Irregular chiasm C-roughest-like isoform X2

Overview
NameIrregular chiasm C-roughest-like isoform X2
Smed IDSMED30004930
Length (bp)2844
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Irregular chiasm C-roughest-like isoform X2 (SMED30004930) t-SNE clustered cells

Violin plots show distribution of expression levels for Irregular chiasm C-roughest-like isoform X2 (SMED30004930) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Irregular chiasm C-roughest-like isoform X2 (SMED30004930) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Irregular chiasm C-roughest-like isoform X2 (SMED30004930) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004930

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30004930SMESG000077979.1 dd_Smed_v4_12549_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal regionSMED30004930SMESG000077979.1 SmedASXL_010810SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30004930SMESG000077979.1 dd_Smed_v4_12549_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30004930SMESG000077979.1 dd_Smed_v4_12549_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30004930SMESG000077979.1 dd_Smed_v4_12549_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30004930SMESG000077979.1 dd_Smed_v4_12549_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30004930SMESG000077979.1 dd_Smed_v4_12549_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30004930SMESG000077979.1 dd_Smed_v4_12549_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004930SMESG000077979.1 Contig34243newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30004930SMESG000077979.1 Contig34243uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynx musculatureSMED30004930SMESG000077979.1 dd_Smed_v4_12549_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Human
Match: KIRREL1 (kirre like nephrin family adhesion molecule 1 [Source:HGNC Symbol;Acc:HGNC:15734])

HSP 1 Score: 83.1889 bits (204), Expect = 1.236e-15
Identity = 126/588 (21.43%), Postives = 207/588 (35.20%), Query Frame = 2
Query:   41 IAFVVIMLSSFFLLSNSTKYVLKDEPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCH-IELTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMW--------TVKTETGLSDNGKIQRQNYSLMRLSSDFHNSNI-SCKIVNKKDYLDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYH-KFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKVIDSDYGT-YTC----SFSYGKTIVT-KQIHLLPL 1753
            ++ +V +L+     S  T+     EP++  V+ GQ  VL C L     +V    QW+KD   L        +  R  + GS  +G Y+L     EL D+A Y C   E  LR          +  L ++ PP +                      +I +      N TC + N  P   ++W             T L  +GK +     L+   +D     + +C+ +N+       +P+   T   L + +   + T     + +  GE V F+C +   P  I+ Y W           G +L+E +  +         F    + C +   V   N                   S  +N+ + P+I       T ++IG  V L+C    NP  ++ W K                              NM+ S S     + V + D   Y C A         + V +     P I  E     V  DG   + C + S   P P  I W ++ + L + + ER  +       GV S L    V+++D+ T Y C    SF  G  I+  ++  +LP+
Sbjct:    2 LSLLVWILTLSDTFSQGTQTRFSQEPADQTVVAGQRAVLPCVLLNYSGIV----QWTKDGLALGMGQGLKAWP-RYRVVGSADAGQYNLEITDAELSDDASYECQATEAALRSR--------RAKLTVLIPPEDTRID---------------GGPVILLQAGTPHNLTCRAFNAKPAATIIWFRDGTQQEGAVASTELLKDGKRETTVSQLLINPTDLDIGRVFTCRSMNE------AIPSGKETSIELDVHHPPTV-TLSIEPQTVQEGERVVFTCQATANPE-ILGYRW---------AKGGFLIEDAHESRYETNVDYSFFTEPVSCEVHNKVGSTNV------------------STLVNVHFAPRIVVD-PKPTTTDIGSDVTLTCVWVGNPPLTLTWTKKD---------------------------SNMVLSNSNQLLLKSVTQADAGTYTCRAIVPRIGVAEREVPLYVNGPPIISSEAVQYAVRGDG-GKVECFIGS--TPPPDRIAWAWKENFLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPGTAIIQLEEREVLPV 495          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Human
Match: KIRREL1 (kirre like nephrin family adhesion molecule 1 [Source:HGNC Symbol;Acc:HGNC:15734])

