SMED30004931

Overview
NameSMED30004931
Smed IDSMED30004931
Length (bp)720
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30004931 (SMED30004931) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30004931 (SMED30004931) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30004931 (SMED30004931) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30004931 (SMED30004931) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004931

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30004931h1SMcG0007836 SmedASXL_012963SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30004931h1SMcG0007836 SmedASXL_012963SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30004931h1SMcG0007836 SmedASXL_071880SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30004931h1SMcG0007836 SmedASXL_071880SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30004931 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.004478:3707..4306 -2973
Homology
BLAST of SMED30004931 vs. Ensembl Human
Match: ZFR2 (zinc finger RNA binding protein 2 [Source:HGNC Symbol;Acc:HGNC:29189])

HSP 1 Score: 51.9878 bits (123), Expect = 3.066e-7
Identity = 34/114 (29.82%), Postives = 49/114 (42.98%), Query Frame = 3
Query:  198 CDACNISCSSQTTYDFHIKGKRHTKTLTKKALSEIDKATNYTNFEENRISTDSVQIPAIIQQSQILYKPKLMCEICTVNCPNPEQYEKHLEGLRHQKRLKLNRYIELKNNKDPS 539
            CD C ISC+   TY  H+ G++H K           +A   T  + N  S   VQ              +L C++C V+C   + Y  H+ G +HQK L  +R    +   DPS
Sbjct:  273 CDICKISCAGPQTYREHLGGQKHRK----------KEAAQKTGVQPNG-SPRGVQA-------------QLHCDLCAVSCTGADAYAAHIRGSKHQKGLLSHR----QQAADPS 358          
BLAST of SMED30004931 vs. Ensembl Human
Match: ZFR2 (zinc finger RNA binding protein 2 [Source:HGNC Symbol;Acc:HGNC:29189])

HSP 1 Score: 51.2174 bits (121), Expect = 7.964e-7
Identity = 31/102 (30.39%), Postives = 45/102 (44.12%), Query Frame = 3
Query:  198 CDACNISCSSQTTYDFHIKGKRHTKTLTKKALSEIDKATNYTNFEENRISTDSVQIPAIIQQSQILYKPKLMCEICTVNCPNPEQYEKHLEGLRHQKRLKLN 503
            CD C ISC+   TY  H+ G++H K           +A   T  + N  S   VQ              +L C++C V+C   + Y  H+ G +HQK  KL+
Sbjct:  273 CDICKISCAGPQTYREHLGGQKHRKK----------EAAQKTGVQPNG-SPRGVQ-------------AQLHCDLCAVSCTGADAYAAHIRGSKHQKVFKLH 350          
BLAST of SMED30004931 vs. Ensembl Human
Match: ZFR (zinc finger RNA binding protein [Source:HGNC Symbol;Acc:HGNC:17277])

HSP 1 Score: 50.0618 bits (118), Expect = 1.725e-6
Identity = 30/102 (29.41%), Postives = 45/102 (44.12%), Query Frame = 3
Query:  198 CDACNISCSSQTTYDFHIKGKRHTKTLTK-KALSEIDKATNYTNFEENRISTDSVQIPAIIQQSQILYKPKLMCEICTVNCPNPEQYEKHLEGLRHQKRLKL 500
            CD C ISC+   TY  H++G++H K     KA      + + T   +N                      +L CE+C V+C   + Y  H+ G +HQK +KL
Sbjct:  333 CDVCKISCAGPQTYKEHLEGQKHKKKEAALKASQNTSSSNSSTRGTQN----------------------QLRCELCDVSCTGADAYAAHIRGAKHQKVVKL 412          
BLAST of SMED30004931 vs. Ensembl Celegans
Match: Y95B8A.8 (pep chromosome:WBcel235:I:853451:872103:1 gene:WBGene00022388.1 transcript:Y95B8A.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y95B8A.8)

HSP 1 Score: 47.3654 bits (111), Expect = 5.108e-6
Identity = 28/105 (26.67%), Postives = 52/105 (49.52%), Query Frame = 3
Query:  198 CDACNISCSSQTTYDFHIKGKRHTKTLTKKALSEIDKATNYTNFEENRISTDSVQIPAIIQQSQILYKPKLMCEICTVNCPNPEQYEKHLEGLRHQKRLKLNRYI 512
            C+ C ISC+   TY  H++G+RH K   K+A+++  +    T+  +N++S                Y+    C++C V C   + Y  H+ G +H K  +L++ +
Sbjct:  129 CEVCKISCAGGITYKEHLEGQRHKK---KEAMAK--QGIPSTSLAKNKLS----------------YR----CDLCDVTCTGQDTYSAHVRGGKHLKTAQLHKKL 208          
BLAST of SMED30004931 vs. Ensembl Fly
Match: Zn72D (gene:FBgn0263603 transcript:FBtr0333294)

HSP 1 Score: 49.2914 bits (116), Expect = 1.324e-6
Identity = 27/103 (26.21%), Postives = 47/103 (45.63%), Query Frame = 3
Query:  198 CDACNISCSSQTTYDFHIKGKRHTKTLTKKALSEIDKATNYTNFEENRISTDSVQIPAIIQQSQILYKPKLMCEICTVNCPNPEQYEKHLEGLRHQKRLKLNR 506
            C+ C ISC+   TY  H++G++H     KK  + +  + +  +  +NR +                      CE+C V C   + Y  H+ G +HQK +KL++
Sbjct:  207 CEVCKISCAGPQTYREHLEGQKH-----KKREASLKMSASANSATQNRGNN-------------------YHCELCDVTCTGTDAYAAHVRGAKHQKVVKLHQ 285          

HSP 2 Score: 46.2098 bits (108), Expect = 4.438e-6
Identity = 19/54 (35.19%), Postives = 34/54 (62.96%), Query Frame = 3
Query:  414 CEICTVNCPNPEQYEKHLEGLRHQKR---LKLNRYI-ELKNNKDPSVYCDICDL 563
            CE+C ++C  P+ Y +HLEG +H+KR   LK++        N+  + +C++CD+
Sbjct:  207 CEVCKISCAGPQTYREHLEGQKHKKREASLKMSASANSATQNRGNNYHCELCDV 260          

HSP 3 Score: 21.9422 bits (45), Expect = 4.438e-6
Identity = 8/24 (33.33%), Postives = 12/24 (50.00%), Query Frame = 1
Query:  634 HCGYCNVSLKSANDAIAHYQTQKH 705
            HC  C+V+    +   AH +  KH
Sbjct:  254 HCELCDVTCTGTDAYAAHVRGAKH 277          
BLAST of SMED30004931 vs. Ensembl Fly
Match: Zn72D (gene:FBgn0263603 transcript:FBtr0310582)

HSP 1 Score: 49.2914 bits (116), Expect = 1.324e-6
Identity = 27/103 (26.21%), Postives = 47/103 (45.63%), Query Frame = 3
Query:  198 CDACNISCSSQTTYDFHIKGKRHTKTLTKKALSEIDKATNYTNFEENRISTDSVQIPAIIQQSQILYKPKLMCEICTVNCPNPEQYEKHLEGLRHQKRLKLNR 506
            C+ C ISC+   TY  H++G++H     KK  + +  + +  +  +NR +                      CE+C V C   + Y  H+ G +HQK +KL++
Sbjct:  207 CEVCKISCAGPQTYREHLEGQKH-----KKREASLKMSASANSATQNRGNN-------------------YHCELCDVTCTGTDAYAAHVRGAKHQKVVKLHQ 285          

