
Query: 1296 SDKGRFYAFGRVFSGKVGTGQKVRIMGPNY------------VSGKKDDLYEK------SIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVT----------------------QTSSE--------------LCLSKSPNKHNRLYMTAAPMGEE-----------------LASDIDAGKITARSDVKER---------------GRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQ----------------YLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLH-------ADAIHRG--------------------------------------------------GGQIIPTARR-CIYATVLTAGPC-LLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPL-DPTTK 2573
            S +  F AF RVFSG    G+K+ ++GP Y             S   +DL         +++   L+MGR +E +E+VP GN+ G+ G+  +++K+ T+ +         + F  +P+VRVAVEPK+P+++P+LV+G+K L ++DP VQ+ I E+GE+++  AGE+HL+ CL DL E  A I I  S+P++ +RE++T                      QT  E              L    +PNK   L + A P+ EE                 L S ++ G+ T     K +               GR   +T D       +IW FGP   GPN++V  S+  Q                   +  +S+V+ F  A+    +CEE + GV F +    L+       +D  H+G                                                   GQ+I T +  C YA  L   P  L+  +Y C+I      LG +Y+ L+KR G +  E    GT  +++KA LPV ESF F  E+R +T G A PQ VF HW++ P +P   PTT+
Sbjct:  500 SSQEAFIAFARVFSGIARRGKKIFVLGPKYSPVDFLQRVPLGFSAPLEDLPPVPHMACCTLENLYLLMGRELEDLEEVPPGNVLGIGGLQDFVLKSATLCSLPSCPPFIPLNFEATPIVRVAVEPKHPSEMPQLVKGMKLLNQADPCVQVLIQETGEHVLVTAGEVHLQRCLDDLRERFAKIHISVSEPIIPFRETITKPPKVDMVNEEIGRQQKVAVIHQTKEEQSKIPEGIHVDSDGLITIPTPNKLATLSVRAIPLPEEVTRILEENSDLIRSMELLTSSLNEGRNTQAIHQKTQEKIWEFKGKLEKHLTGRKWRNTVD-------QIWSFGPRKCGPNILVSRSEDFQNSVWSGPAGRESKEASRFRDFGNSIVSGFQLATLSGPMCEEPLMGVCFVLEKWELNKCAEQGASDKQHQGQCDLAGEGQGGGKTCHVGDENQEQQDVCSEPFEETSQKGDSPVIDCYGPFSGQLIATMKEACRYA--LQVKPQRLMAAMYTCDIMATSDVLGRVYAVLSKREGRVLQEEMKEGTDMFIIKAVLPVAESFGFADEIRKRTSGLASPQLVFSHWEVIPSDPFWVPTTE 1078          

HSP 2 Score: 202.986 bits (515), Expect = 6.210e-53
Identity = 141/391 (36.06%), Postives = 212/391 (54.22%), Query Frame = 3
Query:  111 MVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISM-YNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVII------------------------AQYGE--LDGPMG-------DIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSDKLMKRLWGDNFFSEKSKKWCKRPDEGVRG----FNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEE-KALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSP 1166
            MV   +D++  L +   NIRN+ V+AHVDHGK+TL D L+S  GII+   AG  R+ D+R+DEQ R IT+KS+AIS+ Y E  E+                       +LINLIDSPGHVDFSSEV+ A+R+ DG ++VVD V GVC QT+ VLRQA  E I+PVL +NK+D  +  L+  P++ Y   + ++E +N +                         ++ GE   D   G        +  +PE G V F S +  W F +++FA +Y++K  +  + L+K LWGD + + K+KK  K   +  +G    F Q +L+ I+ ++  V+ K  E   ++   +G+K+ + E +   PK  +  I  +WLP    +L M+C  LPSP
Sbjct:    1 MVLSGVDKMIRLQKNTANIRNICVLAHVDHGKTTLADCLISSNGIISSRLAGKLRYMDSREDEQVRGITMKSSAISLHYAEGHEE-----------------------YLINLIDSPGHVDFSSEVSTAVRICDGCIIVVDAVEGVCPQTQAVLRQAWLENIRPVLVINKIDRLIVELKFTPQEAYSHLKNILEQINALTGTLFTSKVLEERAERETESQAKPHSEQGEQVYDWSAGLEDVDDSQLYFSPEQGNVVFTSAIDGWGFGIEHFARIYSQKIGIKKEVLLKTLWGDYYINMKAKKIMKV--DQAKGKKPLFVQLILENIWSLYDAVLKKDKEKIDKIVTSLGLKIGAREARHSDPKVQINAICSQWLPISHAVLAMVCHKLPSP 366          
BLAST of Elongation factor 2 vs. UniProt/SwissProt
Match: sp|P29691|EF2_CAEEL (Elongation factor 2 OS=Caenorhabditis elegans OX=6239 GN=eef-2 PE=1 SV=4)

HSP 1 Score: 1237.25 bits (3200), Expect = 0.000e+0
Identity = 616/852 (72.30%), Postives = 710/852 (83.33%), Query Frame = 3
Query:  111 MVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVK-VVQPVALSDDGKTDE-KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELDGPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSDKLMKRLWGDNFFSEKSKKWCK-RPDEGVRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSEDIPPLDKFLDKL 2657
            MVNFT+D+IRALM++KRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAG+KAG+ RFTDTRKDEQERCITIKSTAIS++ E+ +  L  VK   Q   +  DGK ++  GFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLFMNKMD A+  LQ   E+L+Q FQR++E++NVIIA YG+ DGPMG I V P  G VGFGSGL  WAFT+K FA+MYA KF +  DKLMK LWGD FF  K+KKW   + DE  RGF QFVL PI+MVF  VMN   +  A L +K+G+KL ++EK L+ K L+K  MRKWLPAGDT+LQMI  HLPSP  +QKYR ++LYEGP DDE A+++K CDPNG L+MYISKMVPTSDKGRFYAFGRVFSGKV TG K RI GPNYV GKK+DLYEK+IQRTILMMGR++E IED+P GNI GLVGVDQYLVK GTI+T+  AHN+RVMKFSVSPVVRVAVE KNPADLPKLVEGLKRLAKSDPMVQ   +ESGE+IIAGAGELHLEICLKDLEE+HACIP+KKSDPVVSYRE+V   S+++CLSKSPNKHNRL+ TA PM + LA DI+ G + AR + K R + L + Y++DV+E+RKIWCFGPDG GPN+++DV+KGVQYLNEIKDSVVA F WA+++ +L +ENMRGVRFN+HDVTLHADAIHRGGGQIIPTARR  YA+VLTA P LLEPVY  EIQ PE A+GGIY  LN+RRG +F E QV GTP +VVKAYLPVNESF FT++LR+ TGGQAFPQCVFDHWQ+ PG+PL+  TKP   V DTRKRKGL E +P LD +LDK+
Sbjct:    1 MVNFTVDEIRALMDRKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGSKAGETRFTDTRKDEQERCITIKSTAISLFFELEKKDLEFVKGENQFETVEVDGKKEKYNGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLFMNKMDRALLELQLGAEELFQTFQRIVENINVIIATYGDDDGPMGPIMVDPSIGNVGFGSGLHGWAFTLKQFAEMYAGKFGVQVDKLMKNLWGDRFFDLKTKKWSSTQTDESKRGFCQFVLDPIFMVFDAVMNIKKDKTAALVEKLGIKLANDEKDLEGKPLMKVFMRKWLPAGDTMLQMIAFHLPSPVTAQKYRMEMLYEGPHDDEAAVAIKTCDPNGPLMMYISKMVPTSDKGRFYAFGRVFSGKVATGMKARIQGPNYVPGKKEDLYEKTIQRTILMMGRFIEPIEDIPSGNIAGLVGVDQYLVKGGTITTYKDAHNMRVMKFSVSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIFEESGEHIIAGAGELHLEICLKDLEEDHACIPLKKSDPVVSYRETVQSESNQICLSKSPNKHNRLHCTAQPMPDGLADDIEGGTVNARDEFKARAKILAEKYEYDVTEARKIWCFGPDGTGPNLLMDVTKGVQYLNEIKDSVVAGFQWATREGVLSDENMRGVRFNVHDVTLHADAIHRGGGQIIPTARRVFYASVLTAEPRLLEPVYLVEIQCPEAAVGGIYGVLNRRRGHVFEESQVTGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQVLPGDPLEAGTKPNQIVLDTRKRKGLKEGVPALDNYLDKM 852          
BLAST of Elongation factor 2 vs. UniProt/SwissProt
Match: sp|P13060|EF2_DROME (Elongation factor 2 OS=Drosophila melanogaster OX=7227 GN=EF2 PE=1 SV=4)

HSP 1 Score: 1235.32 bits (3195), Expect = 0.000e+0
Identity = 611/850 (71.88%), Postives = 714/850 (84.00%), Query Frame = 3
Query:  111 MVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELDGPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSDKLMKRLWGDNFFSEKSKKWCKRPD-EGVRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSEDIPPLDKFLDKL 2657
            MVNFT+D+IR LM+KKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGAKAG+ RFTDTRKDEQERCITIKSTAISMY E+ E  L  V +  P    D  + + KGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKP+LFMNKMD A+  LQ + E+LYQ FQR++E+VNVIIA Y +  GPMG+++V P  G+VGFGSGL  WAFT+K F++MY++KF++   KLM RLWG+NFF+ K+KKW K+ + +  R F  ++L PIY VF  +MN   E+   L +K+GV L  E+K    K LLK +MR WLPAG+ LLQMI IHLPSP ++QKYR ++LYEGP DDE AI++K+CDP+G L+MYISKMVPTSDKGRFYAFGRVF+GKV TGQK RIMGPNY  GKK+DLYEK+IQRTILMMGRYVEAIEDVP GNICGLVGVDQ+LVKTGTI+TF  AHN++VMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQ  I+ESGE+IIAGAGELHLEICLKDLEE+HACIP+KKSDPVVSYRE+V++ S ++CLSKSPNKHNRL M A PM + L  DID G ++A+ + K R R+L + YD+DV+E+RKIWCFGPDG GPN ++D +K VQYLNEIKDSVVA F WASK+ IL +EN+RGVRFNI+DVTLHADAIHRGGGQIIPT RRC+YA  +TA P L+EPVY CEIQ PE A+GGIY  LN+RRG +F E QV GTP +VVKAYLPVNESF FT++LR+ TGGQAFPQCVFDHWQ+ PG+P +P++KP   V+DTRKRKGL E +P L ++LDKL
Sbjct:    1 MVNFTVDEIRGLMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGAKAGETRFTDTRKDEQERCITIKSTAISMYFEVEEKDL--VFITHP----DQREKECKGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPILFMNKMDRALLELQLDAEELYQTFQRIVENVNVIIATYNDDGGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMYSEKFKIDVVKLMNRLWGENFFNAKTKKWQKQKEADNKRSFCMYILDPIYKVFDAIMNYKKEEIGTLLEKIGVTLKHEDKDKDGKALLKTVMRTWLPAGEALLQMIAIHLPSPVVAQKYRMEMLYEGPHDDEAAIAVKSCDPDGPLMMYISKMVPTSDKGRFYAFGRVFAGKVATGQKCRIMGPNYTPGKKEDLYEKAIQRTILMMGRYVEAIEDVPSGNICGLVGVDQFLVKTGTITTFKDAHNMKVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHIIAGAGELHLEICLKDLEEDHACIPLKKSDPVVSYRETVSEESDQMCLSKSPNKHNRLLMKALPMPDGLPEDIDNGDVSAKDEFKARARYLSEKYDYDVTEARKIWCFGPDGTGPNFILDCTKSVQYLNEIKDSVVAGFQWASKEGILADENLRGVRFNIYDVTLHADAIHRGGGQIIPTTRRCLYAAAITAKPRLMEPVYLCEIQCPEVAVGGIYGVLNRRRGHVFEENQVVGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQVLPGDPSEPSSKPYAIVQDTRKRKGLKEGLPDLSQYLDKL 844          
BLAST of Elongation factor 2 vs. UniProt/SwissProt
Match: sp|Q90705|EF2_CHICK (Elongation factor 2 OS=Gallus gallus OX=9031 GN=EEF2 PE=1 SV=3)

HSP 1 Score: 1224.15 bits (3166), Expect = 0.000e+0
Identity = 616/868 (70.97%), Postives = 710/868 (81.80%), Query Frame = 3
Query:  111 MVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELD-GPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSDK-------------LMKRLWGDNFFSEKSKKWCKR---PD--EGVRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSEDIPPLDKFLDKL 2657
            MVNFT+DQIRA+M+KK NIRNMSVIAHVDHGKSTLTDSLV KAGIIA A+AG+ RFTDTRKDEQERCITIKSTAIS++ E++E+ LA +K       S DG     GFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVL MNKMD A+  LQ +PE+LYQ FQR++E+VNVII+ YGE + GPMG+I + P  GTVGFGSGL  WAFT+K FA+MY  KF    D              +MK+LWGD +F   + K+ K    PD  +  R F Q +L PI+ VF  +M    E+AA+L +K+ +KLDSE+K  + K LLK +MR+WLPAGD LLQMI IHLPSP  +QKYR +LLYEGP DDE AI +KNCDP G L+MYISKMVPTSDKGRFYAFGRVFSG V TG KVRIMGPNY  GKK+DLY K IQRTILMMGRYVE IEDVPCGNI GLVGVDQ+LVKTGTI+TF  AHN+RVMKFSVSPVVRVAVE KNPADLPKLVEGLKRLAKSDPMVQ  I+ESGE+IIAGAGELHLEICLKDLEE+HACIPIKKSDPVVSYRE+V++ S+ +CLSKSPNKHNRLYM A P  + LA DID G+++AR ++K+R R+L + Y+WDV+E+RKIWCFGPDG GPN++ D++KGVQYLNEIKDSVVA F WA+K+ +LCEENMRGVRF++HDVTLHADAIHRGGGQIIPTARRC+YA VLTA P L+EP+Y  EIQ PE  +GGIY  LN++RG +F E QVAGTP +VVKAYLPVNESF FT++LR+ TGGQAFPQCVFDHWQ+ PG+P D  ++P   V +TRKRKGL E IP LD FLDKL
Sbjct:    1 MVNFTVDQIRAIMDKKANIRNMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLFYELSENDLAFIK------QSKDGS----GFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLMMNKMDRALLELQLDPEELYQTFQRIVENVNVIISTYGEGESGPMGNIMIDPVLGTVGFGSGLHGWAFTLKQFAEMYVAKFAAKGDAQMNPTERAKKVEDMMKKLWGDRYFDPATGKFSKSATGPDGKKLPRTFCQLILDPIFKVFDAIMTFKKEEAAKLIEKLDIKLDSEDKDKEGKPLLKAVMRRWLPAGDALLQMITIHLPSPVTAQKYRCELLYEGPPDDEAAIGIKNCDPRGSLMMYISKMVPTSDKGRFYAFGRVFSGLVSTGLKVRIMGPNYTPGKKEDLYLKPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQFLVKTGTITTFEHAHNMRVMKFSVSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHIIAGAGELHLEICLKDLEEDHACIPIKKSDPVVSYRETVSEESNVMCLSKSPNKHNRLYMKARPFPDGLAEDIDKGEVSARQELKQRARYLAEKYEWDVTEARKIWCFGPDGTGPNILTDITKGVQYLNEIKDSVVAGFQWATKEGVLCEENMRGVRFDVHDVTLHADAIHRGGGQIIPTARRCLYACVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQVAGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPFDSASRPSQVVAETRKRKGLKEGIPALDNFLDKL 858          
BLAST of Elongation factor 2 vs. UniProt/SwissProt
Match: sp|Q1HPK6|EF2_BOMMO (Translation elongation factor 2 OS=Bombyx mori OX=7091 GN=tef2 PE=1 SV=1)

HSP 1 Score: 1211.82 bits (3134), Expect = 0.000e+0
Identity = 606/850 (71.29%), Postives = 709/850 (83.41%), Query Frame = 3
Query:  111 MVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELDGPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSDKLMKRLWGDNFFSEKSKKWCK-RPDEGVRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSEDIPPLDKFLDKL 2657
            MVNFT+D+IR +M+KKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGA+AG+ RFTDTRKDEQ+RCITIKSTAISM+ E+ E  L  V +  P    D  +  EKGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKP+LFMNKMD A+  LQ E E+LYQ FQR++E+VNVIIA Y +  GPMG+++V P  G+VGFGSGL  WAFT+K F++MYA KF++   KLM RLWG+NFF+ ++KKW K + D+  R F  +VL PIY VF  +M    E+  +L KK+GV +  E+     K LLK +MR WLPAG+ LLQMI IHLPSP ++QKYR ++LYEGP DDE AI +K+CDP   L+MY+SKMVPTSDKGRFYAFGRVFSGKV TGQK RIMGPN+  GKK+DLYEK+IQRTILMMGRYVEAIEDVP GNICGLVGVDQ+LVKTGTI+TF  AHN++VMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQ   +ESGE+I+AGAGELHLEICLKDLEE+HACIPIKKSDPVVSYRE+V + S +LCLSKSPNKHNRL+M A PM + L  DID G++  R D K R R+L + Y++DV+E+RKIWCFGP+G GPN++VD SKGVQYLNEIKDSVVA F WA+K+ ++ EEN+RGVRFNI+DVTLH DAIHRGGGQIIPT RRC+YA +LTA P L+EPVY CEIQ PE A+GGIY  LN+RRG +F E QVAGTP ++VKAYLPVNESF FT++LR+ TGGQAFPQCVFDHWQ+ PG+P +P +KP   V++TRKRKGL E +P L ++LDKL
Sbjct:    1 MVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRCITIKSTAISMFFELEEKDL--VFITNP----DQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPILFMNKMDRALLELQLEAEELYQTFQRIVENVNVIIATYNDDGGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMYADKFKIDLVKLMNRLWGENFFNPQTKKWSKQKDDDNKRSFCMYVLDPIYKVFDAIMKFKKEEIDDLLKKIGVTIKHEDSDKDGKALLKVVMRSWLPAGEALLQMIAIHLPSPVVAQKYRMEMLYEGPHDDEAAIGIKSCDPEAPLMMYVSKMVPTSDKGRFYAFGRVFSGKVVTGQKARIMGPNFTPGKKEDLYEKTIQRTILMMGRYVEAIEDVPSGNICGLVGVDQFLVKTGTITTFKNAHNMKVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQCINEESGEHIVAGAGELHLEICLKDLEEDHACIPIKKSDPVVSYRETVAEESDQLCLSKSPNKHNRLFMKAQPMPDGLPEDIDEGRVNPRDDFKTRARYLTEKYEYDVTEARKIWCFGPEGTGPNILVDCSKGVQYLNEIKDSVVAGFQWAAKEGVMAEENLRGVRFNIYDVTLHTDAIHRGGGQIIPTTRRCLYACLLTAQPRLMEPVYLCEIQCPEVAVGGIYGVLNRRRGHVFEESQVAGTPMFIVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQVLPGDPCEPQSKPYNVVQETRKRKGLKEGLPDLTQYLDKL 844          
BLAST of Elongation factor 2 vs. UniProt/SwissProt
Match: sp|Q3SYU2|EF2_BOVIN (Elongation factor 2 OS=Bos taurus OX=9913 GN=EEF2 PE=2 SV=3)