HSP 1 Score: 53.9138 bits (128), Expect = 1.461e-6
Identity = 68/320 (21.25%), Postives = 115/320 (35.94%), Query Frame = 2
Query:  812 IHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKVIDSDYGT-YTC----SFSYGKTIVT-KQIHLLPL 1753
            +  GE V F+C +   P I+  Y W           G +L+E +  +         F    + C +   V   N                   S  +N+ + P+I       T ++IG  V L+C    NP  ++ W K                     +  E  +   ++S+++    + V + D   Y C A         + V +     P I  E     V  DG   + C + S   P P  I W ++ + L + + ER  +       GV S L    V+++D+ T Y C    SF  G  I+  ++  +LP+
Sbjct:   32 VQEGERVVFTCQATANPEIL-GYRW---------AKGGFLIEDAHESRYETNVDYSFFTEPVSCEVHNKVGSTNV------------------STLVNVHFAPRIVVD-PKPTTTDIGSDVTLTCVWVGNPPLTLTWTKKDSNMGPRPPG----------SPPEAALSAQVLSNSNQLLLKSVTQADAGTYTCRAIVPRIGVAEREVPLYVNGPPIISSEAVQYAVRGDG-GKVECFIGS--TPPPDRIAWAWKENFLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPGTAIIQLEEREVLPV 309          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Human
Match: IGSF10 (immunoglobulin superfamily member 10 [Source:HGNC Symbol;Acc:HGNC:26384])

HSP 1 Score: 53.9138 bits (128), Expect = 1.983e-6
Identity = 54/219 (24.66%), Postives = 87/219 (39.73%), Query Frame = 2
Query: 1100 LNILYPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKV-EQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKVIDSDYGTYTCSF--SYGKTIVTKQIHLL 1747
            L +L  P  + PF    V+ +G+   L+C VD NP   I W   + GT  +    ++ Y               +I+S            D   Y C A+ +    I K V++   ++P I      T+K  +    SL C+ +  PKP   NIKW   +  +       R  IN + ++     L  K+    D G Y C    S G T++T  + ++
Sbjct: 2331 LEMLRRPTFRNPFNEKIVAQLGKSTALNCSVDGNPPPEIIWILPN-GTRFSNGPQSYQY---------------LIASNGSFIISKTTREDAGKYRCAAR-NKVGYIEKLVILEIGQKPVILTYAPGTVKGISGESLSLHCVSDGIPKP---NIKWTMPSGYVV-----DRPQINGKYILHDNGTLVIKEATAYDRGNYICKAQNSVGHTLITVPVMIV 2524          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Human
Match: KIRREL1 (kirre like nephrin family adhesion molecule 1 [Source:HGNC Symbol;Acc:HGNC:15734])

HSP 1 Score: 52.373 bits (124), Expect = 4.498e-6
Identity = 89/432 (20.60%), Postives = 150/432 (34.72%), Query Frame = 2
Query:  506 IIWVPENQKLNFTCISKNGSPMPQLMW--------TVKTETGLSDNGKIQRQNYSLMRLSSDFHNSNI-SCKIVNKKDYLDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKF-QVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKVIDSDYGT-YTC----SFSYGKTIVT-KQIHLLPL 1753
            +I +      N TC + N  P   ++W             T L  +GK +     L+   +D     + +C+ +N+       +P+   T   L + +   + T     + +  GE V F+C +   P I+  Y W           G +L+E +  +         F    + C +   V   N                   S  +N+ + P+I       T ++IG  V L+C    NP  ++ W K                              NM+ S S     + V + D   Y C A         + V +     P I  E     V  DG   + C + S   P P  I W ++ + L + + ER  +       GV S L    V+++D+ T Y C    SF  G  I+  ++  +LP+
Sbjct:   30 VILLQAGTPHNLTCRAFNAKPAATIIWFRDGTQQEGAVASTELLKDGKRETTVSQLLINPTDLDIGRVFTCRSMNEA------IPSGKETSIELDVHHPPTV-TLSIEPQTVQEGERVVFTCQATANPEIL-GYRW---------AKGGFLIEDAHESRYETNVDYSFFTEPVSCEVHNKVGSTNV------------------STLVNVHFAPRIVVD-PKPTTTDIGSDVTLTCVWVGNPPLTLTWTKKD---------------------------SNMVLSNSNQLLLKSVTQADAGTYTCRAIVPRIGVAEREVPLYVNGPPIISSEAVQYAVRGDG-GKVECFIGS--TPPPDRIAWAWKENFLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPGTAIIQLEEREVLPV 395          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Celegans
Match: syg-2 (Synaptogenesis protein syg-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9U3P2])

