Peptidase M60 domain-containing protein

Overview
NamePeptidase M60 domain-containing protein
Smed IDSMED30004932
Length (bp)2191
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Peptidase M60 domain-containing protein (SMED30004932) t-SNE clustered cells

Violin plots show distribution of expression levels for Peptidase M60 domain-containing protein (SMED30004932) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004932

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30004932h1SMcG0018613 SmedASXL_017423SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30004932h1SMcG0018620 SmedASXL_017423SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30004932h1SMcG0018613 SmedASXL_019388SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30004932h1SMcG0018613 dd_Smed_v4_9120_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004932h1SMcG0018613 dd_Smed_v4_9120_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30004932h1SMcG0018613 dd_Smed_v4_9120_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30004932h1SMcG0018613 dd_Smed_v6_9120_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Human
Match: TCAF2 (TRPM8 channel associated factor 2 [Source:HGNC Symbol;Acc:HGNC:26878])

HSP 1 Score: 149.443 bits (376), Expect = 9.571e-37
Identity = 99/370 (26.76%), Postives = 178/370 (48.11%), Query Frame = 1
Query:  985 GLYVVPGKHVSVQITESN-SQSCRIFINFHLFNTINKEKLYKWPITKTEFIIKRNILETFAYPFGGLLSISCDANND--KVKITFINVVKVPVFDRRDKKDTKDWIQQ-QSVVSPWAVVSSDTLVFVLSSNAIRNLADPETFMRMYDSMVKEEFHLKGRSISTSYREIISTDIQITAGYMHAGYPIGTQIFWVTNPYNKKDYFFDKYNIEIDGEWGLMHELGHNLQEPIFTF-NGAGEVNNNIFTLVAIESMTNMSSWSPNDGWVSTKVKIKDLVKYLNNGT-FEEWKKTYYVALSIYAQLRNSFGWEFYSQVFRRYNELKNEIGSISDNEKIQLWIKTTSEISGMNLCPLYELWKWPISQKTEKELSKL 2076
            GLY++ G++  V ++E+  S   R+ I  H  +     KL + P+   +  + R    + +  +GGLL +     +    V +T    V  P + +  K   ++W +Q Q  ++PW  +++D ++  + +  ++ L DPE  +R++D M++    L          E I  D+QI+AG+MH+GYPI   +  V    N+ D       +   G WG +HELGHN Q   + F     E   N++++   E++  +     ++  +S   + + +  +L  G    +W    + AL  Y QL+ +FGWE ++Q+F  Y  L +      +  ++ LW+K  SE    NL P +E W WPI ++    L+ L
Sbjct:  444 GLYLLEGQNAEVSLSEAAASAGLRVQIGCHTDDLTKARKLSRAPVVTHQCWMDRTE-RSVSCLWGGLLYVIVPKGSQLGPVPVTIRGAVPAPYY-KLGKTSLEEWKRQMQENLAPWGELATDNIILTVPTTNLQALKDPEPVLRLWDEMMQAVARLAAEPFPFRRPERIVADVQISAGWMHSGYPIMCHLESVKEIINEMD-------MRSRGVWGPIHELGHNQQRHGWEFPPHTTEATCNLWSVYVHETVLGIPRAQAHEA-LSPPERERRIKAHLGKGAPLCDW--NVWTALETYLQLQEAFGWEPFTQLFAEYQTLSHL--PKDNTGRMNLWVKKFSEKVKKNLVPFFEAWGWPIQKEVADSLASL 799          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Human
Match: TCAF2 (TRPM8 channel associated factor 2 [Source:HGNC Symbol;Acc:HGNC:26878])

HSP 1 Score: 149.443 bits (376), Expect = 9.571e-37
Identity = 99/370 (26.76%), Postives = 178/370 (48.11%), Query Frame = 1
Query:  985 GLYVVPGKHVSVQITESN-SQSCRIFINFHLFNTINKEKLYKWPITKTEFIIKRNILETFAYPFGGLLSISCDANND--KVKITFINVVKVPVFDRRDKKDTKDWIQQ-QSVVSPWAVVSSDTLVFVLSSNAIRNLADPETFMRMYDSMVKEEFHLKGRSISTSYREIISTDIQITAGYMHAGYPIGTQIFWVTNPYNKKDYFFDKYNIEIDGEWGLMHELGHNLQEPIFTF-NGAGEVNNNIFTLVAIESMTNMSSWSPNDGWVSTKVKIKDLVKYLNNGT-FEEWKKTYYVALSIYAQLRNSFGWEFYSQVFRRYNELKNEIGSISDNEKIQLWIKTTSEISGMNLCPLYELWKWPISQKTEKELSKL 2076
            GLY++ G++  V ++E+  S   R+ I  H  +     KL + P+   +  + R    + +  +GGLL +     +    V +T    V  P + +  K   ++W +Q Q  ++PW  +++D ++  + +  ++ L DPE  +R++D M++    L          E I  D+QI+AG+MH+GYPI   +  V    N+ D       +   G WG +HELGHN Q   + F     E   N++++   E++  +     ++  +S   + + +  +L  G    +W    + AL  Y QL+ +FGWE ++Q+F  Y  L +      +  ++ LW+K  SE    NL P +E W WPI ++    L+ L
Sbjct:  444 GLYLLEGQNAEVSLSEAAASAGLRVQIGCHTDDLTKARKLSRAPVVTHQCWMDRTE-RSVSCLWGGLLYVIVPKGSQLGPVPVTIRGAVPAPYY-KLGKTSLEEWKRQMQENLAPWGELATDNIILTVPTTNLQALKDPEPVLRLWDEMMQAVARLAAEPFPFRRPERIVADVQISAGWMHSGYPIMCHLESVKEIINEMD-------MRSRGVWGPIHELGHNQQRHGWEFPPHTTEATCNLWSVYVHETVLGIPRAQAHEA-LSPPERERRIKAHLGKGAPLCDW--NVWTALETYLQLQEAFGWEPFTQLFAEYQTLSHL--PKDNTGRMNLWVKKFSEKVKKNLVPFFEAWGWPIQKEVADSLASL 799          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Human
Match: TCAF2 (TRPM8 channel associated factor 2 [Source:HGNC Symbol;Acc:HGNC:26878])

HSP 1 Score: 149.828 bits (377), Expect = 1.075e-36
Identity = 99/370 (26.76%), Postives = 178/370 (48.11%), Query Frame = 1
Query:  985 GLYVVPGKHVSVQITESN-SQSCRIFINFHLFNTINKEKLYKWPITKTEFIIKRNILETFAYPFGGLLSISCDANND--KVKITFINVVKVPVFDRRDKKDTKDWIQQ-QSVVSPWAVVSSDTLVFVLSSNAIRNLADPETFMRMYDSMVKEEFHLKGRSISTSYREIISTDIQITAGYMHAGYPIGTQIFWVTNPYNKKDYFFDKYNIEIDGEWGLMHELGHNLQEPIFTFNG-AGEVNNNIFTLVAIESMTNMSSWSPNDGWVSTKVKIKDLVKYLNNGT-FEEWKKTYYVALSIYAQLRNSFGWEFYSQVFRRYNELKNEIGSISDNEKIQLWIKTTSEISGMNLCPLYELWKWPISQKTEKELSKL 2076
            GLY++ G++  V ++E+  S   R+ I  H  +     KL + P+   +  + R    + +  +GGLL +     +    V +T    V  P + +  K   ++W +Q Q  ++PW  +++D ++  + +  ++ L DPE  +R++D M++    L          E I  D+QI+AG+MH+GYPI   +  V    N+ D       +   G WG +HELGHN Q   + F     E   N++++   E++  +     ++  +S   + + +  +L  G    +W    + AL  Y QL+ +FGWE ++Q+F  Y  L +      +  ++ LW+K  SE    NL P +E W WPI ++    L+ L
Sbjct:  548 GLYLLEGQNAEVSLSEAAASAGLRVQIGCHTDDLTKARKLSRAPVVTHQCWMDRTE-RSVSCLWGGLLYVIVPKGSQLGPVPVTIRGAVPAPYY-KLGKTSLEEWKRQMQENLAPWGELATDNIILTVPTTNLQALKDPEPVLRLWDEMMQAVARLAAEPFPFRRPERIVADVQISAGWMHSGYPIMCHLESVKEIINEMD-------MRSRGVWGPIHELGHNQQRHGWEFPPHTTEATCNLWSVYVHETVLGIPRAQAHEA-LSPPERERRIKAHLGKGAPLCDW--NVWTALETYLQLQEAFGWEPFTQLFAEYQTLSHL--PKDNTGRMNLWVKKFSEKVKKNLVPFFEAWGWPIQKEVADSLASL 903          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Human
Match: TCAF2C (TRPM8 channel associated factor 2C [Source:HGNC Symbol;Acc:HGNC:53641])

HSP 1 Score: 148.288 bits (373), Expect = 1.581e-36
Identity = 99/370 (26.76%), Postives = 178/370 (48.11%), Query Frame = 1
Query:  985 GLYVVPGKHVSVQITESN-SQSCRIFINFHLFNTINKEKLYKWPITKTEFIIKRNILETFAYPFGGLLSISCDANND--KVKITFINVVKVPVFDRRDKKDTKDWIQQ-QSVVSPWAVVSSDTLVFVLSSNAIRNLADPETFMRMYDSMVKEEFHLKGRSISTSYREIISTDIQITAGYMHAGYPIGTQIFWVTNPYNKKDYFFDKYNIEIDGEWGLMHELGHNLQEPIFTFNG-AGEVNNNIFTLVAIESMTNMSSWSPNDGWVSTKVKIKDLVKYLNNGT-FEEWKKTYYVALSIYAQLRNSFGWEFYSQVFRRYNELKNEIGSISDNEKIQLWIKTTSEISGMNLCPLYELWKWPISQKTEKELSKL 2076
            GLY++ G++  V ++E+  S   R+ I  H  +     KL + P+   +  + R    + +  +GGLL +     +    V +T    V  P + +  K   ++W +Q Q  ++PW  +++D ++  + +  ++ L DPE  +R++D M++    L          E I  D+QI+AG+MH+GYPI   +  V    N+ D       +   G WG +HELGHN Q   + F     E   N++++   E++  +     ++  +S   + + +  +L  G    +W    + AL  Y QL+ +FGWE ++Q+F  Y  L +      +  ++ LW+K  SE    NL P +E W WPI ++    L+ L
Sbjct:  341 GLYLLEGQNAEVSLSEAAASAGLRVQIGCHTDDLTKARKLSRAPVVTHQCWMDRTE-RSVSCLWGGLLYVIVPKGSQLGPVPVTIRGAVPAPYY-KLGKTSLEEWKRQMQENLAPWGELATDNIILTVPTTNLQALKDPEPVLRLWDEMMQAVARLAAEPFPFRRPERIVADVQISAGWMHSGYPIMCHLESVKEIINEMD-------MRSRGVWGPIHELGHNQQWHGWEFPPHTTEATCNLWSVYVHETVLGIPRAQAHEA-LSPPERERRIKAHLGKGAPLCDW--NVWTALETYLQLQQAFGWEPFTQLFAEYQTLSHL--PKDNTGRMNLWVKKFSEKVKKNLVPFFEAWGWPIQKEVADSLASL 696          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Human
Match: TCAF1 (TRPM8 channel associated factor 1 [Source:HGNC Symbol;Acc:HGNC:22201])

HSP 1 Score: 136.346 bits (342), Expect = 1.995e-32
Identity = 108/389 (27.76%), Postives = 182/389 (46.79%), Query Frame = 1
Query:  985 GLYVVPGKHV-SVQITESN-SQSCRIFINFHLFNTINKEKLYKWPITKTEFIIKRNILE----TFAYPFGGLLSISCDANN--DKVKITFINVVKVPVFDRRDKKDTKDWIQQ-QSVVSPWAVVSSDTLVFVLSSNAIRNLADPETFMRMYDSMVKEEFHLKGRSISTSYREIISTDIQITAGYMHAGYPIGTQIFWVTNPYNKKDYFFDKYNIEIDGEWGLMHELGHNLQEPIFTFNG-AGEVNNNIFTLVAIE-------SMTNMSSWSPNDGWVSTKVKIKDLVKYLNNG-TFEEWKKTYYVALSIYAQLRNSFGWEFYSQVFRRYNELKNEIGSISDN-EKIQLWIKTTSEISGMNLCPLYELWKWPISQKTEKELSKLQMFLPD 2094
            GLY+ PG+ +  V + E+  S   +I I  H  +     KL++ P+     +I R  L+    +    +GGLL I    N+    V +T    V  P + +  +   ++W ++ Q    PW  +++D ++  + +  +R L +PE  +R++D +++    L          + I  D+QI+ G+MHAGYPI   +  V    N+K        I   G WG +HELG N Q   + F     E   N++ +   E       S  N++ W P        V+ K +  YL+ G   + W    + AL  Y QL+ +FGWE + ++F  Y   +N+    ++N +K+ LW+K  S     NL P +E W WPI    +KE++    +LP+
Sbjct:  548 GLYI-PGRQIIEVSLPEAAASADLKIQIGCHTDDLTRASKLFRGPL-----VINRCCLDKPTKSITCLWGGLLYIIVPQNSKLGSVPVTVKGAVHAPYY-KLGETTLEEWKRRIQENPGPWGELATDNIILTVPTANLRTLENPEPLLRLWDEVMQAVARLGAEPFPLRLPQRIVADVQISVGWMHAGYPIMCHLESVQELINEK-------LIRTKGLWGPVHELGRNQQRQEWEFPPHTTEATCNLWCVYVHETVLGIPRSRANIALWPP--------VREKRVRIYLSKGPNVKNWNA--WTALETYLQLQEAFGWEPFIRLFTEY---RNQTNLPTENVDKMNLWVKMFSHQVQKNLAPFFEAWAWPI----QKEVATSLAYLPE 905          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-210b2.3 (si:ch211-210b2.3 [Source:ZFIN;Acc:ZDB-GENE-131122-13])

HSP 1 Score: 139.043 bits (349), Expect = 2.050e-33
Identity = 106/388 (27.32%), Postives = 183/388 (47.16%), Query Frame = 1
Query:  940 QMQLNLKYKDEVSQLGLYVVPGKHVSVQIT-ESNSQSCRIFINFHLFNTINKEKLYKWPITKTEFIIKRNILETFAYPFGGLLSISC--DANNDKVKITFINVVKVPVFDRRDKKDTKDWIQQ-QSVVSPWAVVSSDTLVFVLSSNAIRNLADPETFMRMYDSMVKEEFHLKGRSISTSYREIISTDIQITAGYMHAGYPIGTQIFWVTNPYNKKDYFFDKYNIEIDGEWGLMHELGHNLQEPIFTF-NGAGEVNNNIFTLVAIESM--TNMSSWSPNDGWVSTKVKIKDLVKYLNNGT-FEEWKKTYYVALSIYAQLRNSFGWEFYSQVFRRYNELKNEIGSISDNE-KIQLWIKTTSEISGMNLCPLYELWKWPISQKTEKELSKL 2076
            ++  N    +E    GLY+ PG    + I  E    + ++ +     N      L + P+    F +    ++     +GGL+      ++  D V+I     V+ P F +  +    DW+ + +   +PWA +  + LV  L S+ IRNL  P+   +++D++++    L         +E    D+QI+AG+MH+GYPI       +   N K+     +       WG +H+LGHN Q  ++ F     E   N++++   E +   N +   P     S + +IK+   Y + G  FE W    + AL  Y QL+  FGW+ + +VF  Y+++K+     +DN  K+ L+ KT S++   NL P +++W WPI   TE+ELS L
Sbjct:  530 RITANTADSEEWISTGLYLCPGMKTYITIPQEIIGTNWQVQLGCQTNNIGGSNVLKRAPVVHERFPLDSEKVQVCNL-WGGLIYFVAPPESKVDGVEIVVQTAVQAPYF-KSGETSVADWVGKIRQRPAPWAELEFENLVMTLPSDFIRNLERPDQVAKLWDAIMRSVSDLAATPAKFPRKERFVGDVQISAGFMHSGYPIMMLSSSASELLNVKEAHKHDF-------WGPLHKLGHNQQRKVWEFPPHTTECTCNLWSVYVHEKVLGVNKAKAHPCMTLQSRQERIKE---YFSGGKDFENWNT--WTALETYMQLQEKFGWDAFKKVFSLYHDMKD---VPNDNAGKMNLYAKTFSKVVNHNLSPFFKVWGWPIQPNTEQELSHL 900          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Zebrafish
Match: zgc:162193 (zgc:162193 [Source:NCBI gene;Acc:323315])