HSP 2 Score: 46.2098 bits (108), Expect = 4.438e-6
Identity = 19/54 (35.19%), Postives = 34/54 (62.96%), Query Frame = 3
Query:  414 CEICTVNCPNPEQYEKHLEGLRHQKR---LKLNRYI-ELKNNKDPSVYCDICDL 563
            CE+C ++C  P+ Y +HLEG +H+KR   LK++        N+  + +C++CD+
Sbjct:  207 CEVCKISCAGPQTYREHLEGQKHKKREASLKMSASANSATQNRGNNYHCELCDV 260          

HSP 3 Score: 21.9422 bits (45), Expect = 4.438e-6
Identity = 8/24 (33.33%), Postives = 12/24 (50.00%), Query Frame = 1
Query:  634 HCGYCNVSLKSANDAIAHYQTQKH 705
            HC  C+V+    +   AH +  KH
Sbjct:  254 HCELCDVTCTGTDAYAAHVRGAKH 277          
BLAST of SMED30004931 vs. Ensembl Fly
Match: Zn72D (gene:FBgn0263603 transcript:FBtr0310581)

HSP 1 Score: 49.2914 bits (116), Expect = 1.324e-6
Identity = 27/103 (26.21%), Postives = 47/103 (45.63%), Query Frame = 3
Query:  198 CDACNISCSSQTTYDFHIKGKRHTKTLTKKALSEIDKATNYTNFEENRISTDSVQIPAIIQQSQILYKPKLMCEICTVNCPNPEQYEKHLEGLRHQKRLKLNR 506
            C+ C ISC+   TY  H++G++H     KK  + +  + +  +  +NR +                      CE+C V C   + Y  H+ G +HQK +KL++
Sbjct:  207 CEVCKISCAGPQTYREHLEGQKH-----KKREASLKMSASANSATQNRGNN-------------------YHCELCDVTCTGTDAYAAHVRGAKHQKVVKLHQ 285          

HSP 2 Score: 46.2098 bits (108), Expect = 4.438e-6
Identity = 19/54 (35.19%), Postives = 34/54 (62.96%), Query Frame = 3
Query:  414 CEICTVNCPNPEQYEKHLEGLRHQKR---LKLNRYI-ELKNNKDPSVYCDICDL 563
            CE+C ++C  P+ Y +HLEG +H+KR   LK++        N+  + +C++CD+
Sbjct:  207 CEVCKISCAGPQTYREHLEGQKHKKREASLKMSASANSATQNRGNNYHCELCDV 260          

HSP 3 Score: 21.9422 bits (45), Expect = 4.438e-6
Identity = 8/24 (33.33%), Postives = 12/24 (50.00%), Query Frame = 1
Query:  634 HCGYCNVSLKSANDAIAHYQTQKH 705
            HC  C+V+    +   AH +  KH
Sbjct:  254 HCELCDVTCTGTDAYAAHVRGAKH 277          
BLAST of SMED30004931 vs. Ensembl Fly
Match: Zn72D (gene:FBgn0263603 transcript:FBtr0075494)

HSP 1 Score: 49.2914 bits (116), Expect = 1.324e-6
Identity = 27/103 (26.21%), Postives = 47/103 (45.63%), Query Frame = 3
Query:  198 CDACNISCSSQTTYDFHIKGKRHTKTLTKKALSEIDKATNYTNFEENRISTDSVQIPAIIQQSQILYKPKLMCEICTVNCPNPEQYEKHLEGLRHQKRLKLNR 506
            C+ C ISC+   TY  H++G++H     KK  + +  + +  +  +NR +                      CE+C V C   + Y  H+ G +HQK +KL++
Sbjct:  207 CEVCKISCAGPQTYREHLEGQKH-----KKREASLKMSASANSATQNRGNN-------------------YHCELCDVTCTGTDAYAAHVRGAKHQKVVKLHQ 285          

HSP 2 Score: 46.2098 bits (108), Expect = 4.438e-6
Identity = 19/54 (35.19%), Postives = 34/54 (62.96%), Query Frame = 3
Query:  414 CEICTVNCPNPEQYEKHLEGLRHQKR---LKLNRYI-ELKNNKDPSVYCDICDL 563
            CE+C ++C  P+ Y +HLEG +H+KR   LK++        N+  + +C++CD+
Sbjct:  207 CEVCKISCAGPQTYREHLEGQKHKKREASLKMSASANSATQNRGNNYHCELCDV 260          

HSP 3 Score: 21.9422 bits (45), Expect = 4.438e-6
Identity = 8/24 (33.33%), Postives = 12/24 (50.00%), Query Frame = 1
Query:  634 HCGYCNVSLKSANDAIAHYQTQKH 705
            HC  C+V+    +   AH +  KH
Sbjct:  254 HCELCDVTCTGTDAYAAHVRGAKH 277          
BLAST of SMED30004931 vs. Ensembl Zebrafish
Match: zfr (zinc finger RNA binding protein [Source:NCBI gene;Acc:321659])

HSP 1 Score: 50.0618 bits (118), Expect = 1.210e-6
Identity = 29/101 (28.71%), Postives = 50/101 (49.50%), Query Frame = 3
Query:  198 CDACNISCSSQTTYDFHIKGKRHTKTLTKKALSEIDKATNYTNFEENRISTDSVQIPAIIQQSQILYKPKLMCEICTVNCPNPEQYEKHLEGLRHQKRLKL 500
            CD C ISC+   TY  H++G++H K   K+A  ++ ++++ ++   +       Q               L CE+C V+C   + Y  H+ G +HQK +KL
Sbjct:  304 CDVCKISCAGPQTYKEHLEGQKHKK---KEAALKVSQSSSSSSGGGSSARGTQNQ---------------LRCELCDVSCTGADAYAAHIRGAKHQKVVKL 386          
BLAST of SMED30004931 vs. Ensembl Zebrafish
Match: zfr (zinc finger RNA binding protein [Source:NCBI gene;Acc:321659])

HSP 1 Score: 50.0618 bits (118), Expect = 1.236e-6
Identity = 29/101 (28.71%), Postives = 50/101 (49.50%), Query Frame = 3
Query:  198 CDACNISCSSQTTYDFHIKGKRHTKTLTKKALSEIDKATNYTNFEENRISTDSVQIPAIIQQSQILYKPKLMCEICTVNCPNPEQYEKHLEGLRHQKRLKL 500
            CD C ISC+   TY  H++G++H K   K+A  ++ ++++ ++   +       Q               L CE+C V+C   + Y  H+ G +HQK +KL
Sbjct:  326 CDVCKISCAGPQTYKEHLEGQKHKK---KEAALKVSQSSSSSSGGGSSARGTQNQ---------------LRCELCDVSCTGADAYAAHIRGAKHQKVVKL 408          
BLAST of SMED30004931 vs. Ensembl Zebrafish
Match: zfr (zinc finger RNA binding protein [Source:NCBI gene;Acc:321659])