HSP 1 Score: 58.9214 bits (141), Expect = 1.625e-8
Identity = 106/421 (25.18%), Postives = 165/421 (39.19%), Query Frame = 2
Query:   53 VIMLSSFFLLSNSTKYVLKDEPSEVKVILGQPTVLKCRLE-IPENVVKIKLQWSKD---MFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTE--LQDEALYGCHIELTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMWTVKTETGLSDNGKIQRQN-------YSLMRLSSDF--HNSNISCKIVNKK--------DYLDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDN-----CDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVSNI--GEWVVLSCE-VDSNPQASIRW 1222
             I+L  F  +  S+++ L + PS +  I G+    +C  E  PE +V    QW  +   + G     I   ++GR +    I+    +LH K T   L D+  Y C +   L   E    +  K  L II PP  + F  +  N            SII V EN  LN TC+  N  P P+++W +  +    D  +    +       Y+ + + SD   H   I+C+   K+          LD   P +  TV++L  +N   LR+  N+         ++ S      P  + +Y     + N   Q+   L  RS      IK          +   F + Q DN     C +N +R  N   + KA+    L + YPP      E    SNI  G    + C+ + SNP + I W
Sbjct:    5 AILLWLFGSIHISSQFFL-ESPSNLSTIAGESITFRCSAEKSPEPIVY--SQWKSNTGSLLGYHQEGILPGHQGRFSY---IKQNAEELHLKITHVNLDDDGEYECQM---LHPEE--GPIRAKSFLNIIVPPQLVYFSNYQPN------------SIIAVKENTPLNITCVVPNVKPEPEVLWYMDGKVMSRDVKQASTPHLNKTFTVYTSLVVQSDRNDHGKVITCEAFQKETDIRITTNTTLDVLFPPSDPTVEIL--RNPSALRSGDNV--------TIACSVTGGNPPPDVFWY-----HENKRLQSHSTLDTRSKE----IK----------NIYSFIASQNDNMAEYECRANNSRTGN--PKRKAM---KLEVNYPP---ASVELFGESNIRYGSSANIQCKSLPSNPASQITW 365          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Celegans
Match: syg-2 (Synaptogenesis protein syg-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9U3P2])

HSP 1 Score: 58.9214 bits (141), Expect = 1.700e-8
Identity = 106/421 (25.18%), Postives = 165/421 (39.19%), Query Frame = 2
Query:   53 VIMLSSFFLLSNSTKYVLKDEPSEVKVILGQPTVLKCRLE-IPENVVKIKLQWSKD---MFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTE--LQDEALYGCHIELTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMWTVKTETGLSDNGKIQRQN-------YSLMRLSSDF--HNSNISCKIVNKK--------DYLDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDN-----CDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVSNI--GEWVVLSCE-VDSNPQASIRW 1222
             I+L  F  +  S+++ L + PS +  I G+    +C  E  PE +V    QW  +   + G     I   ++GR +    I+    +LH K T   L D+  Y C +   L   E    +  K  L II PP  + F  +  N            SII V EN  LN TC+  N  P P+++W +  +    D  +    +       Y+ + + SD   H   I+C+   K+          LD   P +  TV++L  +N   LR+  N+         ++ S      P  + +Y     + N   Q+   L  RS      IK          +   F + Q DN     C +N +R  N   + KA+    L + YPP      E    SNI  G    + C+ + SNP + I W
Sbjct:    5 AILLWLFGSIHISSQFFL-ESPSNLSTIAGESITFRCSAEKSPEPIVYS--QWKSNTGSLLGYHQEGILPGHQGRFSY---IKQNAEELHLKITHVNLDDDGEYECQM---LHPEE--GPIRAKSFLNIIVPPQLVYFSNYQPN------------SIIAVKENTPLNITCVVPNVKPEPEVLWYMDGKVMSRDVKQASTPHLNKTFTVYTSLVVQSDRNDHGKVITCEAFQKETDIRITTNTTLDVLFPPSDPTVEIL--RNPSALRSGDNV--------TIACSVTGGNPPPDVFWY-----HENKRLQSHSTLDTRSKE----IK----------NIYSFIASQNDNMAEYECRANNSRTGN--PKRKAM---KLEVNYPP---ASVELFGESNIRYGSSANIQCKSLPSNPASQITW 365          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Celegans
Match: unc-89 (Muscle M-line assembly protein unc-89 [Source:UniProtKB/Swiss-Prot;Acc:O01761])