HSP 1 Score: 138.272 bits (347), Expect = 3.333e-33
Identity = 100/377 (26.53%), Postives = 174/377 (46.15%), Query Frame = 1
Query:  985 GLYVVPGKHVSVQIT-ESNSQSCRIFINFHLFNTINKEKLYKWPITKTEFIIKRNILETFAYPFGGLLSISCDANN--DKVKITFINVVKVPVFDRRDKKDTKDWIQQ-QSVVSPWAVVSSDTLVFVLSSNAIRNLADPETFMRMYDSMVKEEFHLKGRSISTSYREIISTDIQITAGYMHAGYPIGTQIFWVTNPYNKKDYFFDKYNIEIDGEWGLMHELGHNLQEPIFTF-NGAGEVNNNIFTL------VAIESMTNMSSWSPNDGWVSTKVKIKDLVKYLNNGT-FEEWKKTYYVALSIYAQLRNSFGWEFYSQVFRRYNELKNEIGSISDNE-KIQLWIKTTSEISGMNLCPLYELWKWPISQKTEKELSKL 2076
            GLY+ PG    + +  E   ++ ++ +     N      L + P+    F +   +++ +   +GGL+ +   +    D V+I     V+ P F +  +    DW+   +   +PWA +  + L+    S  IRNL  P+   +++D++++    L  R      +E    D+QI+ G+MHAGYPI           N ++ +         G WG +HELGHN Q  ++ F     E   N+++L        I+S     + +P D    TK+       Y + G     W    ++AL  Y QL+  FGW+ + +VF  Y+++    G  +DN  K+ L+ +T S++  +NL P ++ W WPI   TE+ LS L
Sbjct:  545 GLYLSPGMKTYIAVPPEIVGKNWQVQLGCQTDNIGGSNTLKRAPVVHARFPLDSEMVQVWNL-WGGLIYLIAPSQTKVDGVEIVVQTAVQAPYF-KSGETSVADWVSHIRQAPAPWAELEFENLIMTFDSAFIRNLDRPDEVAKLWDTIMRTITDLAARPPKLPRKERFVADVQISYGFMHAGYPIMMHSGSAPGLVNVEEAY-------KCGLWGAIHELGHNQQRGVWEFPPHTTECTCNLWSLYVHEQVFGIKSANAHPAITPADRQARTKM-------YFDGGKDLNSW--CMWMALETYMQLQEKFGWDAFKKVFSLYHDM---TGVPNDNAGKMNLYAQTFSKVVNLNLSPFFKAWGWPIQPNTEQNLSHL 900          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Zebrafish
Match: zgc:162193 (zgc:162193 [Source:NCBI gene;Acc:323315])

HSP 1 Score: 138.272 bits (347), Expect = 3.333e-33
Identity = 100/377 (26.53%), Postives = 174/377 (46.15%), Query Frame = 1
Query:  985 GLYVVPGKHVSVQIT-ESNSQSCRIFINFHLFNTINKEKLYKWPITKTEFIIKRNILETFAYPFGGLLSISCDANN--DKVKITFINVVKVPVFDRRDKKDTKDWIQQ-QSVVSPWAVVSSDTLVFVLSSNAIRNLADPETFMRMYDSMVKEEFHLKGRSISTSYREIISTDIQITAGYMHAGYPIGTQIFWVTNPYNKKDYFFDKYNIEIDGEWGLMHELGHNLQEPIFTF-NGAGEVNNNIFTL------VAIESMTNMSSWSPNDGWVSTKVKIKDLVKYLNNGT-FEEWKKTYYVALSIYAQLRNSFGWEFYSQVFRRYNELKNEIGSISDNE-KIQLWIKTTSEISGMNLCPLYELWKWPISQKTEKELSKL 2076
            GLY+ PG    + +  E   ++ ++ +     N      L + P+    F +   +++ +   +GGL+ +   +    D V+I     V+ P F +  +    DW+   +   +PWA +  + L+    S  IRNL  P+   +++D++++    L  R      +E    D+QI+ G+MHAGYPI           N ++ +         G WG +HELGHN Q  ++ F     E   N+++L        I+S     + +P D    TK+       Y + G     W    ++AL  Y QL+  FGW+ + +VF  Y+++    G  +DN  K+ L+ +T S++  +NL P ++ W WPI   TE+ LS L
Sbjct:  545 GLYLSPGMKTYIAVPPEIVGKNWQVQLGCQTDNIGGSNTLKRAPVVHARFPLDSEMVQVWNL-WGGLIYLIAPSQTKVDGVEIVVQTAVQAPYF-KSGETSVADWVSHIRQAPAPWAELEFENLIMTFDSAFIRNLDRPDEVAKLWDTIMRTITDLAARPPKLPRKERFVADVQISYGFMHAGYPIMMHSGSAPGLVNVEEAY-------KCGLWGAIHELGHNQQRGVWEFPPHTTECTCNLWSLYVHEQVFGIKSANAHPAITPADRQARTKM-------YFDGGKDLNSW--CMWMALETYMQLQEKFGWDAFKKVFSLYHDM---TGVPNDNAGKMNLYAQTFSKVVNLNLSPFFKAWGWPIQPNTEQNLSHL 900          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Zebrafish
Match: zgc:162193 (zgc:162193 [Source:NCBI gene;Acc:323315])

HSP 1 Score: 138.272 bits (347), Expect = 3.333e-33
Identity = 100/377 (26.53%), Postives = 174/377 (46.15%), Query Frame = 1
Query:  985 GLYVVPGKHVSVQIT-ESNSQSCRIFINFHLFNTINKEKLYKWPITKTEFIIKRNILETFAYPFGGLLSISCDANN--DKVKITFINVVKVPVFDRRDKKDTKDWIQQ-QSVVSPWAVVSSDTLVFVLSSNAIRNLADPETFMRMYDSMVKEEFHLKGRSISTSYREIISTDIQITAGYMHAGYPIGTQIFWVTNPYNKKDYFFDKYNIEIDGEWGLMHELGHNLQEPIFTF-NGAGEVNNNIFTL------VAIESMTNMSSWSPNDGWVSTKVKIKDLVKYLNNGT-FEEWKKTYYVALSIYAQLRNSFGWEFYSQVFRRYNELKNEIGSISDNE-KIQLWIKTTSEISGMNLCPLYELWKWPISQKTEKELSKL 2076
            GLY+ PG    + +  E   ++ ++ +     N      L + P+    F +   +++ +   +GGL+ +   +    D V+I     V+ P F +  +    DW+   +   +PWA +  + L+    S  IRNL  P+   +++D++++    L  R      +E    D+QI+ G+MHAGYPI           N ++ +         G WG +HELGHN Q  ++ F     E   N+++L        I+S     + +P D    TK+       Y + G     W    ++AL  Y QL+  FGW+ + +VF  Y+++    G  +DN  K+ L+ +T S++  +NL P ++ W WPI   TE+ LS L
Sbjct:  545 GLYLSPGMKTYIAVPPEIVGKNWQVQLGCQTDNIGGSNTLKRAPVVHARFPLDSEMVQVWNL-WGGLIYLIAPSQTKVDGVEIVVQTAVQAPYF-KSGETSVADWVSHIRQAPAPWAELEFENLIMTFDSAFIRNLDRPDEVAKLWDTIMRTITDLAARPPKLPRKERFVADVQISYGFMHAGYPIMMHSGSAPGLVNVEEAY-------KCGLWGAIHELGHNQQRGVWEFPPHTTECTCNLWSLYVHEQVFGIKSANAHPAITPADRQARTKM-------YFDGGKDLNSW--CMWMALETYMQLQEKFGWDAFKKVFSLYHDM---TGVPNDNAGKMNLYAQTFSKVVNLNLSPFFKAWGWPIQPNTEQNLSHL 900          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-210b2.2 (si:ch211-210b2.2 [Source:ZFIN;Acc:ZDB-GENE-131118-33])

HSP 1 Score: 137.887 bits (346), Expect = 4.841e-33
Identity = 107/388 (27.58%), Postives = 180/388 (46.39%), Query Frame = 1
Query:  940 QMQLNLKYKDEVSQLGLYVVPGKHVSVQIT-ESNSQSCRIFINFHLFNTINKEKLYKWPITKTEFIIKRNILETFAYPFGGLLSISC--DANNDKVKITFINVVKVPVFDRRDKKDTKDWIQQ-QSVVSPWAVVSSDTLVFVLSSNAIRNLADPETFMRMYDSMVKEEFHLKGRSISTSYREIISTDIQITAGYMHAGYPIGTQIFWVTNPYNKKDYFFDKYNIEIDGEWGLMHELGHNLQEPIFTF-NGAGEVNNNIFTLVAIESM--TNMSSWSPNDGWVSTKVKIKDLVKYLNNGT-FEEWKKTYYVALSIYAQLRNSFGWEFYSQVFRRYNELKNEIGSISDNE-KIQLWIKTTSEISGMNLCPLYELWKWPISQKTEKELSKL 2076
            ++  N    +E    GLY+ PG    + I  E      ++ +     N      L + P+    F +    ++     +GGL+      ++  D V+I     V+ P F +  +    DW+ + +   +PWA +  + LV  L S+ IRNL  P+   +++D++++    L         +E    D+QI+AG+MH+GYPI       +   N K+     +       WG +HELGHN Q  ++ F     E   N++++   E +   N +   P     S +  IK   KY + G   + W K    AL  Y QL+  FGW+ + +VF  Y+++K+     +DN  K+ L+ KT S++   NL P +++W WPI   TE+ELS L
Sbjct:  526 RITANTADSEEWISTGLYLSPGMKTYITIPPEIIGTKWQVQLGCQTDNIGGSNVLKRAPVVHERFPLDSEKVQVCNL-WGGLIYFVAPPESKVDGVEIVVQTAVQAPYF-KSGETSVADWVGKIRQRPAPWAELEFENLVMTLPSDFIRNLERPDEVAKLWDAIMRSVSDLAATPAKFRRKERFVGDVQISAGFMHSGYPIMMLSSSASQLLNVKEAHKHDF-------WGPLHELGHNQQRKVWEFPPHTTECTCNLWSVYVHEKVLGVNKAKAHPCMTLESRQACIK---KYFSGGKDLKNWTKA--TALETYMQLQEKFGWDAFKKVFSLYHDMKD---VPNDNAGKMNLYAKTFSKVVNHNLSPFFKVWGWPIQPNTEQELSHL 896          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000045101.1 (TRPM8 channel-associated factor 2 [Source:NCBI gene;Acc:100170200])

HSP 1 Score: 154.836 bits (390), Expect = 2.231e-38
Identity = 108/377 (28.65%), Postives = 182/377 (48.28%), Query Frame = 1
Query:  985 GLYVVPGK-HVSVQITESNSQSCRIFINFHLFNTINKEKLYKWPITKTEFIIKRNILETFAYPFGGLLSISCD--ANNDKVKITFINVVKVPVFDRRDKKDTKDWIQQ-QSVVSPWAVVSSDTLVFVLSSNAIRNLADPETFMRMYDSMVKEEFHLKGRSISTSYREIISTDIQITAGYMHAGYPIGTQIFWVTNPYNKKDYFFDKYNIEIDGEWGLMHELGHNLQEPIFTF-NGAGEVNNNIFTLVAIESMTNMSSWSPNDGWVSTKVKIKDLVKYLNNGT-FEEWKKTYYVALSIYAQLRNSFGWEFYSQVFRRYNELKNEIGSISDNE-KIQLWIKTTSEISGMNLCPLYELWKWPISQKTEKELSKLQMFLPD 2094
            GLY+ P K  V V    +  Q  ++ +  H  +  +K++ Y+ PI   +  + R  ++   Y +GGLL I     +N   + +        P +  + K     W+Q  + +  PWA + ++ ++  + S+AIR+L DPE  +  +D M+     L     + S  E I  D+QI+AG+MHAGYP+   +  V        Y  +   ++ +G WG +HELGHN Q+ ++ F     E   N++++   E++  +     N   +    +   +  YL  G   E W    + AL  Y QL+  FGWE + Q+F+ Y  +    G  +DN+ K+ LW +  SE    NL P +E W WPI ++T  +LS L ++  D
Sbjct:  533 GLYLSPKKTAVLVFPASAVQQGLQVQVGCHSDDLGSKDEFYRAPIVVRKISVHREKVQVSCY-WGGLLYIIVKERSNLGTIPVQVYGAEPAPTY-IKGKTSLDSWLQSLRDLPPPWAELITENIILTVPSDAIRSLNDPEELLGFWDRMMVAITELAAIPTTFSRPERIVADVQISAGWMHAGYPVMVHLASV-------KYLTNLSCMQKEGLWGPIHELGHNQQQKVWEFPPHTTEATCNLWSVFVNETVVGVPRDKANSA-LEPASRAACIEAYLKTGPKLENW--NVWTALETYLQLQEGFGWEPFKQLFKDYQSMS---GISNDNKSKMNLWAEKFSEAVQTNLIPFFEAWGWPIEEETRSKLSALPVWEKD 894          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000002244.1 (TRPM8 channel-associated factor homolog [Source:NCBI gene;Acc:100489234])

HSP 1 Score: 149.058 bits (375), Expect = 1.523e-36
Identity = 104/391 (26.60%), Postives = 185/391 (47.31%), Query Frame = 1
Query:  985 GLYVVPGKHVSVQITESN-SQSCRIFINFHLFNTINKEKLYKWPITKTEFIIKRNILETFAYPFGGLLSISCDANND--KVKITFINVVKVPVFDRRDKKDTKDWIQQ-QSVVSPWAVVSSDTLVFVLSSNAIRNLADPETFMRMYDSMVKEEFHLKGRSISTSYREIISTDIQITAGYMHAGYPIGTQIFWVTNPYNKKDYFFDKYNIEIDGEWGLMHELGHNLQEPIFTF-NGAGEVNNNIFTLVAIESMTNMSSWSPND---GWVSTKVKIKDLVKYLNNGT-FEEWKKTYYVALSIYAQLRNSFGWEFYSQVFR--RYNELKNEIGSISDNEKIQLWIKTTSEISGMNLCPLYELWKWPISQKTEKELSKLQMFLPDDFLTKMIEKR 2124
            GLY+ P K V ++   S   Q  ++ +  H  +   KE L + P+      + R  +   ++ +GGLL I   +N++   V +        P++ +  K     W+   + + +PWA + ++ ++  + S+A+R+L +PE  + ++D ++     L  +       E I  D+QI+AG+MHAGYPI   +              D +++E +G WG +HELGHN Q+  + F     E   N++ +   E++  +    P D   G +   V+   +  YL NG   E+W    + AL  Y QL+   GW+ + +++R    + + NE     +  K+ LW +  S  +  NL P +E W WPI Q T  +LS L ++  D     +  K+
Sbjct:  511 GLYLPPRKAVVIEFPASAVQQGFQVQVGCHSDDPSAKETLNRAPVVVRRIHVDRQKVPVSSF-WGGLLYIIVRSNSNFGTVPVRVYGAEPAPIYIK-GKTSLDSWLHSIRQLPAPWAELVTENIILTVPSDAVRSLKNPEALLSLWDRIMAAIADLAAKPKKFPRPERIVADVQISAGWMHAGYPIMCDL-------ESAKELTDLHHMEKEGIWGPIHELGHNQQKTQWEFPPHTTEATCNLWAVYVHETVLGI----PRDRAHGNLQPNVRTSRIKSYLQNGANLEQWDG--WTALETYLQLQEGLGWDPFRRLYRDPSISGMSNE-----NTFKMNLWAEKFSRAAQTNLVPFFEAWGWPIDQSTRSKLSALPVWEKDPMKPYVTAKK 881          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000045059.1 (TRPM8 channel-associated factor 2 [Source:NCBI gene;Acc:100170200])