HSP 1 Score: 1204.89 bits (3116), Expect = 0.000e+0
Identity = 615/868 (70.85%), Postives = 710/868 (81.80%), Query Frame = 3
Query:  111 MVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELD-GPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSD-------------KLMKRLWGDNFFSEKSKKWCKR---PD--EGVRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSEDIPPLDKFLDKL 2657
            MVNFT+DQIRA+M+KK NIRNMSVIAHVDHGKSTLTDSLV KAGIIA A+AG+ RFTDTRKDEQERCITIKSTAIS++ E++E+ L  +K       S DG     GFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVL MNKMD A+  LQ EPE+LYQ FQR++E+VNVII+ YGE + GPMG+I + P  GTVGFGSGL  WAFT+K FA+MY  KF    +              +MK+LWGD +F   + K+ K    PD  +  R F Q +L PI+ VF  +MN   E+ A+L +K+ +KLDSE+K  + K LLK +MR+WLPAGD LLQMI IHLPSP  +QKYR +LLYEGP DDE A+ +K+CDP G L+MYISKMVPTSDKGRFYAFGRVFSG V TG KVRIMGPNY  GKK+DLY K IQRTILMMGRYVE IEDVPCGNI GLVGVDQ+LVKTGTI+TF  AHN+RVMKFSVSPVVRVAVE KNPADLPKLVEGLKRLAKSDPMVQ  I+ESGE+IIAGAGELHLEICLKDLEE+HACIPIKKSDPVVSYRE+V++ S+ LCLSKSPNKHNRLYM A P  + LA DID G+++AR ++K+R R+L + Y+WDV+E+RKIWCFGPDG GPN++ D++KGVQYLNEIKDSVVA F WA+K+  LCEENMRGVRF++HDVTLHADAIHRGGGQIIPTARRC+YA+VLTA P L+EP+Y  EIQ PE  +GGIY  LN++RG +F E QVAGTP +VVKAYLPVNESF FT++LR+ TGGQAFPQCVFDHWQ+ PG+P D T++P   V +TRKRKGL E IP LD FLDKL
Sbjct:    1 MVNFTVDQIRAIMDKKANIRNMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLFYELSENDLNFIK------QSKDGS----GFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQRIVENVNVIISTYGEGESGPMGNIMIDPVLGTVGFGSGLHGWAFTLKQFAEMYVAKFAAKGEGQLGPAERAKKVEDMMKKLWGDRYFDPATGKFSKSANSPDGKKLPRTFCQLILDPIFKVFDAIMNFKKEETAKLIEKLDIKLDSEDKDKEGKPLLKAVMRRWLPAGDALLQMITIHLPSPVTAQKYRCELLYEGPPDDEAAMGIKSCDPKGPLMMYISKMVPTSDKGRFYAFGRVFSGLVSTGLKVRIMGPNYTPGKKEDLYLKPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQFLVKTGTITTFEHAHNMRVMKFSVSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHIIAGAGELHLEICLKDLEEDHACIPIKKSDPVVSYRETVSEESNVLCLSKSPNKHNRLYMKARPFPDGLAEDIDKGEVSARQELKQRARYLAEKYEWDVAEARKIWCFGPDGTGPNILTDITKGVQYLNEIKDSVVAGFQWATKEGALCEENMRGVRFDVHDVTLHADAIHRGGGQIIPTARRCLYASVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEETQVAGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPFDNTSRPSQVVAETRKRKGLKEGIPALDNFLDKL 858          
BLAST of Elongation factor 2 vs. TrEMBL
Match: A0A504YZD9 (Translation elongation factor 2 OS=Fasciola gigantica OX=46835 GN=FGIG_00796 PE=4 SV=1)

HSP 1 Score: 1326.61 bits (3432), Expect = 0.000e+0
Identity = 647/851 (76.03%), Postives = 743/851 (87.31%), Query Frame = 3
Query:  111 MVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELDGPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSDKLMKRLWGDNFFSEKSKKWCK--RPDEGVRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSEDIPPLDKFLDKL 2657
            MV FT++++R +M+ KRNIRNMSVIAHVDHGKSTLTDSLV KAGIIA ++AGDARFTDTRKDEQ+RCITIKSTAIS+YN+MTE+ L  VK VQPVA++ DG T+E+GFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLFMNKMDMAV  L C+ E+LY KFQRVIE+VNVIIAQ+GELDGPMG+I V+P +GTVGFGSGLQSWAFT++NFA +Y  KF +   KLMKRLWGDNF+++K+KKW K  + D+ +RGFN +VLKPIY VF+TVM KS E+  EL KKMG+KLD  E AL  KQ LKCIM KWLPAGD+LL+MIC+HLPSP  SQ YR ++LYEGP DDE AI++K+CDPNG L+MYISKMVPTSDKGRFYAFGRVFSG V TGQKVRIMGPNYV GKKDDLYEK+IQRT+LMMGRY EA+E+VPCGNICGLVGVDQ++VKTGTI+TFAGAHN+R MKFSVSPVVRVAVE +NPADLPKLVEGLKRLAKSDPMVQI+ +ESGE+IIAGAGELHLEICLKDLEE+HACIP+KK+DPVVSYRE+V  TS+  CLSKSPNKHNRL M A+P+ EE++ DID GKI+ + D+K+RGR+L DT+ WDV E+R+IWCFGP+  GPN+VVDV+KGVQYLNEIKDSVV AF WA+K+ +LC ENMRGVR N+ D TLH DAIHRGGGQII TARRC YA VLTA P +LEPVY  EIQGP+T LGGIYSTLNK+RG+I SE ++ G P   VKA+LPVNESF FT++LRA TGGQAFPQCVFDHWQ YPGNPLD  +KPG  V   RKRKGLS++IP LDK+LDKL
Sbjct:    1 MVKFTVEELRRMMDLKRNIRNMSVIAHVDHGKSTLTDSLVCKAGIIADSRAGDARFTDTRKDEQDRCITIKSTAISLYNKMTEEDLQMVKSVQPVAVNADG-TEERGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLFMNKMDMAVTTLSCDMEELYNKFQRVIENVNVIIAQFGELDGPMGNISVSPTDGTVGFGSGLQSWAFTLRNFAKLYGSKFNLEPSKLMKRLWGDNFYNQKTKKWSKMKQSDDEIRGFNHYVLKPIYTVFKTVMEKSREEQTELLKKMGIKLDESENALADKQRLKCIMHKWLPAGDSLLEMICVHLPSPVASQAYRMEMLYEGPHDDEAAIAVKSCDPNGPLMMYISKMVPTSDKGRFYAFGRVFSGCVATGQKVRIMGPNYVPGKKDDLYEKTIQRTVLMMGRYTEAVENVPCGNICGLVGVDQFIVKTGTITTFAGAHNMRQMKFSVSPVVRVAVECQNPADLPKLVEGLKRLAKSDPMVQITTEESGEHIIAGAGELHLEICLKDLEEDHACIPLKKTDPVVSYRETVMDTSNIPCLSKSPNKHNRLTMRASPLTEEVSVDIDDGKISNKQDMKDRGRYLADTHGWDVQEARRIWCFGPESAGPNVVVDVTKGVQYLNEIKDSVVTAFQWATKEGVLCSENMRGVRINLEDATLHTDAIHRGGGQIIGTARRCFYACVLTAQPAILEPVYLVEIQGPDTILGGIYSTLNKKRGVIQSEERIMGMPVCNVKAFLPVNESFGFTTDLRANTGGQAFPQCVFDHWQQYPGNPLDSNSKPGQAVLAIRKRKGLSDEIPSLDKYLDKL 850          
BLAST of Elongation factor 2 vs. TrEMBL
Match: H2KSL0 (Elongation factor 2 OS=Clonorchis sinensis OX=79923 GN=CLF_109644 PE=4 SV=1)

HSP 1 Score: 1323.15 bits (3423), Expect = 0.000e+0
Identity = 638/854 (74.71%), Postives = 745/854 (87.24%), Query Frame = 3
Query:  102 ELKMVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELDGPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSDKLMKRLWGDNFFSEKSKKWCKR--PDEGVRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSEDIPPLDKFLDKL 2657
            ++ +V FT+D++R +M+ KRNIRNMSVIAHVDHGKSTLTDSLV KAGIIA ++AGDARFTDTRKDEQERCITIKSTAIS+YN+M+++    VK VQP+A+  DG ++E GFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKP+LFMNKMDMAV  L CE E+LY KFQRVIE+VNVIIAQ+GELDGPMG+I V+P +GTVGFGSGLQSWAFT++NFA +YA KF +  DKLMKR WGDNFF+ K+KKW K    D+ +RGFNQ+VL PIY VF+TVM KS E+   L  KMG+KLD  E AL  KQ LKC+M KWLPAGD+LL+MIC+HLPSP  SQ YR ++LYEGP DDE+A+++KNCDPNG L+MY+SKMVPTSDKGRF+AFGRVF+G + TGQKVRIMGPNYV GKKDDLYEK+IQRT+LMMGRY EAIE+VPCGNICGLVGVDQ+LVKTGTI+TF GAHN+R MKFSVSPVVRVAV+ +NPADLPKLVEGLKRLAKSDPMVQI+ +ESGE+IIAGAGELHLEICLKDLEE+HACIP+KK+DPVVSYRE+VT+TS+  CLSKSPNKHNRL M A P+ EE++ DID GK++A+ D+K+RGR+L D + WDV E+R+IWCFGP+  GPN+VVDV+KGVQYLNEIKDS+V AF W +K+ +LC ENMRGVR N+ D TLHADAIHRGGGQII TARRC +A VLTA P +LEPVY  EIQGP+TALGGIYSTLN++RG+I SE ++ GTP  VVKAYLPVNESF FT++LRA TGGQAFPQCVFDHWQLYPGNPLD ++KPG  V   RKRKGL++++P LDK+LDKL
Sbjct:    3 QVTLVKFTVDELRRMMDMKRNIRNMSVIAHVDHGKSTLTDSLVCKAGIIADSRAGDARFTDTRKDEQERCITIKSTAISLYNKMSQEGADMVKAVQPIAVHPDG-SEEHGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPILFMNKMDMAVTTLSCEMEELYTKFQRVIENVNVIIAQFGELDGPMGNISVSPTDGTVGFGSGLQSWAFTLRNFAKLYASKFGIEVDKLMKRFWGDNFFNIKTKKWSKNKNSDDDIRGFNQYVLTPIYTVFETVMKKSREEQTTLLGKMGIKLDESENALPDKQRLKCVMHKWLPAGDSLLEMICVHLPSPVTSQAYRMEMLYEGPHDDEVALAVKNCDPNGPLMMYVSKMVPTSDKGRFFAFGRVFAGTIATGQKVRIMGPNYVPGKKDDLYEKAIQRTVLMMGRYTEAIENVPCGNICGLVGVDQFLVKTGTITTFEGAHNMRQMKFSVSPVVRVAVDCQNPADLPKLVEGLKRLAKSDPMVQITSEESGEHIIAGAGELHLEICLKDLEEDHACIPLKKTDPVVSYRETVTETSNIPCLSKSPNKHNRLTMRAEPLTEEVSVDIDEGKVSAKQDMKDRGRYLADNHGWDVQEARRIWCFGPESTGPNVVVDVTKGVQYLNEIKDSIVTAFQWVTKEGVLCSENMRGVRINLEDATLHADAIHRGGGQIIGTARRCFFACVLTANPAILEPVYLVEIQGPDTALGGIYSTLNRKRGVIQSEERMQGTPICVVKAYLPVNESFGFTTDLRANTGGQAFPQCVFDHWQLYPGNPLDYSSKPGQAVLAIRKRKGLADEVPSLDKYLDKL 855          
BLAST of Elongation factor 2 vs. TrEMBL
Match: A0A5J4NFF6 (Elongation factor 2 OS=Paragonimus westermani OX=34504 GN=DEA37_0001767 PE=4 SV=1)

HSP 1 Score: 1321.99 bits (3420), Expect = 0.000e+0
Identity = 642/850 (75.53%), Postives = 742/850 (87.29%), Query Frame = 3
Query:  114 VNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELDGPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSDKLMKRLWGDNFFSEKSKKWC--KRPDEGVRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSEDIPPLDKFLDKL 2657
            V FT+D++R +M+ KRNIRNMSVIAHVDHGKSTLTDSLV KAGIIA A+AGDARFTDTRKDEQ+RCITIKSTAIS+YN+M+E+ +A VK VQP+A++ DG T+E+GFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLFMNKMDMAV  L CE E+LY KFQRVIE+VNVIIAQ+GE+DGPMG I V+P +GTVGFGSGLQSWAFT+KNFA +YA KF++   +LMKR WGDNF++ K+KKW   K+ D+ +RGFNQ+VL PIYMVF TVM KS ++   L  KMG+KLD  E AL  KQ LKCIM +WLPAGD+LL+MIC+HLPSP  SQ YR ++LYEGP DDE AI++KNCDPNG L+MYISKMVPTSDKGRF+AFGRVFSG V TGQKVRIMGPNYV GKKDDLYEK+IQRT+LMMGRY EA+E+VPCGNICGLVGVDQ++VKTGTI+TFAGAHN+R MKFSVSPVVRVAVE +NPADLPKLVEGLKRLAKSDPMVQI+ +ESGE+I+AGAGELHLEICLKDLEE+HACIP+KK+DPVVSYRE+VT+TSS  CLSKSPNKHNRL M A P+ EE++ DID GKI+ + D+K+RGR+L D + WDV E+R+IWCFGP+  GPN+VVDV+KGVQYLNEIKDSVV AF W +K+ +LC ENMRGVR ++ D TLH DAIHRGGGQII TARRC YA VLTA P +LEPVY  EIQGP+T+LGGIYSTLN++RG+I SE ++ GTP  VVKA+LPVNESF FT++LRA TGGQAFPQCVFDHWQ YPGNPLDP +KPG  V   RKRKGL ++IP LDK+LDKL
Sbjct:    9 VKFTVDELRRMMDLKRNIRNMSVIAHVDHGKSTLTDSLVCKAGIIADARAGDARFTDTRKDEQDRCITIKSTAISLYNKMSEEDIAMVKAVQPIAIAADG-TEERGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLFMNKMDMAVTTLSCEMEELYLKFQRVIENVNVIIAQFGEIDGPMGSISVSPTDGTVGFGSGLQSWAFTLKNFAKLYASKFKLEPTRLMKRFWGDNFYNTKTKKWTNIKQSDDEIRGFNQYVLTPIYMVFDTVMKKSRDEQTILLTKMGIKLDEAEYALPDKQRLKCIMHRWLPAGDSLLEMICVHLPSPVTSQAYRMEMLYEGPQDDEAAIAVKNCDPNGPLMMYISKMVPTSDKGRFFAFGRVFSGCVATGQKVRIMGPNYVPGKKDDLYEKTIQRTVLMMGRYTEAVENVPCGNICGLVGVDQFIVKTGTITTFAGAHNMRQMKFSVSPVVRVAVECQNPADLPKLVEGLKRLAKSDPMVQITTEESGEHIVAGAGELHLEICLKDLEEDHACIPLKKTDPVVSYRETVTETSSIQCLSKSPNKHNRLLMRAQPLTEEVSVDIDDGKISNKQDMKDRGRYLADNHGWDVQEARRIWCFGPESTGPNVVVDVTKGVQYLNEIKDSVVTAFQWVTKEGVLCSENMRGVRMDLEDATLHTDAIHRGGGQIIGTARRCFYACVLTAAPAILEPVYLVEIQGPDTSLGGIYSTLNRKRGVIQSEERMQGTPICVVKAFLPVNESFGFTTDLRANTGGQAFPQCVFDHWQQYPGNPLDPNSKPGQAVLAIRKRKGLPDEIPCLDKYLDKL 857          
BLAST of Elongation factor 2 vs. TrEMBL
Match: A0A419Q5F5 (Elongation factor 2 OS=Clonorchis sinensis OX=79923 GN=eef-2 PE=4 SV=1)

HSP 1 Score: 1321.99 bits (3420), Expect = 0.000e+0
Identity = 637/854 (74.59%), Postives = 745/854 (87.24%), Query Frame = 3
Query:  102 ELKMVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELDGPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSDKLMKRLWGDNFFSEKSKKWCKR--PDEGVRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSEDIPPLDKFLDKL 2657
            ++ +V FT+D++R +M+ KRNIRNMSVIAHVDHGKSTLTDSLV KAGIIA ++AGDARFTDTRKDEQERCITIKSTAIS+YN+M+++    VK VQP+A+  DG ++E GFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKP+LFMNKMDMAV  L CE E+LY KFQRVIE+VNVIIAQ+GELDGPMG+I V+P +GTVGFGSGLQSWAFT++NFA +YA KF +  +KLMKR WGDNFF+ K+KKW K    D+ +RGFNQ+VL PIY VF+TVM KS E+   L  KMG+KLD  E AL  KQ LKC+M KWLPAGD+LL+MIC+HLPSP  SQ YR ++LYEGP DDE+A+++KNCDPNG L+MY+SKMVPTSDKGRF+AFGRVF+G + TGQKVRIMGPNYV GKKDDLYEK+IQRT+LMMGRY EAIE+VPCGNICGLVGVDQ+LVKTGTI+TF GAHN+R MKFSVSPVVRVAV+ +NPADLPKLVEGLKRLAKSDPMVQI+ +ESGE+IIAGAGELHLEICLKDLEE+HACIP+KK+DPVVSYRE+VT+TS+  CLSKSPNKHNRL M A P+ EE++ DID GK++A+ D+K+RGR+L D + WDV E+R+IWCFGP+  GPN+VVDV+KGVQYLNEIKDS+V AF W +K+ +LC ENMRGVR N+ D TLHADAIHRGGGQII TARRC +A VLTA P +LEPVY  EIQGP+TALGGIYSTLN++RG+I SE ++ GTP  VVKAYLPVNESF FT++LRA TGGQAFPQCVFDHWQLYPGNPLD ++KPG  V   RKRKGL++++P LDK+LDKL
Sbjct:    3 QVTLVKFTVDELRRMMDMKRNIRNMSVIAHVDHGKSTLTDSLVCKAGIIADSRAGDARFTDTRKDEQERCITIKSTAISLYNKMSQEGADMVKAVQPIAVHPDG-SEEHGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPILFMNKMDMAVTTLSCEMEELYTKFQRVIENVNVIIAQFGELDGPMGNISVSPTDGTVGFGSGLQSWAFTLRNFAKLYASKFGIEVNKLMKRFWGDNFFNIKTKKWSKNKNSDDDIRGFNQYVLTPIYTVFETVMKKSREEQTALLGKMGIKLDESENALPDKQRLKCVMHKWLPAGDSLLEMICVHLPSPVTSQAYRMEMLYEGPHDDEVALAVKNCDPNGPLMMYVSKMVPTSDKGRFFAFGRVFAGTIATGQKVRIMGPNYVPGKKDDLYEKAIQRTVLMMGRYTEAIENVPCGNICGLVGVDQFLVKTGTITTFEGAHNMRQMKFSVSPVVRVAVDCQNPADLPKLVEGLKRLAKSDPMVQITSEESGEHIIAGAGELHLEICLKDLEEDHACIPLKKTDPVVSYRETVTETSNIPCLSKSPNKHNRLTMRAEPLTEEVSVDIDEGKVSAKQDMKDRGRYLADNHGWDVQEARRIWCFGPESTGPNVVVDVTKGVQYLNEIKDSIVTAFQWVTKEGVLCSENMRGVRINLEDATLHADAIHRGGGQIIGTARRCFFACVLTANPAILEPVYLVEIQGPDTALGGIYSTLNRKRGVIQSEERMQGTPICVVKAYLPVNESFGFTTDLRANTGGQAFPQCVFDHWQLYPGNPLDYSSKPGQAVLAIRKRKGLADEVPSLDKYLDKL 855          
BLAST of Elongation factor 2 vs. TrEMBL
Match: Q6AZM9 (Eft-2-prov protein OS=Xenopus laevis OX=8355 GN=eef2.2 PE=2 SV=1)