HSP 1 Score: 52.7582 bits (125), Expect = 1.513e-6
Identity = 48/163 (29.45%), Postives = 69/163 (42.33%), Query Frame = 2
Query: 1112 YPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQ--TSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEA---------QASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWY 1567
            Y PKI  P E+ TV N G+ + LSC+VD+ P+AS+ WYK       ++R+   Y +  T+T+ +N+ T                  E D+  Y C A           S   K+ K  V  + EEP        +  +     +L C V   P P    IKWY
Sbjct: 4661 YAPKINPPLEDKTV-NGGQPIRLSCKVDAIPRASVVWYKDGLPLRADSRTSIQYEEDGTATLAINDST------------------EEDIGAYRCVATNAHGTINTSCSVNVKVPKQEVKKEGEEPFFTKGLVDLWADRGDSFTLKCAVTGDPFP---EIKWY 4801          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Celegans
Match: unc-89 (Muscle M-line assembly protein unc-89 [Source:UniProtKB/Swiss-Prot;Acc:O01761])

HSP 1 Score: 52.7582 bits (125), Expect = 1.595e-6
Identity = 48/163 (29.45%), Postives = 69/163 (42.33%), Query Frame = 2
Query: 1112 YPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQ--TSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEA---------QASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWY 1567
            Y PKI  P E+ TV N G+ + LSC+VD+ P+AS+ WYK       ++R+   Y +  T+T+ +N+ T                  E D+  Y C A           S   K+ K  V  + EEP        +  +     +L C V   P P    IKWY
Sbjct: 4741 YAPKINPPLEDKTV-NGGQPIRLSCKVDAIPRASVVWYKDGLPLRADSRTSIQYEEDGTATLAINDST------------------EEDIGAYRCVATNAHGTINTSCSVNVKVPKQEVKKEGEEPFFTKGLVDLWADRGDSFTLKCAVTGDPFP---EIKWY 4881          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Celegans
Match: unc-89 (Muscle M-line assembly protein unc-89 [Source:UniProtKB/Swiss-Prot;Acc:O01761])

HSP 1 Score: 52.7582 bits (125), Expect = 1.637e-6
Identity = 48/163 (29.45%), Postives = 69/163 (42.33%), Query Frame = 2
Query: 1112 YPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQ--TSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEA---------QASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWY 1567
            Y PKI  P E+ TV N G+ + LSC+VD+ P+AS+ WYK       ++R+   Y +  T+T+ +N+ T                  E D+  Y C A           S   K+ K  V  + EEP        +  +     +L C V   P P    IKWY
Sbjct: 5381 YAPKINPPLEDKTV-NGGQPIRLSCKVDAIPRASVVWYKDGLPLRADSRTSIQYEEDGTATLAINDST------------------EEDIGAYRCVATNAHGTINTSCSVNVKVPKQEVKKEGEEPFFTKGLVDLWADRGDSFTLKCAVTGDPFP---EIKWY 5521          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Fly
Match: rst (gene:FBgn0003285 transcript:FBtr0343758)