HSP 1 Score: 146.362 bits (368), Expect = 1.231e-35
Identity = 103/377 (27.32%), Postives = 185/377 (49.07%), Query Frame = 1
Query:  985 GLYVVPGKHVSVQITESN-SQSCRIFINFHLFNTINKEKLYKWPITKTEFIIKRNILETFAYPFGGLLSISCDANNDK--VKITFINVVKVPVFDRRDKKDTKDWIQQ-QSVVSPWAVVSSDTLVFVLSSNAIRNLADPETFMRMYDSMVKEEFHLKGRSISTSYREIISTDIQITAGYMHAGYPIGTQIFWVTNPYNKKDYFFDKYNIEIDGEWGLMHELGHNLQEPIFTFN-GAGEVNNNIFTLVAIESMTNMSSWSPNDGWVSTKVKIKDLVKYLNNGT-FEEWKKTYYVALSIYAQLRNSFGWEFYSQVFRRYNELKNEIGSISDNE-KIQLWIKTTSEISGMNLCPLYELWKWPISQKTEKELSKLQMFLPD 2094
            GLY+ P K   ++   S   Q  ++ +     +  + EK  + P+   +  + R  +    + +GGLL I   AN++   + +        PV+  + K +   W+Q  + + +PWA + ++ ++  + S+AIR+L+DPE  + ++D ++     L     +    E    D+QI+AG+MHAGYPI   +              D   ++  G WG +HELGHN Q+  + F     E   N++++   E++  +   +   G +  + +   + +Y+ NG+  E+W    + AL  Y QL+  FGWE + Q+F+ Y  +    G  +DN+ K+ LW +  SE    NL P +E W WPI ++T  +LS L ++  D
Sbjct:  533 GLYLAPRKTAVLEFPASVVQQGLKVQVGCQADDLSSAEKYCRAPVVVRKCHVDRQKVSVSCF-WGGLLYIIVKANSNLGIIPVKVYGAEPAPVY-IKGKTNLDSWLQSVRYLPAPWAELITENIILTVPSDAIRSLSDPEALLSLWDKIMVSITELAAIPKTFPRPERFVADVQISAGWMHAGYPIMCHL-------ESAKELTDLNVMQTVGIWGPIHELGHNQQKINWEFPPHTTEATCNLWSVYVHETVLGIPR-NKAHGSLQPETRACYIQEYVKNGSNLEQWD--VWTALETYLQLQEGFGWEPFKQLFKDYQSMS---GISNDNKSKMNLWAEKFSEAVQTNLIPFFEAWGWPIEEETRSKLSALPVWEKD 894          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000045084.1 (TRPM8 channel-associated factor 2 [Source:NCBI gene;Acc:100170200])

HSP 1 Score: 143.28 bits (360), Expect = 1.122e-34
Identity = 102/377 (27.06%), Postives = 184/377 (48.81%), Query Frame = 1
Query:  985 GLYVVPGKHVSVQITESN-SQSCRIFINFHLFNTINKEKLYKWPITKTEFIIKRNILETFAYPFGGLLSISCDANNDK--VKITFINVVKVPVFDRRDKKDTKDWIQQ-QSVVSPWAVVSSDTLVFVLSSNAIRNLADPETFMRMYDSMVKEEFHLKGRSISTSYREIISTDIQITAGYMHAGYPIGTQIFWVTNPYNKKDYFFDKYNIEIDGEWGLMHELGHNLQEPIFTFN-GAGEVNNNIFTLVAIESMTNMSSWSPNDGWVSTKVKIKDLVKYLNNGT-FEEWKKTYYVALSIYAQLRNSFGWEFYSQVFRRYNELKNEIGSISDNE-KIQLWIKTTSEISGMNLCPLYELWKWPISQKTEKELSKLQMFLPD 2094
            GLY+ P K   ++   S   Q  ++ +     +  + EK  + P+   +  + R  +    + +GGLL I   AN++   + +        PV+  + K +   W+Q  + + +PWA + ++ ++  + S+AIR+L+DPE  + ++D ++     L     +    E    D+QI+AG+MHAGYPI   +              D   ++  G WG +HELGHN Q+  + F     E   N++++   E++  +   +   G +  + +   + +Y+ NG+  E+W    + AL  Y QL+  FGWE + ++F+ Y  +    G  +DN+ K+ LW +  SE    NL P +E W WPI + T  +LS L ++  D
Sbjct:  533 GLYLAPRKTAVLEFPASVVQQGLKVQVGCQADDLSSAEKYCRAPVVVRKCHVDRQKVSVSCF-WGGLLYIIVKANSNLGIIPVKVYGAEPAPVY-IKGKTNLDSWLQSVRYLPAPWAELITENIILTVPSDAIRSLSDPEALLSLWDKIMVSITELAAIPKTFPRPERFVADVQISAGWMHAGYPIMCHL-------ESAKELTDLNVMQTVGIWGPIHELGHNQQKINWEFPPHTTEATCNLWSVYVHETVLGIPR-NKAHGSLQPETRACYIQEYVKNGSNLEQWD--VWTALETYLQLQEGFGWEPFKRLFKDYQSMS---GISNDNKSKMNLWAEKFSEAVQTNLIPFFEAWGWPIEEATRIKLSALPVWEKD 894          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000045039.1 (TRPM8 channel-associated factor 2 [Source:NCBI gene;Acc:100170200])

HSP 1 Score: 142.51 bits (358), Expect = 2.301e-34
Identity = 102/377 (27.06%), Postives = 184/377 (48.81%), Query Frame = 1
Query:  985 GLYVVPGKHVSVQITESN-SQSCRIFINFHLFNTINKEKLYKWPITKTEFIIKRNILETFAYPFGGLLSISCDANNDK--VKITFINVVKVPVFDRRDKKDTKDWIQQ-QSVVSPWAVVSSDTLVFVLSSNAIRNLADPETFMRMYDSMVKEEFHLKGRSISTSYREIISTDIQITAGYMHAGYPIGTQIFWVTNPYNKKDYFFDKYNIEIDGEWGLMHELGHNLQEPIFTFN-GAGEVNNNIFTLVAIESMTNMSSWSPNDGWVSTKVKIKDLVKYLNNGT-FEEWKKTYYVALSIYAQLRNSFGWEFYSQVFRRYNELKNEIGSISDNE-KIQLWIKTTSEISGMNLCPLYELWKWPISQKTEKELSKLQMFLPD 2094
            GLY+ P K   ++   S   Q  ++ +     +  + EK  + P+   +  + R  +    + +GGLL I   AN++   + +        PV+  + K +   W+Q  + + +PWA + ++ ++  + S+AIR+L+DPE  + ++D ++     L     +    E    D+QI+AG+MHAGYPI   +              D   ++  G WG +HELGHN Q+  + F     E   N++++   E++  +   +   G +  + +   + +Y+ NG+  E+W    + AL  Y QL+  FGWE + ++F+ Y  +    G  +DN+ K+ LW +  SE    NL P +E W WPI + T  +LS L ++  D
Sbjct:  533 GLYLAPRKTAVLEFPASVVQQGLKVQVGCQADDLSSAEKYCRAPVVVRKCHVDRQKVSVSCF-WGGLLYIIVKANSNLGIIPVKVYGAEPAPVY-IKGKTNLDSWLQSVRYLPAPWAELITENIILTVPSDAIRSLSDPEALLSLWDKIMVSITELAAIPKTFPRPERFVADVQISAGWMHAGYPIMCHL-------ESAKELTDLNVMQTVGIWGPIHELGHNQQKINWEFPPHTTEATCNLWSVYVHETVLGIPR-NKAHGSLQPETRACYIQEYVKNGSNLEQWD--VWTALETYLQLQEGFGWEPFKRLFKDYQSMS---GISNDNKSKMNLWAEKFSEAVQTNLIPFFEAWGWPIEEATRIKLSVLPVWEKD 894          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Mouse
Match: Tcaf1 (TRPM8 channel-associated factor 1 [Source:MGI Symbol;Acc:MGI:1914665])

HSP 1 Score: 147.132 bits (370), Expect = 5.739e-36
Identity = 113/389 (29.05%), Postives = 183/389 (47.04%), Query Frame = 1
Query:  985 GLYVVPGKHV-SVQITESN-SQSCRIFINFHLFNTINKEKLYKWPITKTEFIIKRNILE----TFAYPFGGLLSISCDANN--DKVKITFINVVKVPVFDRRDKKDTKDWIQQQ-SVVSPWAVVSSDTLVFVLSSNAIRNLADPETFMRMYDSMVKEEFHLKGRSISTSYREIISTDIQITAGYMHAGYPIGTQIFWVTNPYNKKDYFFDKYNIEIDGEWGLMHELGHNLQEPIFTFNG-AGEVNNNIFTLVAIE-------SMTNMSSWSPNDGWVSTKVKIKDLVKYLNNG-TFEEWKKTYYVALSIYAQLRNSFGWEFYSQVFRRYNELKNEIGSISDN-EKIQLWIKTTSEISGMNLCPLYELWKWPISQKTEKELSKLQMFLPD 2094
            GLY+ PG+ V  V + ES  S   +I I  H  +     KL++ P+     +I R  L+    +    +GGLL I    N+    V +T    V+ P F +  +   ++W ++      PW  +++D ++  + +  +R L +PE  +R++D M++    L G +      + I  D+QI+ G+MHAGYPI   +  V    N+K        I   G WG +HELG N Q   + F     E   N++ +   E       S  N++ W P        V+ K +  YL+ G + + W    + AL  Y QL+ +FGWE + ++F  Y          SDN +K+ LW+K  S+    NL P +E W WPI    +KE++    +LP+
Sbjct:  548 GLYI-PGRQVIDVSVPESAASADLKIQIGCHTDDLTRASKLFRGPL-----VINRCCLDKPTKSITCLWGGLLYIIVPQNSKLGSVPLTVKGAVRAP-FYKLGETSKEEWKRRLLEYPGPWGELATDNIILTVPTANLRTLENPEPLLRLWDEMMQAVAKLGGETFPLRLPQRIVADVQISVGWMHAGYPIMCHLESVQELINEK-------LIRTKGLWGPVHELGRNQQRQEWEFPPHTTEATCNLWCVYVHETVLGIPRSRANIALWPP--------VREKRVRIYLSKGPSVKHWNA--WTALETYLQLQEAFGWEPFIRLFTEYRNQTTSSSPPSDNVDKMNLWVKMFSQQVQRNLAPFFEAWGWPI----QKEVATSLAYLPE 908          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Mouse
Match: Tcaf1 (TRPM8 channel-associated factor 1 [Source:MGI Symbol;Acc:MGI:1914665])

HSP 1 Score: 147.132 bits (370), Expect = 5.739e-36
Identity = 113/389 (29.05%), Postives = 183/389 (47.04%), Query Frame = 1
Query:  985 GLYVVPGKHV-SVQITESN-SQSCRIFINFHLFNTINKEKLYKWPITKTEFIIKRNILE----TFAYPFGGLLSISCDANN--DKVKITFINVVKVPVFDRRDKKDTKDWIQQQ-SVVSPWAVVSSDTLVFVLSSNAIRNLADPETFMRMYDSMVKEEFHLKGRSISTSYREIISTDIQITAGYMHAGYPIGTQIFWVTNPYNKKDYFFDKYNIEIDGEWGLMHELGHNLQEPIFTFNG-AGEVNNNIFTLVAIE-------SMTNMSSWSPNDGWVSTKVKIKDLVKYLNNG-TFEEWKKTYYVALSIYAQLRNSFGWEFYSQVFRRYNELKNEIGSISDN-EKIQLWIKTTSEISGMNLCPLYELWKWPISQKTEKELSKLQMFLPD 2094
            GLY+ PG+ V  V + ES  S   +I I  H  +     KL++ P+     +I R  L+    +    +GGLL I    N+    V +T    V+ P F +  +   ++W ++      PW  +++D ++  + +  +R L +PE  +R++D M++    L G +      + I  D+QI+ G+MHAGYPI   +  V    N+K        I   G WG +HELG N Q   + F     E   N++ +   E       S  N++ W P        V+ K +  YL+ G + + W    + AL  Y QL+ +FGWE + ++F  Y          SDN +K+ LW+K  S+    NL P +E W WPI    +KE++    +LP+
Sbjct:  548 GLYI-PGRQVIDVSVPESAASADLKIQIGCHTDDLTRASKLFRGPL-----VINRCCLDKPTKSITCLWGGLLYIIVPQNSKLGSVPLTVKGAVRAP-FYKLGETSKEEWKRRLLEYPGPWGELATDNIILTVPTANLRTLENPEPLLRLWDEMMQAVAKLGGETFPLRLPQRIVADVQISVGWMHAGYPIMCHLESVQELINEK-------LIRTKGLWGPVHELGRNQQRQEWEFPPHTTEATCNLWCVYVHETVLGIPRSRANIALWPP--------VREKRVRIYLSKGPSVKHWNA--WTALETYLQLQEAFGWEPFIRLFTEYRNQTTSSSPPSDNVDKMNLWVKMFSQQVQRNLAPFFEAWGWPI----QKEVATSLAYLPE 908          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Mouse
Match: Tcaf1 (TRPM8 channel-associated factor 1 [Source:MGI Symbol;Acc:MGI:1914665])

HSP 1 Score: 147.132 bits (370), Expect = 5.739e-36
Identity = 113/389 (29.05%), Postives = 183/389 (47.04%), Query Frame = 1
Query:  985 GLYVVPGKHV-SVQITESN-SQSCRIFINFHLFNTINKEKLYKWPITKTEFIIKRNILE----TFAYPFGGLLSISCDANN--DKVKITFINVVKVPVFDRRDKKDTKDWIQQQ-SVVSPWAVVSSDTLVFVLSSNAIRNLADPETFMRMYDSMVKEEFHLKGRSISTSYREIISTDIQITAGYMHAGYPIGTQIFWVTNPYNKKDYFFDKYNIEIDGEWGLMHELGHNLQEPIFTFNG-AGEVNNNIFTLVAIE-------SMTNMSSWSPNDGWVSTKVKIKDLVKYLNNG-TFEEWKKTYYVALSIYAQLRNSFGWEFYSQVFRRYNELKNEIGSISDN-EKIQLWIKTTSEISGMNLCPLYELWKWPISQKTEKELSKLQMFLPD 2094
            GLY+ PG+ V  V + ES  S   +I I  H  +     KL++ P+     +I R  L+    +    +GGLL I    N+    V +T    V+ P F +  +   ++W ++      PW  +++D ++  + +  +R L +PE  +R++D M++    L G +      + I  D+QI+ G+MHAGYPI   +  V    N+K        I   G WG +HELG N Q   + F     E   N++ +   E       S  N++ W P        V+ K +  YL+ G + + W    + AL  Y QL+ +FGWE + ++F  Y          SDN +K+ LW+K  S+    NL P +E W WPI    +KE++    +LP+
Sbjct:  548 GLYI-PGRQVIDVSVPESAASADLKIQIGCHTDDLTRASKLFRGPL-----VINRCCLDKPTKSITCLWGGLLYIIVPQNSKLGSVPLTVKGAVRAP-FYKLGETSKEEWKRRLLEYPGPWGELATDNIILTVPTANLRTLENPEPLLRLWDEMMQAVAKLGGETFPLRLPQRIVADVQISVGWMHAGYPIMCHLESVQELINEK-------LIRTKGLWGPVHELGRNQQRQEWEFPPHTTEATCNLWCVYVHETVLGIPRSRANIALWPP--------VREKRVRIYLSKGPSVKHWNA--WTALETYLQLQEAFGWEPFIRLFTEYRNQTTSSSPPSDNVDKMNLWVKMFSQQVQRNLAPFFEAWGWPI----QKEVATSLAYLPE 908          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Mouse
Match: Tcaf3 (TRPM8 channel-associated factor 3 [Source:MGI Symbol;Acc:MGI:3042585])