HSP 1 Score: 1321.61 bits (3419), Expect = 0.000e+0
Identity = 643/851 (75.56%), Postives = 742/851 (87.19%), Query Frame = 3
Query:  111 MVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELDGPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSDKLMKRLWGDNFFSEKSKKW--CKRPDEGVRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSEDIPPLDKFLDKL 2657
            MV FT++++R +M+ K+NIRNMSVIAHVDHGKSTLTDSLV KAGIIA ++AGDARFTDTRKDEQERCITIKSTAIS+YN+M+ED +  VK VQ VA++ DG T+E+GFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLFMNKMDMAV  L C+ E+LY KFQRVIE+VNVIIAQ+GELDGPMG+I V+P +GTVGFGSGLQSWAFT++NFA +Y  KF +   KLMKRLWGDNF+++K+KKW   K+ ++ +RGFN +VLKPIY VF+TVM K  E+   L +KMG+KLD  E AL  KQ LKCIM KWLPAGD+LL+MIC+HLPSP  SQ YR ++LYEGP DDE AI++KNCDPNG L+MYISKMVPTSDKGRFYAFGRVFSG V TGQKVRIMGPNY+ GKKDDLYEK+IQRT+LMMGRY EA+E+VPCGNICGLVGVDQ++VKTGTI+TFAGAHN+R MKFSVSPVVRVAVE +NPADLPKLVEGLKRLAKSDPMVQI+ +ESGE+IIAGAGELHLEICLKDLEE+HACIP+KK+DPVVSYRE+V  TS+  CLSKSPNKHNRL M A+P+ EE++ DID GKI+ + D+K+RGR+L D + WDV E+R+IWCFGP+  GPN+VVDV+KGVQYLNEIKDSVV AF WA+K+ +LC ENMRGVR N+ D TLH DAIHRGGGQII TARRC YA VLTA P +LEPVY  EIQGP+T LGGIYSTLNK+RG+I SE +VAG P   VKA+LPVNESF FT++LRA TGGQAFPQCVFDHWQ YPGNPLDP++KPG  V   RKRKGLS++IP LDK+LDKL
Sbjct:    1 MVKFTVEELRRMMDLKKNIRNMSVIAHVDHGKSTLTDSLVCKAGIIADSRAGDARFTDTRKDEQERCITIKSTAISLYNKMSEDDIEMVKSVQSVAVNADG-TEERGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLFMNKMDMAVTTLSCDMEELYNKFQRVIENVNVIIAQFGELDGPMGNISVSPTDGTVGFGSGLQSWAFTLRNFAKLYGSKFGLEPSKLMKRLWGDNFYNQKTKKWSKVKQSEDEIRGFNHYVLKPIYTVFKTVMEKPREEQNALLQKMGIKLDESENALADKQRLKCIMHKWLPAGDSLLEMICVHLPSPVTSQAYRMEMLYEGPHDDEAAIAVKNCDPNGPLMMYISKMVPTSDKGRFYAFGRVFSGCVATGQKVRIMGPNYIPGKKDDLYEKTIQRTVLMMGRYTEAVENVPCGNICGLVGVDQFIVKTGTITTFAGAHNMRQMKFSVSPVVRVAVECQNPADLPKLVEGLKRLAKSDPMVQITTEESGEHIIAGAGELHLEICLKDLEEDHACIPLKKTDPVVSYRETVMDTSNIPCLSKSPNKHNRLTMRASPLTEEVSVDIDDGKISNKQDMKDRGRYLADNHGWDVQEARRIWCFGPESTGPNVVVDVTKGVQYLNEIKDSVVTAFQWATKEGVLCSENMRGVRINLEDATLHTDAIHRGGGQIIGTARRCFYACVLTAQPAILEPVYLVEIQGPDTILGGIYSTLNKKRGVIQSEERVAGMPVCCVKAFLPVNESFGFTTDLRANTGGQAFPQCVFDHWQQYPGNPLDPSSKPGQAVLAIRKRKGLSDEIPSLDKYLDKL 850          
BLAST of Elongation factor 2 vs. Ensembl Cavefish
Match: eef2b (eukaryotic translation elongation factor 2 [Source:NCBI gene;Acc:103031761])

HSP 1 Score: 1205.28 bits (3117), Expect = 0.000e+0
Identity = 608/868 (70.05%), Postives = 704/868 (81.11%), Query Frame = 3
Query:  111 MVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELDG-PMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSD-------------KLMKRLWGDNFFSEKSKKWCKR---PD--EGVRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSEDIPPLDKFLDKL 2657
            MVNFT+DQIRA+M+KK NIRNMSVIAHVDHGKSTLTDSLVSKAGIIA ++AG+ RFTDTRKDEQERCITIKSTAISMY E++++ LA +K       S DG     GFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVL MNKMD A+  LQ EP++L+Q FQR++E+VNVII+ YGE +G PMG+I + P  GTVGFGSGL  WAFT+K FA+MY  KF    D              +MK+LWGD +F   + K+ K    PD  +  R F Q +L PI+ VF  +MN   E+ A+L  K+ +KLD E+K  + K LLK +MR+WLPAG+ LLQMI IHLPSP  +Q+YR +LLYEGP DDE A+ +KNCDP   L+MYISKMVPTSDKGRFYAFGRVFSG V TG KVRIMGPNY  GKK+DLY K IQRTILMMGRYVE IEDVPCGNI GLVGVDQ+LVKTGTI+TF  AHN+RVMKFSVSPVVRVAVE KNPADLPKLVEGLKRLAKSDPMVQ  I+ESGE+IIAGAGELHLEICLKDLEE+HACIP+KKSDPVVSYRE+V++ S ++CLSKSPNKHNRLYM A P  + LA D++ G ++AR ++K R R+L D Y+W+V+E+RKIWCFGPDGNGPN++VDV+KGVQYLNEIKDSVVA F WA+K+  LCEENMR +RF+IHDVTLHADAIHRGGGQIIPTARR +YA+ LTA P L+EP+Y  EIQ PE  +GGIY  LN++RG +F E QV GTP +VVKAYLPVNESF FT++LR+ TGGQAFPQCVFDHWQ+  G+P D T+KP   V + RKRKGL E IPPLD FLDKL
Sbjct:    1 MVNFTVDQIRAIMDKKSNIRNMSVIAHVDHGKSTLTDSLVSKAGIIASSRAGETRFTDTRKDEQERCITIKSTAISMYYELSDNDLAFIK------QSKDGS----GFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLMMNKMDRALLELQLEPDELFQTFQRIVENVNVIISTYGEDEGGPMGNIMIDPVIGTVGFGSGLHGWAFTLKQFAEMYVAKFAAKGDGQLGPAERCKKVEDMMKKLWGDRYFDPATGKFSKTATGPDGKKLPRTFAQLILDPIFKVFDAIMNFKKEETAKLIDKLDIKLDQEDKDKEGKPLLKAVMRRWLPAGEALLQMITIHLPSPVTAQRYRCELLYEGPGDDEAAMGIKNCDPKAPLMMYISKMVPTSDKGRFYAFGRVFSGCVSTGLKVRIMGPNYTPGKKEDLYLKPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQFLVKTGTITTFEQAHNMRVMKFSVSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHIIAGAGELHLEICLKDLEEDHACIPLKKSDPVVSYRETVSEESDQMCLSKSPNKHNRLYMKARPFQDGLAEDVEKGDVSARQELKARARYLADKYEWEVTEARKIWCFGPDGNGPNILVDVTKGVQYLNEIKDSVVAGFQWATKEGALCEENMRAIRFDIHDVTLHADAIHRGGGQIIPTARRVLYASQLTAEPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQVMGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILQGDPKDATSKPCQIVAEIRKRKGLKEGIPPLDNFLDKL 858          
BLAST of Elongation factor 2 vs. Ensembl Cavefish
Match: eef2b (eukaryotic translation elongation factor 2 [Source:NCBI gene;Acc:103031761])

HSP 1 Score: 1202.96 bits (3111), Expect = 0.000e+0
Identity = 607/867 (70.01%), Postives = 703/867 (81.08%), Query Frame = 3
Query:  114 VNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELDG-PMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSD-------------KLMKRLWGDNFFSEKSKKWCKR---PD--EGVRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSEDIPPLDKFLDKL 2657
            VNFT+DQIRA+M+KK NIRNMSVIAHVDHGKSTLTDSLVSKAGIIA ++AG+ RFTDTRKDEQERCITIKSTAISMY E++++ LA +K       S DG     GFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVL MNKMD A+  LQ EP++L+Q FQR++E+VNVII+ YGE +G PMG+I + P  GTVGFGSGL  WAFT+K FA+MY  KF    D              +MK+LWGD +F   + K+ K    PD  +  R F Q +L PI+ VF  +MN   E+ A+L  K+ +KLD E+K  + K LLK +MR+WLPAG+ LLQMI IHLPSP  +Q+YR +LLYEGP DDE A+ +KNCDP   L+MYISKMVPTSDKGRFYAFGRVFSG V TG KVRIMGPNY  GKK+DLY K IQRTILMMGRYVE IEDVPCGNI GLVGVDQ+LVKTGTI+TF  AHN+RVMKFSVSPVVRVAVE KNPADLPKLVEGLKRLAKSDPMVQ  I+ESGE+IIAGAGELHLEICLKDLEE+HACIP+KKSDPVVSYRE+V++ S ++CLSKSPNKHNRLYM A P  + LA D++ G ++AR ++K R R+L D Y+W+V+E+RKIWCFGPDGNGPN++VDV+KGVQYLNEIKDSVVA F WA+K+  LCEENMR +RF+IHDVTLHADAIHRGGGQIIPTARR +YA+ LTA P L+EP+Y  EIQ PE  +GGIY  LN++RG +F E QV GTP +VVKAYLPVNESF FT++LR+ TGGQAFPQCVFDHWQ+  G+P D T+KP   V + RKRKGL E IPPLD FLDKL
Sbjct:   27 VNFTVDQIRAIMDKKSNIRNMSVIAHVDHGKSTLTDSLVSKAGIIASSRAGETRFTDTRKDEQERCITIKSTAISMYYELSDNDLAFIK------QSKDGS----GFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLMMNKMDRALLELQLEPDELFQTFQRIVENVNVIISTYGEDEGGPMGNIMIDPVIGTVGFGSGLHGWAFTLKQFAEMYVAKFAAKGDGQLGPAERCKKVEDMMKKLWGDRYFDPATGKFSKTATGPDGKKLPRTFAQLILDPIFKVFDAIMNFKKEETAKLIDKLDIKLDQEDKDKEGKPLLKAVMRRWLPAGEALLQMITIHLPSPVTAQRYRCELLYEGPGDDEAAMGIKNCDPKAPLMMYISKMVPTSDKGRFYAFGRVFSGCVSTGLKVRIMGPNYTPGKKEDLYLKPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQFLVKTGTITTFEQAHNMRVMKFSVSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHIIAGAGELHLEICLKDLEEDHACIPLKKSDPVVSYRETVSEESDQMCLSKSPNKHNRLYMKARPFQDGLAEDVEKGDVSARQELKARARYLADKYEWEVTEARKIWCFGPDGNGPNILVDVTKGVQYLNEIKDSVVAGFQWATKEGALCEENMRAIRFDIHDVTLHADAIHRGGGQIIPTARRVLYASQLTAEPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQVMGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILQGDPKDATSKPCQIVAEIRKRKGLKEGIPPLDNFLDKL 883          
BLAST of Elongation factor 2 vs. Ensembl Cavefish
Match: eftud2 (elongation factor Tu GTP binding domain containing 2 [Source:NCBI gene;Acc:103026464])

HSP 1 Score: 578.17 bits (1489), Expect = 0.000e+0
Identity = 313/875 (35.77%), Postives = 500/875 (57.14%), Query Frame = 3
Query:  102 ELKMVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXX-XXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELDGPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKF-QMSSDKLMKRLWGDNFFSEKSKKWCKRP--DEGVRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAG---AHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVD------VSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLD---------PTTKPGIT---VRDTRKRKGLSEDIPPLDKFLD 2651
            EL    + ++ +  LM+    IRN+++  H+ HGK+   D L+ +    I      D R+TD    EQER + IKST ++M                   L D   +  K +L N++D+PGHV+FS EVTA +R++DG ++ +D   GV + TE +++ A+ ER+   + +NK+D  +  L+  P D Y K + +++ VN +++ Y   +     + V+P  G V F S   S  FT+ +FA +Y+  F  ++ ++  KRLWGD +F+ K++K+ K+       R F +FVL+P+Y +   V+         +  ++G+ L  EE  L  + LL+ +  ++       + M   H+PSP    + + +  Y G LD ++  +M  CDP+G L+ + +KM  T D  +F+AFGRV SG +  GQ V+++G NY    ++D    +I R  + + RY   +  VP GN   + G DQ +VKT TI+   G   A   R +KF+ + V+++AVEP NP++LPK+++GL+++ KS P +   ++ESGE++I G GEL+L+  + DL + ++ I IK +DPVV++ E+V +TSS  C +++PNK N++ M A P+ + LA DI+   +    + K+ G F    YDWD+  +R IW FGPD  GPN++VD      V K +  L  +KDS+V  F W +++  LC+E +R V+F I D  +  + +HRGGGQ+IPTARR +Y+  L A P L+EP Y  E+Q P   +  +Y+ L +RRG +  +  + G+P Y +KA++P  +SF F ++LR  T GQAF   VF HWQ+ PG+PLD         P   P +    +  TR+RKGLSED+  + KF D
Sbjct:  113 ELPATVYDMEFLADLMDSSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRDDADLRYTDILFTEQERGVGIKSTPVTM------------------VLPD---SRGKSYLFNIMDTPGHVNFSDEVTAGIRISDGVVLFIDAAEGVMLNTERLIKHAVQERLAITICINKVDRLILELKLPPTDAYYKLRHIVDEVNGMLSTYSTDES----LVVSPLLGNVCFASSQYSICFTLGSFAKIYSDTFGDINYNEFAKRLWGDIYFNPKTRKFTKKAPNSNSQRSFVEFVLEPLYKILSQVVGDVDTSLPRVLDELGIHLTKEELKLNIRPLLRLVCNRFFGEFTGFVDMCVQHIPSPQGGARAKIEHSYTGGLDSDLGEAMAECDPDGPLMCHTTKMYSTDDGVQFHAFGRVLSGTLQAGQPVKVLGENYTLEDEEDSQVCTIGRLWISVARYQIEVNRVPAGNWVLIEGCDQPIVKTATITEPRGTEEAQIFRPLKFNTASVIKIAVEPVNPSELPKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCVMHDLRKMYSEIDIKVADPVVTFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQTKYDWDLLAARSIWAFGPDTTGPNILVDDTLPSEVDKAL--LGSVKDSIVQGFQWGTREGPLCDEPIRNVKFKILDAVIAQEPLHRGGGQVIPTARRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFSLSVFHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDV-SISKFFD 959          
BLAST of Elongation factor 2 vs. Ensembl Cavefish
Match: efl1 (elongation factor like GTPase 1 [Source:NCBI gene;Acc:103028390])

HSP 1 Score: 224.942 bits (572), Expect = 3.177e-60
Identity = 151/554 (27.26%), Postives = 243/554 (43.86%), Query Frame = 3
Query: 1311 FYAFGRVFSGKVGTGQKVRIMGPNYVSG----------KKDD-------LYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQT------------------------------------SSELCLSKSPNKHNRLYMTAAPMGE----------ELASDIDAGKITAR---------------SDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQY------------------LNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTL-------HADAIHRGG-----------------------------GQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPL-DPTTK 2573
            F AF RV+SG V  GQ+V ++GP Y               DD       L   +++   ++MGR +E +E+VP GN+ G+ G++ +++K+ T+ST         + F  +P+VRVA+EPK+P+++PKLV G++ L ++DP  ++ I E+GE+++  AGE+HL+ CL DL E  A I I  S P++ +RE++ +                                     S  L    +PNK   + + A P+ E          EL   ++   + AR                + + R    +  + W  +  R IW FGP   GPN++++  +G Q                   L +  +S+V  F  A+    +CEE + GV F++    +         D+   GG                             GQ+I   +             L+  +Y CEI      LG +Y  L+KR G + +E    GT  ++++A LPV ESF F  E+R +T G A PQ VF HW++   +P   PTT+
Sbjct:  502 FIAFARVYSGVVRRGQRVFVLGPKYDPALTLRTLPEGCSADDTVPSVPHLACCTLEHLYMLMGRELEELEEVPAGNVLGIAGMEDFILKSATVSTSPACPPFTPLNFEATPIVRVAIEPKHPSEMPKLVRGMRLLNQADPCAEVLIQETGEHVLVTAGEVHLQRCLDDLRERFAKIEISASKPIIPFRETIIRPPKVDMVNEDLGRQQKVAVIHQAKEEQSKYHEGPQVDSGGLVNLTTPNKMATIGVRAVPLPEEATRLLEGSAELIRTMEQFSLFAREGKTLEISQKTLEQIQEFRTRLEGHLQGWKWRNAVER-IWAFGPRRCGPNILLNGVEGYQRPSVWQCLEGEKEKPEAATLRDFDNSIVNGFQLATLSGPMCEEPLMGVCFSVESWEMKLAPQFTQQDSSESGGSNEAEASSSSAGGQSRWRGDVTDCYGPFSGQLIAAMKEACRHAFQAKPQRLMAAMYTCEIMATAEVLGRVYGVLSKREGRVLNEEMKEGTDMFIIRAVLPVAESFGFADEMRKRTSGLASPQLVFSHWEVISSDPFWVPTTE 1054          

HSP 2 Score: 214.542 bits (545), Expect = 7.486e-57
Identity = 147/406 (36.21%), Postives = 220/406 (54.19%), Query Frame = 3
Query:  111 MVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIA-------------QYGELDG--PMGDI-------QV-----------------TPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSDKLMKRLWGDNFFSEKSKKWCKRPDEGVRG--FNQFVLKPIYMVFQTVMNKSLEDAAE-LAKKMGVKLDSEE-KALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLL 1199
            M + +++++  L +K  NIRN+ ++AHVDHGK+TL D LV+  GII+   AG  R+ D+R+DEQ R IT+KS+AIS++                        + E  +LINLIDSPGHVDFSSEV+ A+R+ DGA+VVVD V GVC QT+ VLRQA  E I+PVL +NK+D  +  L+  P++ Y   Q+++E VN +               +  EL+G  P G++       QV                 +P+ G V F S   SW F++  FA +Y +K  + S+ L K LWGD + + K+KK  K      +   F Q VL  I+ ++  V+ +  ++  E +   +G+K+ + + +   PK LL  I  +WLP    +L M+C  LPSP+     R + L
Sbjct:    1 MGHTSLEKLIRLQKKTSNIRNICILAHVDHGKTTLADCLVASNGIISTRLAGKMRYLDSREDEQIRGITMKSSAISLHF----------------------TSGESEYLINLIDSPGHVDFSSEVSTAVRLCDGAIVVVDAVEGVCPQTQAVLRQAWLENIRPVLVINKIDRLIVELKLSPQEAYTHLQKILEQVNAVTGALFTSKVLEERAVKEAELEGAVPEGEVPELSGGEQVYDWSAGLEETDDSHLYFSPDQGNVVFASAFDSWGFSIHQFAQIYCQKMGIRSEVLQKTLWGDFYINPKAKKIMKGAQSKGKKPLFVQLVLDNIWSLYDAVVTRRDKEKVEKIVASLGLKVMARDLRHSDPKVLLSAICSQWLPLSQAVLSMVCERLPSPSEMSAERVEKL 384          
BLAST of Elongation factor 2 vs. Ensembl Cavefish
Match: efl1 (elongation factor like GTPase 1 [Source:NCBI gene;Acc:103028390])

HSP 1 Score: 214.542 bits (545), Expect = 9.925e-57
Identity = 147/406 (36.21%), Postives = 220/406 (54.19%), Query Frame = 3
Query:  111 MVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIA-------------QYGELDG--PMGDI-------QV-----------------TPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSDKLMKRLWGDNFFSEKSKKWCKRPDEGVRG--FNQFVLKPIYMVFQTVMNKSLEDAAE-LAKKMGVKLDSEE-KALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLL 1199
            M + +++++  L +K  NIRN+ ++AHVDHGK+TL D LV+  GII+   AG  R+ D+R+DEQ R IT+KS+AIS++                        + E  +LINLIDSPGHVDFSSEV+ A+R+ DGA+VVVD V GVC QT+ VLRQA  E I+PVL +NK+D  +  L+  P++ Y   Q+++E VN +               +  EL+G  P G++       QV                 +P+ G V F S   SW F++  FA +Y +K  + S+ L K LWGD + + K+KK  K      +   F Q VL  I+ ++  V+ +  ++  E +   +G+K+ + + +   PK LL  I  +WLP    +L M+C  LPSP+     R + L
Sbjct:    1 MGHTSLEKLIRLQKKTSNIRNICILAHVDHGKTTLADCLVASNGIISTRLAGKMRYLDSREDEQIRGITMKSSAISLHF----------------------TSGESEYLINLIDSPGHVDFSSEVSTAVRLCDGAIVVVDAVEGVCPQTQAVLRQAWLENIRPVLVINKIDRLIVELKLSPQEAYTHLQKILEQVNAVTGALFTSKVLEERAVKEAELEGAVPEGEVPELSGGEQVYDWSAGLEETDDSHLYFSPDQGNVVFASAFDSWGFSIHQFAQIYCQKMGIRSEVLQKTLWGDFYINPKAKKIMKGAQSKGKKPLFVQLVLDNIWSLYDAVVTRRDKEKVEKIVASLGLKVMARDLRHSDPKVLLSAICSQWLPLSQAVLSMVCERLPSPSEMSAERVEKL 384          