HSP 1 Score: 49.6766 bits (117), Expect = 1.357e-6
Identity = 29/101 (28.71%), Postives = 50/101 (49.50%), Query Frame = 3
Query:  198 CDACNISCSSQTTYDFHIKGKRHTKTLTKKALSEIDKATNYTNFEENRISTDSVQIPAIIQQSQILYKPKLMCEICTVNCPNPEQYEKHLEGLRHQKRLKL 500
            CD C ISC+   TY  H++G++H K   K+A  ++ ++++ ++   +       Q               L CE+C V+C   + Y  H+ G +HQK +KL
Sbjct:  326 CDVCKISCAGPQTYKEHLEGQKHKK---KEAALKVSQSSSSSSGGGSSARGTQNQ---------------LRCELCDVSCTGADAYAAHIRGAKHQKVVKL 408          
BLAST of SMED30004931 vs. Ensembl Zebrafish
Match: zfr2 (zinc finger RNA binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-070705-184])

HSP 1 Score: 49.6766 bits (117), Expect = 1.471e-6
Identity = 30/103 (29.13%), Postives = 48/103 (46.60%), Query Frame = 3
Query:  198 CDACNISCSSQTTYDFHIKGKRHTKT-LTKKALSEIDKATNYTNFEENRISTDSVQIPAIIQQSQILYKPKLMCEICTVNCPNPEQYEKHLEGLRHQKRLKLN 503
            CD C ISC+   TY  H++G++H K    +K+ S++                     P  +Q        +L CE+C V+C   + Y  H+ G +HQK +KL+
Sbjct:  322 CDICKISCAGPQTYREHLEGQKHKKKEAAQKSGSQVTNG------------------PRGVQT-------QLRCELCDVSCTGADAYAAHIRGSKHQKVVKLH 399          
BLAST of SMED30004931 vs. Ensembl Xenopus
Match: ca12 (carbonic anhydrase XII [Source:Xenbase;Acc:XB-GENE-1015246])

HSP 1 Score: 53.5286 bits (127), Expect = 1.167e-7
Identity = 30/101 (29.70%), Postives = 47/101 (46.53%), Query Frame = 3
Query:  198 CDACNISCSSQTTYDFHIKGKRHTKTLTKKALSEIDKATNYTNFEENRISTDSVQIPAIIQQSQILYKPKLMCEICTVNCPNPEQYEKHLEGLRHQKRLKL 500
            CD C ISC+   TY  H++G++H     KK  + +  + N T+       T +                +L CE+C V+C   + Y  H+ G +HQK +KL
Sbjct:  326 CDVCKISCAGPQTYKEHLEGQKH-----KKKEAALKASQNTTSSSTAVRGTQN----------------QLRCELCDVSCTGADAYAAHIRGAKHQKVVKL 405          
BLAST of SMED30004931 vs. Ensembl Xenopus
Match: ca12 (carbonic anhydrase XII [Source:Xenbase;Acc:XB-GENE-1015246])

HSP 1 Score: 53.1434 bits (126), Expect = 1.423e-7
Identity = 30/101 (29.70%), Postives = 47/101 (46.53%), Query Frame = 3
Query:  198 CDACNISCSSQTTYDFHIKGKRHTKTLTKKALSEIDKATNYTNFEENRISTDSVQIPAIIQQSQILYKPKLMCEICTVNCPNPEQYEKHLEGLRHQKRLKL 500
            CD C ISC+   TY  H++G++H     KK  + +  + N T+       T +                +L CE+C V+C   + Y  H+ G +HQK +KL
Sbjct:  333 CDVCKISCAGPQTYKEHLEGQKH-----KKKEAALKASQNTTSSSTAVRGTQN----------------QLRCELCDVSCTGADAYAAHIRGAKHQKVVKL 412          
BLAST of SMED30004931 vs. Ensembl Xenopus
Match: ca12 (carbonic anhydrase XII [Source:Xenbase;Acc:XB-GENE-1015246])

HSP 1 Score: 53.1434 bits (126), Expect = 1.449e-7
Identity = 30/101 (29.70%), Postives = 47/101 (46.53%), Query Frame = 3
Query:  198 CDACNISCSSQTTYDFHIKGKRHTKTLTKKALSEIDKATNYTNFEENRISTDSVQIPAIIQQSQILYKPKLMCEICTVNCPNPEQYEKHLEGLRHQKRLKL 500
            CD C ISC+   TY  H++G++H     KK  + +  + N T+       T +                +L CE+C V+C   + Y  H+ G +HQK +KL
Sbjct:  334 CDVCKISCAGPQTYKEHLEGQKH-----KKKEAALKASQNTTSSSTAVRGTQN----------------QLRCELCDVSCTGADAYAAHIRGAKHQKVVKL 413          
BLAST of SMED30004931 vs. Ensembl Xenopus
Match: ca12 (carbonic anhydrase XII [Source:Xenbase;Acc:XB-GENE-1015246])

HSP 1 Score: 53.1434 bits (126), Expect = 1.487e-7
Identity = 30/101 (29.70%), Postives = 47/101 (46.53%), Query Frame = 3
Query:  198 CDACNISCSSQTTYDFHIKGKRHTKTLTKKALSEIDKATNYTNFEENRISTDSVQIPAIIQQSQILYKPKLMCEICTVNCPNPEQYEKHLEGLRHQKRLKL 500
            CD C ISC+   TY  H++G++H     KK  + +  + N T+       T +                +L CE+C V+C   + Y  H+ G +HQK +KL
Sbjct:  311 CDVCKISCAGPQTYKEHLEGQKH-----KKKEAALKASQNTTSSSTAVRGTQN----------------QLRCELCDVSCTGADAYAAHIRGAKHQKVVKL 390          
BLAST of SMED30004931 vs. Ensembl Xenopus
Match: ca12 (carbonic anhydrase XII [Source:Xenbase;Acc:XB-GENE-1015246])

HSP 1 Score: 53.1434 bits (126), Expect = 1.538e-7
Identity = 30/101 (29.70%), Postives = 47/101 (46.53%), Query Frame = 3
Query:  198 CDACNISCSSQTTYDFHIKGKRHTKTLTKKALSEIDKATNYTNFEENRISTDSVQIPAIIQQSQILYKPKLMCEICTVNCPNPEQYEKHLEGLRHQKRLKL 500
            CD C ISC+   TY  H++G++H     KK  + +  + N T+       T +                +L CE+C V+C   + Y  H+ G +HQK +KL
Sbjct:  326 CDVCKISCAGPQTYKEHLEGQKH-----KKKEAALKASQNTTSSSTAVRGTQN----------------QLRCELCDVSCTGADAYAAHIRGAKHQKVVKL 405          
BLAST of SMED30004931 vs. Ensembl Mouse
Match: Zfr2 (zinc finger RNA binding protein 2 [Source:MGI Symbol;Acc:MGI:2143792])