HSP 1 Score: 142.895 bits (359), Expect = 1.146e-34
Identity = 106/371 (28.57%), Postives = 175/371 (47.17%), Query Frame = 1
Query:  985 GLYVVPGKHVSVQI-TESNSQSCRIFINFHLFNTINKEKLYKWPITKTEFIIKRNILETFAYPFGGLLSISCDA--NNDKVKITFINVVKVPVFDRRDKKDTKDWIQQ-QSVVSPWAVVSSDTLVFVLSSNAIRNLADPETFMRMYDSMVKEEFHLKGRSISTSYREIISTDIQITAGYMHAGYPIGTQIFWVTNPYNKKDYFFDKYNIEIDGEWGLMHELGHNLQEPIFTF-NGAGEVNNNIFTLVAIESMTNMSSWSPNDGWVSTKVKIKDLVKYLNNGT-FEEWKKTYYVALSIYAQLRNSFGWEFYSQVFRRYNELKNEIGSISDNE-KIQLWIKTTSEISGMNLCPLYELWKWPISQKTEKELSKL 2076
            GLY+  G+   V + +E+     ++ I  H  N I++ + Y  P   T      +   + ++ +GGLL I      N D V +T    V  P F R  K   ++W        +PW  +++D ++  + +  ++ L DP   ++++D MV+    L  R       E +  D QI+ G++H+GYPI   I  V       +    ++ I   G WG++HELGHN Q+  +TF     E   N++T+   E++ N+     +   ++ +++ + +  +LN G     W    + AL  Y QL+  FGWE + QVF  Y  L    G   +NE K+ LW+K  SE    NL P +E W WP+     K L+ L
Sbjct:  539 GLYLPEGQVAQVLLPSEATHAKLKVLIGCHRDN-ISQARTYFRPPVMTYVYHLTSSQTSISWLYGGLLYIMVPNKYNQDNVSVTIRGAVSAPYF-RLGKTTQEEWKNLITHSKAPWGELATDNIILTIPTVNLKELQDPYPLLQLWDKMVRAVAKLAARPFPFQRAERVVLDKQISFGFLHSGYPIMGLISIV-------EGIISEFKIRSHGIWGVIHELGHNHQKSGWTFPPHTTEALCNLWTIYVHETVLNIPREQAHPS-LNPELRRQRIKYHLNKGAPLSNW--IMWTALETYLQLQEGFGWEPFIQVFADYRTLS---GLPQNNEDKMNLWVKKFSEAVHKNLAPFFEAWGWPVKYAVAKSLASL 894          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Mouse
Match: Tcaf2 (TRPM8 channel-associated factor 2 [Source:MGI Symbol;Acc:MGI:2385258])

HSP 1 Score: 133.265 bits (334), Expect = 1.257e-31
Identity = 96/371 (25.88%), Postives = 174/371 (46.90%), Query Frame = 1
Query:  985 GLYVVPGKHVSVQITE-SNSQSCRIFINFHLFNTINKEKLYKWPITKTEFIIKRNILETFAYPFGGLLSI----SCDANNDKVKITFINVVKVPVFDRRDKKDTKDWIQQ-QSVVSPWAVVSSDTLVFVLSSNAIRNLADPETFMRMYDSMVKEEFHLKGRSISTSYREIISTDIQITAGYMHAGYPIGTQIFWVTNPYNKKDYFFDKYNIEIDGEWGLMHELGHNLQEPIFTFNG-AGEVNNNIFTLVAIESMTNMSSWSPNDGWVSTKVKIKDLVKYLNNGT-FEEWKKTYYVALSIYAQLRNSFGWEFYSQVFRRYNELKNEIGSISDNE-KIQLWIKTTSEISGMNLCPLYELWKWPISQKTEKELS 2070
            GLY++ G+   + ++E + S   ++ I  H  +     KL++ P+   +  + R    + +  +GGLL I     C      V +T  N V  P + +  K   ++W    Q  + PW  +++D ++  + + +++ L +PE  ++++D M++    L  +       E I  D+Q++AG+MH+GYPI   +  V              NI   G WG +HELGHN Q   + F     E   N++++   E++  +     +   +  + + K + ++L  G   + W    + AL  Y QL+  FGWE +  +F  Y  +        DNE K+ +W+K  SE    NL P +E W WPI +   ++L+
Sbjct:  549 GLYLLEGQSTEISVSEPAASAGLKVQIGCHTDDLTFAIKLFRAPVVTYQCCMNRT-QRSVSCLWGGLLYIIVPKGCQLG--PVSVTITNAVPAPYY-KLGKTSLEEWKSCIQKNLGPWGELATDNVILTVPTASLKTLENPEPLLQLWDEMMQAVARLASQPFPFQRPERIVADVQLSAGWMHSGYPIMCHMESVQE-------LVSLANIRSKGLWGPIHELGHNQQCRGWEFPPHTTEATCNLWSVYVHETVLGIPRAQAHPQ-LKPEEREKRIKEHLQKGAPLQNWN--VWTALETYLQLQEVFGWEPFITLFAEYQTI---FYIPEDNECKMNIWLKLFSEKVQKNLVPFFEAWGWPIQKDVAEDLA 902          
BLAST of Peptidase M60 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6P6V7|TCAF3_RAT (TRPM8 channel-associated factor 3 OS=Rattus norvegicus OX=10116 GN=Tcaf3 PE=2 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 9.831e-37
Identity = 112/373 (30.03%), Postives = 178/373 (47.72%), Query Frame = 1
Query:  985 GLYVVPGKHVSVQI-TESNSQSCRIFINFHLFNTINKEKLYKWPITKTEFIIKRNILETFAYPFGGLLSISCDA--NNDKVKITFINVVKVPVFDRRDKKDTKDWIQQ-QSVVSPWAVVSSDTLVFVLSSNAIRNLADPETFMRMYDSMVKEEFHLKGRSISTSYREIISTDIQITAGYMHAGYPIGTQIFWVTNPYNKKDYFFDKYNIEIDGEWGLMHELGHNLQEPIFTFN-GAGEVNNNIFTLVAIESMTNM--SSWSPNDGWVSTKVKIKDLVKYLNNGT-FEEWKKTYYVALSIYAQLRNSFGWEFYSQVFRRYNELKNEIGSISDNE-KIQLWIKTTSEISGMNLCPLYELWKWPISQKTEKELSKL 2076
            GLY+  G+   V + TE+     ++ I  H+ N I++ K Y  P   T      +   + ++ +GGLL I      N D V +T    V  P F R  K   ++W    +   +PW  +++D ++  + +  ++ L DP   ++++D +VK    L  R       E I  D QI+ G++H+GYPI   I  V       +   +++ I   G WG+ HELGHN Q+P +TF     E   N++++   E++ N+      P+      K +IKD   +LN G     W    + AL  Y QL+  FGWE + Q+F  Y  L    G   +NE K+ LW+K  SE+   NL P ++ W WP+     K L+ L
Sbjct:  539 GLYLPEGQVAQVTLPTEATHAKLKVLIGCHIDN-ISQAKTYIRPPVMTYVYHLTSSQTSISWLYGGLLYIMVPDKYNQDNVSVTISGAVSAPYF-RLGKTTQEEWKNLIEHSKAPWGELATDNIILTIPTVNLKVLQDPYPLLQLWDKIVKAVAKLAARPFPFQRPERIVLDKQISFGFLHSGYPIMGLIIIV-------EGIINEFKIRSHGVWGVTHELGHNHQKPGWTFRPHTTEALCNLWSIYVHETVLNIPRDQAHPSLNPELRKQRIKD---HLNKGAPLSNW--IVWTALETYLQLQEGFGWEPFIQLFANYQTL---TGLPQNNEDKMNLWVKKFSEVVQKNLAPFFKAWGWPVQHAVAKSLASL 894          
BLAST of Peptidase M60 domain-containing protein vs. UniProt/SwissProt
Match: sp|A6NFQ2|TCAF2_HUMAN (TRPM8 channel-associated factor 2 OS=Homo sapiens OX=9606 GN=TCAF2 PE=1 SV=2)