HSP 2 Score: 162.925 bits (411), Expect = 2.059e-40
Identity = 106/391 (27.11%), Postives = 178/391 (45.52%), Query Frame = 3
Query: 1311 FYAFGRVFSGKVGTGQKVRIMGPNYVSG----------KKDDLYEK-------SIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQT------------------------------------SSELCLSKSPNKHNRLYMTAAPMGE----------ELASDIDAGKITAR---------------SDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQY------------------LNEIKDSVVAAFNWASKDSILCEENMRGVRFNI 2195
            F AF RV+SG V  GQ+V ++GP Y               DD           +++   ++MGR +E +E+VP GN+ G+ G++ +++K+ T+ST         + F  +P+VRVA+EPK+P+++PKLV G++ L ++DP  ++ I E+GE+++  AGE+HL+ CL DL E  A I I  S P++ +RE++ +                                     S  L    +PNK   + + A P+ E          EL   ++   + AR                + + R    +  + W  +  R IW FGP   GPN++++  +G Q                   L +  +S+V  F  A+    +CEE + GV F++
Sbjct:  515 FIAFARVYSGVVRRGQRVFVLGPKYDPALTLRTLPEGCSADDTVPSVPHLACCTLEHLYMLMGRELEELEEVPAGNVLGIAGMEDFILKSATVSTSPACPPFTPLNFEATPIVRVAIEPKHPSEMPKLVRGMRLLNQADPCAEVLIQETGEHVLVTAGEVHLQRCLDDLRERFAKIEISASKPIIPFRETIIRPPKVDMVNEDLGRQQKVAVIHQAKEEQSKYHEGPQVDSGGLVNLTTPNKMATIGVRAVPLPEEATRLLEGSAELIRTMEQFSLFAREGKTLEISQKTLEQIQEFRTRLEGHLQGWKWRNAVER-IWAFGPRRCGPNILLNGVEGYQRPSVWQCLEGEKEKPEAATLRDFDNSIVNGFQLATLSGPMCEEPLMGVCFSV 904          

HSP 3 Score: 83.5741 bits (205), Expect = 7.588e-16
Identity = 41/113 (36.28%), Postives = 59/113 (52.21%), Query Frame = 3
Query: 2238 GQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPL-DPTTK 2573
            GQ+I   +             L+  +Y CEI      LG +Y  L+KR G + +E    GT  ++++A LPV ESF F  E+R +T G A PQ VF HW++   +P   PTT+
Sbjct:  980 GQLIAAMKEACRHAFQAKPQRLMAAMYTCEIMATAEVLGRVYGVLSKREGRVLNEEMKEGTDMFIIRAVLPVAESFGFADEMRKRTSGLASPQLVFSHWEVISSDPFWVPTTE 1092          
BLAST of Elongation factor 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001336.1 (pep scaffold:Pmarinus_7.0:GL476352:246829:320669:1 gene:ENSPMAG00000001142.1 transcript:ENSPMAT00000001336.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1222.99 bits (3163), Expect = 0.000e+0
Identity = 614/868 (70.74%), Postives = 704/868 (81.11%), Query Frame = 3
Query:  111 MVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGE-LDGPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSDK-------------LMKRLWGDNFFSEKSKKWCKRPDEGV-----RGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSEDIPPLDKFLDKL 2657
            MVNFT+DQIRA+M+KK NIRNMSVIAHVDHGKSTLTDSLV KAGIIAG++AG+ RFTDTRKDEQERCITIKSTAIS+Y E+ E  LA +K  +          D  GFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAI ERIKPVL MNKMD A+  LQ EPE L+Q FQR++E+VNVII+ YGE  +GPMG+I V P  GTVGFGSGL  WAFT+K FA+MY  KF    DK             +MK+LWG+ +F   + K+ K           R F Q VL PI+ VF  +MN   E+ A+L +K+ +KLD+E+K  + K LLK +MR+WLPAGD LL MI IHLPSP  +Q+YR +LLYEGP DDE A+ +KNCDP   L+MYISKMVPT+DKGRFYAFGRVFSG V TGQKVRIMGPNY  GKK+DL+ K IQRTILMMGRYVE IE+VPCGNI GLVGVDQ+LVKTGTIST+  AHNLRVMKFSVSPVVRVAVE KNPADLPKLVEGLKRLAKSDPMVQ  I+ESGE+IIAGAGELHLEICLKDLEE+HACIPIKKSDPVVSYRE+V   S ++CLSKSPNKHNRLYM A P+ + LA DID G++ AR ++K R R+LVD Y+WDV+E+RKIWCFGPDG GPNM+VDV+KGVQYLNEIKDSVVA F WA K+ +LC+ENMRGVRF+IHDVTLHADAIHRGGGQIIPTARR +YA++LTAGP L+EP+Y  EIQ PE  +GGIY  LN++RG +F E QVAGTP +VVKAYLPVNESF FT++LR+ TGGQAFPQCVFDHWQ+ PG+P DPTT+P   V +TRKRKGL E IP LD +LDKL
Sbjct:    1 MVNFTVDQIRAIMDKKSNIRNMSVIAHVDHGKSTLTDSLVCKAGIIAGSRAGETRFTDTRKDEQERCITIKSTAISLYYELQETDLAFIKQCK----------DGNGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIGERIKPVLMMNKMDRALLELQLEPEPLFQTFQRIVENVNVIISTYGEDENGPMGNIMVDPVAGTVGFGSGLHGWAFTLKQFAEMYVSKFAAKGDKNISATERCKKVEDMMKKLWGERYFDPATMKFSKSATNAAGEKLPRTFCQLVLDPIFKVFDAIMNFKKEETAKLVEKLDIKLDTEDKDKEGKPLLKAVMRRWLPAGDALLHMITIHLPSPVTAQRYRCELLYEGPGDDEAAMGIKNCDPKAPLMMYISKMVPTTDKGRFYAFGRVFSGVVSTGQKVRIMGPNYTPGKKEDLFIKPIQRTILMMGRYVEPIEEVPCGNIVGLVGVDQFLVKTGTISTYEHAHNLRVMKFSVSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHIIAGAGELHLEICLKDLEEDHACIPIKKSDPVVSYRETVENESDQVCLSKSPNKHNRLYMKARPLSDGLAEDIDKGEVAARQELKLRARYLVDKYEWDVTEARKIWCFGPDGTGPNMLVDVTKGVQYLNEIKDSVVAGFQWAMKEGVLCDENMRGVRFDIHDVTLHADAIHRGGGQIIPTARRVMYASMLTAGPRLMEPIYLVEIQCPEAVVGGIYGVLNRKRGHVFEESQVAGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPSDPTTRPAQVVVETRKRKGLKEGIPALDNYLDKL 858          
BLAST of Elongation factor 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000172.1 (pep scaffold:Pmarinus_7.0:GL487060:72:9589:1 gene:ENSPMAG00000000152.1 transcript:ENSPMAT00000000172.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 272.322 bits (695), Expect = 5.873e-83
Identity = 145/383 (37.86%), Postives = 223/383 (58.22%), Query Frame = 3
Query: 1437 LMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAG---AHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSV-VAAFNWASKDSILCEENMRGVRFNIHDV-------TLHADAIHR----GGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQL 2540
            + + RY   +  VP GN   + GVDQ +VKT TI+   G   A   R +KF+ S V+++AVEP NP++LPK+++GL+++ KS P++   ++ESGE+II G GEL+L+  + DL + ++ I IK +DPVVS+ E+V +TSS  C +++PNK N++ M A P+ + LA DI+   +    + K+ G F    YDWD+  +R IW FGPD  GPN++VD +   + L  +   V +  F + +       E     R   H V        +  + +H     GG  + PTARR +Y+  L A P L+EP Y  E+Q P   +  +Y+ L +RRG +  +  + G+P Y +KA++P  +SF F ++LR  T GQAF   VF HWQ+
Sbjct:    2 VAVSRYRIEVSRVPAGNWVLIEGVDQPIVKTATITEPTGTDEAQIFRPLKFNTSSVIKIAVEPVNPSELPKMLDGLRKVNKSYPVLTTKVEESGEHIILGTGELYLDCVMHDLRKMYSEIDIKVADPVVSFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQTKYDWDLLAARSIWAFGPDTTGPNILVDDTLPSEVLRPLVFRVKILHFGFCA----FAREGCSCTRPRWHTVGYCRAWHVMARELVHPCEFCGGVYVXPTARRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFCLSVFHHWQV 380          
BLAST of Elongation factor 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002238.1 (pep scaffold:Pmarinus_7.0:GL477208:59906:84789:-1 gene:ENSPMAG00000002026.1 transcript:ENSPMAT00000002238.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 213.001 bits (541), Expect = 4.219e-57
Identity = 164/616 (26.62%), Postives = 257/616 (41.72%), Query Frame = 3
Query: 1293 TSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKK-DDLYEKSIQRTIL----------------MMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPA--DLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQ-------------------------------------TSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYD---WDVSES---------------------RKIWCFGPDGNGPNMVVDVSKG----------------VQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDV----------------------TLHAD-------------------AIHRGG--------------------GQIIPTARR-CIYATVLTAGPC-LLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPL----------------DPTTKPGITVRDTRKRKGL 2615
             SD+  F AF RV+SG V  GQ++ ++GP Y      + L E  I   +L                +MGR +E++++VP GN+ G+ G++ +++K+ TIS+         + F   P++RVAVEPK+P+  ++P LV G+K L ++DP V++ I E+GE+++  AGE+HL+ CL DL +  A I I  SDP++ +RE++ +                                     ++  L L  +P +   + + A P+ E +   ++      R+ ++     L +  D   W + E+                      +IW FGP   GPN++++   G                     E   S+ + F  AS    +CEE M GV F +                          LH++                   A H  G                    GQ+I T +  C YA    A P  L+  +Y CEI      LG +Y  L+KR G +  E    GT  +++KA LPV ESF F  E+R +T G A PQ +F HW++   +PL                D  +K    +R  RKRKGL
Sbjct:  434 ASDREHFVAFARVYSGTVRKGQRLYVLGPKYDPATALEKLPEGPISEALLVGVPHLACLTVDSLYLLMGRELESLDEVPAGNLLGIGGLENHVLKSATISSCLACPPFIPLYFEAVPIIRVAVEPKHPSKGEMPLLVNGMKLLNQADPCVEVLIQETGEHVLVTAGEVHLQRCLDDLRQRFARIQINVSDPIIPFRETIIRRPKVDMVNEEIGQQRVSVIHQKQRQDQGARIPEDVHVSADGLVLMHTPRRQCVIAIRATPLPEGITQLLEKHGDLIRT-MEHFNMALKEGQDMTAWQIQEAIRDFKKQLEDNFRGLKWKNAVNQIWSFGPRRYGPNLLLNRISGYHRPSVWQCIEGKPEDFHSYGEYDSSLASGFQLASLAGPMCEEPMMGVCFEVERCEPGSVAGSDRERHGGTAEAPAKALHSEKKSERAGSPSSGHREPPTNASHEAGDKKTAELGKKEETDSYGSFTGQLISTMKEACRYA--FQAKPQRLMAAMYTCEIHATAEVLGRVYGVLSKREGRVLQEEMKEGTDIFIIKAVLPVAESFGFAEEIRKRTSGLASPQLIFSHWEVISSDPLWVPTTEEEYAHFGERADSESKARQYMRAVRKRKGL 1046          

HSP 2 Score: 153.295 bits (386), Expect = 4.365e-38
Identity = 112/348 (32.18%), Postives = 177/348 (50.86%), Query Frame = 3
Query:  432 FLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVI-------------------------IAQYGELDGPMGD------------IQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSDKLMKRLWGDNFFSEKSKKWCKRPDEGVRG--FNQFVLKPIYMVFQTVM---NKSLEDAAELAKKMGVK-LDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSP-------------AISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKG 1307
            +LINLIDSPGHVDFSSEV+ A+R+ DGA+VVVD V GVC QT+ VLRQA  E I P L +NK+D  +  L+  P + + + Q+++E VN +                         +A  G+ D P+ D            +  +P+ G V F   L  W   +++FA +Y+KK  +  + L+K LWGD + + K+KK  K      +   F Q VL  I+ +++ V+   N+  E + ++   +G+K L  + +   PK  L  I  +WLP  + +L M+   LPSP             A +Q++ +       L D+  IS K+ D +  +++++SKM+    K 
Sbjct:    4 YLINLIDSPGHVDFSSEVSTAVRLCDGAIVVVDAVEGVCPQTQMVLRQAWLENIHPCLVINKIDRLITELKLTPTEAHIQLQKILEQVNAVTGSLFISKVLEESAEKVSSGPVEATLANEGKAD-PLFDWSAGFEEADDSSLYFSPDQGNVVFACALDGWGLFIEHFARLYSKKMGVRKEVLLKTLWGDFYLNTKAKKIMKGAQAKGKKPLFVQLVLDNIWALYEAVVIRSNRDKEKSEKIVNSLGLKILARDMRHTDPKVYLSAICSQWLPLSEAVLSMVSCRLPSPLEMSAQRVEKLLCARAQRFESLPEQTQTLRDDF-ISCKSSD-DAPVIVFVSKMISVDAKA 348          
BLAST of Elongation factor 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008388.1 (pep scaffold:Pmarinus_7.0:GL490073:1463:6204:1 gene:ENSPMAG00000007588.1 transcript:ENSPMAT00000008388.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.472 bits (293), Expect = 2.823e-30
Identity = 77/216 (35.65%), Postives = 122/216 (56.48%), Query Frame = 3
Query:  273 RFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQ--YGEL-DGPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKF-QMSSDKLMKRLWGDNFFSEKS 908
            R+TDT   EQER ++IKST ++M              V P     D K   K FL N++D+PGHV+FS E TA+ R+ DG ++ +D   GV + TE +++ A+ ER+   + +NK+D  V  L+  P D Y K + +++ VN ++++  Y E  DG    + V+P  G V F S   S  FT+ +FA +Y+  +  +S  +  +RLWGD +F+ K+
Sbjct:    2 RYTDTLFTEQERGVSIKSTPVTM--------------VLP-----DSKG--KSFLFNIMDTPGHVNFSDEATASFRLCDGVVLFIDAAEGVMLNTERLIKHAVQERLAITVCINKIDRLVLELKLPPTDAYFKLRHIVDEVNSLLSRSLYSESEDG----LVVSPLLGNVCFASSEYSVCFTLGSFAKIYSDVYGDVSYQEFARRLWGDVYFNPKT 192          
BLAST of Elongation factor 2 vs. Ensembl Sea Lamprey
Match: gfm2 (G elongation factor, mitochondrial 2 [Source:NCBI gene;Acc:558184])

HSP 1 Score: 63.929 bits (154), Expect = 1.451e-10
Identity = 44/109 (40.37%), Postives = 56/109 (51.38%), Query Frame = 3
Query:  297 EQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMD 623
            E+ER ITI+S A+S +                            G  INL+D+PGHVDF+ EV   LRV DGA+ V D  +GV  QT TV RQA    +  + F+NKMD
Sbjct:   15 ERERGITIQSAAVSFH--------------------------WSGHRINLVDTPGHVDFTVEVERCLRVLDGAVAVFDASAGVEAQTMTVWRQADRYEVPRLCFLNKMD 97          
BLAST of Elongation factor 2 vs. Ensembl Yeast
Match: EFT2 (Elongation factor 2 (EF-2), also encoded by EFT1; catalyzes ribosomal translocation during protein synthesis; contains diphthamide, the unique posttranslationally modified histidine residue specifically ADP-ribosylated by diphtheria toxin; EFT2 has a paralog, EFT1, that arose from the whole genome duplication [Source:SGD;Acc:S000002793])

HSP 1 Score: 1067.76 bits (2760), Expect = 0.000e+0
Identity = 535/854 (62.65%), Postives = 648/854 (75.88%), Query Frame = 3
Query:  111 MVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELDGPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSDKLMKRLWGDNFFSEKSKKWCKRPDEGV-----RGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSEDIPPLDKFLDKL 2657
            MV FT+DQ+R+LM+K  N+RNMSVIAHVDHGKSTLTDSLV +AGII+ AKAG+ARFTDTRKDEQER ITIKSTAIS+Y+EM+++ +  +K           KTD   FLINLIDSPGHVDFSSEVTAALRVTDGALVVVD + GVCVQTETVLRQA+ ERIKPV+ +NK+D A+  LQ   EDLYQ F R +ESVNVI++ Y   D  +GD+QV P  GTV FGSGL  WAFT++ FA  YAKKF +   K+M RLWGD+FF+ K+KKW  +  +       R FN F+L PI+ +F  +MN   ++   L +K+ + L  +EK L+ K LLK +MRK+LPA D LL+MI +HLPSP  +Q YR + LYEGP DD   I++KNCDP   L++Y+SKMVPTSDKGRFYAFGRVF+G V +GQKVRI GPNYV GKKDDL+ K+IQR +LMMGR+VE I+D P GNI GLVG+DQ+L+KTGT++T   AHN++VMKFSVSPVV+VAVE KN  DLPKLVEGLKRL+KSDP V   + ESGE+I+AG GELHLEICL+DLE +HA +P+K S PVV+YRE+V   SS+  LSKSPNKHNR+Y+ A P+ EE++  I+ G I  R D K R R + D Y WDV+++RKIWCFGPDGNGPN+V+D +K VQYL+EIKDSVVAAF WA+K+  +  E MR VR NI DVTLHADAIHRGGGQIIPT RR  YA  L A P + EPV+  EIQ PE A+GGIYS LNK+RG + SE Q  GTP + VKAYLPVNESF FT ELR  TGGQAFPQ VFDHW     +PLDPT+K G  V   RKR G+ E++P   ++ DKL
Sbjct:    1 MVAFTVDQMRSLMDKVTNVRNMSVIAHVDHGKSTLTDSLVQRAGIISAAKAGEARFTDTRKDEQERGITIKSTAISLYSEMSDEDVKEIK----------QKTDGNSFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDTIEGVCVQTETVLRQALGERIKPVVVINKVDRALLELQVSKEDLYQTFARTVESVNVIVSTYA--DEVLGDVQVYPARGTVAFGSGLHGWAFTIRQFATRYAKKFGVDKAKMMDRLWGDSFFNPKTKKWTNKDTDAEGKPLERAFNMFILDPIFRLFTAIMNFKKDEIPVLLEKLEIVLKGDEKDLEGKALLKVVMRKFLPAADALLEMIVLHLPSPVTAQAYRAEQLYEGPADDANCIAIKNCDPKADLMLYVSKMVPTSDKGRFYAFGRVFAGTVKSGQKVRIQGPNYVPGKKDDLFIKAIQRVVLMMGRFVEPIDDCPAGNIIGLVGIDQFLLKTGTLTTSETAHNMKVMKFSVSPVVQVAVEVKNANDLPKLVEGLKRLSKSDPCVLTYMSESGEHIVAGTGELHLEICLQDLEHDHAGVPLKISPPVVAYRETVESESSQTALSKSPNKHNRIYLKAEPIDEEVSLAIENGIINPRDDFKARARIMADDYGWDVTDARKIWCFGPDGNGPNLVIDQTKAVQYLHEIKDSVVAAFQWATKEGPIFGEEMRSVRVNILDVTLHADAIHRGGGQIIPTMRRATYAGFLLADPKIQEPVFLVEIQCPEQAVGGIYSVLNKKRGQVVSEEQRPGTPLFTVKAYLPVNESFGFTGELRQATGGQAFPQMVFDHWSTLGSDPLDPTSKAGEIVLAARKRHGMKEEVPGWQEYYDKL 842          
BLAST of Elongation factor 2 vs. Ensembl Yeast
Match: EFT1 (Elongation factor 2 (EF-2), also encoded by EFT2; catalyzes ribosomal translocation during protein synthesis; contains diphthamide, the unique posttranslationally modified histidine residue specifically ADP-ribosylated by diphtheria toxin; EFT1 has a paralog, EFT2, that arose from the whole genome duplication [Source:SGD;Acc:S000005659])