HSP 1 Score: 50.447 bits (119), Expect = 8.305e-7
Identity = 32/102 (31.37%), Postives = 47/102 (46.08%), Query Frame = 3
Query:  198 CDACNISCSSQTTYDFHIKGKRHTKTLTKKALSEIDKATNYTNFEENRISTDSVQIPAIIQQSQILYKPKLMCEICTVNCPNPEQYEKHLEGLRHQKRLKLN 503
            C+ C +SC+   TY  H++G++H K   K+A                R ST     P   + SQ L+     C +C V+C   + Y  H+ G RHQK  KL+
Sbjct:  207 CEVCRVSCAGPQTYRDHLEGQKHRK---KQA--------------AQRTSTQPSGGP---RGSQSLH-----CGLCAVSCTGADAYAAHMRGARHQKVFKLH 283          
BLAST of SMED30004931 vs. Ensembl Mouse
Match: Zfr (zinc finger RNA binding protein [Source:MGI Symbol;Acc:MGI:1341890])

HSP 1 Score: 50.0618 bits (118), Expect = 1.298e-6
Identity = 31/102 (30.39%), Postives = 45/102 (44.12%), Query Frame = 3
Query:  198 CDACNISCSSQTTYDFHIKGKRHTKTLTK-KALSEIDKATNYTNFEENRISTDSVQIPAIIQQSQILYKPKLMCEICTVNCPNPEQYEKHLEGLRHQKRLKL 500
            CD C ISC+   TY  H++G++H K     KA      + N T   +N                      +L CE+C V+C   + Y  H+ G +HQK +KL
Sbjct:  333 CDVCKISCAGPQTYKEHLEGQKHKKKEAALKASQNTSSSNNSTRGTQN----------------------QLRCELCDVSCTGADAYAAHIRGAKHQKVVKL 412          
BLAST of SMED30004931 vs. UniProt/SwissProt
Match: sp|Q5U231|ZFR_XENTR (Zinc finger RNA-binding protein OS=Xenopus tropicalis OX=8364 GN=zfr PE=2 SV=1)

HSP 1 Score: 53.1434 bits (126), Expect = 7.538e-7
Identity = 30/101 (29.70%), Postives = 47/101 (46.53%), Query Frame = 3
Query:  198 CDACNISCSSQTTYDFHIKGKRHTKTLTKKALSEIDKATNYTNFEENRISTDSVQIPAIIQQSQILYKPKLMCEICTVNCPNPEQYEKHLEGLRHQKRLKL 500
            CD C ISC+   TY  H++G++H     KK  + +  + N T+       T +                +L CE+C V+C   + Y  H+ G +HQK +KL
Sbjct:  333 CDVCKISCAGPQTYKEHLEGQKH-----KKKEAALKASQNTTSSSTAVRGTQN----------------QLRCELCDVSCTGADAYAAHIRGAKHQKVVKL 412          
BLAST of SMED30004931 vs. UniProt/SwissProt
Match: sp|Q6GPM1|ZFR_XENLA (Zinc finger RNA-binding protein OS=Xenopus laevis OX=8355 GN=zfr PE=2 SV=1)

HSP 1 Score: 53.1434 bits (126), Expect = 8.719e-7
Identity = 30/101 (29.70%), Postives = 47/101 (46.53%), Query Frame = 3
Query:  198 CDACNISCSSQTTYDFHIKGKRHTKTLTKKALSEIDKATNYTNFEENRISTDSVQIPAIIQQSQILYKPKLMCEICTVNCPNPEQYEKHLEGLRHQKRLKL 500
            CD C ISC+   TY  H++G++H     KK  + +  + N T+       T +                +L CE+C V+C   + Y  H+ G +HQK +KL
Sbjct:  324 CDVCKISCAGPQTYKEHLEGQKH-----KKKEAALKASQNTTSSSTAVRGTQN----------------QLRCELCDVSCTGADAYAAHIRGAKHQKVVKL 403          
BLAST of SMED30004931 vs. UniProt/SwissProt
Match: sp|Q9UPR6|ZFR2_HUMAN (Zinc finger RNA-binding protein 2 OS=Homo sapiens OX=9606 GN=ZFR2 PE=2 SV=3)

HSP 1 Score: 51.2174 bits (121), Expect = 3.824e-6
Identity = 31/102 (30.39%), Postives = 45/102 (44.12%), Query Frame = 3
Query:  198 CDACNISCSSQTTYDFHIKGKRHTKTLTKKALSEIDKATNYTNFEENRISTDSVQIPAIIQQSQILYKPKLMCEICTVNCPNPEQYEKHLEGLRHQKRLKLN 503
            CD C ISC+   TY  H+ G++H K           +A   T  + N  S   VQ              +L C++C V+C   + Y  H+ G +HQK  KL+
Sbjct:  273 CDICKISCAGPQTYREHLGGQKHRKK----------EAAQKTGVQPNG-SPRGVQ-------------AQLHCDLCAVSCTGADAYAAHIRGSKHQKVFKLH 350          
BLAST of SMED30004931 vs. UniProt/SwissProt
Match: sp|Q96KR1|ZFR_HUMAN (Zinc finger RNA-binding protein OS=Homo sapiens OX=9606 GN=ZFR PE=1 SV=2)

HSP 1 Score: 50.0618 bits (118), Expect = 8.283e-6
Identity = 30/102 (29.41%), Postives = 45/102 (44.12%), Query Frame = 3
Query:  198 CDACNISCSSQTTYDFHIKGKRHTKTLTK-KALSEIDKATNYTNFEENRISTDSVQIPAIIQQSQILYKPKLMCEICTVNCPNPEQYEKHLEGLRHQKRLKL 500
            CD C ISC+   TY  H++G++H K     KA      + + T   +N                      +L CE+C V+C   + Y  H+ G +HQK +KL
Sbjct:  333 CDVCKISCAGPQTYKEHLEGQKHKKKEAALKASQNTSSSNSSTRGTQN----------------------QLRCELCDVSCTGADAYAAHIRGAKHQKVVKL 412          
BLAST of SMED30004931 vs. UniProt/SwissProt
Match: sp|Q5REX3|ZFR_PONAB (Zinc finger RNA-binding protein OS=Pongo abelii OX=9601 GN=ZFR PE=2 SV=1)