HSP 1 Score: 149.828 bits (377), Expect = 5.163e-36
Identity = 99/370 (26.76%), Postives = 178/370 (48.11%), Query Frame = 1
Query:  985 GLYVVPGKHVSVQITESN-SQSCRIFINFHLFNTINKEKLYKWPITKTEFIIKRNILETFAYPFGGLLSISCDANND--KVKITFINVVKVPVFDRRDKKDTKDWIQQ-QSVVSPWAVVSSDTLVFVLSSNAIRNLADPETFMRMYDSMVKEEFHLKGRSISTSYREIISTDIQITAGYMHAGYPIGTQIFWVTNPYNKKDYFFDKYNIEIDGEWGLMHELGHNLQEPIFTFNG-AGEVNNNIFTLVAIESMTNMSSWSPNDGWVSTKVKIKDLVKYLNNGT-FEEWKKTYYVALSIYAQLRNSFGWEFYSQVFRRYNELKNEIGSISDNEKIQLWIKTTSEISGMNLCPLYELWKWPISQKTEKELSKL 2076
            GLY++ G++  V ++E+  S   R+ I  H  +     KL + P+   +  + R    + +  +GGLL +     +    V +T    V  P + +  K   ++W +Q Q  ++PW  +++D ++  + +  ++ L DPE  +R++D M++    L          E I  D+QI+AG+MH+GYPI   +  V    N+ D       +   G WG +HELGHN Q   + F     E   N++++   E++  +     ++  +S   + + +  +L  G    +W    + AL  Y QL+ +FGWE ++Q+F  Y  L +      +  ++ LW+K  SE    NL P +E W WPI ++    L+ L
Sbjct:  548 GLYLLEGQNAEVSLSEAAASAGLRVQIGCHTDDLTKARKLSRAPVVTHQCWMDRTE-RSVSCLWGGLLYVIVPKGSQLGPVPVTIRGAVPAPYY-KLGKTSLEEWKRQMQENLAPWGELATDNIILTVPTTNLQALKDPEPVLRLWDEMMQAVARLAAEPFPFRRPERIVADVQISAGWMHSGYPIMCHLESVKEIINEMD-------MRSRGVWGPIHELGHNQQRHGWEFPPHTTEATCNLWSVYVHETVLGIPRAQAHEA-LSPPERERRIKAHLGKGAPLCDW--NVWTALETYLQLQEAFGWEPFTQLFAEYQTLSHL--PKDNTGRMNLWVKKFSEKVKKNLVPFFEAWGWPIQKEVADSLASL 903          
BLAST of Peptidase M60 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8BNE1|TCAF1_MOUSE (TRPM8 channel-associated factor 1 OS=Mus musculus OX=10090 GN=Tcaf1 PE=2 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 4.174e-35
Identity = 113/389 (29.05%), Postives = 183/389 (47.04%), Query Frame = 1
Query:  985 GLYVVPGKHV-SVQITESN-SQSCRIFINFHLFNTINKEKLYKWPITKTEFIIKRNILE----TFAYPFGGLLSISCDANN--DKVKITFINVVKVPVFDRRDKKDTKDWIQQQ-SVVSPWAVVSSDTLVFVLSSNAIRNLADPETFMRMYDSMVKEEFHLKGRSISTSYREIISTDIQITAGYMHAGYPIGTQIFWVTNPYNKKDYFFDKYNIEIDGEWGLMHELGHNLQEPIFTFNG-AGEVNNNIFTLVAIE-------SMTNMSSWSPNDGWVSTKVKIKDLVKYLNNG-TFEEWKKTYYVALSIYAQLRNSFGWEFYSQVFRRYNELKNEIGSISDN-EKIQLWIKTTSEISGMNLCPLYELWKWPISQKTEKELSKLQMFLPD 2094
            GLY+ PG+ V  V + ES  S   +I I  H  +     KL++ P+     +I R  L+    +    +GGLL I    N+    V +T    V+ P F +  +   ++W ++      PW  +++D ++  + +  +R L +PE  +R++D M++    L G +      + I  D+QI+ G+MHAGYPI   +  V    N+K        I   G WG +HELG N Q   + F     E   N++ +   E       S  N++ W P        V+ K +  YL+ G + + W    + AL  Y QL+ +FGWE + ++F  Y          SDN +K+ LW+K  S+    NL P +E W WPI    +KE++    +LP+
Sbjct:  548 GLYI-PGRQVIDVSVPESAASADLKIQIGCHTDDLTRASKLFRGPL-----VINRCCLDKPTKSITCLWGGLLYIIVPQNSKLGSVPLTVKGAVRAP-FYKLGETSKEEWKRRLLEYPGPWGELATDNIILTVPTANLRTLENPEPLLRLWDEMMQAVAKLGGETFPLRLPQRIVADVQISVGWMHAGYPIMCHLESVQELINEK-------LIRTKGLWGPVHELGRNQQRQEWEFPPHTTEATCNLWCVYVHETVLGIPRSRANIALWPP--------VREKRVRIYLSKGPSVKHWNA--WTALETYLQLQEAFGWEPFIRLFTEYRNQTTSSSPPSDNVDKMNLWVKMFSQQVQRNLAPFFEAWGWPI----QKEVATSLAYLPE 908          
BLAST of Peptidase M60 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5XHI4|TCAF_XENLA (TRPM8 channel-associated factor homolog OS=Xenopus laevis OX=8355 GN=tcaf PE=2 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 3.524e-34
Identity = 101/384 (26.30%), Postives = 182/384 (47.40%), Query Frame = 1
Query:  985 GLYVVPGKHVSVQITESN-SQSCRIFINFHLFNTINKEKLYKWPITKTEFIIKRNILETFAYPFGGLLSISCDANNDKVKITFINVVKVPVFDR-------RDKKDTKDWIQQ-QSVVSPWAVVSSDTLVFVLSSNAIRNLADPETFMRMYDSMVKEEFHLKGRSISTSYREIISTDIQITAGYMHAGYPIGTQIFWVTNPYNKKDYFFDKYNIEIDGEWGLMHELGHNLQEPIFTFN-GAGEVNNNIFTLVAIESMTNMSSWSPNDGWVSTKVKIKDLVKYLNNGT-FEEWKKTYYVALSIYAQLRNSFGWEFYSQVFRRYNEL---KNEIGSISDNEKIQLWIKTTSEISGMNLCPLYELWKWPISQKTEKELSKLQMFLPD 2094
            GLY+ P K   ++   S   Q  ++ +     +  + +K  + P+    F +    +    + +GGL+ I+  AN++      + ++ V V++        + K     WIQ  +++ +PWA + ++ ++  + S+AIR+L+DPE  + ++D ++     L          E    D+QI+AG+MHAGYPI   +              D   ++  G WG +HELGHN Q+  +       E   N++++   E++  +   S     +  + +   + +YL NG+  E+W    + AL  Y QL+  FGWE + Q+F+ Y  +   +NE     +  K+ LW +  SE    NL P +E W WPI + T  +LS L ++  D
Sbjct:  530 GLYLAPRKTAVLEFPASAVHQGLQVQVGCQSDDLSSADKYCRAPVVVRRFHVDSQRVSVSCF-WGGLVYITVKANSN------LGIIPVKVYEAEPAPIYIKGKTSLDTWIQSIRNLPAPWAELITENIILTVPSDAIRSLSDPEALLSLWDKIMVAITELAAIPKKLPRPERFVADVQISAGWMHAGYPIMCHL-------ESAKELTDLNIMQTGGIWGPIHELGHNQQKTNWELPPHTTEATCNLWSVYVHETVLGIPR-SQAHCCLQAETRANHIQEYLRNGSNIEQW--NVWTALETYLQLQEGFGWEPFKQLFKDYQSMSGIRNE-----NKSKMNLWAEKFSEAVQTNLVPFFEAWGWPIEEATHSKLSVLPVWEKD 891          
BLAST of Peptidase M60 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6QR59|TCAF3_MOUSE (TRPM8 channel-associated factor 3 OS=Mus musculus OX=10090 GN=Tcaf3 PE=1 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 8.017e-34
Identity = 106/371 (28.57%), Postives = 175/371 (47.17%), Query Frame = 1
Query:  985 GLYVVPGKHVSVQI-TESNSQSCRIFINFHLFNTINKEKLYKWPITKTEFIIKRNILETFAYPFGGLLSISCDA--NNDKVKITFINVVKVPVFDRRDKKDTKDWIQQ-QSVVSPWAVVSSDTLVFVLSSNAIRNLADPETFMRMYDSMVKEEFHLKGRSISTSYREIISTDIQITAGYMHAGYPIGTQIFWVTNPYNKKDYFFDKYNIEIDGEWGLMHELGHNLQEPIFTF-NGAGEVNNNIFTLVAIESMTNMSSWSPNDGWVSTKVKIKDLVKYLNNGT-FEEWKKTYYVALSIYAQLRNSFGWEFYSQVFRRYNELKNEIGSISDNE-KIQLWIKTTSEISGMNLCPLYELWKWPISQKTEKELSKL 2076
            GLY+  G+   V + +E+     ++ I  H  N I++ + Y  P   T      +   + ++ +GGLL I      N D V +T    V  P F R  K   ++W        +PW  +++D ++  + +  ++ L DP   ++++D MV+    L  R       E +  D QI+ G++H+GYPI   I  V       +    ++ I   G WG++HELGHN Q+  +TF     E   N++T+   E++ N+     +   ++ +++ + +  +LN G     W    + AL  Y QL+  FGWE + QVF  Y  L    G   +NE K+ LW+K  SE    NL P +E W WP+     K L+ L
Sbjct:  539 GLYLPEGQVAQVLLPSEATHAKLKVLIGCHRDN-ISQARTYFRPPVMTYVYHLTSSQTSISWLYGGLLYIMVPNKYNQDNVSVTIRGAVSAPYF-RLGKTTQEEWKNLITHSKAPWGELATDNIILTIPTVNLKELQDPYPLLQLWDKMVRAVAKLAARPFPFQRAERVVLDKQISFGFLHSGYPIMGLISIV-------EGIISEFKIRSHGIWGVIHELGHNHQKSGWTFPPHTTEALCNLWTIYVHETVLNIPREQAHPS-LNPELRRQRIKYHLNKGAPLSNW--IMWTALETYLQLQEGFGWEPFIQVFADYRTLS---GLPQNNEDKMNLWVKKFSEAVHKNLAPFFEAWGWPVKYAVAKSLASL 894          
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Match: V4A0M8 (Peptidase M60 domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_165593 PE=4 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 1.045e-66
Identity = 140/439 (31.89%), Postives = 227/439 (51.71%), Query Frame = 1
Query:  874 IAPGLSFYPGTFQSSDILLENFQMQLNLK-YKDEVSQLGLYVVPGKHVSVQITESNSQSCRIFINFHLFNTINKEKLYKWPITKTEFIIKRNILETFAYPFGGLLSISCDANNDKVKITFINVVKVPVFDRRDKKDTKDWIQQQSVVSPWAVVSSDTLVFVLSSNAIRNLADPETFMRMYDSMVKEEFHLKGRSISTSYREIISTDIQITAGYMHAGYPIGTQIFWVTNPYNKKDYFFDKYNIEIDGEWGLMHELGHNLQEPIFTFNGAGEVNNNIFTLVAIESMTNMSSWSPNDGWVSTKVKIKDLVKYLNNGTFEEWKKTYYVALSIYAQLRNSFGWEFYSQVFRRYNELKNEIGSISDNEKIQLWIKTTSEISGMNLCPLYELWKWPISQKTEKELSKLQMFLPDDFLTKMIEKRVDEIISKFGGIDSVFRTPLTI 2187
            I PG++ +PG F+S+        + L L  Y+++V   G YV  G  ++V +   N +   + I  H      + +L +WP       +        A  FGGL+  +  +N   + +   NV++ P+FD       + W  ++     WA + S+ L+  L S +IRNL  P + M+ +D ++K  FHLKG  I    ++ + TD+Q +AGYMH+GYP+ T +  V NP + + +  + +N+   G WG+ HE GHN+QE ++TF G  EV  NIFTL A++++           W+  ++       Y N+  +  WK    +AL IYAQ+ +  GW  + +VFRRY  +        +N++I LW    SE+S +NL  L + WK P+S K  +E+SK Q FLPDD + +M  +R   I++K+    +  R P  I
Sbjct:  505 ILPGIANFPGDFESTP---SKTSVTLTLSSYQEDVHPTGYYVQAGDSLAVSVLSQNGKGWTVQIGAHSDCLSGQSELKRWPNVVCCKPLNEQCTIVKAT-FGGLVYFTSPSNQQSITVQLDNVIQAPLFDLTLPTTIEQWNGRRQAPGLWADICSEFLIITLPSKSIRNLDGPVSVMKKWDEVLKAHFHLKGIDIRNHRKQWLVTDVQPSAGYMHSGYPVVTHLD-VANP-SHEFFLLNSHNLNTKGSWGVFHEFGHNMQEGVWTFPGTTEVTVNIFTLHAMDTLIGKRPIVHE--WLQNQMSNAKRYLYHNDQNYSHWKSDPGIALFIYAQIAHHLGWGVFKEVFRRYGRMNPSSYPNKENDQIDLWYTLLSEVSQLNLASLVDFWKIPLSDKARREMSKFQPFLPDDDVMRMAPERTHMILAKYH--SNCLRQPAYI 933          
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Match: A0A1S3I0H4 (TRPM8 channel-associated factor 2-like OS=Lingula unguis OX=7574 GN=LOC106159184 PE=4 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 1.955e-66
Identity = 147/437 (33.64%), Postives = 228/437 (52.17%), Query Frame = 1
Query:  880 PGLSFYPGTFQSSDILLENFQMQLNLKYKDEVSQLGLYVVPGKHVSVQITESNSQSC---RIFINFHLFNTIN-KEKLYKWPITKTEFIIKRNILETFAYPFGGLLSISCDANNDKVKITFINVVKVPVFDRRDKKDTKDWIQQQSVVSPWAVVSSDTLVFVLSSNAIRNLADPETFMRMYDSMVKEEFHLKGRSISTSYREIISTDIQITAGYMHAGYPIGTQIFWVTNP---YNKKDYF-FDKYNIEIDGEWGLMHELGHNLQEPIFTFNGAGEVNNNIFTLVAIESMTNMSSWSPNDGWVSTKVKIKDLVKYL-NNGTFEEWKKTYYVALSIYAQLRNSFGWEFYSQVFRRY-NELKNEIGSISDN-EKIQLWIKTTSEISGMNLCPLYELWKWPISQKTEKELSKLQMFLPDDFLTKMIEKRVDEIISKFGGI 2157
            PG+  +PG F SS   L+  ++ L  K++  +S  G YV  G+ V V +T          +I I  H  + +N KE   +WP      + +       + P+GGLL       N ++ +   NVV+ P FD    +  +DW ++++    WA ++   +VF + S ++R + DP T + ++DS V  +  L+G   +   RE +  D Q +AGYMHAGYPI T +  V +P   YN  D F F +  ++  G WGL HE+GHN+Q   +TF+G GEV NNIFTL   E++T   +W   +     K + + L + L +  +  +WKK  + AL +Y+QL + FGW  +  VFR Y N +K E  S  D+  KI +W    SEI   NL P+ + W  P+S      L+    FLP+D +T   + RVD+++  + GI
Sbjct:  286 PGIGVFPGDF-SSKPPLQTVRLNLTTKHRQRLST-GYYVPAGQPVKVTVTSDQGTDLSGWKICIGAHDDSLVNVKEPWRRWP--DVAVLEELKATTALSSPYGGLLFFDSPERNAELTVIVCNVVEAPFFDLTKPEIVEDWSRRRNAPGLWAELAGRHIVFTVPSTSVREIDDPTTILALWDSAVAAQHDLRGTDRNLQKRERVVADEQPSAGYMHAGYPIVTHLD-VVDPNFQYNGSDNFVFSESGMKSYGNWGLFHEIGHNMQRKAWTFSGMGEVTNNIFTLYTYEAVTGNDAW---NNPTMKKFRAEKLPRLLQSQPSLSDWKKDPFFALCVYSQLAHEFGWRSFKTVFRLYENSVKKEEESNQDDGAKIDMWFGRFSEIVRHNLSPMCDFWGIPLSTGVRNNLTLFPAFLPNDEITAAGQARVDQVLPNYPGI 714          
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Match: V3ZHF7 (Peptidase M60 domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_236481 PE=4 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 5.346e-64
Identity = 144/473 (30.44%), Postives = 238/473 (50.32%), Query Frame = 1
Query:  775 LIPCSKGSITKESDQDLIKLFNYILISFFGRTLIAPGLSFYPGTFQSSDILLENFQMQLNLKYKDEVSQLGLYVVPGKHVSVQITESNSQSC--RIFINFHLFNTINKEKLYKWPI-TKTEFIIKRNILETFAYPFGGLLSISCDANNDKVKITFINVVKVPVFDRRDKKDTKDWIQQQSVVSPWAVVSSDTLVFVLSSNAIRNLADPETFMRMYDSMVKEEFHLKGRSISTSYREIISTDIQITAGYMHAGYPIGTQIFWVTNPYNKKDYFFDKYNIEIDGEWGLMHELGHNLQEPIFTFNGAGEVNNNIFTLVAIESMTNMSSWSPNDGWVSTKV-KIKDLVKYLNNGTFEEWKKTYYVALSIYAQLRNSFGWEFYSQVFRRYNELKNEIGSISDNEKIQLWIKTTSEISGMNLCPLYELWKWPISQKTEKELSKLQMFLPDDFLTKMIEKRVDEIISKFGGIDSVFRTPL 2181
             IP  K  ++    + ++ L + +  +  G   + PG+  +PG F + D  L + ++ +  +        G YV  G+ V ++I    S +C   I I  H  +      + +WPI T+ + I ++N+      P GGL+ +       K+ I   N ++ P+FD    +   +W   +     WA +    +VF L + ++ +L DP   +  +D +V    HL+G   ++  RE I  D+Q + GYMH+GYPI T +  V +P +K  +  +   +   G WGL HELGHN+Q+P +TF G GEV  NIFTL A++ +   S W     W+  KV K +  ++  ++  F +W+    +AL +YAQL N FGW  Y + FR+Y E        ++ EKI  W +T S+ S  NL PL +LW  P+S    ++L     FLPDD +T+ + ++V+E+  K+  +    R P 
Sbjct:  259 CIPSEKRPVSSSIGKSVMFLHDVLAKTGNGYKKM-PGIDLFPGDF-TEDPPLSDGRIIIESEIP-AAHPTGFYVRAGEEVELEIVTEESLNCGWEIQIGCHSDHLQTSNAMKRWPIITEKQKITQKNL--KMKTPIGGLMYVWSPKMASKIIINVKNAIESPLFDLTQPETIINWKTNRQAPGLWADLGGHHIVFTLPAKSVGDLEDPTAVLESWDRVVCAHHHLRGTDPNSQRREWIVADVQPSCGYMHSGYPIVTHLD-VADP-SKSSFLLNNKTLLESGNWGLFHELGHNMQKPTWTFRGTGEVTCNIFTLHAMDVIAQKSPWI--HSWLEGKVPKARQFIR--SSAGFSKWQSDPGIALFVYAQLYNQFGWSVYKKTFRQYEEQDMPPQLKTEEEKIDYWFETMSKFSEYNLAPLADLWSIPLSDTCREQLKVFPSFLPDDEITQGVPEKVEELEKKYPKLVRKIRPPC 720          
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Match: A0A1S3KG34 (TRPM8 channel-associated factor 2 OS=Lingula unguis OX=7574 GN=LOC106181552 PE=4 SV=1)

HSP 1 Score: 235.728 bits (600), Expect = 1.141e-63
Identity = 145/437 (33.18%), Postives = 226/437 (51.72%), Query Frame = 1
Query:  880 PGLSFYPGTFQSSDILLENFQMQLNLKYKDEVSQLGLYVVPGKHVSVQITESNSQSC---RIFINFHLFNTIN-KEKLYKWPITKTEFIIKRNILETFAYPFGGLLSISCDANNDKVKITFINVVKVPVFDRRDKKDTKDWIQQQSVVSPWAVVSSDTLVFVLSSNAIRNLADPETFMRMYDSMVKEEFHLKGRSISTSYREIISTDIQITAGYMHAGYPIGTQIFWVTNP---YNKKDYF-FDKYNIEIDGEWGLMHELGHNLQEPIFTFNGAGEVNNNIFTLVAIESMTNMSSWSPNDGWVSTKVKIKDLVKYLN-NGTFEEWKKTYYVALSIYAQLRNSFGWEFYSQVFRRY-NELKNEIGSISDN-EKIQLWIKTTSEISGMNLCPLYELWKWPISQKTEKELSKLQMFLPDDFLTKMIEKRVDEIISKFGGI 2157
            PG+  +PG F S    L+  ++ L  K++  +S  G YV  G+ V V +T          +I I  H  + +N KE   +WP       +K       + P+GGLL       N ++ +   NVV+ P FD    +  +DW ++++    W  ++   +VF + S ++R + DP T + ++DS V  +  L+G   +   RE +  D Q +AGYMHAGYPI T +  V +P   YN  D F F +  +++ G WGL HE+GHN+Q   +TF+G GEV NNIFTL   E++T   +W   +     K + + L + L    +  +WKK  + AL +Y+QL + FGW  +  VFR Y N +K E  S  D+  KI ++    SEI   NL P+ + W  P+S      L+    FLP+D +T   + RVD+++  + GI
Sbjct:  286 PGIDVFPGDF-SFKPPLQTVRLNLTTKHRQRLST-GYYVPAGQPVKVAVTSDQGTDLSGWKICIGAHDDSLVNVKEPWRRWPDVAVLEELKATT--ALSSPYGGLLFFDSPERNAELTVIVCNVVEAPFFDLTKPEIVEDWSRRRNAPGLWTELAGRHIVFTVPSTSVREIDDPTTILALWDSAVAAQHDLRGTDPNFQKRERVVADEQPSAGYMHAGYPIVTHLD-VVDPNFQYNGSDNFVFSESGMKLYGNWGLFHEIGHNMQRKAWTFSGMGEVTNNIFTLYTYEAVTGNDAW---NNPTMKKFRAEKLPRLLQTQPSLNDWKKDPFFALCVYSQLAHEFGWGSFKTVFRLYENSVKKEEESNQDDGAKIDMYFGRFSEIVRHNLSPMCDFWGIPLSTGVRNNLTLFPAFLPNDEITAAGQARVDQVLPNYPGI 714          
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Match: R7UHN9 (Peptidase M60 domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_195748 PE=4 SV=1)

HSP 1 Score: 234.958 bits (598), Expect = 1.897e-63
Identity = 162/609 (26.60%), Postives = 300/609 (49.26%), Query Frame = 1
Query:  394 VFILLQLIKSGLQIIIGVKPWAYYYYQAQFLDSELKV--LFETAGIWPSK---DSDSDVWRTVTKFSTNTMPFYYRLEYAXXXXXXXXXXXXXIGNFLAEVPFHKIMSKRTFELLKSSI--VDLYSNYLPYIKHLIPCSKGSITKESDQDLIKLFNYILISFFGRTLIAPGLSFYPGTFQSSDILLENFQMQLNLKYKDEVSQLGLYVVPGKHVSVQITE--SNSQSCRIFINFHLFNTINKEKLYKWPITKTEFIIKRNILETFAYPFGGLLSISCDANNDKVKITFINVVKVPVFDRRDKKDTKDWIQQQSVVSPWAVVSSDTLVFVLSSNAIRNLADPETFMRMYDSMVKEEFHLKGRSISTSYREIISTDIQITAGYMHAGYPIGTQIFWVTNPYNKKDYFFDKYNIEIDGEWGLMHELGHNLQEPIFTFNGAGEVNNNIFTLVAIESMTNMSSWSPNDGWVSTKVKIKDLVKYLNNGT-FEEWKKTYYVALSIYAQLRNSFGWEFYSQVFRRYNELKNEIGSISDNEKIQLWIKTTSEISGMNLCPLYELWKWPISQKTEKELSKLQMFLPDDFLTKMIEKRVDEIISKFGGIDSVFRTPLTIP 2190
            V +LL  I+ G  +I  + PW +      + + ++ +  + E AGI  +    + ++D +   +  ST  +P    ++    +  +L   +  + + L ++P   + S  TF+ L   +   D Y+  +P  K+ +           D     L     +S   R   APG+  +PG F+  D+  +  ++ L+   +D +    +Y+  G+ + ++I E  ++ Q  +++I  H  + +   +  + P    +  +  +    F+ P+GG +         ++ +T  NVV+ P +       T  WI Q+     WA ++   ++  L S++I++L DP   +  +DS+V     ++   +S+  ++ I  D+Q   GYMH+GYPI T +  V +P + + +  +   ++ +G WGL HELGHN+Q   +TF G  EV  N+FTL A++ +  +  W     W++ ++    + +YL  G  F  WKK   +AL IYAQL +  GW  Y  VFR+Y  + NE    +D+EKI+LWI T +E  G NLC L+  W + I    ++ L++L +FLP D +T  + +R+ +++++F G      T L +P
Sbjct:  129 VLMLLDFIEHGGGLIFAICPWGWLQLNKNYAEEDMPMYSILERAGIHFTGHYINGNADGFTVPSIPSTARVPTL--IQKCLSSSENLGLYAYDLASLLEDLPLRIVRS--TFQDLLDEVEETDFYNLVIPEEKYPL----------KDNRSKGLLLLSCLSARVRGDKAPGVHAFPGDFEG-DVQHKCVRINLDSARRD-IFPAAVYLPAGETLEIEIHEGSTDPQKWKVWIGAHSDDLVRSSQWKRLPKVHIKQRLSEDTNVIFS-PYGGNVYFESPDEESQLDVTVSNVVESPCY-------TDHWIGQRDAPGLWADLAGRHIMITLPSSSIKDLVDPSEVLAFWDSVVAAHHVVRTTDVSSHRKQWIVCDVQPVVGYMHSGYPIVTHMD-VADPTSDQ-FLLNHDKLKAEGNWGLYHELGHNMQRLEWTFQGTSEVTVNVFTLHAMDVVNGVKPWI--HPWLNNQMNA--IKRYLMAGADFTTWKKEPGIALGIYAQLAHHLGWGTYKAVFRKYEVMSNEQKPKTDDEKIRLWITTFAECCGQNLCALFRFWGFTIPNDLQRNLAELPLFLPMDEMTLFVPERIAKVVAEFDGEGGCMDT-LPLP 706          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-210b2.3 (si:ch211-210b2.3 [Source:ZFIN;Acc:ZDB-GENE-131122-13])