HSP 1 Score: 1067.76 bits (2760), Expect = 0.000e+0
Identity = 535/854 (62.65%), Postives = 648/854 (75.88%), Query Frame = 3
Query:  111 MVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELDGPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSDKLMKRLWGDNFFSEKSKKWCKRPDEGV-----RGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSEDIPPLDKFLDKL 2657
            MV FT+DQ+R+LM+K  N+RNMSVIAHVDHGKSTLTDSLV +AGII+ AKAG+ARFTDTRKDEQER ITIKSTAIS+Y+EM+++ +  +K           KTD   FLINLIDSPGHVDFSSEVTAALRVTDGALVVVD + GVCVQTETVLRQA+ ERIKPV+ +NK+D A+  LQ   EDLYQ F R +ESVNVI++ Y   D  +GD+QV P  GTV FGSGL  WAFT++ FA  YAKKF +   K+M RLWGD+FF+ K+KKW  +  +       R FN F+L PI+ +F  +MN   ++   L +K+ + L  +EK L+ K LLK +MRK+LPA D LL+MI +HLPSP  +Q YR + LYEGP DD   I++KNCDP   L++Y+SKMVPTSDKGRFYAFGRVF+G V +GQKVRI GPNYV GKKDDL+ K+IQR +LMMGR+VE I+D P GNI GLVG+DQ+L+KTGT++T   AHN++VMKFSVSPVV+VAVE KN  DLPKLVEGLKRL+KSDP V   + ESGE+I+AG GELHLEICL+DLE +HA +P+K S PVV+YRE+V   SS+  LSKSPNKHNR+Y+ A P+ EE++  I+ G I  R D K R R + D Y WDV+++RKIWCFGPDGNGPN+V+D +K VQYL+EIKDSVVAAF WA+K+  +  E MR VR NI DVTLHADAIHRGGGQIIPT RR  YA  L A P + EPV+  EIQ PE A+GGIYS LNK+RG + SE Q  GTP + VKAYLPVNESF FT ELR  TGGQAFPQ VFDHW     +PLDPT+K G  V   RKR G+ E++P   ++ DKL
Sbjct:    1 MVAFTVDQMRSLMDKVTNVRNMSVIAHVDHGKSTLTDSLVQRAGIISAAKAGEARFTDTRKDEQERGITIKSTAISLYSEMSDEDVKEIK----------QKTDGNSFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDTIEGVCVQTETVLRQALGERIKPVVVINKVDRALLELQVSKEDLYQTFARTVESVNVIVSTYA--DEVLGDVQVYPARGTVAFGSGLHGWAFTIRQFATRYAKKFGVDKAKMMDRLWGDSFFNPKTKKWTNKDTDAEGKPLERAFNMFILDPIFRLFTAIMNFKKDEIPVLLEKLEIVLKGDEKDLEGKALLKVVMRKFLPAADALLEMIVLHLPSPVTAQAYRAEQLYEGPADDANCIAIKNCDPKADLMLYVSKMVPTSDKGRFYAFGRVFAGTVKSGQKVRIQGPNYVPGKKDDLFIKAIQRVVLMMGRFVEPIDDCPAGNIIGLVGIDQFLLKTGTLTTSETAHNMKVMKFSVSPVVQVAVEVKNANDLPKLVEGLKRLSKSDPCVLTYMSESGEHIVAGTGELHLEICLQDLEHDHAGVPLKISPPVVAYRETVESESSQTALSKSPNKHNRIYLKAEPIDEEVSLAIENGIINPRDDFKARARIMADDYGWDVTDARKIWCFGPDGNGPNLVIDQTKAVQYLHEIKDSVVAAFQWATKEGPIFGEEMRSVRVNILDVTLHADAIHRGGGQIIPTMRRATYAGFLLADPKIQEPVFLVEIQCPEQAVGGIYSVLNKKRGQVVSEEQRPGTPLFTVKAYLPVNESFGFTGELRQATGGQAFPQMVFDHWSTLGSDPLDPTSKAGEIVLAARKRHGMKEEVPGWQEYYDKL 842          
BLAST of Elongation factor 2 vs. Ensembl Yeast
Match: SNU114 (GTPase component of U5 snRNP involved in mRNA splicing via spliceosome; binds directly to U5 snRNA; proposed to be involved in conformational changes of the spliceosome; similarity to ribosomal translocation factor EF-2 [Source:SGD;Acc:S000001656])

HSP 1 Score: 270.396 bits (690), Expect = 8.938e-77
Identity = 245/922 (26.57%), Postives = 417/922 (45.23%), Query Frame = 3
Query:  129 DQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDA-------RFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELDGPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSS--DKLMKRLWGDNFFSEKSKKWCKRPDEGVR---GFNQFVLKPIYMVFQTVMNKSLEDAAELAK-KMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYV-SGKKDDLYEKS-------------------IQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFS------VSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTS-SELCLSKSPNKHNR-------LYMTAAPMGEELASDID---AGKITARSDV-------KERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDV---SKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADA-IHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGI-IFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDH--WQLYPGNPLD-----PTTKPGIT-------VRDTRKRKG------LSEDIPPLDKFL 2648
            D + ++      I N+ VI  +  GK++L D LV  +       + +        R+ D  K E +R ++IK    ++                   L  D   + K  +IN +D+PGHV+F  E   AL  +D  L+V+D V GV    E +++Q+I   +     +NK+D  +  L+  P D Y K   +I ++N             G++  +P +  + F S    + FT+K F   Y      SS  D    RLWG  ++ + +  +  +P E V     F +F+L P+Y +F   ++   +    L +    V L  E     P+  LK +++        L+          AI++ Y+   L++      ++I  K+  P G L  ++ K V     G  ++  R++SG +  G  VRI+  +   S +K  L++ S                   ++   L+ GRYV  + +   G I  + G+    +K+ T+ +     +++ +KF          V ++ ++P  P +LPKL++ L +++K  P V I ++ESGE++I G GEL+++  L DL   +A I IK SDP+  + ES +  S + + +S S ++          + + A PM  ++  D+     GK     D+       ++  + L   Y WD   SR +W F    NG  ++ D        + L++ K+ ++  F WA K+  L EE + GV++ +  +++ +D  I     QIIP  ++  Y  +LTA P LLEP+Y+ +I      L  +   + KRRG  I+  ++VAGTP   V+  +PV ES  F ++LR  T G    Q  F H  W+  PG+ LD     P  KP          V  TR+RKG      +S D P L+K++
Sbjct:  121 DYMLSMANIPERIINVGVIGPLHSGKTSLMDLLVIDSHKRIPDMSKNVELGWKPLRYLDNLKQEIDRGLSIKLNGSTL-------------------LCTD--LESKSRMINFLDAPGHVNFMDETAVALAASDLVLIVIDVVEGVTFVVEQLIKQSIKNNVAMCFVINKLDRLILDLKLPPMDAYLKLNHIIANINSFTK---------GNV-FSPIDNNIIFASTKLGFTFTIKEFVSYYYAHSIPSSKIDDFTTRLWGSVYYHKGN--FRTKPFENVEKYPTFVEFILIPLYKIFSYALSMEKDKLKNLLRSNFRVNLSQEALQYDPQPFLKHVLQLIFRQQTGLVD---------AITRCYQPFELFDNK-TAHLSIPGKST-PEGTLWAHVLKTVDYG--GAEWSLVRIYSGLLKRGDTVRILDTSQSESRQKRQLHDISKTETSNEDEDEDDETPSCEVEEIGLLGGRYVYPVHEAHKGQIVLIKGISSAYIKSATLYSVKSKEDMKQLKFFKPLDYITEAVFKIVLQPLLPRELPKLLDALNKISKYYPGVIIKVEESGEHVILGNGELYMDCLLYDLRASYAKIEIKISDPLTVFSESCSNESFASIPVSNSISRLGEENLPGLSISVAAEPMDSKMIQDLSRNTLGKGQNCLDIDGIMDNPRKLSKILRTEYGWDSLASRNVWSF---YNGNVLINDTLPDEISPELLSKYKEQIIQGFYWAVKEGPLAEEPIYGVQYKLLSISVPSDVNIDVMKSQIIPLMKKACYVGLLTAIPILLEPIYEVDITVHAPLLPIVEELMKKRRGSRIYKTIKVAGTPLLEVRGQVPVIESAGFETDLRLSTNGLGMCQLYFWHKIWRKVPGDVLDKDAFIPKLKPAPINSLSRDFVMKTRRRKGISTGGFMSNDGPTLEKYI 993          
BLAST of Elongation factor 2 vs. Ensembl Yeast
Match: RIA1 (Cytoplasmic GTPase/eEF2-like factor involved in ribosomal biogenesis; with Sdo1p, a guanine nucleotide exchange factor (GEF), promotes release of Tif6p from 60S ribosomal subunits in the cytoplasm so that they can assemble with 40S subunits to generate mature ribosomes; required for quality control check of newly made large ribosomal subunits before they are released into the pool of translating ribosomes [Source:SGD;Acc:S000005107])

HSP 1 Score: 221.476 bits (563), Expect = 6.031e-60
Identity = 151/410 (36.83%), Postives = 226/410 (55.12%), Query Frame = 3
Query:  165 IRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELDGPMGD----------------------IQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSDKLMKRLWGDNFFSEKSKKWCKRPDEGVRG------FNQFVLKPIYMVFQTVM-NKSLEDAAELAKKMGVKLDSEE-KALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYR--TDLLYE---GPLDDEIAISMKNCDPNGHLVMYISKMV 1289
            IRN+ ++AHVDHGK++L+DSL++  GII+   AG  RF D R DEQ R IT++S+AIS+Y           +V++    SD+    E   L+NLIDSPGH+DFSSEV+AA R+ DGA+V+VD V GVC QT TVLRQ   E++KP+L +NK+D  +  LQ  P++ Y    +VIE VN +I  +   +  + D                      I   P +  V F S +  W F +   A  Y +K     + L K LWGD +   K+KK     ++G++G      F   +L+ I+ ++Q ++ ++  E   ++AK + +KL + + ++   KQLL+ IM +WLP    +L  +   LPSP  SQ  R  T L+ E     +D  +  +MK CD  G +  Y+SKM+
Sbjct:   19 IRNICIVAHVDHGKTSLSDSLLASNGIISQRLAGKIRFLDARPDEQLRGITMESSAISLY----------FRVLRKQEGSDEPLVSEH--LVNLIDSPGHIDFSSEVSAASRLCDGAVVLVDVVEGVCSQTVTVLRQCWTEKLKPILVLNKIDRLITELQLTPQEAYIHLSKVIEQVNSVIGSFFANERQLDDLFWREQLEKNENAEYIEKDDSGIYFNPTDNNVIFASAIDGWGFNIGQLAKFYEQKLGAKRENLQKVLWGDFYMDPKTKKIIN--NKGLKGRSLKPLFTSLILENIWKIYQNIITSRDSEMVEKIAKTLNIKLLARDLRSKDDKQLLRTIMGQWLPVSTAVLLTVIEKLPSPLESQTDRLNTILVSESDTAAMDPRLLKAMKTCDKEGPVSAYVSKML 414          

HSP 2 Score: 189.504 bits (480), Expect = 1.224e-49
Identity = 141/481 (29.31%), Postives = 224/481 (46.57%), Query Frame = 3
Query: 1311 FYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSI-QRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGT-ISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTS-------SEL---------------------------CLSKSPNKHNRLYMTAA----PMGEELASDIDAGK--ITARSDV---KERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVV-------DVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDV-TLHADAIHR------------GGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPL 2558
              AF R++SG +  GQ++ ++GP Y     ++  E +I     L MG+ +  ++  P GNI G+ G+   ++K+GT I       NL  + F  +P+VRVAVEP NP ++ KLV GLK L ++DP V   ++ +GE+I+  AGELHLE CLKDL E  A I I  S+P + YRE+    S       S+L                            LS+  N    +  T+     P+ E   S     K  + A  +V   +E+ R L+  +        K+  FGP   G N+++        + +G     E  DS+   F  A  +  L  E ++G+   +  V  +  D I                G++I + R  I+   L   P ++  +Y C+IQ     LG +Y+ + +R G I SE    GTP + ++A++PV E+F  + ++R +T G A PQ VF  ++    +P 
Sbjct:  582 LVAFARIYSGTLRVGQEISVLGPKYDPKCPEEHIETAIITHLYLFMGKELVPLDVCPSGNIVGIRGLAGKVLKSGTLIEKGVQGVNLAGVNFHFTPIVRVAVEPANPVEMSKLVRGLKLLDQADPCVHTYVENTGEHILCTAGELHLERCLKDLTERFAGIEITHSEPAIPYRETFLSASDMNPPQNSQLGRGVHELLLSQYKITFRTFPLSGKVTDFLSQHQNSIKNILKTSTSSMDPVIESTGSSFLDKKSLLVAFEEVINQEEKSRELLSGF------KVKLAGFGPSRVGCNILLSQDNLLGSLFEGTPAAFEYSDSIKNGFQLAVSEGPLANEPVQGMCVLVESVHKMSQDEIESIEDPRYQQHIVDLSGRLITSTRDAIHEAFLDWSPRIMWAIYSCDIQTSVDVLGKVYAVILQRHGKIISEEMKEGTPFFQIEAHVPVVEAFGLSEDIRKRTSGAAQPQLVFSGFECIDLDPF 1056          
BLAST of Elongation factor 2 vs. Ensembl Yeast
Match: MEF1 (Mitochondrial elongation factor involved in translational elongation [Source:SGD;Acc:S000004059])

HSP 1 Score: 85.1149 bits (209), Expect = 2.424e-17
Identity = 101/417 (24.22%), Postives = 162/417 (38.85%), Query Frame = 3
Query: 1320 FGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISID-ESGENIIAGAGELHLEICLKDLEEEHA--CIPIKKSDPVVSYRESVTQTS----SELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAA----FNWASKDSILCEENMRGVRFNIHDVTLHA-DAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHW 2534
            + RV+ G++  G  +     N  +GKK       + R + M    +E +++V  G IC   G+D     +G   T           +    VV +++ P N  D     + L R  K DP  ++  D ES E II+G GELHLEI ++ +  E+   C+  K   P VSYRES+T  +    +    S    ++ R+  T +P+      DI  G I   + V  R                                           I D  +AA    F    +   L    +  V+  I+D  +HA D+          +A R  +   L A P ++EP+    +  P    G +   LNK + +I  +    G  ++ +KA   ++  F F + LRA T G+      F H+
Sbjct:  392 YVRVYQGRLRKGNYI----TNVKTGKK-----VKVARLVRMHSSEMEDVDEVGSGEICATFGID---CASGDTFTDGSVQYSMSSMYVPDAVVSLSITP-NSKDASNFSKALNRFQKEDPTFRVKFDPESKETIISGMGELHLEIYVERMRREYNVDCVTGK---PQVSYRESITIPADFDYTHKKQSGGAGQYGRVIGTLSPV-----DDITKGNIFETAIVGGR-------------------------------------------IPDKYLAACGKGFEEVCEKGPLIGHRVLDVKMLINDGAIHAVDSNELSFKTATMSAFRDAF---LRAQPVIMEPIMNVSVTSPNEFQGNVIGLLNKLQAVI--QDTENGHDEFTLKAECALSTMFGFATSLRASTQGKGEFSLEFSHY 739          

HSP 2 Score: 68.9366 bits (167), Expect = 2.253e-12
Identity = 57/158 (36.08%), Postives = 79/158 (50.00%), Query Frame = 3
Query:  165 IRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFT-----DTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMD 623
            +RN+ + AH+D GK+T T+ ++     I        R       D+   E+E+ ITI+S A                     +   +GK     +  NLID+PGH+DF+ EV  ALRV DGA++VV  VSGV  QT TV RQ     +  V F+NKMD
Sbjct:   70 LRNIGISAHIDSGKTTFTERVLYYTKRIKAIHEVRGRDNVGAKMDSMDLEREKGITIQSAATY------------------CSWDKEGKN----YHFNLIDTPGHIDFTIEVERALRVLDGAVLVVCAVSGVQSQTVTVDRQMRRYNVPRVTFINKMD 205          
BLAST of Elongation factor 2 vs. Ensembl Nematostella
Match: EDO45605 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSB9])

HSP 1 Score: 1191.79 bits (3082), Expect = 0.000e+0
Identity = 600/839 (71.51%), Postives = 691/839 (82.36%), Query Frame = 3
Query:  147 MEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELDGPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSDKLMKRLWGDNFFSEKSKKWCKRPDEG-VRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAG-KITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSEDIPPLDKFLDKL 2657
            M+KK NIRNMSVIAHVDHGKSTLTDSLVSKAGIIA AKAG+ RFTDTRKDEQ+RCITIKSTAIS+Y E+ E     +   QP     D K  E+GFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLFMNKMD A+  LQ + EDLYQ F R++ES+NVIIA Y + DGPMG+IQV PE GTV FGSGL  WAFT+K  +++Y+ KF++   KLMKRLWGD F + + KKW K    G VRGFNQFVL PI+ +F  +MN   E  A L +K+ +KL  EE+ L+ K L K +MRKWLPAG+ +LQMI IHLPSP +SQKYR +LLYEGP DD +A+ +K CDP   L +YISKMVPTSDKGRFYAFGRVFSGKV +GQKVRIMGP+YV GKK+DLY K+IQRTILMMGRY+E I DVPCGNI GLVGVDQ+LVKTGTIST+   HN+++MKFSVSPVVRVAVEPKNPADLPKLVEGL RLAKSDPMVQ   +ESGE+I+AGAGELHLEICLKDLEE+HACIP+KKS+PVVSYRE V+  S+++CLSKSPNKHNRL+MTA P+ E+L  DID G +I  R D K R R+L DTY WDV+E+RKIW FGP+G GPN++VDVSKGVQYLNEIKDSVVA F WA+K+  LC+EN+RGVRFNIHDVTLHADAIHRGGGQIIPTARR +YA +LTA PCLLEPVY  EIQ PE+A+GGIY  LN+RRG +  E  VAGTP ++VKAYLPV ESF FT++LR++TGGQAFPQCVFDHWQ+ PG+  D  + PG  V +TRKRKGL E IP LD +LDKL
Sbjct:    1 MDKKLNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAAAKAGETRFTDTRKDEQDRCITIKSTAISLYYELPESDFEYI--TQP----KDPK--ERGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLFMNKMDRALLELQLDQEDLYQTFARIVESINVIIATYSDEDGPMGNIQVGPEKGTVAFGSGLHGWAFTLKQISEIYSAKFKIPPAKLMKRLWGDQFINAEDKKWKKEQATGNVRGFNQFVLDPIFKMFDAIMNFKKEATANLLEKLKIKLTVEERELEGKPLFKTVMRKWLPAGEAMLQMIAIHLPSPVVSQKYRCELLYEGPQDDAVALGIKACDPEAPLCLYISKMVPTSDKGRFYAFGRVFSGKVASGQKVRIMGPHYVPGKKEDLYLKTIQRTILMMGRYIEPIVDVPCGNIVGLVGVDQFLVKTGTISTYEHCHNMKMMKFSVSPVVRVAVEPKNPADLPKLVEGLNRLAKSDPMVQSFTEESGEHIVAGAGELHLEICLKDLEEDHACIPLKKSEPVVSYRECVSDKSNQMCLSKSPNKHNRLFMTAGPLEEKLPEDIDDGCEINPRQDFKIRARYLADTYGWDVNEARKIWSFGPEGTGPNLLVDVSKGVQYLNEIKDSVVAGFQWATKEGPLCDENVRGVRFNIHDVTLHADAIHRGGGQIIPTARRVLYACMLTAKPCLLEPVYSVEIQCPESAVGGIYGVLNRRRGQVLEESNVAGTPMFIVKAYLPVMESFGFTADLRSKTGGQAFPQCVFDHWQVLPGDVHDLASMPGQVVANTRKRKGLKEGIPALDNYLDKL 831          
BLAST of Elongation factor 2 vs. Ensembl Nematostella
Match: EDO37021 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGZ8])