HSP 1 Score: 105.145 bits (261), Expect = 1.070e-22
Identity = 130/601 (21.63%), Postives = 225/601 (37.44%), Query Frame = 2
Query:   41 IAFVVIML-SSFFLLSNSTKYVLKDEPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCHIELTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMWTVKTETGLSDNGKI-------QRQ--NYSLMRLSS--DFHNSNISCKIVNKKDY--------------------LDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKVIDSDYGTYTCSF--SYGKTIVTKQIH 1741
            +A +V M+ SS +    + ++ +  EP +   ++G    L CR+   +      LQW+KD FGL  S     ++ R  + GS + G Y L      L D+A Y C +         + S      L ++ PP                     +  +I+  E++K+   C+S  G P  ++ W       L+DN +        QR+    S++RL+   + HN+N SC+  N  D                     + G LP             +V + T   I +  H+   V   C +   P   + Y WF+        N E ++    +  ++   + KFH + + C +  SV K                     S++L+I Y P  +   +++  +++G  V L+CEVDSNPQ  I W +                             + ++ +++   F V NE     Y C+A    + +I     V  K  P I  ++    +  D  A + C   S P+    ++ W F   E++  S     ++      GV+S L  +      YG Y C+    YG  +   Q+ 
Sbjct:   10 LATIVGMVRSSPYTSYQNQRFAM--EPQDQTAVVGARVTLPCRVINKQGT----LQWTKDDFGLGTSRDLSGFE-RYAMVGSDEEGDYSLDIYPVMLDDDARYQCQVSPGPEGQPAIRSTFA--GLTVLVPPEAPKI---------------TQGDVIYATEDRKVEIECVSVGGKPAAEITWIDGLGNVLTDNIEYTVIPLPDQRRFTAKSVLRLTPKKEHHNTNFSCQAQNTADRTYRSAKIRVEVKYAPKVKVNVMGSLPGGAGGSVGGAGGGSVHMSTGSRIVE--HS--QVRLECRADANPS-DVRYRWFI--------NDEPIIGGQKTEMVIRNVTRKFHDAIVKCEVQNSVGKSE------------------DSETLDISYAPSFRQRPQSME-ADVGSVVSLTCEVDSNPQPEIVWIQHPS--------------------------DRVVGTSTNLTFSVSNE-TAGRYYCKANVPGYAEISADAYVYLKGSPAIGSQRTQYGLVGD-TARIECFASSVPR--ARHVSWTFNGQEISSESGHDYSILVDAVPGGVKSTLIIRDSQAYHYGKYNCTVVNDYGNDVAEIQLQ 524          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Fly
Match: rst (gene:FBgn0003285 transcript:FBtr0070562)

HSP 1 Score: 105.145 bits (261), Expect = 1.070e-22
Identity = 130/601 (21.63%), Postives = 225/601 (37.44%), Query Frame = 2
Query:   41 IAFVVIML-SSFFLLSNSTKYVLKDEPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCHIELTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMWTVKTETGLSDNGKI-------QRQ--NYSLMRLSS--DFHNSNISCKIVNKKDY--------------------LDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKVIDSDYGTYTCSF--SYGKTIVTKQIH 1741
            +A +V M+ SS +    + ++ +  EP +   ++G    L CR+   +      LQW+KD FGL  S     ++ R  + GS + G Y L      L D+A Y C +         + S      L ++ PP                     +  +I+  E++K+   C+S  G P  ++ W       L+DN +        QR+    S++RL+   + HN+N SC+  N  D                     + G LP             +V + T   I +  H+   V   C +   P   + Y WF+        N E ++    +  ++   + KFH + + C +  SV K                     S++L+I Y P  +   +++  +++G  V L+CEVDSNPQ  I W +                             + ++ +++   F V NE     Y C+A    + +I     V  K  P I  ++    +  D  A + C   S P+    ++ W F   E++  S     ++      GV+S L  +      YG Y C+    YG  +   Q+ 
Sbjct:   10 LATIVGMVRSSPYTSYQNQRFAM--EPQDQTAVVGARVTLPCRVINKQGT----LQWTKDDFGLGTSRDLSGFE-RYAMVGSDEEGDYSLDIYPVMLDDDARYQCQVSPGPEGQPAIRSTFA--GLTVLVPPEAPKI---------------TQGDVIYATEDRKVEIECVSVGGKPAAEITWIDGLGNVLTDNIEYTVIPLPDQRRFTAKSVLRLTPKKEHHNTNFSCQAQNTADRTYRSAKIRVEVKYAPKVKVNVMGSLPGGAGGSVGGAGGGSVHMSTGSRIVE--HS--QVRLECRADANPS-DVRYRWFI--------NDEPIIGGQKTEMVIRNVTRKFHDAIVKCEVQNSVGKSE------------------DSETLDISYAPSFRQRPQSME-ADVGSVVSLTCEVDSNPQPEIVWIQHPS--------------------------DRVVGTSTNLTFSVSNE-TAGRYYCKANVPGYAEISADAYVYLKGSPAIGSQRTQYGLVGD-TARIECFASSVPR--ARHVSWTFNGQEISSESGHDYSILVDAVPGGVKSTLIIRDSQAYHYGKYNCTVVNDYGNDVAEIQLQ 524          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Fly
Match: kirre (gene:FBgn0028369 transcript:FBtr0332492)