HSP 1 Score: 124.79 bits (312), Expect = 5.890e-29
Identity = 94/373 (25.20%), Postives = 173/373 (46.38%), Query Frame = 1
Query:  985 GLYVVPGKHVSVQI-TESNSQSCRIFINFHLFNTINKEKLYKWPITKTEFIIKRNILETFAYPFGGLLSISCDANN--DKVKITFINVVKVPVFDRRDKKDTKDWIQQ-QSVVSPWAVVSSDTLVFVLSSNAIRNLADPETFMRMYDSMVKEEFHLKGRSISTSYREIISTDIQITAGYMHAGYPIGTQIFWVTNPYNKKDYFFDKYNIEIDGEWGLMHELGHNLQEPIFTFN-GAGEVNNNIFTLVAIESMTNMSSWSPNDGWVSTKVKIKDLVKYLNNG-TFEEWKKTYYVALSIYAQLRNSFGWEFYSQVFRRYNELKNEIGSISDNEKIQLWIKTTSEISGMNLCPLYELWKWPISQKTEKELSKLQMF 2085
            GLY+ PG    V +  E   +  ++ I     +  + + L + P+    F + +++L+ +   +GGL+ +        D V++     +K P + +  +    +W+ + ++  +PWA +  + ++  L S  IR L  P+                    ++   +E    D+QI+ G+MHAGYPI   I   + P         K+ I     WG +HELGHN Q   + F     E   N++++   E +  ++  S ++  +S + +      Y   G   ++W  + + AL  Y QL++ FGW+ + +VF  Y+ + N  G   +N K+ L+ +T S++  MNL P ++ W WPI   TE  LS L ++
Sbjct:  546 GLYLSPGMRTFVAVPAEIMDKGWQLQIGCQTDHLGHADVLRRAPVVHERFALDKDMLQVWNL-WGGLIYLIAPPKCKLDGVEVIVQTAIKAPYY-KSGETSVANWMNEIRNAPAPWAELEFENIIITLQSEVIRQLDRPD-------------------EVAFPRKERFVADVQISHGFMHAGYPI--MILSCSAPELVNPESARKFGI-----WGAIHELGHNQQRWAWEFPPNTTECTCNLWSVYVHEEVLGVNRASAHEN-MSPERRWGRAQSYAMGGRQLDQW--SMWTALETYMQLQDRFGWDAFKKVFTAYHTINNVPGD--NNGKMNLYAETFSKVVNMNLAPFFKAWGWPIQPSTEDALSSLPVW 885          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000051129.1 (pep primary_assembly:Astyanax_mexicanus-2.0:1:5658439:5662219:-1 gene:ENSAMXG00000036822.1 transcript:ENSAMXT00000051129.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.0561 bits (240), Expect = 1.933e-22
Identity = 65/209 (31.10%), Postives = 107/209 (51.20%), Query Frame = 1
Query: 1468 REIISTDIQITAGYMHAGYPIGTQIFWVTNPYNKKDYFFDKYNIEIDGE---WGLMHELGHNLQEPIFTFNG-AGEVNNNIFTLVAIESMTNMSSWSPNDGWVSTKVKIKDLVKYLNNG-TFEEWKKTYYVALSIYAQLRNSFGWEFYSQVFRRYNELKNEIGSISDNE-KIQLWIKTTSEISGMNLCPLYELWKWPISQKTEKELSKL 2076
            +E    D+QI AG+MH+GYPI      V+ P        D  N  + G+   WG +HELGHN Q   + F     E   N++++   E +  +   +   G ++ + +   + KY+  G   ++W  T + AL  Y QL+  FGW+ + +VF  Y+++    G   DN+ K+ L+ +T S++   NL P ++ W WPI   TE++L  L
Sbjct:   17 KERFVADVQILAGFMHSGYPIMMHT--VSAP--------DLVNPYVSGKSDFWGPVHELGHNQQHSDWEFPPYTTECTCNLWSVYVHEVVLGVKK-ADAHGQMTPQRRQNRIKKYIEGGRNLKDW--TVWTALETYMQLQEEFGWDAFKKVFAAYHDM---TGVPQDNKGKMNLYAETFSKVVNRNLTPFFKAWGWPIQPSTEEQLCSL 209          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000976.1 (pep scaffold:Pmarinus_7.0:GL479898:35358:38300:-1 gene:ENSPMAG00000000885.1 transcript:ENSPMAT00000000976.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 133.265 bits (334), Expect = 1.890e-32
Identity = 90/362 (24.86%), Postives = 168/362 (46.41%), Query Frame = 1
Query:  985 GLYVVPGKHVSVQITE-SNSQSCRIFINFHLFNTINKEKLYKWP-ITKTEFIIK----RNILETFAYPFGGLLS--ISCDANNDKVKITFINVVKVPVFDRRDKKDTKDWIQ-QQSVVSPWAVVSSDTLVFVLSSNAIRNLADPETFMRMYDSMVKEEFHLKGRSISTSYREIISTDIQITAGYMHAGYPIGTQIFWVTNPYNKKDYFFDKYNIEIDGEWGLMHELGHNLQEPIFTFNG-AGEVNNNIFTLVAIESMTNMSSWSPNDGWVSTKVKIKDLVKYLNNGT-FEEWKKTYYVALSIYAQLRNSFGWEFYSQVFRRYNELKNEIGSISDNEKIQLWIKTTSEISGMNLCPLYELWKW 2037
            GLY  P + V + +   +  +  +I +  H     + + + + P +T++  +++    R  +E  A  +GGLL   +    +  K+++      + P F +  +   + W + ++   +PW+ ++ D+L+  + S A R LADPE  MR++D M     +L      ++  E I  D QI+ G+MHAGYPI      +    N+++       +  +G WG +HELGHN Q P + F     E  NN+F +   E +  ++    +   +    + + L  +++ G     W  T +  L  Y QL+ +FGW+ + ++F  Y    +   ++    K+  W +  S   G NL P +  W W
Sbjct:  529 GLYAPPAQRVLLDLPSLALGRGIQIQLGCHTDQLYDSKTMKRHPEVTRSMPVVRGEMDRGAMEV-ASSWGGLLYLLVPEGVSLGKIRVRVRGAARAPYF-KLGETSLQHWQEFERHYPAPWSELACDSLILTVPSEAARGLADPERLMRLWDRMTGAIAYLAAEPHPSARPERIVVDEQISHGWMHAGYPIMVHRASIPKLLNEQE-------MRAEGMWGPLHELGHNRQRPAWNFPPHTTEATNNLFAVYVHEEVLGVARARAHPD-LRPAERERRLRDHVDAGCPLAAW--TVFTCLETYLQLQEAFGWDPFVRLFGDYQRAASTPSTM--EAKMSEWAERFSRCVGRNLAPFFSAWGW 876          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Medaka
Match: si:ch211-210b2.3 (TRPM8 channel-associated factor homolog [Source:NCBI gene;Acc:101159605])

HSP 1 Score: 136.732 bits (343), Expect = 8.739e-33
Identity = 106/390 (27.18%), Postives = 184/390 (47.18%), Query Frame = 1
Query:  934 NFQMQLNLKYKDEVSQL--GLYVVPGKHVSVQITESNSQSC-RIFINFHLFNTINKEKLYKWPITKTEFIIKRNILETFAYPFGGLLSISCDANNDKVKITFINVVKVPV-FDRRDKKDTKDWIQQQSVVSPWAVVSSDTLVFVLSSNAIRNLADPETFMRMYDSMVKEEFHLKGRSISTSYREIISTDIQITAGYMHAGYPIGTQIFWVTNPYNKKDYFFDKYNIEIDGEWGLMHELGHNLQEPIFTF-NGAGEVNNNIFTLVAIESMTNM--SSWSPNDGWVSTKVKIKDLVKYLNN-GTFEEWKKTYYVALSIYAQLRNSFGWEFYSQVFRRYNELKNEIGSISDNE-KIQLWIKTTSEISGMNLCPLYELWKWPISQKTEKELSKL 2076
            N ++ +++K   E   L  GLY+ PG    + I     Q   +I I     + +N E+L + P    +F +   +++ +   +GGL+ +      D   +  I  + VP  + +      + W   ++  SPWA +  D ++  + S A+R L  PE   ++++ ++K    L  +      +E    D+QI+ G+MHAGYPI  Q   V    N         +++  G WG +HELGHN Q   + F     E   N++++   E +  +  +   PN    + K + ++ V    N  ++E W     VAL  Y QL++ FGW+ + +VF  Y ++    G   DN  K+ L+ +T S+  GM+L   ++ W WPI   TE++LS L
Sbjct:  532 NQRINIDVKTAGEKEWLSTGLYLSPGMKTYISIPAQMVQKGWQIQIGCQT-DQLNAEELKRPPRVHEQFAVTSEMMQVWNL-WGGLIYLVAPPQADVHGVEVIVQMAVPAPYYKSGVTTAEAWSLLRTAPSPWAELEFDNIILTVPSEAVRTLERPEELAQLWNKIMKAIADLAAKPEKFPRKERFVADVQISHGWMHAGYPIMGQKSAVNELVNVD-------HMKSCGLWGPIHELGHNQQRGCWEFPPNTTECTCNLWSVYVHEEVLGIDRAKAHPNMSLENRKSRARNYVTQGRNLNSWEMW-----VALETYMQLQDKFGWDAFKKVFAAYLQMSQFPG---DNPGKMNLYTETFSQTVGMDLTAFFKAWGWPIQASTEQKLSNL 904          
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Match: SMESG000026377.1 (SMESG000026377.1)

HSP 1 Score: 1452.19 bits (3758), Expect = 0.000e+0
Identity = 722/722 (100.00%), Postives = 722/722 (100.00%), Query Frame = 1
Query:   25 MNEYFQKKIKQDVIVPSDSNHGHFYLLNDNVIPYALSVKNKVTVTISSIGKGRISFLATEKLVNPEFYPELQDLFQEVYEKPVENPKLLTKKYFKALIDENKLQTAMFEHFIWNAHDTLGRDLVFILLQLIKSGLQIIIGVKPWAYYYYQAQFLDSELKVLFETAGIWPSKDSDSDVWRTVTKFSTNTMPFYYRLEYAXXXXXXXXXXXXXIGNFLAEVPFHKIMSKRTFELLKSSIVDLYSNYLPYIKHLIPCSKGSITKESDQDLIKLFNYILISFFGRTLIAPGLSFYPGTFQSSDILLENFQMQLNLKYKDEVSQLGLYVVPGKHVSVQITESNSQSCRIFINFHLFNTINKEKLYKWPITKTEFIIKRNILETFAYPFGGLLSISCDANNDKVKITFINVVKVPVFDRRDKKDTKDWIQQQSVVSPWAVVSSDTLVFVLSSNAIRNLADPETFMRMYDSMVKEEFHLKGRSISTSYREIISTDIQITAGYMHAGYPIGTQIFWVTNPYNKKDYFFDKYNIEIDGEWGLMHELGHNLQEPIFTFNGAGEVNNNIFTLVAIESMTNMSSWSPNDGWVSTKVKIKDLVKYLNNGTFEEWKKTYYVALSIYAQLRNSFGWEFYSQVFRRYNELKNEIGSISDNEKIQLWIKTTSEISGMNLCPLYELWKWPISQKTEKELSKLQMFLPDDFLTKMIEKRVDEIISKFGGIDSVFRTPLTIP 2190
            MNEYFQKKIKQDVIVPSDSNHGHFYLLNDNVIPYALSVKNKVTVTISSIGKGRISFLATEKLVNPEFYPELQDLFQEVYEKPVENPKLLTKKYFKALIDENKLQTAMFEHFIWNAHDTLGRDLVFILLQLIKSGLQIIIGVKPWAYYYYQAQFLDSELKVLFETAGIWPSKDSDSDVWRTVTKFSTNTMPFYYRLEYAKKNLMSLKNLSKSIGNFLAEVPFHKIMSKRTFELLKSSIVDLYSNYLPYIKHLIPCSKGSITKESDQDLIKLFNYILISFFGRTLIAPGLSFYPGTFQSSDILLENFQMQLNLKYKDEVSQLGLYVVPGKHVSVQITESNSQSCRIFINFHLFNTINKEKLYKWPITKTEFIIKRNILETFAYPFGGLLSISCDANNDKVKITFINVVKVPVFDRRDKKDTKDWIQQQSVVSPWAVVSSDTLVFVLSSNAIRNLADPETFMRMYDSMVKEEFHLKGRSISTSYREIISTDIQITAGYMHAGYPIGTQIFWVTNPYNKKDYFFDKYNIEIDGEWGLMHELGHNLQEPIFTFNGAGEVNNNIFTLVAIESMTNMSSWSPNDGWVSTKVKIKDLVKYLNNGTFEEWKKTYYVALSIYAQLRNSFGWEFYSQVFRRYNELKNEIGSISDNEKIQLWIKTTSEISGMNLCPLYELWKWPISQKTEKELSKLQMFLPDDFLTKMIEKRVDEIISKFGGIDSVFRTPLTIP
Sbjct:  327 MNEYFQKKIKQDVIVPSDSNHGHFYLLNDNVIPYALSVKNKVTVTISSIGKGRISFLATEKLVNPEFYPELQDLFQEVYEKPVENPKLLTKKYFKALIDENKLQTAMFEHFIWNAHDTLGRDLVFILLQLIKSGLQIIIGVKPWAYYYYQAQFLDSELKVLFETAGIWPSKDSDSDVWRTVTKFSTNTMPFYYRLEYAKKNLMSLKNLSKSIGNFLAEVPFHKIMSKRTFELLKSSIVDLYSNYLPYIKHLIPCSKGSITKESDQDLIKLFNYILISFFGRTLIAPGLSFYPGTFQSSDILLENFQMQLNLKYKDEVSQLGLYVVPGKHVSVQITESNSQSCRIFINFHLFNTINKEKLYKWPITKTEFIIKRNILETFAYPFGGLLSISCDANNDKVKITFINVVKVPVFDRRDKKDTKDWIQQQSVVSPWAVVSSDTLVFVLSSNAIRNLADPETFMRMYDSMVKEEFHLKGRSISTSYREIISTDIQITAGYMHAGYPIGTQIFWVTNPYNKKDYFFDKYNIEIDGEWGLMHELGHNLQEPIFTFNGAGEVNNNIFTLVAIESMTNMSSWSPNDGWVSTKVKIKDLVKYLNNGTFEEWKKTYYVALSIYAQLRNSFGWEFYSQVFRRYNELKNEIGSISDNEKIQLWIKTTSEISGMNLCPLYELWKWPISQKTEKELSKLQMFLPDDFLTKMIEKRVDEIISKFGGIDSVFRTPLTIP 1048          
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Match: SMESG000026355.1 (SMESG000026355.1)