HSP 1 Score: 580.867 bits (1496), Expect = 0.000e+0
Identity = 315/876 (35.96%), Postives = 498/876 (56.85%), Query Frame = 3
Query:  102 ELKMVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXX-XDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELDGPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKF--QMSSDKLMKRLWGDNFFSEKSKKWCKRP--DEGVRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAG---AHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVD------VSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTT-------KPGITVR-----DTRKRKGLSEDIPPLDKFLD 2651
            EL + N+ I+ +  LM+    IRN+++  H+  GK+   D L  +      AK   + R+TD    EQER ++IKST +S+                   L D   T  K +L+N+ D+PGHV+FS EVTAA R+ D  ++ +D   GV + TE +L+ A+ E +   + +NK+D  +  L+  P D Y K + VI+ VN +++ + E      D+ ++P  G V F S    + FT+ +FA +Y   F   +      +RLWGD +FS K++K+ ++       R F +F+L+P+Y +F  V+        +   ++G+ L  +E  +  + LL  + +++       + +   H+PSP        +  Y GPLD +I  +M NCDP+G L+++ +K  P+ D   F+ FGRV SG +  GQ+VRI+G NY    ++D     + R  +   RY   +  VP GN   + GVDQ +VKT TI+   G   A+  R +KF+    +++AVEP NP++LPK+++GL+++ KS P++   ++ESGE++I G GEL+L+  + DL   ++ I IK +DPV+++ E+V +TSS  C +++PNK N++ M A P+ + LA DI+  K+    + K+ G F    YDWD+  +R IW FGP+  GPN++VD      V K +  LN +KDS++  F WA+++  LC+E +R V+F I D  +  + IHRGGGQIIPTARR  Y+  L A P L+EP +  E+Q P   +  +Y+ L +RRG +  +  V G+P Y +KA++P  +SF F ++LR  T GQAF   VF HWQ+ PG+PLD +        +P   +       TR+RKGLSED+  ++KF D
Sbjct:  109 ELPLTNYNIEYLADLMDNPELIRNVALAGHLHSGKTAFLDCLFEQTHPELEAKEGKELRYTDLLFTEQERGLSIKSTPVSL------------------VLPD---TKGKSYLLNIFDTPGHVNFSDEVTAAYRLCDAVMIFIDASEGVMLNTERLLKHAVQENLAITICINKIDRLILELKLPPTDAYYKLKHVIDEVNGLLSVFSE---GADDLVISPLLGNVCFASSSYHFCFTLLSFAKLYVDSFGGNIDPQDFAQRLWGDMYFSSKTRKFTRKAPLSTSQRSFVEFILEPMYKIFGQVVGDVDTTLPQALDELGIHLTKKEMQMNIRPLLSLVCKRFFGDFAGFVDVCVQHIPSPKDVAARMVEHNYTGPLDSDIVDAMNNCDPDGVLMVHTTKQYPSQDATAFHVFGRVMSGTLYAGQQVRILGENYTMEDEEDSRVGIVGRLWIAEARYNIEVNRVPAGNWVLIEGVDQPIVKTATITEVQGSEEAYIFRPLKFNTCSTIKIAVEPHNPSELPKMLDGLRKVNKSYPLLTTKVEESGEHVILGTGELYLDCIMHDLRRMYSEIDIKVADPVIAFCETVVETSSLKCFAETPNKKNKVTMIAEPLEKGLAEDIENEKVLISWNKKKLGEFFQTKYDWDLLAARSIWAFGPENTGPNILVDDTLPSEVDKSL--LNTVKDSIIQGFQWATREGPLCDEPIRNVKFKILDAVIAGEPIHRGGGQIIPTARRVAYSAFLMATPRLMEPYFFVEVQAPADCVSSVYTVLARRRGHVTQDAPVPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFCLSVFHHWQIVPGDPLDKSIVIRPLEPQPATHLAREFMIKTRRRKGLSEDV-SINKFFD 957          
BLAST of Elongation factor 2 vs. Ensembl Nematostella
Match: EDO25965 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TD88])

HSP 1 Score: 284.263 bits (726), Expect = 5.811e-89
Identity = 161/269 (59.85%), Postives = 197/269 (73.23%), Query Frame = 3
Query:  111 MVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELDGPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSDKLMKRLWGDNFFSEKSKKW 917
            MVNFTI++IR +M+ + NIRNMSVIAHVDHGKSTL+D+LV KAGII+   AGDAR+TDTR+DE+ER ITIKST +SMY +   D                   ++K +LINLIDSPGHVDFSSEVTAALRVTDGALVVVD V GV VQTETVLRQA+ E+IKPVL +NK+D ++  L+ + E +Y  F RVI+  NV+I  Y   D  MG+IQV P  G V FGSG   WAFT+  FA +Y+KKF +S DK+M++LWGDN+F  K KKW
Sbjct:    1 MVNFTIEEIRRIMDNQDNIRNMSVIAHVDHGKSTLSDALVCKAGIISTKVAGDARYTDTREDEKERGITIKSTGVSMYYKYDTDYSG-------------NPANQKEYLINLIDSPGHVDFSSEVTAALRVTDGALVVVDTVEGVSVQTETVLRQAMQEKIKPVLMVNKIDRSILELKLDGEAMYNSFLRVIDMANVVITTYQAED--MGEIQVDPSIGNVAFGSGKDQWAFTLTKFARIYSKKFGISFDKMMQKLWGDNYFDAKGKKW 254          
BLAST of Elongation factor 2 vs. Ensembl Nematostella
Match: EDO42153 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2I1])

HSP 1 Score: 207.608 bits (527), Expect = 5.291e-55
Identity = 152/448 (33.93%), Postives = 225/448 (50.22%), Query Frame = 3
Query:  123 TIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQY------------GELDGPMGD--------------------IQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSDKLMKRLWGDNFFSEKSKKWCKRPDEGVRG--FNQFVLKPIYMVFQTVM-----NKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPL--------------DDEIAISMKNCDPNGHLVMYISKMVPTSDKG 1307
            T++ +  L +K +NIRN+ ++AHVDHGK+TL D+LV+  GII+   AG  R+ D+ ++EQ R IT+KS+AIS++                       K DE  +LINLIDSPGHVDFSSEV+ A+R+ DGALVVVD V GV  QT  VLRQA  E I+P L +NK+D  +  L+  P + +   Q+++E VN I                 E    M D                    +  +P+ G V F S +  W F++K+FA++Y+KK  + ++ L K LWGD +   K+K+  K+     +   F QF+L  I+ ++  V+      KS + +  L  K+ V+   + ++  P+  L  I  +WLP    LL M+   LPSP      R D L    L              +D IA S     P   +++++SKM    D  
Sbjct:    5 TVEHLSELQKKPQNIRNICILAHVDHGKTTLADALVASNGIISSRLAGKLRYMDSLEEEQVRGITMKSSAISLH----------------------FKQDEDEYLINLIDSPGHVDFSSEVSTAVRLCDGALVVVDVVEGVSPQTHVVLRQAWLENIRPCLVLNKIDRLITELKYSPSEAFIHLQQILEQVNAITGTLFSSHVMEKSCVSSETRQVMEDPDAVSIDDWSSGLEATDDSNLYFSPDLGNVVFSSAIDGWGFSIKDFANLYSKKLGLKAEILQKTLWGDFYLDSKTKRIFKKAQLKNKKPLFVQFILDNIWALYDAVVIRRDKIKSEQISNSLKLKISVR---DSRSSDPRVYLYAICSQWLPLSSALLSMVVDKLPSPLEIPGERVDKLMCSGLRTFESLPPETRRLKEDFIACSSTKSAP---IIVFVSKMFAVDDNA 424          

HSP 2 Score: 154.066 bits (388), Expect = 4.241e-38
Identity = 110/415 (26.51%), Postives = 186/415 (44.82%), Query Frame = 3
Query: 1299 DKGRFYAFGRVFSGKVGTGQKVRIMGPNY---------------------VSGKKD-----DLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESV-------------TQTSSE--LCLSKSPNKHNRLYMTAAPMGEELASDIDA-----------------------GKITARSDVKERGRFLVDTYDWDVSESRK------------IWCFGPDGNGPNMVVDVSKGV------QYLNE----------IKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRC 2267
            +K  F AF RV+SG +  GQ++ I+GP +                     VS   D      +   ++    L+MGR +EA++ VP GN+ G+ G+  Y++K+ TIS+         +  +  P+VRVAVEP + AD+P L  G++ L ++DP V+  +  +GE++I  AGE+HL+ C+ DL+  +AC+ +  SDP++ +RE+V             T  + E  L + ++ NK   +++ A P+ + + + +D                        G     S +K   R  +  +   + E+ +            IW FGP G GPN++++           Q L+E             S+V+ F   +    LC E + GV F+I  + L+    H     I   A RC
Sbjct:  499 NKTHFMAFARVYSGTISRGQQLYILGPKHDPRDMDEDEVLPSNTDSEGLQVSSSVDLGTTRHVAVFTVSDLYLLMGRELEAVDSVPAGNVLGIGGLQHYVLKSATISSTRSCPPFTALTLAAVPIVRVAVEPVHAADMPALSRGMRLLNQADPCVETLVQSTGEHVIIAAGEVHLQRCVDDLKRRYACVELNVSDPIIPFRETVIPPPRVDMVNEAITDPTKEKHLVVIQTANKQCTIHIRATPLPQRVITLLDESADLIKLLTTSNADRNQSNANIIGSEKRTSGLKPSVRKQLSAFYSALQEAFREAGKQWANAADHIWAFGPRGTGPNILLNRDPDYPRPSIWQCLDENGYKAGEYKPYDSSIVSGFQMTTLSGPLCAEPLMGVCFSIEHLVLNTG--HAKLPNISSPAGRC 911          

HSP 3 Score: 73.9442 bits (180), Expect = 2.458e-13
Identity = 39/121 (32.23%), Postives = 59/121 (48.76%), Query Frame = 3
Query: 2301 LLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQ----------------LYPGNPLDPTTKPGITVRDTRKRKGL 2615
            L+  +Y C IQ     LG +Y+ + +R G + SE    G+  + V+A LPV ESF F+ E+R +T G A PQ +F HW+                ++ G   D   +    +   R+RKGL
Sbjct: 1006 LMAAMYTCHIQATAEVLGRMYAVIARREGRVLSEEMKEGSDVFDVEAVLPVAESFGFSEEIRKRTSGLANPQLMFSHWEAIDLDPYWVPSTEEEYMHFGEKADSENRARKYMNSIRRRKGL 1126          
BLAST of Elongation factor 2 vs. Ensembl Nematostella
Match: EDO28823 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5E0])

HSP 1 Score: 171.785 bits (434), Expect = 9.122e-49
Identity = 115/209 (55.02%), Postives = 140/209 (66.99%), Query Frame = 3
Query:  135 IRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXX---XXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELDGPMGDIQV 752
            IR +M+KK NIRNMSVIAHVDHGKSTLTDSLVSKAGIIA AKAG+ RFTDTRKDEQ+RCITIKS  ++++           KV+      ++ +T      +   +       S    +  R +  A+ +         VCVQTETVLRQAIAERIKPVLFMNKMD A+  LQ + EDLYQ F R++ES+NVIIA Y + DGPMG+IQV
Sbjct:    1 IRGIMDKKLNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAAAKAGETRFTDTRKDEQDRCITIKS-TLAVFTGFRLVCQFLRKVLDIRDNRENARTSGSLSSLVSSNEALCECKSKLEVSKFRFSTLAMELPCSYISLPGVCVQTETVLRQAIAERIKPVLFMNKMDRALLELQLDQEDLYQTFARIVESINVIIATYSDEDGPMGNIQV 208          
BLAST of Elongation factor 2 vs. Ensembl Medaka
Match: ENSORLT00000005814.2 (elongation factor 2 [Source:NCBI gene;Acc:101171982])

HSP 1 Score: 1224.92 bits (3168), Expect = 0.000e+0
Identity = 614/868 (70.74%), Postives = 713/868 (82.14%), Query Frame = 3
Query:  111 MVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGE-LDGPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKF------QMSS-------DKLMKRLWGDNFFSEKSKKWCKRP-----DEGVRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSEDIPPLDKFLDKL 2657
            MVNFT+DQIR +M+KK NIRNMSVIAHVDHGKSTLTDSLVSKAGIIA A+AG+ RFTDTRKDEQERCITIKSTAIS+Y E++E+ +A +K       S DG+    GFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAI ERIKPVL MNKMD A+  LQ EPEDLYQ FQR++ESVNVII+ YGE  +GPMG+I V P  GT+GFGSGL  WAFT+K FA+MYA KF      QM++       + +MK+LWGD ++  ++ K+ K        +  R F   VL PI+ VF  +MN   ++AA+L +KM VKLD+E+K  + K LLK +MR+WLPAG+ LLQMI IHLPSP  +QKYR +LLYEGP DDE A+ +KNCDP   L+MYISKMVPTSDKGRFYAFGRVFSG V TG KVRIMGPN+V GKK+DLY K IQRTILMMGRYVE IEDVPCGNI GLVGVDQYLVKTGTI+TF  AHN++VMKFSVSPVVRVAVE +NPADLPKLVEGLKRLAKSDPMVQ  I+ESGE+I+AGAGELHLEICLKDLEE+HACIPIKKSDPVVSYRE+V+  SS +CLSKSPNKHNRL+M A P  + LA DID G++T+R ++K R R+L D Y+WDV E+RKIWCFGPDG GPNM+VDV+KGVQYLNEIKDSVVA F WA+K+ +LCEENMRG+R++IHDVTLH DAIHRGGGQIIPTARR +YA  LTA P ++EPVY  EIQ PETA+GGIY  L +RRG +F E +V GTP YV+KAYLPV ESF FT++LR+ TGGQAFPQC+FDHWQ+ PGNP++PT+KPG+ V DTRKRKGL E +P LD +LDKL
Sbjct:    1 MVNFTVDQIRGIMDKKANIRNMSVIAHVDHGKSTLTDSLVSKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLYYELSENDMAFIK------QSKDGR----GFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAICERIKPVLMMNKMDRALLELQLEPEDLYQTFQRIVESVNVIISTYGEDENGPMGNIMVDPVIGTIGFGSGLHGWAFTLKQFAEMYAAKFAAKGNSQMTAAERCKKVEDMMKKLWGDRYYDSENGKFVKSAIGADGKKYPRTFCALVLDPIFKVFDAIMNFRKDEAAKLIQKMDVKLDNEDKDKEGKPLLKAVMRRWLPAGEALLQMITIHLPSPVTAQKYRCELLYEGPGDDEAAMGIKNCDPKAPLMMYISKMVPTSDKGRFYAFGRVFSGSVSTGLKVRIMGPNFVPGKKEDLYLKPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQYLVKTGTITTFEQAHNMKVMKFSVSPVVRVAVEARNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHIVAGAGELHLEICLKDLEEDHACIPIKKSDPVVSYRETVSAESSVMCLSKSPNKHNRLFMKARPFEDGLAEDIDKGEVTSRQELKARARYLADKYEWDVGEARKIWCFGPDGTGPNMLVDVTKGVQYLNEIKDSVVAGFQWAAKEGVLCEENMRGIRYDIHDVTLHTDAIHRGGGQIIPTARRVLYACQLTADPRMMEPVYLVEIQCPETAMGGIYGVLTRRRGHVFEESRVMGTPMYVIKAYLPVMESFGFTADLRSNTGGQAFPQCMFDHWQILPGNPMEPTSKPGVVVTDTRKRKGLKEGVPALDNYLDKL 858          
BLAST of Elongation factor 2 vs. Ensembl Medaka
Match: EEF2 (eukaryotic translation elongation factor 2 [Source:NCBI gene;Acc:101162630])

HSP 1 Score: 1202.96 bits (3111), Expect = 0.000e+0
Identity = 610/868 (70.28%), Postives = 703/868 (80.99%), Query Frame = 3
Query:  111 MVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELD-GPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSS-------------DKLMKRLWGDNFFSEKSKKWCKR---PD--EGVRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSEDIPPLDKFLDKL 2657
            MVNFT+DQIRA+M+KK NIRNMSVIAHVDHGKSTLTDSLVSKAGIIA A+AG+ RFTDTRKDEQERCITIKSTAISMY E+ ++ LA +K       S DG     GFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVL MNKMD A+  LQ EP++LYQ FQR++E+VNVII+ YGE + GPMG I + P  GTVGFGSGL  WAFT+K FA+MY  KF                 + +MK+LWGD +F   + K+ K    PD  +  R F+Q VL PI+ VF  +MN   E+ A+L  K+ VKLDSE+K  + K LLK +MR+WLPAG+ LLQMI IHLPSP  +QKYR +LLYEGP DDE A+ +KNCDP   L+MYISKMVPT+DKGRFYAFGRVFSG V TGQKVRIMGPN+  GKK+DLY K IQRTILMMGRYVE IEDVPCGNI GLVGVDQ+LVKTGTI+TF  AHN+RVMKFSVSPVVRVAVE KNPADLPKLVEGLKRLAKSDPMVQ  I+ESGE+IIAGAGELHLEICLKDLEE+HACIP+KKSDPVVSYRE+V++ S ++CLSKSPNKHNRL+M A P  + LA DI+ G ++AR ++K R R+L D Y+W+V+E+RKIWCFGPDG+GPN+++DV+KGVQYLNEIKDSVVA F WASK+  LCEENMR VRF+IHDVTLHADAIHRGGGQIIPTARR +YA  LTA P L+EP+Y  EIQ PE  +GGIY  LN++RG +F E QV GTP +VVKAYLPVNESF FT++LR+ TGGQAFPQCVFDHWQ+  G+P DP T+P   V + RKRKGL E IP LD +LDKL
Sbjct:    1 MVNFTVDQIRAIMDKKSNIRNMSVIAHVDHGKSTLTDSLVSKAGIIASARAGETRFTDTRKDEQERCITIKSTAISMYYELGDNDLAFIK------QSKDGN----GFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLMMNKMDRALLELQLEPDELYQTFQRIVENVNVIISTYGEDESGPMGSIMIDPVIGTVGFGSGLHGWAFTLKQFAEMYVAKFTAKGVAQLGPAERCKKVEDMMKKLWGDRYFDPSAGKFSKTATGPDGQKFPRTFSQLVLDPIFKVFDAIMNFRKEETAKLIDKLDVKLDSEDKEKEGKPLLKAVMRRWLPAGEALLQMITIHLPSPVTAQKYRCELLYEGPGDDEAAMGIKNCDPKAPLMMYISKMVPTTDKGRFYAFGRVFSGCVSTGQKVRIMGPNFTPGKKEDLYIKPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQFLVKTGTITTFDQAHNMRVMKFSVSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHIIAGAGELHLEICLKDLEEDHACIPLKKSDPVVSYRETVSEESDQMCLSKSPNKHNRLFMKARPFPDGLAEDIEKGDVSARQELKARARYLADKYEWEVTEARKIWCFGPDGSGPNLLIDVTKGVQYLNEIKDSVVAGFQWASKEGALCEENMRAVRFDIHDVTLHADAIHRGGGQIIPTARRVLYACQLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQVMGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILQGDPNDPATRPCQVVAEIRKRKGLKEGIPALDNYLDKL 858          
BLAST of Elongation factor 2 vs. Ensembl Medaka
Match: EEF2 (eukaryotic translation elongation factor 2 [Source:NCBI gene;Acc:101162630])

HSP 1 Score: 1202.96 bits (3111), Expect = 0.000e+0
Identity = 610/868 (70.28%), Postives = 703/868 (80.99%), Query Frame = 3
Query:  111 MVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELD-GPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSS-------------DKLMKRLWGDNFFSEKSKKWCKR---PD--EGVRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSEDIPPLDKFLDKL 2657
            MVNFT+DQIRA+M+KK NIRNMSVIAHVDHGKSTLTDSLVSKAGIIA A+AG+ RFTDTRKDEQERCITIKSTAISMY E+ ++ LA +K       S DG     GFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVL MNKMD A+  LQ EP++LYQ FQR++E+VNVII+ YGE + GPMG I + P  GTVGFGSGL  WAFT+K FA+MY  KF                 + +MK+LWGD +F   + K+ K    PD  +  R F+Q VL PI+ VF  +MN   E+ A+L  K+ VKLDSE+K  + K LLK +MR+WLPAG+ LLQMI IHLPSP  +QKYR +LLYEGP DDE A+ +KNCDP   L+MYISKMVPT+DKGRFYAFGRVFSG V TGQKVRIMGPN+  GKK+DLY K IQRTILMMGRYVE IEDVPCGNI GLVGVDQ+LVKTGTI+TF  AHN+RVMKFSVSPVVRVAVE KNPADLPKLVEGLKRLAKSDPMVQ  I+ESGE+IIAGAGELHLEICLKDLEE+HACIP+KKSDPVVSYRE+V++ S ++CLSKSPNKHNRL+M A P  + LA DI+ G ++AR ++K R R+L D Y+W+V+E+RKIWCFGPDG+GPN+++DV+KGVQYLNEIKDSVVA F WASK+  LCEENMR VRF+IHDVTLHADAIHRGGGQIIPTARR +YA  LTA P L+EP+Y  EIQ PE  +GGIY  LN++RG +F E QV GTP +VVKAYLPVNESF FT++LR+ TGGQAFPQCVFDHWQ+  G+P DP T+P   V + RKRKGL E IP LD +LDKL
Sbjct:    1 MVNFTVDQIRAIMDKKSNIRNMSVIAHVDHGKSTLTDSLVSKAGIIASARAGETRFTDTRKDEQERCITIKSTAISMYYELGDNDLAFIK------QSKDGN----GFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLMMNKMDRALLELQLEPDELYQTFQRIVENVNVIISTYGEDESGPMGSIMIDPVIGTVGFGSGLHGWAFTLKQFAEMYVAKFTAKGVAQLGPAERCKKVEDMMKKLWGDRYFDPSAGKFSKTATGPDGQKFPRTFSQLVLDPIFKVFDAIMNFRKEETAKLIDKLDVKLDSEDKEKEGKPLLKAVMRRWLPAGEALLQMITIHLPSPVTAQKYRCELLYEGPGDDEAAMGIKNCDPKAPLMMYISKMVPTTDKGRFYAFGRVFSGCVSTGQKVRIMGPNFTPGKKEDLYIKPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQFLVKTGTITTFDQAHNMRVMKFSVSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHIIAGAGELHLEICLKDLEEDHACIPLKKSDPVVSYRETVSEESDQMCLSKSPNKHNRLFMKARPFPDGLAEDIEKGDVSARQELKARARYLADKYEWEVTEARKIWCFGPDGSGPNLLIDVTKGVQYLNEIKDSVVAGFQWASKEGALCEENMRAVRFDIHDVTLHADAIHRGGGQIIPTARRVLYACQLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQVMGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILQGDPNDPATRPCQVVAEIRKRKGLKEGIPALDNYLDKL 858          
BLAST of Elongation factor 2 vs. Ensembl Medaka
Match: EEF2 (eukaryotic translation elongation factor 2 [Source:NCBI gene;Acc:101162630])