HSP 1 Score: 50.0618 bits (118), Expect = 8.513e-6
Identity = 31/102 (30.39%), Postives = 45/102 (44.12%), Query Frame = 3
Query:  198 CDACNISCSSQTTYDFHIKGKRHTKTLTK-KALSEIDKATNYTNFEENRISTDSVQIPAIIQQSQILYKPKLMCEICTVNCPNPEQYEKHLEGLRHQKRLKL 500
            CD C ISC+   TY  H++G++H K     KA      + N T   +N                      +L CE+C V+C   + Y  H+ G +HQK +KL
Sbjct:  333 CDVCKISCAGPQTYKEHLEGQKHKKKEAALKASQNASSSNNSTRGTQN----------------------QLRCELCDVSCTGADAYAAHIRGAKHQKVVKL 412          
BLAST of SMED30004931 vs. TrEMBL
Match: A0A287E6A0 (Uncharacterized protein OS=Hordeum vulgare subsp. vulgare OX=112509 PE=4 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 4.275e-8
Identity = 50/191 (26.18%), Postives = 84/191 (43.98%), Query Frame = 3
Query:  111 SFDHESLTSS--LYSQYRP-LSATNKKVIP-VQCDACNISCSSQTTYDFHIKGKRHTKTLTKKALSEIDKATNYTNF--------------------------------EENRISTDSVQIPAIIQQSQILYKP--KLMCEICTVNCPNPEQYEKHLEGLRHQKRLKLNRYIELKNNKDPSV---YCDICD 560
            +F  E   S   L+ +  P L+A N+K +P   CD C+++C+SQ+  + H++G+RH + +  +AL   DK T  + +                                 E + S   +    ++Q +    +P  + MC IC  NC +    E HL G RHQ+ ++  +     + KDP V    CDIC+
Sbjct:  172 AFQGEGKGSEAMLHEKKMPQLAANNQKPVPRWTCDICSVNCTSQSVLESHLRGRRHQENI--EALQGDDKGTEVSRWTCDICNVNCTSECDLESHVRGRRHQENIEAFQGEGKGSEARLHEKKMLQLADNNQEPVSRWMCNICNANCTSESDLENHLRGRRHQENIEALQ----GDGKDPEVSGWTCDICN 356          
BLAST of SMED30004931 vs. TrEMBL
Match: A0A4Z2CMQ1 (Zinc finger RNA-binding protein isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_009423 PE=4 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 4.486e-8
Identity = 43/153 (28.10%), Postives = 71/153 (46.41%), Query Frame = 3
Query:  156 RPLSATNKKVIPVQCDACNISCSSQTTYDFHIKGKRHTKTLTK-KALSEIDKATNYTNFEENRISTDSVQIPAIIQQSQILYKPKLMCEICTVNCPNPEQYEKHLEGLRHQKRLKLNRYI--ELKNNKDPSVYCDICDLLMNEDSMTLHRANE 605
            RP   T K+     CD C +SC+    +  H  G+RH K L++ +A+ ++ K           +STD+     I   S+     +L CE+C V C   + Y  HL G +HQ+ LKL++ +   +    DP V   + D++  E      + +E
Sbjct:  181 RPNPTTPKEPAIFYCDICKVSCAGPLAFKDHESGQRHKKRLSQVEAIEKLKK----------EVSTDASSSLVICSASR-----ELRCELCDVGCTGVDSYTAHLSGRQHQRTLKLHKELGKPIPETDDPLVPSIVADMITTESDSAKPKTSE 318          
BLAST of SMED30004931 vs. TrEMBL
Match: A0A287E689 (Uncharacterized protein OS=Hordeum vulgare subsp. vulgare OX=112509 PE=4 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 4.677e-8
Identity = 50/191 (26.18%), Postives = 84/191 (43.98%), Query Frame = 3
Query:  111 SFDHESLTSS--LYSQYRP-LSATNKKVIP-VQCDACNISCSSQTTYDFHIKGKRHTKTLTKKALSEIDKATNYTNF--------------------------------EENRISTDSVQIPAIIQQSQILYKP--KLMCEICTVNCPNPEQYEKHLEGLRHQKRLKLNRYIELKNNKDPSVY---CDICD 560
            +F  E   S   L+ +  P L+A N+K +P   CD C+++C+SQ+  + H++G+RH + +  +AL   DK T  + +                                 E + S   +    ++Q +    +P  + MC IC  NC +    E HL G RHQ+ ++  +     + KDP V    CDIC+
Sbjct:  204 AFQGEGKGSEAMLHEKKMPQLAANNQKPVPRWTCDICSVNCTSQSVLESHLRGRRHQENI--EALQGDDKGTEVSRWTCDICNVNCTSECDLESHVRGRRHQENIEAFQGEGKGSEARLHEKKMLQLADNNQEPVSRWMCNICNANCTSESDLENHLRGRRHQENIEALQ----GDGKDPEVSGWTCDICN 388          
BLAST of SMED30004931 vs. TrEMBL
Match: A0A287E673 (Uncharacterized protein OS=Hordeum vulgare subsp. vulgare OX=112509 PE=4 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 4.994e-8
Identity = 50/191 (26.18%), Postives = 84/191 (43.98%), Query Frame = 3
Query:  111 SFDHESLTSS--LYSQYRP-LSATNKKVIP-VQCDACNISCSSQTTYDFHIKGKRHTKTLTKKALSEIDKATNYTNF--------------------------------EENRISTDSVQIPAIIQQSQILYKP--KLMCEICTVNCPNPEQYEKHLEGLRHQKRLKLNRYIELKNNKDPSV---YCDICD 560
            +F  E   S   L+ +  P L+A N+K +P   CD C+++C+SQ+  + H++G+RH + +  +AL   DK T  + +                                 E + S   +    ++Q +    +P  + MC IC  NC +    E HL G RHQ+ ++  +     + KDP V    CDIC+
Sbjct:  230 AFQGEGKGSEAMLHEKKMPQLAANNQKPVPRWTCDICSVNCTSQSVLESHLRGRRHQENI--EALQGDDKGTEVSRWTCDICNVNCTSECDLESHVRGRRHQENIEAFQGEGKGSEARLHEKKMLQLADNNQEPVSRWMCNICNANCTSESDLENHLRGRRHQENIEALQ----GDGKDPEVSGWTCDICN 414          
BLAST of SMED30004931 vs. TrEMBL
Match: A0A4Z2CM94 (Zinc finger RNA-binding protein isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_009423 PE=4 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 5.559e-8
Identity = 43/153 (28.10%), Postives = 71/153 (46.41%), Query Frame = 3
Query:  156 RPLSATNKKVIPVQCDACNISCSSQTTYDFHIKGKRHTKTLTK-KALSEIDKATNYTNFEENRISTDSVQIPAIIQQSQILYKPKLMCEICTVNCPNPEQYEKHLEGLRHQKRLKLNRYI--ELKNNKDPSVYCDICDLLMNEDSMTLHRANE 605
            RP   T K+     CD C +SC+    +  H  G+RH K L++ +A+ ++ K           +STD+     I   S+     +L CE+C V C   + Y  HL G +HQ+ LKL++ +   +    DP V   + D++  E      + +E
Sbjct:  181 RPNPTTPKEPAIFYCDICKVSCAGPLAFKDHESGQRHKKRLSQVEAIEKLKK----------EVSTDASSSLVICSASR-----ELRCELCDVGCTGVDSYTAHLSGRQHQRTLKLHKELGKPIPETDDPLVPSIVADMITTESDSAKPKTSE 318          
BLAST of SMED30004931 vs. Ensembl Cavefish
Match: zfr2 (zinc finger RNA-binding protein-like [Source:NCBI gene;Acc:103035531])

HSP 1 Score: 54.6842 bits (130), Expect = 2.651e-8
Identity = 30/101 (29.70%), Postives = 45/101 (44.55%), Query Frame = 3
Query:  198 CDACNISCSSQTTYDFHIKGKRHTKTLTKKALSEIDKATNYTNFEENRISTDSVQIPAIIQQSQILYKPKLMCEICTVNCPNPEQYEKHLEGLRHQKRLKL 500
            CD C ISC+   TY  H++G++H     KK  +     +  TN     + T                  +L CE+C V+C   + Y  H+ G +HQK +KL
Sbjct:  315 CDICKISCAGPQTYREHLEGQKH-----KKKEASQKSGSQATNGPRGGVQT------------------QLRCELCDVSCTGADAYAAHIRGAKHQKVVKL 392          
BLAST of SMED30004931 vs. Ensembl Cavefish
Match: zfr (zinc finger RNA binding protein [Source:NCBI gene;Acc:103021415])