HSP 1 Score: 89.7373 bits (221), Expect = 7.600e-18
Identity = 122/556 (21.94%), Postives = 217/556 (39.03%), Query Frame = 2
Query:  113 EPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCHIELTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMW-----TVKTET------GLSDNGKIQRQNYSLMRLSSDFHNSNISCKIVNKKD--YLDGKLPTAVVTVQVLYIKNAVILRTNGNI-DKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITV-SNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLM---CLVESWPKPSPSNIKWYFETSELAIISTERR-YLINKRQL-MGVESKLFFKKVIDSDYGTYTCSF--SYG 1714
            EP +   ++G    L CR  + E V    LQW+KD FGL        ++ R ++ GS + G + L      L D+A Y C +    +  + + S   K  L ++ PP        +    Y           +   E++++   C+S+ G P  ++ W      V T+        L+D+ +I  ++   +    + HN+  +C+  N  D  Y   KL      ++V Y    ++    G +    I  G  V  SC +   P   + Y WF+        N E +    ++  I+   S ++H + + C +  +V K                     SK L+I + P  +     ++V +++G  V + C+V  NP+  I W       S+N+                    + ++   +  K +V +E     Y C+A  + F +I     +  K  P I     + KV+  G+   +   CL  S PK    +I W FE   + + S +   Y+  +  L  GV + L  +    + +G Y C+   SYG
Sbjct:   87 EPQDQTAVVGSRVTLPCR--VMEKVGA--LQWTKDDFGLGQHRNLSGFE-RYSMVGSDEEGDFSLDIYPLMLDDDAKYQCQVGPGPQGEQGIRSRFAK--LTVLVPPEAP----KITQGDY-----------LVTTEDREIELECVSQGGKPAAEITWIDGLGNVLTKGIEYVKEPLADSRRITARSILKLAPKKEHHNTTFTCQAQNTADRTYRSAKL-----LLEVKYAPKVIVSVVGGALAGGKIPEGAEVILSCQADANP-HELSYRWFI--------NDELMTGDFTTKMIIHNVSRQYHDAIVKCEVVNAVGKSE------------------QSKKLDISFGPVFRQ--RPVSVEADLGATVSMRCDVAGNPEPEIEW------ISENS--------------------DQVVGVAAELKLKVSSE-TAGRYFCKAVVNGFPEIGAEATLYVKRAPII----TSHKVQFGGVGGRVKIDCLAFSIPK--AEHILWSFEGKIINMSSADPDIYIFEEHHLPEGVRAALIIRDSKATHFGKYNCTVMNSYG 553          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Fly
Match: kirre (gene:FBgn0028369 transcript:FBtr0309498)