HSP 1 Score: 1179.08 bits (3049), Expect = 0.000e+0
Identity = 600/856 (70.09%), Postives = 691/856 (80.72%), Query Frame = 3
Query:  147 MEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELD-GPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSS-------------DKLMKRLWGDNFFSEKSKKWCKR---PD--EGVRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSEDIPPLDKFLDKL 2657
            M+KK NIRNMSVIAHVDHGKSTLTDSLVSKAGIIA A+AG+ RFTDTRKDEQERCITIKSTAISMY E+ ++ LA +K       S DG     GFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVL MNKMD A+  LQ EP++LYQ FQR++E+VNVII+ YGE + GPMG I + P  GTVGFGSGL  WAFT+K FA+MY  KF                 + +MK+LWGD +F   + K+ K    PD  +  R F+Q VL PI+ VF  +MN   E+ A+L  K+ VKLDSE+K  + K LLK +MR+WLPAG+ LLQMI IHLPSP  +QKYR +LLYEGP DDE A+ +KNCDP   L+MYISKMVPT+DKGRFYAFGRVFSG V TGQKVRIMGPN+  GKK+DLY K IQRTILMMGRYVE IEDVPCGNI GLVGVDQ+LVKTGTI+TF  AHN+RVMKFSVSPVVRVAVE KNPADLPKLVEGLKRLAKSDPMVQ  I+ESGE+IIAGAGELHLEICLKDLEE+HACIP+KKSDPVVSYRE+V++ S ++CLSKSPNKHNRL+M A P  + LA DI+ G ++AR ++K R R+L D Y+W+V+E+RKIWCFGPDG+GPN+++DV+KGVQYLNEIKDSVVA F WASK+  LCEENMR VRF+IHDVTLHADAIHRGGGQIIPTARR +YA  LTA P L+EP+Y  EIQ PE  +GGIY  LN++RG +F E QV GTP +VVKAYLPVNESF FT++LR+ TGGQAFPQCVFDHWQ+  G+P DP T+P   V + RKRKGL E IP LD +LDKL
Sbjct:    1 MDKKSNIRNMSVIAHVDHGKSTLTDSLVSKAGIIASARAGETRFTDTRKDEQERCITIKSTAISMYYELGDNDLAFIK------QSKDGN----GFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLMMNKMDRALLELQLEPDELYQTFQRIVENVNVIISTYGEDESGPMGSIMIDPVIGTVGFGSGLHGWAFTLKQFAEMYVAKFTAKGVAQLGPAERCKKVEDMMKKLWGDRYFDPSAGKFSKTATGPDGQKFPRTFSQLVLDPIFKVFDAIMNFRKEETAKLIDKLDVKLDSEDKEKEGKPLLKAVMRRWLPAGEALLQMITIHLPSPVTAQKYRCELLYEGPGDDEAAMGIKNCDPKAPLMMYISKMVPTTDKGRFYAFGRVFSGCVSTGQKVRIMGPNFTPGKKEDLYIKPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQFLVKTGTITTFDQAHNMRVMKFSVSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHIIAGAGELHLEICLKDLEEDHACIPLKKSDPVVSYRETVSEESDQMCLSKSPNKHNRLFMKARPFPDGLAEDIEKGDVSARQELKARARYLADKYEWEVTEARKIWCFGPDGSGPNLLIDVTKGVQYLNEIKDSVVAGFQWASKEGALCEENMRAVRFDIHDVTLHADAIHRGGGQIIPTARRVLYACQLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQVMGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILQGDPNDPATRPCQVVAEIRKRKGLKEGIPALDNYLDKL 846          
BLAST of Elongation factor 2 vs. Ensembl Medaka
Match: eftud2 (elongation factor Tu GTP binding domain containing 2 [Source:NCBI gene;Acc:101157862])

HSP 1 Score: 574.318 bits (1479), Expect = 0.000e+0
Identity = 310/875 (35.43%), Postives = 501/875 (57.26%), Query Frame = 3
Query:  102 ELKMVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXX-XXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELDGPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKF-QMSSDKLMKRLWGDNFFSEKSKKWCKRP--DEGVRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAG---AHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVD------VSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLD---------PTTKPGIT---VRDTRKRKGLSEDIPPLDKFLD 2651
            EL    + ++ +  LM+    IRN+++  H+ HGK+   D L+ +    I      D R+TD    EQER + IKST ++M                   L D   +  K +L N++D+PGHV+FS EVTA++R++DG ++ +D   GV + TE +++ A+ ER+   + +NK+D  +  L+  P D Y K + +++ VN +++ Y   +    ++ V+P  G V F S   S  FT+ +FA +Y+     ++ ++  KRLWGD +F+ K++K+ K+       R F +F+L+P+Y +   V+         +  ++G+ L  EE  L  + LL+ +  ++       + M   H+PSP    + + +  Y G LD ++  +M  CDP+G L+ + +KM  T D  +F+AFGRV SG +  GQ V+++G NY    ++D    ++ R  + + RY   +  VP GN   + G DQ +VKT TI+   G   A   R +KF+ + V+++AVEP NP++LPK+++GL+++ KS P +   ++ESGE++I G GEL+L+  + DL + ++ I IK +DPVV++ E+V +TSS  C +++PNK N++ M A P+ + LA DI+   +    + K+ G F    YDWD+  +R IW FGPD  GPN++VD      V K +  L  +KDS+V  F W +++  LC+E +R V+F I D  +  + +HRGGGQ+IPTARR +Y+  L A P L+EP Y  E+Q P   +  +Y+ L +RRG +  +  + G+P Y +KA++P  +SF F ++LR  T GQAF   VF HWQ+ PG+PLD         P   P +    +  TR+RKGLSED+  + KF D
Sbjct:  107 ELPATVYDMEFLADLMDGPELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRDDVDLRYTDILFTEQERGVGIKSTPVTM------------------VLPD---SRGKSYLFNIMDTPGHVNFSDEVTASMRISDGVVLFIDAAEGVMLNTERLIKHAVQERMAITICINKVDRLIVELKLPPTDAYYKLRHIVDEVNGLLSTYSTDE----NLVVSPLLGNVCFASSQYSICFTLGSFAKIYSDTHGDINYNEFAKRLWGDIYFNPKTRKFTKKAPSSNSQRSFVEFILEPLYKILSQVVGDVDTSLPRVLDELGIHLSKEELKLNIRPLLRLVCNRFFGEFTGFVDMCVQHVPSPQEGARIKIEHTYTGGLDSDLGEAMAECDPDGPLMCHTTKMYSTEDGVQFHAFGRVLSGTIQAGQPVKVLGENYSLEDEEDSSVCTVGRLWISVARYQIEVNRVPAGNWVLIEGCDQPIVKTATITEPRGNEEAQIFRPLKFNTASVIKIAVEPVNPSELPKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCVMHDLRKMYSEIDIKVADPVVTFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQTKYDWDLLAARSIWAFGPDTTGPNILVDDTLPSEVDKAL--LGSVKDSIVQGFQWGTREGPLCDEPIRNVKFKILDAVIAQEPLHRGGGQVIPTARRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFALSVFHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDV-SISKFFD 953          
BLAST of Elongation factor 2 vs. Planmine SMEST
Match: SMESG000042430.1 (SMESG000042430.1)

HSP 1 Score: 1714.12 bits (4438), Expect = 0.000e+0
Identity = 849/849 (100.00%), Postives = 849/849 (100.00%), Query Frame = 3
Query:  111 MVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELDGPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSDKLMKRLWGDNFFSEKSKKWCKRPDEGVRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSEDIPPLDKFLDKL 2657
            MVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGAKAGDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELDGPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSDKLMKRLWGDNFFSEKSKKWCKRPDEGVRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSEDIPPLDKFLDKL
Sbjct:    1 MVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGAKAGDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELDGPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSDKLMKRLWGDNFFSEKSKKWCKRPDEGVRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSEDIPPLDKFLDKL 849          
BLAST of Elongation factor 2 vs. Planmine SMEST
Match: SMESG000076126.1 (SMESG000076126.1)

HSP 1 Score: 1410.97 bits (3651), Expect = 0.000e+0
Identity = 689/830 (83.01%), Postives = 763/830 (91.93%), Query Frame = 3
Query:  174 MSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELDGPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSDKLMKRLWGDNFFSEKSKKWCKRPDEG-VRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSE-DIPPLDKFLDKL 2657
            MSVIAHVDHGKSTLTDSLVS AGIIAG+KAG+ARFTDTRKDEQERCITIKSTAIS+Y+E+   +L  V+ VQ V  S DGK +E GFL+NLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAI+ERIKP+LFMNKMDMAVQGLQC+PEDLYQKFQRVIE+VNVII+QY ELDGPMGDIQV P+NGTVGFGSGLQSWAFT++NFADMY+KK  +   KLMKRLWG+NFF+EK+KKW K   EG VRGF+Q VLKPIYMVF TVMNK+ EDA  LA KMGVK+DSEE+ L PKQLLK IMRKWLPAG+TL+QMICIHLPSP  SQKYRTD+LYEGP DDE+AI+M  CDP G L+MY+SKMVPTSD+GRFYAFGRVFSGKV +G KVRIMGPN+V GKK+DL+EKSIQRTILMMGR VEAIEDVPCGNICGLVGVDQ+LVKTGTI+TF+GAHNLRVMKFSVSPVVRVAVEP NPADLPKLVEGLKRLAKSDPMVQISI+ESGENIIAGAGELHLEICLKDLEE+HA IPIKKSDPVVSYRESVT TSSE+CLSKSPNKHNRLYMTA+P+ EEL+SDIDAGKITAR ++KERG+FLV+ Y+W+V++SRKIWCFGPDGNGPN+VVDV+KGVQYLNEIKDSVVAAFNWA+KD +LCEENMRGVR NIHDVTLH DAIHRGGGQIIPTARR IYA+VLTA PCLLEPVYQCEIQGPE+ LGGIYSTLN+RRGIIF EM + GTPQY+VKA+LPVNESFNFTS+LRAQTGGQAFPQCVFDHWQ++PGNPLDPT+KPG+ V   RKRKGL +  +PPLD+F+DKL
Sbjct:    1 MSVIAHVDHGKSTLTDSLVSMAGIIAGSKAGEARFTDTRKDEQERCITIKSTAISLYSELNASTLDMVREVQEVD-SRDGKVEENGFLVNLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAISERIKPILFMNKMDMAVQGLQCDPEDLYQKFQRVIENVNVIISQYSELDGPMGDIQVNPQNGTVGFGSGLQSWAFTLRNFADMYSKKMGVEPKKLMKRLWGENFFNEKTKKWTKNSAEGGVRGFSQMVLKPIYMVFNTVMNKTSEDALALASKMGVKIDSEERDLPPKQLLKTIMRKWLPAGETLMQMICIHLPSPVTSQKYRTDMLYEGPKDDEVAIAMSKCDPEGPLMMYVSKMVPTSDRGRFYAFGRVFSGKVASGHKVRIMGPNFVVGKKEDLFEKSIQRTILMMGRNVEAIEDVPCGNICGLVGVDQFLVKTGTITTFSGAHNLRVMKFSVSPVVRVAVEPVNPADLPKLVEGLKRLAKSDPMVQISIEESGENIIAGAGELHLEICLKDLEEDHANIPIKKSDPVVSYRESVTGTSSEICLSKSPNKHNRLYMTASPLSEELSSDIDAGKITARQELKERGKFLVENYEWEVNDSRKIWCFGPDGNGPNLVVDVTKGVQYLNEIKDSVVAAFNWATKDGVLCEENMRGVRINIHDVTLHTDAIHRGGGQIIPTARRAIYASVLTAQPCLLEPVYQCEIQGPESILGGIYSTLNRRRGIIFEEMPITGTPQYIVKAHLPVNESFNFTSDLRAQTGGQAFPQCVFDHWQMFPGNPLDPTSKPGLVVMAARKRKGLPDGGVPPLDRFVDKL 829          
BLAST of Elongation factor 2 vs. Planmine SMEST
Match: SMESG000076108.1 (SMESG000076108.1)

HSP 1 Score: 1410.97 bits (3651), Expect = 0.000e+0
Identity = 689/830 (83.01%), Postives = 763/830 (91.93%), Query Frame = 3
Query:  174 MSVIAHVDHGKSTLTDSLVSXXXXXXXXXXXDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDDGKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIAQYGELDGPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSDKLMKRLWGDNFFSEKSKKWCKRPDEG-VRGFNQFVLKPIYMVFQTVMNKSLEDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLPSPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGRFYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVEAIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSE-DIPPLDKFLDKL 2657
            MSVIAHVDHGKSTLTDSLVS AGIIAG+KAG+ARFTDTRKDEQERCITIKSTAIS+Y+E+   +L  V+ VQ V  S DGK +E GFL+NLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAI+ERIKP+LFMNKMDMAVQGLQC+PEDLYQKFQRVIE+VNVII+QY ELDGPMGDIQV P+NGTVGFGSGLQSWAFT++NFADMY+KK  +   KLMKRLWG+NFF+EK+KKW K   EG VRGF+Q VLKPIYMVF TVMNK+ EDA  LA KMGVK+DSEE+ L PKQLLK IMRKWLPAG+TL+QMICIHLPSP  SQKYRTD+LYEGP DDE+AI+M  CDP G L+MY+SKMVPTSD+GRFYAFGRVFSGKV +G KVRIMGPN+V GKK+DL+EKSIQRTILMMGR VEAIEDVPCGNICGLVGVDQ+LVKTGTI+TF+GAHNLRVMKFSVSPVVRVAVEP NPADLPKLVEGLKRLAKSDPMVQISI+ESGENIIAGAGELHLEICLKDLEE+HA IPIKKSDPVVSYRESVT TSSE+CLSKSPNKHNRLYMTA+P+ EEL+SDIDAGKITAR ++KERG+FLV+ Y+W+V++SRKIWCFGPDGNGPN+VVDV+KGVQYLNEIKDSVVAAFNWA+KD +LCEENMRGVR NIHDVTLH DAIHRGGGQIIPTARR IYA+VLTA PCLLEPVYQCEIQGPE+ LGGIYSTLN+RRGIIF EM + GTPQY+VKA+LPVNESFNFTS+LRAQTGGQAFPQCVFDHWQ++PGNPLDPT+KPG+ V   RKRKGL +  +PPLD+F+DKL
Sbjct:    1 MSVIAHVDHGKSTLTDSLVSMAGIIAGSKAGEARFTDTRKDEQERCITIKSTAISLYSELNASTLDMVREVQEVD-SRDGKVEENGFLVNLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAISERIKPILFMNKMDMAVQGLQCDPEDLYQKFQRVIENVNVIISQYSELDGPMGDIQVNPQNGTVGFGSGLQSWAFTLRNFADMYSKKMGVEPKKLMKRLWGENFFNEKTKKWTKNSAEGGVRGFSQMVLKPIYMVFNTVMNKTSEDALALASKMGVKIDSEERDLPPKQLLKTIMRKWLPAGETLMQMICIHLPSPVTSQKYRTDMLYEGPKDDEVAIAMSKCDPEGPLMMYVSKMVPTSDRGRFYAFGRVFSGKVASGHKVRIMGPNFVVGKKEDLFEKSIQRTILMMGRNVEAIEDVPCGNICGLVGVDQFLVKTGTITTFSGAHNLRVMKFSVSPVVRVAVEPVNPADLPKLVEGLKRLAKSDPMVQISIEESGENIIAGAGELHLEICLKDLEEDHANIPIKKSDPVVSYRESVTGTSSEICLSKSPNKHNRLYMTASPLSEELSSDIDAGKITARQELKERGKFLVENYEWEVNDSRKIWCFGPDGNGPNLVVDVTKGVQYLNEIKDSVVAAFNWATKDGVLCEENMRGVRINIHDVTLHTDAIHRGGGQIIPTARRAIYASVLTAQPCLLEPVYQCEIQGPESILGGIYSTLNRRRGIIFEEMPITGTPQYIVKAHLPVNESFNFTSDLRAQTGGQAFPQCVFDHWQMFPGNPLDPTSKPGLVVMAARKRKGLPDGGVPPLDRFVDKL 829          
BLAST of Elongation factor 2 vs. Planmine SMEST
Match: SMESG000045982.1 (SMESG000045982.1)

HSP 1 Score: 293.893 bits (751), Expect = 2.743e-90
Identity = 151/381 (39.63%), Postives = 232/381 (60.89%), Query Frame = 3
Query: 1563 LRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVD------VSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAFPQCVFDHWQLYPGNPLDPTTK--------PGITVRD----TRKRKGLSEDIPPLDKFLD 2651
             R + F+   V+++AVEP NP++LPK+++GL+++ KS P+V    + SGE+II G GEL+L+  + DL + ++ I IK +DPVVS+ E+V +TSS  C S++PNK N+  M A P+ + +A DI+   +      ++   F    YDWD+  SR IW FGP   GPN++VD      V+K +  L  +K+ VV  F W +++  LC+E +R V+F I D T+  ++  R  G II TARR +Y+  L A P ++EP+   E+  P   +  IY+ ++KRRG +  +  ++G+P Y +KA++P  ESF   ++LR  T GQ+F Q VF HWQ  PG+PLD + K        P    R+    TR+RKGL+ED+  ++KF D
Sbjct:    3 FRPLNFNTCSVIKIAVEPANPSELPKMLDGLRKVNKSYPLVITKAEGSGEHIILGTGELYLDCVMHDLRKMYSDIEIKVADPVVSFCETVVETSSLKCFSETPNKKNKFTMIAEPLQKGIAEDIENKVVQLDWPKRKVEEFFQKKYDWDLLASRSIWAFGPVSTGPNILVDDTLPAEVNKNL--LASVKNYVVQGFQWGTREGPLCDEPIRNVKFKILDATVAPESQTRPDGNIISTARRVVYSAFLMATPRMMEPICFVEVTAPADCISAIYAVISKRRGHVTQDGPISGSPLYTMKAFVPAIESFGLETDLRTFTQGQSFCQSVFHHWQQVPGDPLDRSIKLKPLIAQPPTHLAREFMVKTRRRKGLNEDV-SVNKFFD 380          
BLAST of Elongation factor 2 vs. Planmine SMEST
Match: SMESG000045982.1 (SMESG000045982.1)