HSP 1 Score: 49.2914 bits (116), Expect = 1.927e-6
Identity = 32/102 (31.37%), Postives = 52/102 (50.98%), Query Frame = 3
Query:  198 CDACNISCSSQTTYDFHIKGKRHTKTLTKKALSEIDKATNYTNFEENRISTDSVQIPAIIQQSQILYKPKLMCEICTVNCPNPEQYEKHLEGLRHQKRLKLN 503
            CD C ISC+   TY  H++G++H K   K+A  ++ ++++         S+      A   Q+Q      L CE+C V C   + Y  H+ G +HQK +KL+
Sbjct:  303 CDVCKISCAGPQTYKEHLEGQKHKK---KEAALKVSQSSS---------SSSGGSSSARGTQNQ------LRCELCDVACTGADAYAAHIRGAKHQKVVKLH 386          
BLAST of SMED30004931 vs. Ensembl Medaka
Match: zfr (zinc finger RNA binding protein [Source:NCBI gene;Acc:101166968])

HSP 1 Score: 51.2174 bits (121), Expect = 3.864e-7
Identity = 31/102 (30.39%), Postives = 54/102 (52.94%), Query Frame = 3
Query:  198 CDACNISCSSQTTYDFHIKGKRHTKTLTKKALSEIDKATNYTNFEENRISTDSVQIPAIIQQSQILYKPKLMCEICTVNCPNPEQYEKHLEGLRHQKRLKLN 503
            CD C ISC+   TY  H++G++H K   K+A  ++ ++++            S    A+ + +Q     +L CE+C V+C   + Y  H+ G +HQK +KL+
Sbjct:  322 CDVCKISCAGPQTYKEHLEGQKHKK---KEAALKVSQSSS------------STGGGAMARSAQ----NQLRCELCDVSCTGADAYAAHIRGAKHQKVVKLH 404          
BLAST of SMED30004931 vs. Ensembl Medaka
Match: zfr (zinc finger RNA binding protein [Source:NCBI gene;Acc:101166968])

HSP 1 Score: 50.8322 bits (120), Expect = 4.622e-7
Identity = 31/102 (30.39%), Postives = 54/102 (52.94%), Query Frame = 3
Query:  198 CDACNISCSSQTTYDFHIKGKRHTKTLTKKALSEIDKATNYTNFEENRISTDSVQIPAIIQQSQILYKPKLMCEICTVNCPNPEQYEKHLEGLRHQKRLKLN 503
            CD C ISC+   TY  H++G++H K   K+A  ++ ++++ T               A+ + +Q     +L CE+C V+C   + Y  H+ G +HQK +KL+
Sbjct:  322 CDVCKISCAGPQTYKEHLEGQKHKK---KEAALKVSQSSSSTGGG------------AMARSAQN----QLRCELCDVSCTGADAYAAHIRGAKHQKVVKLH 404          
BLAST of SMED30004931 vs. Planmine SMEST
Match: SMESG000074376.1 (SMESG000074376.1)

HSP 1 Score: 418.313 bits (1074), Expect = 7.145e-151
Identity = 201/203 (99.01%), Postives = 202/203 (99.51%), Query Frame = 3
Query:    3 MHNSYVNLSSYRCVACNIYFNNFDEQKQHYFTYHSRSFDHESLTSSLYSQYRPLSATNKKVIPVQCDACNISCSSQTTYDFHIKGKRHTKTLTKKALSEIDKATNYTNFEENRISTDSVQIPAIIQQSQILYKPKLMCEICTVNCPNPEQYEKHLEGLRHQKRLKLNRYIELKNNKDPSVYCDICDLLMNEDSMTLHRANEER 611
            MHNSYVNLSSYRCVACNIYFNNFDEQKQHYFTYHSRSFDHESLTSSLYSQYRPLSATNKKVIPVQCDACNISCSSQTTYDFHIKGKRHTKTLTKKALSEIDKATN+TNFEENRISTDSVQIPAIIQQSQILYKP LMCEICTVNCPNPEQYEKHLEGLRHQKRLKLNRYIELKNNKDPSVYCDICDLLMNEDSMTLHRANEER
Sbjct:    1 MHNSYVNLSSYRCVACNIYFNNFDEQKQHYFTYHSRSFDHESLTSSLYSQYRPLSATNKKVIPVQCDACNISCSSQTTYDFHIKGKRHTKTLTKKALSEIDKATNFTNFEENRISTDSVQIPAIIQQSQILYKPNLMCEICTVNCPNPEQYEKHLEGLRHQKRLKLNRYIELKNNKDPSVYCDICDLLMNEDSMTLHRANEER 203          
BLAST of SMED30004931 vs. Planmine SMEST
Match: SMESG000074376.1 (SMESG000074376.1)

HSP 1 Score: 414.461 bits (1064), Expect = 4.914e-147
Identity = 197/199 (98.99%), Postives = 198/199 (99.50%), Query Frame = 3
Query:    3 MHNSYVNLSSYRCVACNIYFNNFDEQKQHYFTYHSRSFDHESLTSSLYSQYRPLSATNKKVIPVQCDACNISCSSQTTYDFHIKGKRHTKTLTKKALSEIDKATNYTNFEENRISTDSVQIPAIIQQSQILYKPKLMCEICTVNCPNPEQYEKHLEGLRHQKRLKLNRYIELKNNKDPSVYCDICDLLMNEDSMTLHRA 599
            MHNSYVNLSSYRCVACNIYFNNFDEQKQHYFTYHSRSFDHESLTSSLYSQYRPLSATNKKVIPVQCDACNISCSSQTTYDFHIKGKRHTKTLTKKALSEIDKATN+TNFEENRISTDSVQIPAIIQQSQILYKP LMCEICTVNCPNPEQYEKHLEGLRHQKRLKLNRYIELKNNKDPSVYCDICDLLMNEDSMTLHRA
Sbjct:    1 MHNSYVNLSSYRCVACNIYFNNFDEQKQHYFTYHSRSFDHESLTSSLYSQYRPLSATNKKVIPVQCDACNISCSSQTTYDFHIKGKRHTKTLTKKALSEIDKATNFTNFEENRISTDSVQIPAIIQQSQILYKPNLMCEICTVNCPNPEQYEKHLEGLRHQKRLKLNRYIELKNNKDPSVYCDICDLLMNEDSMTLHRA 199          

HSP 2 Score: 82.4185 bits (202), Expect = 3.804e-18
Identity = 38/42 (90.48%), Postives = 42/42 (100.00%), Query Frame = 1
Query:  595 EQTKSADIHTTVEHCGYCNVSLKSANDAIAHYQTQKHALNMT 720
            ++TK+ADIHTTVEHCGYC+VSLKSANDAIAHYQTQKHALNMT
Sbjct:  218 KKTKNADIHTTVEHCGYCHVSLKSANDAIAHYQTQKHALNMT 259          
BLAST of SMED30004931 vs. Planmine SMEST
Match: SMESG000067725.1 (SMESG000067725.1)