HSP 1 Score: 978.008 bits (2527), Expect = 0.000e+0
Identity = 466/722 (64.54%), Postives = 587/722 (81.30%), Query Frame = 1
Query:   25 MNEYFQKKIKQDVIVPSDSNHGHFYLLNDNVIPYALSVKNKVTVTISSIGKGRISFLATEKLVNPEFYPELQDLFQEVYEKPVENPKLLTKKYFKALIDENKLQTAMFEHFIWNAHDTLGRDLVFILLQLIKSGLQIIIGVKPWAYYYYQAQFLDSELKVLFETAGIWPSKDSDSDVWRTVTKFSTNTMPFYYRLEYAXXXXXXXXXXXXXIGNFLAEVPFHKIMSKRTFELLKSSIVDLYSNYLPYIKHLIPCSKGSITKESDQDLIKLFNYILISFFGRTLIAPGLSFYPGTFQSSDILLENFQMQLNLKYKDEVSQLGLYVVPGKHVSVQITESNSQSCRIFINFHLFNTINKEKLYKWPITKTEFIIKRNILETFAYPFGGLLSISCDANNDKVKITFINVVKVPVFDRRDKKDTKDWIQQQSVVSPWAVVSSDTLVFVLSSNAIRNLADPETFMRMYDSMVKEEFHLKGRSISTSYREIISTDIQITAGYMHAGYPIGTQIFWVTNPYNKKDYFFDKYNIEIDGEWGLMHELGHNLQEPIFTFNGAGEVNNNIFTLVAIESMTNMSSWSPNDGWVSTKVKIKDLVKYLNNGTFEEWKKTYYVALSIYAQLRNSFGWEFYSQVFRRYNELKNEIGSISDNEKIQLWIKTTSEISGMNLCPLYELWKWPISQKTEKELSKLQMFLPDDFLTKMIEKRVDEIISKFGGIDSVFRTPLTIP 2190
            +NEY QKK K ++ + SD   GHF+L ++N I YA +  N++ VTIS++GKGRI+FLA + +V+  ++P+L+DLF +VYEK VE+P  LTK+Y + +I +N  ++A+ E FIWNAH+ LG +LV  LLQL+ SGL+IIIGVKPWAY  Y  + LDSELK+LF+ AG+WPS     + W+TVTK S  TMP Y RLEYAK N  +L+N+S +I + ++++P  K++S+  F L++ SI DLYSNYLP IK LIPC +  +T ES++ L++ FN+IL S FG+ +I PGLSFYPG F S+DI L++ +M+LNL Y  EV+QLGLY +P   +SV+IT+S SQ CRIFIN+H F+   K ++YKWP T  EF I+RN +ETF++ FGGLLSISCD +NDKV+ITF NVV++P+FDRR+KKD KDWI +Q++VSPWAVV+SDTLVFVLSSNAIRNLADP +F+ ++D MVKEEFHL GR+I++S RE++S DIQI AGYMH+GYPIGT+IFWVTNP N+KDYFF  YN+ IDGEWGLMHE+GHNLQE IFTFNG GEV NNIFTLVAIESMTN SSWSP +GWV  K+ +KDLV ++NNGTF+ WK+  ++AL+IYAQ RNSFGWEF++QVFRRYN LKNE+G+ISD +KIQLWIKTTSEISGMNLCPLYELW+WPISQKTE ELSKLQMFLPDDFLTKM+EKRVDEIISKFGG  SV RTPLTIP
Sbjct:  327 VNEYLQKKNKNELKIQSDQIPGHFFLFSNNAIAYATNADNQIPVTISTVGKGRIAFLAADGVVDSIYFPQLKDLFNDVYEKQVESPTYLTKEYLQEIISKNSHESALLEPFIWNAHNELGEELVGTLLQLVNSGLRIIIGVKPWAYVTYHKKILDSELKILFQAAGVWPSLIYADNNWKTVTKHSVYTMPLYQRLEYAKLNANTLQNVSGAIVDIISKIPVEKVLSEINFNLIRESIFDLYSNYLPLIKGLIPCWEVGLTDESNKSLLRFFNFILASPFGKRIIVPGLSFYPGKFHSNDIPLKDIKMRLNLIYHKEVAQLGLYAIPRVDISVKITQSKSQFCRIFINYHHFDVSEKPEMYKWPKTYVEFSIERNKVETFSFSFGGLLSISCDEDNDKVEITFNNVVEIPLFDRRNKKDIKDWIHKQTLVSPWAVVASDTLVFVLSSNAIRNLADPNSFLELFDVMVKEEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPANEKDYFFHMYNLNIDGEWGLMHEVGHNLQESIFTFNGVGEVTNNIFTLVAIESMTNKSSWSPTNGWVPEKLYVKDLVDHINNGTFQNWKENDFLALAIYAQQRNSFGWEFFAQVFRRYNVLKNELGNISDEDKIQLWIKTTSEISGMNLCPLYELWRWPISQKTENELSKLQMFLPDDFLTKMVEKRVDEIISKFGGAKSVLRTPLTIP 1048          
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Match: SMESG000026354.1 (SMESG000026354.1)

HSP 1 Score: 966.452 bits (2497), Expect = 0.000e+0
Identity = 463/722 (64.13%), Postives = 587/722 (81.30%), Query Frame = 1
Query:   25 MNEYFQKKIKQDVIVPSDSNHGHFYLLNDNVIPYALSVKNKVTVTISSIGKGRISFLATEKLVNPEFYPELQDLFQEVYEKPVENPKLLTKKYFKALIDENKLQTAMFEHFIWNAHDTLGRDLVFILLQLIKSGLQIIIGVKPWAYYYYQAQFLDSELKVLFETAGIWPSKDSDSDVWRTVTKFSTNTMPFYYRLEYAXXXXXXXXXXXXXIGNFLAEVPFHKIMSKRTFELLKSSIVDLYSNYLPYIKHLIPCSKGSITKESDQDLIKLFNYILISFFGRTLIAPGLSFYPGTFQSSDILLENFQMQLNLKYKDEVSQLGLYVVPGKHVSVQITESNSQSCRIFINFHLFNTINKEKLYKWPITKTEFIIKRNILETFAYPFGGLLSISCDANNDKVKITFINVVKVPVFDRRDKKDTKDWIQQQSVVSPWAVVSSDTLVFVLSSNAIRNLADPETFMRMYDSMVKEEFHLKGRSISTSYREIISTDIQITAGYMHAGYPIGTQIFWVTNPYNKKDYFFDKYNIEIDGEWGLMHELGHNLQEPIFTFNGAGEVNNNIFTLVAIESMTNMSSWSPNDGWVSTKVKIKDLVKYLNNGTFEEWKKTYYVALSIYAQLRNSFGWEFYSQVFRRYNELKNEIGSISDNEKIQLWIKTTSEISGMNLCPLYELWKWPISQKTEKELSKLQMFLPDDFLTKMIEKRVDEIISKFGGIDSVFRTPLTIP 2190
            +NEY QKK K ++ + SD N GHF+L ++N I YA +  N++ VTIS++GKGRI+FLA + +V+  ++P+L+DLF +VYEK VE+P  LTK+Y + +I +N  ++++ E FIW+AH+ LG +LV  LLQL+ SGL+IIIGVKPWAY YY+    +SELK+LF+ AG+WPS     + W+TVTK S  TMP Y RLEYAK N  +L+N+S +I + ++++P  K++S+  F L++ SI DLYSNYLP IK LIPC +  +T ES++ L++ FN+IL S FG+ +I PGLSFYPG F S+DI L++ +M+LNL Y  EV+QLGLY +P   +SV+IT+S SQ CRIFIN+H F+   K ++YKWP T  EF I+RN +E F++ FGGLLSISCD +NDKV+ITF NVV++P+FDRR+KKD KDWI +Q++VSPWAVV+SDTLVFVLSSNAIRNLADP +F+ ++D MVKEEFHL GR+I++S RE++S DIQI AGYMH+GYPIGT+IFWVTNP N+KDYFF  YN+ IDGEWGLMHE+GHNLQE IFTFNG GEV NNIFTLVAIESMTN SSWSP +GWV  K+ +KDLV ++NNGTF+ WK+  ++AL+IYAQ RNSFGWEF++QVFRRYN LKNE+G+ISD +KIQLWIKTTSEISGMNLCPLYELW+WPISQKTE ELSKLQMFLPDDFLTKM+EKRVDEIISKFGG  SV RTPLTIP
Sbjct:   11 VNEYLQKKSKNELKIQSDVNPGHFFLFSNNAIAYATNADNQIPVTISTVGKGRIAFLAADGVVDSIYFPQLKDLFNDVYEKQVESPTYLTKEYLQEIISKNSSKSSILEPFIWSAHNELGEELVGTLLQLVNSGLRIIIGVKPWAYDYYKKNIFESELKILFQAAGVWPSLIYADNNWKTVTKHSVYTMPLYQRLEYAKLNANTLQNVSGAIVDIISKIPVEKVLSEINFNLIRESIFDLYSNYLPLIKGLIPCWEVGLTDESNKSLLRFFNFILASPFGKRIIVPGLSFYPGKFHSNDIPLKDIKMRLNLIYHKEVAQLGLYAIPRVDISVKITQSKSQFCRIFINYHHFDVSEKPEMYKWPKTYVEFSIERNKVEIFSFSFGGLLSISCDEDNDKVEITFNNVVEIPLFDRRNKKDIKDWIHKQTLVSPWAVVASDTLVFVLSSNAIRNLADPNSFLELFDVMVKEEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPANEKDYFFHMYNLNIDGEWGLMHEVGHNLQESIFTFNGVGEVTNNIFTLVAIESMTNKSSWSPTNGWVPEKLYVKDLVDHINNGTFQNWKENDFLALAIYAQQRNSFGWEFFAQVFRRYNVLKNELGNISDEDKIQLWIKTTSEISGMNLCPLYELWRWPISQKTENELSKLQMFLPDDFLTKMVEKRVDEIISKFGGAKSVLRTPLTIP 732          
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Match: SMESG000026376.1 (SMESG000026376.1)

HSP 1 Score: 779.63 bits (2012), Expect = 0.000e+0
Identity = 384/725 (52.97%), Postives = 515/725 (71.03%), Query Frame = 1
Query:   19 KIMNEYFQKKIKQDVIVPSDSNHGHFYLLNDNVIPYALSVKNKVTVTISSIGKGRISFLATEKLVNPEFYPELQDLFQEVYEKPVENPKLLTKKYFKALIDENKLQTAMFEHFIWNAHDTLGRDLVFILLQLIKSGLQIIIGVKPWAYYYYQAQFLDSELKVLFETAGIWPSKDSDSDVWRTVTKFSTNTMPFYYRLEYAXXXXXXXXXXXXXIGNFLAEVPFHKIMSKRTFELLKSSIVDLYSNYLPYIKHLIPCSKGSITKESDQDLIKLFNYILISFFGRTLIAPGLSFYPGTFQSSDILLENFQMQLNLKYKDEVSQLGLYVVPGKHVSVQITESNSQSCRIFINFHLFNTINKEKLYKWPITKTEFIIKRNILETFAYPFGGLLSISCDANNDKVKITFINVVKVPVFDRRDKKDTKDWIQQQSVVSPWAVVSSDTLVFVLSSNAIRNLADPETFMRMYDSMVKEEFHLKGRSISTSYREIISTDIQITAGYMHAGYPIGTQIFWVTNPYNKKDYFFDKYNIEIDGEWGLMHELGHNLQEPIFTFNGAGEVNNNIFTLVAIESMTNMSSWSPNDGWVSTKVKIKDLVKYLNNGTFE-EWKKTYYVALSIYAQLRNSFGWEFYSQVFRRYNELKNEIGSISDNEKIQLWIKTTSEISGMNLCPLYELWKWPISQKTEKELSKLQMFLPDDFLTKMIEKRVDEIISKFGGIDSVFRTPLTIP 2190
            K M EY+Q K K++V        G+FYLL DN I YA++  NK+++TIS++GKGRI F+A E  +N   Y  L + FQ+V++KPV  PKLL K Y + +I ENK  + + E FIWNAH T G+ LV +LL+ IKSGL+IIIG KPW+Y  Y    LDSE+K+LF  AGIWPS     D ++ VT+ S  TM    + EYAK N+ ++ ++  +      ++   + + K+ F+ +K  I DLY++Y P+I+ L PC   +I+K+SD+  +K F+YIL+S  G+ LI P L+ YPG FQS++    N +M+LNL YK EV+ LGLY+ P    SV+I +S S  C I++N H FN  +K ++ KWP+T   F IKR   ET  +PFGGL+SISCD NNDKV+I F NV+++P +DRR+K+++KDWI++Q + SPWAV++ D ++F+L+S AIRNLADPET ++MYDSM KEEFHL+G S   S R I+S+DIQI AGYMH+GYPIGTQI++  NPY K  YFF+K  ++ DG WGLMHE+GHNLQE  FTFNG GE   NIF+++A ESMTN +SWS   GW   ++ I+ + +YL NGTF+  W++ ++VAL IYAQ++N FGWEFY+QVFRRYN L ++  SIS++EKIQLWIK TSEIS MNLCPLYELWKWPIS  TE+ELSK  MFLPDDF+TK +EKR + II + G   SV R PL +P
Sbjct:  324 KKMKEYYQNKNKKEVTFSLARYPGYFYLLKDNAIAYAVNANNKISMTISTVGKGRIGFMAGEDSINLGSYKNLLNYFQDVFDKPVVKPKLLRKSYLQEIISENKSLSVLSEPFIWNAHQTFGQGLVNVLLEYIKSGLRIIIGFKPWSYESYVKPILDSEIKILFYAAGIWPSLHYIEDKFKPVTQHSIYTMSLDKKFEYAKINIKNMNDVLAAYREVFDDIYIERSLDKKDFDSMKKVIHDLYTDYWPFIQSLTPCLNYAISKQSDKGFLKFFSYILLSEIGKDLIPPALALYPGKFQSTNPPFVNIKMKLNLLYKYEVAPLGLYLYPRLKTSVKIIQSKSTRCYIYVNHHHFNIADKSEVTKWPVTYKYFTIKRGKWETIQFPFGGLMSISCDENNDKVEIIFKNVIQIPYYDRRNKENSKDWIRKQKIESPWAVLAGDAVIFILASTAIRNLADPETILQMYDSMFKEEFHLRGTSFPLSRRGIVSSDIQIGAGYMHSGYPIGTQIYYNNNPY-KSGYFFNKEILKKDGAWGLMHEMGHNLQEGTFTFNGTGETTTNIFSIIATESMTNQNSWSQTSGWFHERLTIESVQEYLINGTFDNNWRENHFVALCIYAQIKNYFGWEFYAQVFRRYNALTHKQRSISEDEKIQLWIKITSEISKMNLCPLYELWKWPISDATEQELSKFPMFLPDDFVTKSVEKRTNNIIRRRG---SVIRQPLPVP 1044          
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Match: SMESG000026362.1 (SMESG000026362.1)