HSP 1 Score: 222.246 bits (565), Expect = 1.929e-65
Identity = 110/280 (39.29%), Postives = 172/280 (61.43%), Query Frame = 3
Query: 1563 LRVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLKDLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPMGEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGPNMVVD------VSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTLHADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGIYSTLNKRR 2384
             R + F+   V+++AVEP NP++LPK+++GL+++ KS P+V    + SGE+II G GEL+L+  + DL + ++ I IK +DPVVS+ E+V +TSS  C S++PNK N+  M A P+ + +A DI+   +      ++   F    YDWD+  SR IW FGP   GPN++VD      V+K +  L  +K+ VV  F W +++  LC+E +R V+F I D T+  ++  R  G II TARR +Y+  L A P ++EP+   E+  P   +  IY+ ++KRR
Sbjct:    3 FRPLNFNTCSVIKIAVEPANPSELPKMLDGLRKVNKSYPLVITKAEGSGEHIILGTGELYLDCVMHDLRKMYSDIEIKVADPVVSFCETVVETSSLKCFSETPNKKNKFTMIAEPLQKGIAEDIENKVVQLDWPKRKVEEFFQKKYDWDLLASRSIWAFGPVSTGPNILVDDTLPAEVNKNL--LASVKNYVVQGFQWGTREGPLCDEPIRNVKFKILDATVAPESQTRPDGNIISTARRVVYSAFLMATPRMMEPICFVEVTAPADCISAIYAVISKRR 280          
The following BLAST results are available for this feature:
BLAST of Elongation factor 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EEF20.000e+070.74eukaryotic translation elongation factor 2 [Source... [more]
EFTUD20.000e+036.16elongation factor Tu GTP binding domain containing... [more]
EFTUD20.000e+036.16elongation factor Tu GTP binding domain containing... [more]
EFTUD20.000e+036.16elongation factor Tu GTP binding domain containing... [more]
EFTUD20.000e+035.97elongation factor Tu GTP binding domain containing... [more]
back to top
BLAST of Elongation factor 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eef-20.000e+072.30Elongation factor 2 [Source:UniProtKB/Swiss-Prot;... [more]
eef-20.000e+072.30Elongation factor 2 [Source:UniProtKB/Swiss-Prot;... [more]
eef-20.000e+072.30Elongation factor 2 [Source:UniProtKB/Swiss-Prot;... [more]
eef-20.000e+072.14Elongation factor 2 [Source:UniProtKB/Swiss-Prot;... [more]
eef-20.000e+072.14Elongation factor 2 [Source:UniProtKB/Swiss-Prot;... [more]
back to top
BLAST of Elongation factor 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eEF20.000e+071.88gene:FBgn0000559 transcript:FBtr0085911[more]
eEF20.000e+071.88gene:FBgn0000559 transcript:FBtr0085912[more]
eEF20.000e+071.88gene:FBgn0000559 transcript:FBtr0332966[more]
CG48490.000e+035.15gene:FBgn0039566 transcript:FBtr0085257[more]
CG331581.624e-6237.08gene:FBgn0053158 transcript:FBtr0075390[more]
back to top
BLAST of Elongation factor 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eef2l20.000e+069.35eukaryotic translation elongation factor 2, like 2... [more]
eef2b0.000e+069.31eukaryotic translation elongation factor 2b [Sourc... [more]
eef2b0.000e+070.85eukaryotic translation elongation factor 2b [Sourc... [more]
eef2a.10.000e+062.12eukaryotic translation elongation factor 2a, tande... [more]
eef2a.10.000e+062.27eukaryotic translation elongation factor 2a, tande... [more]
back to top
BLAST of Elongation factor 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eef2.20.000e+071.43eukaryotic translation elongation factor 2, gene 2... [more]
eef2.20.000e+070.39eukaryotic translation elongation factor 2, gene 2... [more]
eef2.20.000e+070.39eukaryotic translation elongation factor 2, gene 2... [more]
eef2.20.000e+070.39eukaryotic translation elongation factor 2, gene 2... [more]
eef2.10.000e+069.70eukaryotic translation elongation factor 2, gene 1... [more]
back to top
BLAST of Elongation factor 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Eef20.000e+070.97eukaryotic translation elongation factor 2 [Source... [more]
Eftud20.000e+036.16elongation factor Tu GTP binding domain containing... [more]
Eftud20.000e+036.16elongation factor Tu GTP binding domain containing... [more]
Eftud20.000e+035.97elongation factor Tu GTP binding domain containing... [more]
Efl18.487e-6028.57elongation factor like GTPase 1 [Source:MGI Symbol... [more]
back to top
BLAST of Elongation factor 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P29691|EF2_CAEEL0.000e+072.30Elongation factor 2 OS=Caenorhabditis elegans OX=6... [more]
sp|P13060|EF2_DROME0.000e+071.88Elongation factor 2 OS=Drosophila melanogaster OX=... [more]
sp|Q90705|EF2_CHICK0.000e+070.97Elongation factor 2 OS=Gallus gallus OX=9031 GN=EE... [more]
sp|Q1HPK6|EF2_BOMMO0.000e+071.29Translation elongation factor 2 OS=Bombyx mori OX=... [more]
sp|Q3SYU2|EF2_BOVIN0.000e+070.85Elongation factor 2 OS=Bos taurus OX=9913 GN=EEF2 ... [more]
back to top
BLAST of Elongation factor 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YZD90.000e+076.03Translation elongation factor 2 OS=Fasciola gigant... [more]
H2KSL00.000e+074.71Elongation factor 2 OS=Clonorchis sinensis OX=7992... [more]
A0A5J4NFF60.000e+075.53Elongation factor 2 OS=Paragonimus westermani OX=3... [more]
A0A419Q5F50.000e+074.59Elongation factor 2 OS=Clonorchis sinensis OX=7992... [more]
Q6AZM90.000e+075.56Eft-2-prov protein OS=Xenopus laevis OX=8355 GN=ee... [more]
back to top
BLAST of Elongation factor 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eef2b0.000e+070.05eukaryotic translation elongation factor 2 [Source... [more]
eef2b0.000e+070.01eukaryotic translation elongation factor 2 [Source... [more]
eftud20.000e+035.77elongation factor Tu GTP binding domain containing... [more]
efl13.177e-6027.26elongation factor like GTPase 1 [Source:NCBI gene;... [more]
efl19.925e-5736.21elongation factor like GTPase 1 [Source:NCBI gene;... [more]
back to top
BLAST of Elongation factor 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001336.10.000e+070.74pep scaffold:Pmarinus_7.0:GL476352:246829:320669:1... [more]
ENSPMAT00000000172.15.873e-8337.86pep scaffold:Pmarinus_7.0:GL487060:72:9589:1 gene:... [more]
ENSPMAT00000002238.14.219e-5726.62pep scaffold:Pmarinus_7.0:GL477208:59906:84789:-1 ... [more]
ENSPMAT00000008388.12.823e-3035.65pep scaffold:Pmarinus_7.0:GL490073:1463:6204:1 gen... [more]
gfm21.451e-1040.37G elongation factor, mitochondrial 2 [Source:NCBI ... [more]
back to top
BLAST of Elongation factor 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
EFT20.000e+062.65Elongation factor 2 (EF-2), also encoded by EFT1; ... [more]
EFT10.000e+062.65Elongation factor 2 (EF-2), also encoded by EFT2; ... [more]
SNU1148.938e-7726.57GTPase component of U5 snRNP involved in mRNA spli... [more]
RIA16.031e-6036.83Cytoplasmic GTPase/eEF2-like factor involved in ri... [more]
MEF12.424e-1724.22Mitochondrial elongation factor involved in transl... [more]
back to top
BLAST of Elongation factor 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO456050.000e+071.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO370210.000e+035.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO259655.811e-8959.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421535.291e-5533.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO288239.122e-4955.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Elongation factor 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000005814.20.000e+070.74elongation factor 2 [Source:NCBI gene;Acc:10117198... [more]
EEF20.000e+070.28eukaryotic translation elongation factor 2 [Source... [more]
EEF20.000e+070.28eukaryotic translation elongation factor 2 [Source... [more]
EEF20.000e+070.09eukaryotic translation elongation factor 2 [Source... [more]
eftud20.000e+035.43elongation factor Tu GTP binding domain containing... [more]
back to top
BLAST of Elongation factor 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000042430.10.000e+0100.00SMESG000042430.1[more]
SMESG000076126.10.000e+083.01SMESG000076126.1[more]
SMESG000076108.10.000e+083.01SMESG000076108.1[more]
SMESG000045982.12.743e-9039.63SMESG000045982.1[more]
SMESG000045982.11.929e-6539.29SMESG000045982.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004937 ID=SMED30004937|Name=Elongation factor 2|organism=Schmidtea mediterranea sexual|type=transcript|length=2949bp
AAATCATTCAGTTTTACTCATTAGTTGTTTAAATCTTTTGTTGTATGTTT
ATATTTATTTTTCTAATTTGATCACTTAATTGCGTGTAGTCCTAATAATT
AGAATTAAAGATGGTTAATTTTACAATAGATCAAATAAGAGCTCTTATGG
AGAAAAAGAGAAACATCCGAAATATGAGTGTCATAGCTCATGTTGATCAT
GGAAAGTCTACTTTAACTGATTCATTAGTAAGTAAAGCTGGTATAATAGC
TGGTGCCAAAGCTGGTGATGCTAGATTTACAGACACAAGAAAAGATGAAC
AAGAAAGGTGTATAACCATTAAATCTACGGCTATTTCCATGTATAATGAA
ATGACTGAAGATAGCTTAGCTGCCGTCAAAGTTGTTCAGCCAGTAGCTTT
AAGTGATGATGGTAAAACTGACGAAAAGGGATTTCTAATCAATTTAATTG
ATTCTCCTGGCCACGTTGATTTTAGTAGTGAAGTGACAGCAGCGTTGAGA
GTTACTGATGGAGCTCTTGTTGTTGTTGATTGTGTTTCGGGAGTGTGCGT
TCAAACAGAAACTGTATTGCGACAGGCTATTGCTGAAAGAATCAAGCCTG
TTCTTTTTATGAATAAAATGGACATGGCAGTTCAGGGCTTACAGTGCGAG
CCGGAAGATTTGTATCAAAAATTTCAAAGAGTTATTGAAAGTGTTAATGT
TATTATAGCGCAATATGGTGAGTTAGATGGACCAATGGGAGATATTCAAG
TGACTCCAGAAAATGGTACGGTTGGTTTCGGTTCTGGATTGCAAAGTTGG
GCTTTTACAGTAAAAAACTTTGCCGATATGTATGCTAAGAAGTTTCAAAT
GTCTTCAGATAAATTAATGAAACGGTTGTGGGGTGATAACTTTTTCAGTG
AAAAATCAAAGAAATGGTGTAAAAGGCCAGATGAAGGTGTCAGAGGATTT
AATCAGTTTGTGCTTAAACCAATCTACATGGTTTTTCAGACGGTGATGAA
CAAGTCGTTAGAAGATGCCGCTGAATTGGCAAAAAAAATGGGTGTAAAAT
TAGACAGCGAAGAAAAAGCTCTTCAGCCAAAACAATTACTTAAGTGTATT
ATGCGAAAATGGCTTCCTGCTGGTGACACTTTGCTTCAAATGATTTGTAT
ACATTTGCCAAGTCCAGCAATTTCACAAAAGTATCGTACTGATTTGTTAT
ACGAAGGTCCACTTGATGATGAAATTGCAATTTCAATGAAGAATTGTGAT
CCAAACGGACACTTGGTGATGTACATAAGCAAAATGGTACCGACTTCTGA
CAAAGGTAGATTTTATGCTTTCGGCCGAGTTTTTTCCGGTAAAGTAGGAA
CTGGGCAAAAAGTCAGAATTATGGGGCCTAATTATGTTAGTGGCAAAAAA
GATGATTTATACGAGAAGAGTATTCAAAGAACAATTTTGATGATGGGAAG
ATATGTTGAAGCAATTGAAGACGTTCCTTGTGGAAATATTTGTGGACTTG
TCGGTGTAGATCAATATTTAGTTAAAACTGGAACGATATCTACTTTTGCT
GGAGCTCACAATTTAAGGGTAATGAAATTCAGTGTAAGTCCAGTTGTTCG
AGTTGCAGTAGAACCTAAAAATCCAGCCGACTTGCCAAAATTAGTGGAAG
GTCTTAAAAGATTGGCAAAGTCAGATCCCATGGTACAAATATCGATTGAT
GAATCGGGTGAAAATATTATTGCCGGCGCTGGAGAACTTCATTTAGAAAT
CTGTCTGAAAGATCTTGAAGAAGAACATGCATGTATTCCAATAAAGAAAA
GTGATCCAGTTGTTTCATACAGAGAATCAGTTACTCAGACCAGTAGTGAA
TTATGTTTGAGTAAATCTCCAAACAAACATAACAGGCTTTACATGACTGC
AGCTCCAATGGGAGAGGAATTAGCCAGTGATATCGATGCGGGTAAAATTA
CTGCTCGATCTGATGTTAAAGAAAGAGGTCGATTTTTGGTTGATACTTAC
GACTGGGATGTTAGTGAATCGAGAAAGATTTGGTGTTTCGGCCCTGATGG
CAACGGACCTAATATGGTTGTTGACGTATCGAAAGGAGTTCAATATTTAA
ATGAAATTAAAGACAGTGTAGTTGCGGCCTTTAATTGGGCATCCAAAGAC
AGTATATTGTGTGAGGAAAACATGCGCGGAGTTCGTTTTAATATTCATGA
TGTCACGTTGCATGCCGATGCTATTCATAGAGGAGGTGGACAGATTATTC
CAACTGCAAGACGATGTATCTACGCTACAGTATTGACAGCTGGACCGTGC
TTATTGGAGCCCGTTTACCAGTGTGAAATCCAAGGTCCTGAAACTGCTCT
AGGAGGAATTTATAGTACTCTAAACAAAAGAAGAGGCATTATTTTCAGTG
AAATGCAAGTTGCCGGAACTCCGCAGTATGTTGTGAAAGCGTATTTACCT
GTAAACGAATCATTTAATTTTACATCTGAGTTGAGAGCTCAAACTGGTGG
GCAGGCTTTCCCACAATGTGTTTTTGATCATTGGCAATTATATCCGGGAA
ACCCACTGGATCCCACAACGAAACCAGGAATCACTGTACGAGACACGAGA
AAAAGAAAAGGACTTTCTGAGGATATTCCACCCTTAGATAAATTCTTGGA
TAAACTTTAAATTCCAATCAATAAATAAATATCTGGATCTTTAAGTTTTT
TAGTAAATGATCATAATTTATTGATTCGATAGATAATAAGTGAAAAACAT
TACATTTTCATATTCAGAACATAAATTTCATTTTGCATGTGGTTTAACAA
TTCGAGTGAGCCAATAGGAATGGGAATATATTACGTTTTAGACAAGAAAT
TTTTATTGCAATTAATTTAATAAAAGTGCATTGTATCTTGTGAAATTTTA
AATAAAATAATAACTAGCTGTATAAGGCTAGTATTGTACATTATTTGAC
back to top

protein sequence of SMED30004937-orf-1

>SMED30004937-orf-1 ID=SMED30004937-orf-1|Name=SMED30004937-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=850bp
MVNFTIDQIRALMEKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGAK
AGDARFTDTRKDEQERCITIKSTAISMYNEMTEDSLAAVKVVQPVALSDD
GKTDEKGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTE
TVLRQAIAERIKPVLFMNKMDMAVQGLQCEPEDLYQKFQRVIESVNVIIA
QYGELDGPMGDIQVTPENGTVGFGSGLQSWAFTVKNFADMYAKKFQMSSD
KLMKRLWGDNFFSEKSKKWCKRPDEGVRGFNQFVLKPIYMVFQTVMNKSL
EDAAELAKKMGVKLDSEEKALQPKQLLKCIMRKWLPAGDTLLQMICIHLP
SPAISQKYRTDLLYEGPLDDEIAISMKNCDPNGHLVMYISKMVPTSDKGR
FYAFGRVFSGKVGTGQKVRIMGPNYVSGKKDDLYEKSIQRTILMMGRYVE
AIEDVPCGNICGLVGVDQYLVKTGTISTFAGAHNLRVMKFSVSPVVRVAV
EPKNPADLPKLVEGLKRLAKSDPMVQISIDESGENIIAGAGELHLEICLK
DLEEEHACIPIKKSDPVVSYRESVTQTSSELCLSKSPNKHNRLYMTAAPM
GEELASDIDAGKITARSDVKERGRFLVDTYDWDVSESRKIWCFGPDGNGP
NMVVDVSKGVQYLNEIKDSVVAAFNWASKDSILCEENMRGVRFNIHDVTL
HADAIHRGGGQIIPTARRCIYATVLTAGPCLLEPVYQCEIQGPETALGGI
YSTLNKRRGIIFSEMQVAGTPQYVVKAYLPVNESFNFTSELRAQTGGQAF
PQCVFDHWQLYPGNPLDPTTKPGITVRDTRKRKGLSEDIPPLDKFLDKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003746translation elongation factor activity
GO:0005525GTP binding
GO:0003924GTPase activity
Vocabulary: biological process
TermDefinition
GO:0006414translational elongation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000028Category 2 cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR005225Small_GTP-bd_dom
IPR041095EFG_II
IPR035647EFG_III/V
IPR000795TF_GTP-bd_dom
IPR000640EFG_V-like
IPR005517Transl_elong_EFG/EF2_IV
IPR014721Ribosomal_S5_D2-typ_fold_subgr
IPR004161EFTu-like_2
IPR009022EFG_III
IPR027417P-loop_NTPase
IPR031157G_TR_CS
IPR009000Transl_B-barrel_sf
IPR020568Ribosomal_S5_D2-typ_fold
Vocabulary: cellular component
TermDefinition
GO:0019013viral nucleocapsid
GO:0030529intracellular ribonucleoprotein complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000795Transcription factor, GTP-binding domainPRINTSPR00315ELONGATNFCTcoord: 21..34
score: 65.3
coord: 65..73
score: 52.69
coord: 111..121
score: 61.57
coord: 127..138
score: 32.19
coord: 163..172
score: 47.08
IPR000795Transcription factor, GTP-binding domainPFAMPF00009GTP_EFTUcoord: 18..350
e-value: 1.9E-64
score: 216.8
IPR000795Transcription factor, GTP-binding domainPROSITEPS51722G_TR_2coord: 17..353
score: 52.848
IPR000640Elongation factor EFG, domain V-likeSMARTSM00838EFG_C_acoord: 730..819
e-value: 2.5E-17
score: 73.6
IPR000640Elongation factor EFG, domain V-likePFAMPF00679EFG_Ccoord: 731..817
e-value: 4.7E-20
score: 71.4
IPR005517Translation elongation factor EFG/EF2, domain IVSMARTSM00889EFG_IV_2coord: 608..728
e-value: 6.6E-25
score: 98.7
IPR005517Translation elongation factor EFG/EF2, domain IVPFAMPF03764EFG_IVcoord: 614..727
e-value: 3.9E-29
score: 100.9
IPR005225Small GTP-binding protein domainTIGRFAMTIGR00231TIGR00231coord: 20..174
e-value: 3.1E-17
score: 60.8
IPR004161Translation elongation factor EFTu-like, domain 2PFAMPF03144GTP_EFTU_D2coord: 401..476
e-value: 1.4E-13
score: 51.0
IPR014721Ribosomal protein S5 domain 2-type fold, subgroupGENE3DG3DSA:3.30.230.10coord: 575..728
e-value: 1.0E-66
score: 225.3
NoneNo IPR availableGENE3DG3DSA:2.40.30.10coord: 49..478
e-value: 2.6E-180
score: 601.8
NoneNo IPR availableGENE3DG3DSA:3.30.70.240coord: 729..849
e-value: 8.5E-49
score: 166.2
NoneNo IPR availableGENE3DG3DSA:3.90.1430.10coord: 234..335
e-value: 2.6E-180
score: 601.8
NoneNo IPR availableGENE3DG3DSA:3.30.70.870coord: 492..569
e-value: 2.6E-37
score: 128.6
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 13..351
e-value: 2.6E-180
score: 601.8
NoneNo IPR availablePANTHERPTHR42908FAMILY NOT NAMEDcoord: 1..849
NoneNo IPR availablePANTHERPTHR42908:SF20coord: 1..849
NoneNo IPR availableCDDcd03700EF2_snRNP_like_IIcoord: 385..479
e-value: 1.64952E-50
score: 170.102
NoneNo IPR availableCDDcd01885EF2coord: 20..242
e-value: 3.1815E-113
score: 342.289
NoneNo IPR availableCDDcd04096eEF2_snRNP_like_Ccoord: 733..812
e-value: 3.35676E-43
score: 148.843
NoneNo IPR availableCDDcd01681aeEF2_snRNP_like_IVcoord: 565..736
e-value: 8.88655E-96
score: 295.248
NoneNo IPR availableCDDcd16261EF2_snRNP_IIIcoord: 494..565
e-value: 1.24849E-41
score: 144.252
IPR041095Elongation Factor G, domain IIPFAMPF14492EFG_IIcoord: 494..556
e-value: 2.5E-15
score: 56.3
IPR031157Tr-type G domain, conserved sitePROSITEPS00301G_TR_1coord: 58..73
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 4..350
IPR009000Translation protein, beta-barrel domain superfamilySUPERFAMILYSSF50447Translation proteinscoord: 351..487
IPR020568Ribosomal protein S5 domain 2-type foldSUPERFAMILYSSF54211Ribosomal protein S5 domain 2-likecoord: 568..732
IPR035647EF-G domain III/V-likeSUPERFAMILYSSF54980EF-G C-terminal domain-likecoord: 733..846
IPR035647EF-G domain III/V-likeSUPERFAMILYSSF54980EF-G C-terminal domain-likecoord: 491..566