HSP 1 Score: 265.003 bits (676), Expect = 3.261e-88
Identity = 133/199 (66.83%), Postives = 151/199 (75.88%), Query Frame = 3
Query:    3 MHNSYVNLSSYRCVACNIYFNNFDEQKQHYFTYHSRSFDHESLTSSLYSQYRPLSATNKKVIPVQCDACNISCSSQTTYDFHIKGKRHTKTLTKKALSEIDKATNYTNFEENRISTDSVQIPAIIQQSQILYKPKLMCEICTVNCPNPEQYEKHLEGLRHQKRLKLNRYIELKNNKDPSVYCDICDLLMNEDSMTLHRA 599
            M+N Y N+SSY CVACNIYFNNFDEQKQH F  HS S+DHESL S+LYSQYR    TNKK IPVQCD CNI+CSSQTTYDFHIKGK+HTK L++K L E  K  +    E N    D V+     QQ QIL K  LMCEIC VNC  PEQ E+HLEG RH+K+LKLNRYIEL+NNKDPSV+CDIC+  MNE+SM +HRA
Sbjct:    1 MNNMYDNVSSYCCVACNIYFNNFDEQKQHCFLNHSGSYDHESLKSALYSQYRSPYVTNKKTIPVQCDVCNITCSSQTTYDFHIKGKKHTKALSRKDLFENGKTASNAKVEGNDC-MDPVEYSD--QQGQILSKSNLMCEICDVNCLRPEQLERHLEGSRHRKKLKLNRYIELRNNKDPSVFCDICESFMNEESMNMHRA 196          

HSP 2 Score: 73.559 bits (179), Expect = 4.981e-15
Identity = 33/42 (78.57%), Postives = 40/42 (95.24%), Query Frame = 1
Query:  595 EQTKSADIHTTVEHCGYCNVSLKSANDAIAHYQTQKHALNMT 720
            ++ +SADI TTVEHCGYC++SLK+A+DAIAHYQTQKHALNMT
Sbjct:  215 KKARSADIPTTVEHCGYCHMSLKNASDAIAHYQTQKHALNMT 256          
BLAST of SMED30004931 vs. Planmine SMEST
Match: SMESG000067725.1 (SMESG000067725.1)

HSP 1 Score: 261.536 bits (667), Expect = 6.461e-87
Identity = 131/195 (67.18%), Postives = 148/195 (75.90%), Query Frame = 3
Query:   15 YVNLSSYRCVACNIYFNNFDEQKQHYFTYHSRSFDHESLTSSLYSQYRPLSATNKKVIPVQCDACNISCSSQTTYDFHIKGKRHTKTLTKKALSEIDKATNYTNFEENRISTDSVQIPAIIQQSQILYKPKLMCEICTVNCPNPEQYEKHLEGLRHQKRLKLNRYIELKNNKDPSVYCDICDLLMNEDSMTLHRA 599
            Y N+SSY CVACNIYFNNFDEQKQH F  HS S+DHESL S+LYSQYR    TNKK IPVQCD CNI+CSSQTTYDFHIKGK+HTK L++K L E  K  +    E N    D V+     QQ QIL K  LMCEIC VNC  PEQ E+HLEG RH+K+LKLNRYIEL+NNKDPSV+CDIC+  MNE+SM +HRA
Sbjct:    2 YDNVSSYCCVACNIYFNNFDEQKQHCFLNHSGSYDHESLKSALYSQYRSPYVTNKKTIPVQCDVCNITCSSQTTYDFHIKGKKHTKALSRKDLFENGKTASNAKVEGNDC-MDPVEYSD--QQGQILSKSNLMCEICDVNCLRPEQLERHLEGSRHRKKLKLNRYIELRNNKDPSVFCDICESFMNEESMNMHRA 193          

HSP 2 Score: 73.559 bits (179), Expect = 4.986e-15
Identity = 33/42 (78.57%), Postives = 40/42 (95.24%), Query Frame = 1
Query:  595 EQTKSADIHTTVEHCGYCNVSLKSANDAIAHYQTQKHALNMT 720
            ++ +SADI TTVEHCGYC++SLK+A+DAIAHYQTQKHALNMT
Sbjct:  212 KKARSADIPTTVEHCGYCHMSLKNASDAIAHYQTQKHALNMT 253          
BLAST of SMED30004931 vs. Planmine SMEST
Match: SMESG000067728.1 (SMESG000067728.1)

HSP 1 Score: 78.1814 bits (191), Expect = 7.783e-18
Identity = 53/180 (29.44%), Postives = 89/180 (49.44%), Query Frame = 3
Query:  102 HSRSFDHESLTS-SLYSQYRPLSATNKKVIPVQCDACNISCSSQTTYDFHIKGKRHTKTLTKKALSEI--------DKATNYTNF------EENRISTDSVQIPAIIQQSQILYKPKLMCEICTVNCPNPEQYEKHLEGLRHQKRLKLNRYIELKNNKDPSVYCDICDLLMNEDSMTLHR 596
            H    D  S+ + S +++ RP      K  P  C+ C ISC+S++ YD H +GK+H + L K  LSE+         K  +Y  +       E+RI+  ++         +        C+IC ++C +    + HL G +H+++LK     +L  NKDP VYC+IC++ +  + M LH+
Sbjct:   15 HDIPIDKNSVNARSKFTRIRP-----TKYDPHNCEICKISCNSKSIYDIHTEGKKHKRALEK--LSELKFPCDLCSQKLNDYNTWITHLSSHEHRIAELNILSSTTCNLPRTTLNKINRCDICDLDCGSNIILQSHLTGAKHKRKLKQLNMEKLAENKDPKVYCEICEICLEPNLMMLHK 187          