HSP 1 Score: 777.704 bits (2007), Expect = 0.000e+0
Identity = 380/723 (52.56%), Postives = 523/723 (72.34%), Query Frame = 1
Query:   25 MNEYFQKKIKQDVIVPSDSNHGHFYLLNDNVIPYALSVKNKVTVTISSIGKGRISFLATEKLVNPEFYPELQDLFQEVYEKPVENPKLLTKKYFKALIDENKLQTAMFEHFIWNAHDTLGRDLVFILLQLIKSGLQIIIGVKPWAYYYYQAQFLDSELKVLFETAGIWPSKDSDSDVWRTVTKFSTNTMPFYYRLEYAXXXXXXXXXXXXXIGNFLAEVPFHKIMSKRTFELLKSSIVDLYSNYLPYIKHLIPCSKGSITKESDQDLIKLFNYILISFFGRTLIAPGLSFYPGTFQSSDILLENFQMQLNLKYKDEVSQLGLYVVPGKHVSVQITESNSQSCRIFINFHLFNTINKEKLYKWPITKTEFIIKRNILETFAYPFGGLLSISCDANNDKVKITFINVVKVPVFDRRDKKDTKDWIQQQSVVSPWAVVSSDTLVFVLSSNAIRNLADPETFMRMYDSMVKEEFHLKGRSISTSYREIISTDIQITAGYMHAGYPIGTQIFWVTNPYNKKDYFFDKYNIEIDGEWGLMHELGHNLQEPIFTFNGAGEVNNNIFTLVAIESMTNMSSWSPNDGWVSTKVKIKDLVKYLNNGTFEE-WKKTYYVALSIYAQLRNSFGWEFYSQVFRRYNELKNEIGSISDNEKIQLWIKTTSEISGMNLCPLYELWKWPISQKTEKELSKLQMFLPDDFLTKMIEKRVDEIISKFGGIDSVFRTPLTIP 2190
            MNEY+QKK K+++ +      GHFYLL DN I YA++  NK+++TIS++GKGRI+F+ +E L+N + Y  L D FQ+V++KPVENPKLL K Y + +I ENK ++ + + FIW+ +  LG  LV ILL+ IKSGL+IIIG KPW+Y   +     SEL +LF  AG+WPS     D ++ VT+ S  TM    R EYAKKN   + ++++       ++   + + KR F+L+K+SI DLY++Y P+I+ L PC +  ++ +SD+  +K F+YIL++ FG+ L+ P LS YPG FQS++  + N +M+LNL YK+EV+ LGLY+ P     V+I +S S  C I++N H F+  +K ++ KWP+T   F I+R   ET  +PFGGL+SISC+ NNDKV+I F NV+++P +DRR+K+++KDWI++Q + +PWAV++ DT+VFV+SS AIRNLADPET ++MYDSM KEE HL+G S   S R+I+++DIQI AGYMH+GYPIGTQIF+  NP+ +  YFF+K  ++ +G WGL+HELGHNLQ  IFTF+G  E  NNIF+++A  SMTN SSWSP  GW   ++ I+ + +YL +GTF++ W+  ++VAL IYAQL N+FGWEFY+QVFRRYN L NE+G ISD+  IQLWIKTTSEIS MNLCPLYELWKWPIS   EKELSK  MFLPDDF+TK +E R+++II K G   SV R PL +P
Sbjct:  326 MNEYYQKKSKKELQISLGRFPGHFYLLKDNAIVYAMNANNKISMTISTVGKGRIAFMGSEDLINAKPYKSLLDFFQDVFDKPVENPKLLNKYYLQKIISENKSESILSQPFIWSPYRLLGPKLVGILLEYIKSGLRIIIGFKPWSYDDDKRPLSSSELTILFHAAGVWPSLKYVQDKFQPVTQHSIYTMSLDKRFEYAKKNNEIMNDVTEMFQKVFDDISIERSLDKRNFDLMKNSIHDLYADYWPFIQSLTPCLEVPVSAQSDRYFLKFFSYILLTEFGKDLMPPALSLYPGKFQSTNPPVVNIKMKLNLLYKNEVAPLGLYLYPRHKTPVKIIQSKSTRCYIYVNHHQFHVADKSEVTKWPVTYKYFTIERGKWETIQFPFGGLMSISCNENNDKVEIIFKNVIQIPYYDRRNKENSKDWIRKQKIKAPWAVLAGDTMVFVISSIAIRNLADPETLLQMYDSMFKEELHLRGTSFPLSRRDILTSDIQIKAGYMHSGYPIGTQIFYNNNPH-RPGYFFNKKLLKKEGAWGLVHELGHNLQHDIFTFSGTIETTNNIFSIIATVSMTNESSWSPTSGWFKERLTIERVQEYLISGTFDKNWRGNHFVALCIYAQLINNFGWEFYAQVFRRYNVLANELGGISDDAIIQLWIKTTSEISKMNLCPLYELWKWPISNTNEKELSKFPMFLPDDFVTKSVENRINDIIRKRG---SVIRQPLPVP 1044          
The following BLAST results are available for this feature:
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TCAF29.571e-3726.76TRPM8 channel associated factor 2 [Source:HGNC Sym... [more]
TCAF29.571e-3726.76TRPM8 channel associated factor 2 [Source:HGNC Sym... [more]
TCAF21.075e-3626.76TRPM8 channel associated factor 2 [Source:HGNC Sym... [more]
TCAF2C1.581e-3626.76TRPM8 channel associated factor 2C [Source:HGNC Sy... [more]
TCAF11.995e-3227.76TRPM8 channel associated factor 1 [Source:HGNC Sym... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-210b2.32.050e-3327.32si:ch211-210b2.3 [Source:ZFIN;Acc:ZDB-GENE-131122-... [more]
zgc:1621933.333e-3326.53zgc:162193 [Source:NCBI gene;Acc:323315][more]
zgc:1621933.333e-3326.53zgc:162193 [Source:NCBI gene;Acc:323315][more]
zgc:1621933.333e-3326.53zgc:162193 [Source:NCBI gene;Acc:323315][more]
si:ch211-210b2.24.841e-3327.58si:ch211-210b2.2 [Source:ZFIN;Acc:ZDB-GENE-131118-... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000045101.12.231e-3828.65TRPM8 channel-associated factor 2 [Source:NCBI gen... [more]
ENSXETT00000002244.11.523e-3626.60TRPM8 channel-associated factor homolog [Source:NC... [more]
ENSXETT00000045059.11.231e-3527.32TRPM8 channel-associated factor 2 [Source:NCBI gen... [more]
ENSXETT00000045084.11.122e-3427.06TRPM8 channel-associated factor 2 [Source:NCBI gen... [more]
ENSXETT00000045039.12.301e-3427.06TRPM8 channel-associated factor 2 [Source:NCBI gen... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tcaf15.739e-3629.05TRPM8 channel-associated factor 1 [Source:MGI Symb... [more]
Tcaf15.739e-3629.05TRPM8 channel-associated factor 1 [Source:MGI Symb... [more]
Tcaf15.739e-3629.05TRPM8 channel-associated factor 1 [Source:MGI Symb... [more]
Tcaf31.146e-3428.57TRPM8 channel-associated factor 3 [Source:MGI Symb... [more]
Tcaf21.257e-3125.88TRPM8 channel-associated factor 2 [Source:MGI Symb... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6P6V7|TCAF3_RAT9.831e-3730.03TRPM8 channel-associated factor 3 OS=Rattus norveg... [more]
sp|A6NFQ2|TCAF2_HUMAN5.163e-3626.76TRPM8 channel-associated factor 2 OS=Homo sapiens ... [more]
sp|Q8BNE1|TCAF1_MOUSE4.174e-3529.05TRPM8 channel-associated factor 1 OS=Mus musculus ... [more]
sp|Q5XHI4|TCAF_XENLA3.524e-3426.30TRPM8 channel-associated factor homolog OS=Xenopus... [more]
sp|Q6QR59|TCAF3_MOUSE8.017e-3428.57TRPM8 channel-associated factor 3 OS=Mus musculus ... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4A0M81.045e-6631.89Peptidase M60 domain-containing protein OS=Lottia ... [more]
A0A1S3I0H41.955e-6633.64TRPM8 channel-associated factor 2-like OS=Lingula ... [more]
V3ZHF75.346e-6430.44Peptidase M60 domain-containing protein OS=Lottia ... [more]
A0A1S3KG341.141e-6333.18TRPM8 channel-associated factor 2 OS=Lingula ungui... [more]
R7UHN91.897e-6326.60Peptidase M60 domain-containing protein OS=Capitel... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:ch211-210b2.35.890e-2925.20si:ch211-210b2.3 [Source:ZFIN;Acc:ZDB-GENE-131122-... [more]
ENSAMXT00000051129.11.933e-2231.10pep primary_assembly:Astyanax_mexicanus-2.0:1:5658... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000000976.11.890e-3224.86pep scaffold:Pmarinus_7.0:GL479898:35358:38300:-1 ... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:ch211-210b2.38.739e-3327.18TRPM8 channel-associated factor homolog [Source:NC... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026377.10.000e+0100.00SMESG000026377.1[more]
SMESG000026355.10.000e+064.54SMESG000026355.1[more]
SMESG000026354.10.000e+064.13SMESG000026354.1[more]
SMESG000026376.10.000e+052.97SMESG000026376.1[more]
SMESG000026362.10.000e+052.56SMESG000026362.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004932 ID=SMED30004932|Name=Peptidase M60 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2191bp
ATGAGGAAAGGCAAAATGAAAATAATGAATGAATATTTTCAAAAGAAAAT
CAAACAAGATGTTATAGTCCCATCAGATTCCAATCATGGACACTTTTATC
TTTTGAATGATAACGTAATTCCATACGCGTTAAGTGTAAAGAATAAAGTT
ACCGTGACAATTTCGTCAATCGGAAAAGGTCGGATATCGTTTTTAGCGAC
GGAAAAATTAGTTAATCCTGAATTCTATCCCGAACTGCAAGATCTTTTCC
AAGAGGTATATGAAAAGCCTGTAGAAAATCCTAAACTACTTACAAAAAAA
TATTTTAAAGCCCTAATTGATGAAAATAAATTGCAAACTGCAATGTTTGA
GCATTTTATTTGGAATGCTCACGATACATTGGGACGTGATTTGGTTTTTA
TTCTACTCCAATTAATTAAATCAGGATTACAAATTATAATTGGAGTGAAA
CCATGGGCATATTATTATTACCAAGCGCAATTTTTGGACAGCGAACTGAA
AGTTCTTTTTGAAACGGCTGGTATTTGGCCGTCAAAAGATTCTGATAGTG
ATGTTTGGAGGACAGTTACAAAATTCAGTACAAATACTATGCCGTTTTAT
TACAGGTTAGAGTATGCCAAAAAAAACTTAATGAGTCTAAAAAACCTTTC
AAAATCAATTGGTAATTTCCTTGCTGAAGTTCCATTTCATAAGATAATGA
GTAAAAGAACCTTTGAGTTATTAAAGTCAAGCATTGTTGATTTATATTCA
AATTATTTGCCATATATTAAGCATCTAATACCTTGTTCAAAGGGTTCAAT
AACAAAAGAATCCGACCAAGATCTCATCAAACTATTCAATTATATTTTAA
TTTCTTTTTTCGGAAGAACTTTAATTGCTCCAGGATTATCGTTTTATCCT
GGCACTTTTCAATCAAGTGATATTTTACTTGAAAACTTCCAAATGCAACT
CAATTTAAAATATAAAGACGAAGTGTCTCAACTCGGACTTTACGTTGTCC
CAGGAAAACATGTTTCAGTGCAAATTACTGAATCAAATTCTCAGTCATGC
CGAATATTTATTAATTTCCATTTATTTAATACTATAAATAAAGAGAAGCT
GTATAAATGGCCGATCACAAAAACTGAATTCATAATCAAAAGAAACATAT
TGGAAACGTTTGCTTATCCCTTTGGTGGGCTGTTATCCATATCTTGTGAT
GCTAATAATGATAAAGTAAAAATAACTTTCATTAATGTAGTCAAAGTGCC
AGTATTCGATAGAAGAGACAAGAAAGACACAAAGGATTGGATTCAACAAC
AAAGTGTAGTTTCACCATGGGCCGTTGTATCGAGTGACACTCTTGTATTT
GTGTTATCGTCAAATGCCATTCGTAATTTAGCCGACCCGGAAACATTTAT
GAGGATGTATGATTCTATGGTTAAAGAAGAATTCCATTTGAAAGGAAGAT
CAATTTCTACGAGTTACAGAGAAATAATATCCACAGATATACAAATAACA
GCTGGATATATGCATGCAGGATATCCTATCGGTACACAAATATTCTGGGT
CACGAATCCCTATAATAAAAAAGATTACTTTTTTGACAAATATAACATTG
AAATCGATGGTGAATGGGGTTTGATGCATGAGTTGGGACATAATCTACAA
GAGCCCATATTCACTTTCAATGGGGCTGGTGAAGTAAACAACAACATATT
TACTTTAGTGGCAATTGAATCTATGACCAATATGAGTTCTTGGTCTCCAA
ATGATGGTTGGGTTTCTACAAAAGTTAAAATTAAGGATCTTGTTAAGTAT
CTTAATAATGGAACATTTGAAGAATGGAAAAAGACTTACTATGTCGCGTT
GTCTATCTATGCACAATTAAGAAATAGTTTTGGATGGGAGTTTTATTCTC
AAGTATTTCGACGGTATAATGAACTTAAAAACGAGATAGGAAGCATTTCT
GATAACGAAAAAATTCAGCTGTGGATCAAAACAACATCTGAAATATCCGG
AATGAATTTGTGTCCCTTATATGAGCTGTGGAAATGGCCTATTAGTCAGA
AAACTGAAAAAGAATTATCCAAACTTCAAATGTTTCTCCCAGATGATTTC
CTTACCAAAATGATAGAAAAAAGAGTAGATGAAATAATTTCCAAATTTGG
TGGAATAGATTCAGTTTTCCGTACGCCTTTGACAATTCCAG
back to top

protein sequence of SMED30004932-orf-1

>SMED30004932-orf-1 ID=SMED30004932-orf-1|Name=SMED30004932-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=730bp
MRKGKMKIMNEYFQKKIKQDVIVPSDSNHGHFYLLNDNVIPYALSVKNKV
TVTISSIGKGRISFLATEKLVNPEFYPELQDLFQEVYEKPVENPKLLTKK
YFKALIDENKLQTAMFEHFIWNAHDTLGRDLVFILLQLIKSGLQIIIGVK
PWAYYYYQAQFLDSELKVLFETAGIWPSKDSDSDVWRTVTKFSTNTMPFY
YRLEYAKKNLMSLKNLSKSIGNFLAEVPFHKIMSKRTFELLKSSIVDLYS
NYLPYIKHLIPCSKGSITKESDQDLIKLFNYILISFFGRTLIAPGLSFYP
GTFQSSDILLENFQMQLNLKYKDEVSQLGLYVVPGKHVSVQITESNSQSC
RIFINFHLFNTINKEKLYKWPITKTEFIIKRNILETFAYPFGGLLSISCD
ANNDKVKITFINVVKVPVFDRRDKKDTKDWIQQQSVVSPWAVVSSDTLVF
VLSSNAIRNLADPETFMRMYDSMVKEEFHLKGRSISTSYREIISTDIQIT
AGYMHAGYPIGTQIFWVTNPYNKKDYFFDKYNIEIDGEWGLMHELGHNLQ
EPIFTFNGAGEVNNNIFTLVAIESMTNMSSWSPNDGWVSTKVKIKDLVKY
LNNGTFEEWKKTYYVALSIYAQLRNSFGWEFYSQVFRRYNELKNEIGSIS
DNEKIQLWIKTTSEISGMNLCPLYELWKWPISQKTEKELSKLQMFLPDDF
LTKMIEKRVDEIISKFGGIDSVFRTPLTIP
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005575cellular_component
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR042279Pep_M60_3
IPR035423M60-like_N
IPR031161Peptidase_M60_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR031161Peptidase family M60 domainSMARTSM01276M60_like_2coord: 323..628
e-value: 4.5E-45
score: 165.7
IPR031161Peptidase family M60 domainPFAMPF13402Peptidase_M60coord: 415..678
e-value: 3.2E-40
score: 138.4
IPR031161Peptidase family M60 domainPROSITEPS51723PEPTIDASE_M60coord: 323..628
score: 54.488
IPR042279Peptidase M60, enhancin-like domain 3GENE3DG3DSA:1.10.390.30coord: 550..712
e-value: 6.4E-26
score: 93.2
IPR035423M60-like domain, N-terminalPFAMPF17291M60-like_Ncoord: 313..406
e-value: 3.1E-8
score: 33.5
NoneNo IPR availableGENE3DG3DSA:1.10.1740.210coord: 420..548
e-value: 2.0E-6
score: 30.2
NoneNo IPR availablePANTHERPTHR15730:SF5SI:CH211-210B2.2-RELATEDcoord: 296..693
NoneNo IPR availablePANTHERPTHR15730EXPERIMENTAL AUTOIMMUNE PROSTATITIS ANTIGEN 2-RELATEDcoord: 296..693
NoneNo IPR availableCDDcd18708PIN_VapC-likecoord: 618..698
e-value: 0.00103682
score: 37.3378