HSP 2 Score: 30.0314 bits (66), Expect = 7.783e-18
Identity = 11/26 (42.31%), Postives = 17/26 (65.38%), Query Frame = 1
Query:  628 VEHCGYCNVSLKSANDAIAHYQTQKH 705
            +E CG C+ SL   +DA+ HY ++ H
Sbjct:  210 MEFCGLCDQSLSGISDAVDHYNSENH 235          
The following BLAST results are available for this feature:
BLAST of SMED30004931 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ZFR23.066e-729.82zinc finger RNA binding protein 2 [Source:HGNC Sym... [more]
ZFR27.964e-730.39zinc finger RNA binding protein 2 [Source:HGNC Sym... [more]
ZFR1.725e-629.41zinc finger RNA binding protein [Source:HGNC Symbo... [more]
back to top
BLAST of SMED30004931 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Y95B8A.85.108e-626.67pep chromosome:WBcel235:I:853451:872103:1 gene:WBG... [more]
back to top
BLAST of SMED30004931 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Zn72D1.324e-626.21gene:FBgn0263603 transcript:FBtr0333294[more]
Zn72D1.324e-626.21gene:FBgn0263603 transcript:FBtr0310582[more]
Zn72D1.324e-626.21gene:FBgn0263603 transcript:FBtr0310581[more]
Zn72D1.324e-626.21gene:FBgn0263603 transcript:FBtr0075494[more]
back to top
BLAST of SMED30004931 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
zfr1.210e-628.71zinc finger RNA binding protein [Source:NCBI gene;... [more]
zfr1.236e-628.71zinc finger RNA binding protein [Source:NCBI gene;... [more]
zfr1.357e-628.71zinc finger RNA binding protein [Source:NCBI gene;... [more]
zfr21.471e-629.13zinc finger RNA binding protein 2 [Source:ZFIN;Acc... [more]
back to top
BLAST of SMED30004931 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ca121.167e-729.70carbonic anhydrase XII [Source:Xenbase;Acc:XB-GENE... [more]
ca121.423e-729.70carbonic anhydrase XII [Source:Xenbase;Acc:XB-GENE... [more]
ca121.449e-729.70carbonic anhydrase XII [Source:Xenbase;Acc:XB-GENE... [more]
ca121.487e-729.70carbonic anhydrase XII [Source:Xenbase;Acc:XB-GENE... [more]
ca121.538e-729.70carbonic anhydrase XII [Source:Xenbase;Acc:XB-GENE... [more]
back to top
BLAST of SMED30004931 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Zfr28.305e-731.37zinc finger RNA binding protein 2 [Source:MGI Symb... [more]
Zfr1.298e-630.39zinc finger RNA binding protein [Source:MGI Symbol... [more]
back to top
BLAST of SMED30004931 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5U231|ZFR_XENTR7.538e-729.70Zinc finger RNA-binding protein OS=Xenopus tropica... [more]
sp|Q6GPM1|ZFR_XENLA8.719e-729.70Zinc finger RNA-binding protein OS=Xenopus laevis ... [more]
sp|Q9UPR6|ZFR2_HUMAN3.824e-630.39Zinc finger RNA-binding protein 2 OS=Homo sapiens ... [more]
sp|Q96KR1|ZFR_HUMAN8.283e-629.41Zinc finger RNA-binding protein OS=Homo sapiens OX... [more]
sp|Q5REX3|ZFR_PONAB8.513e-630.39Zinc finger RNA-binding protein OS=Pongo abelii OX... [more]
back to top
BLAST of SMED30004931 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A287E6A04.275e-826.18Uncharacterized protein OS=Hordeum vulgare subsp. ... [more]
A0A4Z2CMQ14.486e-828.10Zinc finger RNA-binding protein isoform 1 OS=Schis... [more]
A0A287E6894.677e-826.18Uncharacterized protein OS=Hordeum vulgare subsp. ... [more]
A0A287E6734.994e-826.18Uncharacterized protein OS=Hordeum vulgare subsp. ... [more]
A0A4Z2CM945.559e-828.10Zinc finger RNA-binding protein isoform 2 OS=Schis... [more]
back to top
BLAST of SMED30004931 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
zfr22.651e-829.70zinc finger RNA-binding protein-like [Source:NCBI ... [more]
zfr1.927e-631.37zinc finger RNA binding protein [Source:NCBI gene;... [more]
back to top
BLAST of SMED30004931 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004931 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004931 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30004931 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
zfr3.864e-730.39zinc finger RNA binding protein [Source:NCBI gene;... [more]
zfr4.622e-730.39zinc finger RNA binding protein [Source:NCBI gene;... [more]
back to top
BLAST of SMED30004931 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074376.17.145e-15199.01SMESG000074376.1[more]
SMESG000074376.14.914e-14798.99SMESG000074376.1[more]
SMESG000067725.13.261e-8866.83SMESG000067725.1[more]
SMESG000067725.16.461e-8767.18SMESG000067725.1[more]
SMESG000067728.17.783e-1829.44SMESG000067728.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004931 ID=SMED30004931|Name=SMED30004931|organism=Schmidtea mediterranea sexual|type=transcript|length=720bp
TTATGCATAATTCTTATGTTAATTTGTCAAGTTACCGTTGTGTAGCCTGT
AATATTTATTTCAACAATTTTGATGAGCAGAAACAACATTATTTTACTTA
CCATTCTAGGAGTTTTGATCACGAATCATTAACATCGTCATTATATTCTC
AATATAGACCTTTATCTGCCACTAACAAAAAAGTTATTCCCGTACAATGC
GATGCCTGCAATATAAGTTGTTCATCTCAAACTACTTATGACTTTCACAT
CAAAGGTAAAAGGCACACAAAAACTTTAACTAAAAAAGCTTTATCTGAAA
TTGACAAAGCCACAAATTATACCAATTTTGAAGAAAATAGAATCTCCACG
GATTCAGTTCAAATTCCAGCTATTATACAACAAAGTCAAATATTATACAA
ACCTAAATTAATGTGTGAAATTTGTACTGTTAATTGTCCAAACCCGGAAC
AATATGAAAAACATTTGGAAGGGTTACGACATCAAAAAAGATTGAAGTTG
AATCGATACATTGAACTAAAGAATAATAAAGATCCATCCGTTTATTGTGA
TATATGTGACTTATTAATGAATGAAGATTCAATGACTTTGCATCGAGCAA
ACGAAGAGCGCTGATATTCACACGACTGTTGAGCACTGCGGATATTGTAA
CGTGTCGCTGAAGAGTGCAAACGATGCGATAGCTCACTACCAGACACAGA
AACACGCATTGAACATGACA
back to top

protein sequence of SMED30004931-orf-1

>SMED30004931-orf-1 ID=SMED30004931-orf-1|Name=SMED30004931-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=204bp
MHNSYVNLSSYRCVACNIYFNNFDEQKQHYFTYHSRSFDHESLTSSLYSQ
YRPLSATNKKVIPVQCDACNISCSSQTTYDFHIKGKRHTKTLTKKALSEI
DKATNYTNFEENRISTDSVQIPAIIQQSQILYKPKLMCEICTVNCPNPEQ
YEKHLEGLRHQKRLKLNRYIELKNNKDPSVYCDICDLLMNEDSMTLHRAN
EER*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR013087Znf_C2H2_type
IPR036236Znf_C2H2_sf
IPR003604Matrin/U1-like-C_Znf_C2H2
IPR015880Znf_C2H2-like
IPR007087Znf_C2H2
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0008270zinc ion binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 64..88
e-value: 5.4
score: 15.6
coord: 11..34
e-value: 6.0
score: 15.3
coord: 136..160
e-value: 4.7
score: 16.2
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 13..34
IPR003604Matrin/U1-C-like, C2H2-type zinc fingerSMARTSM00451ZnF_U1_5coord: 61..95
e-value: 3.2E-4
score: 30.0
coord: 133..167
e-value: 0.0055
score: 25.9
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 123..171
e-value: 1.0E-10
score: 42.9
coord: 52..100
e-value: 1.7E-9
score: 39.1
NoneNo IPR availablePFAMPF12874zf-metcoord: 65..88
e-value: 6.8E-7
score: 29.5
coord: 137..160
e-value: 2.8E-4
score: 21.2
NoneNo IPR availablePANTHERPTHR45762:SF7coord: 12..101
NoneNo IPR availablePANTHERPTHR45762:SF7coord: 126..189
NoneNo IPR availablePANTHERPTHR45762FAMILY NOT NAMEDcoord: 12..101
coord: 126..189
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 55..92
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 133..167