HSP 1 Score: 89.7373 bits (221), Expect = 7.600e-18
Identity = 122/556 (21.94%), Postives = 217/556 (39.03%), Query Frame = 2
Query:  113 EPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCHIELTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMW-----TVKTET------GLSDNGKIQRQNYSLMRLSSDFHNSNISCKIVNKKD--YLDGKLPTAVVTVQVLYIKNAVILRTNGNI-DKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITV-SNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLM---CLVESWPKPSPSNIKWYFETSELAIISTERR-YLINKRQL-MGVESKLFFKKVIDSDYGTYTCSF--SYG 1714
            EP +   ++G    L CR  + E V    LQW+KD FGL        ++ R ++ GS + G + L      L D+A Y C +    +  + + S   K  L ++ PP        +    Y           +   E++++   C+S+ G P  ++ W      V T+        L+D+ +I  ++   +    + HN+  +C+  N  D  Y   KL      ++V Y    ++    G +    I  G  V  SC +   P   + Y WF+        N E +    ++  I+   S ++H + + C +  +V K                     SK L+I + P  +     ++V +++G  V + C+V  NP+  I W       S+N+                    + ++   +  K +V +E     Y C+A  + F +I     +  K  P I     + KV+  G+   +   CL  S PK    +I W FE   + + S +   Y+  +  L  GV + L  +    + +G Y C+   SYG
Sbjct:   87 EPQDQTAVVGSRVTLPCR--VMEKVGA--LQWTKDDFGLGQHRNLSGFE-RYSMVGSDEEGDFSLDIYPLMLDDDAKYQCQVGPGPQGEQGIRSRFAK--LTVLVPPEAP----KITQGDY-----------LVTTEDREIELECVSQGGKPAAEITWIDGLGNVLTKGIEYVKEPLADSRRITARSILKLAPKKEHHNTTFTCQAQNTADRTYRSAKL-----LLEVKYAPKVIVSVVGGALAGGKIPEGAEVILSCQADANP-HELSYRWFI--------NDELMTGDFTTKMIIHNVSRQYHDAIVKCEVVNAVGKSE------------------QSKKLDISFGPVFRQ--RPVSVEADLGATVSMRCDVAGNPEPEIEW------ISENS--------------------DQVVGVAAELKLKVSSE-TAGRYFCKAVVNGFPEIGAEATLYVKRAPII----TSHKVQFGGVGGRVKIDCLAFSIPK--AEHILWSFEGKIINMSSADPDIYIFEEHHLPEGVRAALIIRDSKATHFGKYNCTVMNSYG 553          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Fly
Match: kirre (gene:FBgn0028369 transcript:FBtr0070560)

HSP 1 Score: 89.7373 bits (221), Expect = 7.600e-18
Identity = 122/556 (21.94%), Postives = 217/556 (39.03%), Query Frame = 2
Query:  113 EPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCHIELTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMW-----TVKTET------GLSDNGKIQRQNYSLMRLSSDFHNSNISCKIVNKKD--YLDGKLPTAVVTVQVLYIKNAVILRTNGNI-DKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITV-SNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLM---CLVESWPKPSPSNIKWYFETSELAIISTERR-YLINKRQL-MGVESKLFFKKVIDSDYGTYTCSF--SYG 1714
            EP +   ++G    L CR  + E V    LQW+KD FGL        ++ R ++ GS + G + L      L D+A Y C +    +  + + S   K  L ++ PP        +    Y           +   E++++   C+S+ G P  ++ W      V T+        L+D+ +I  ++   +    + HN+  +C+  N  D  Y   KL      ++V Y    ++    G +    I  G  V  SC +   P   + Y WF+        N E +    ++  I+   S ++H + + C +  +V K                     SK L+I + P  +     ++V +++G  V + C+V  NP+  I W       S+N+                    + ++   +  K +V +E     Y C+A  + F +I     +  K  P I     + KV+  G+   +   CL  S PK    +I W FE   + + S +   Y+  +  L  GV + L  +    + +G Y C+   SYG
Sbjct:   87 EPQDQTAVVGSRVTLPCR--VMEKVGA--LQWTKDDFGLGQHRNLSGFE-RYSMVGSDEEGDFSLDIYPLMLDDDAKYQCQVGPGPQGEQGIRSRFAK--LTVLVPPEAP----KITQGDY-----------LVTTEDREIELECVSQGGKPAAEITWIDGLGNVLTKGIEYVKEPLADSRRITARSILKLAPKKEHHNTTFTCQAQNTADRTYRSAKL-----LLEVKYAPKVIVSVVGGALAGGKIPEGAEVILSCQADANP-HELSYRWFI--------NDELMTGDFTTKMIIHNVSRQYHDAIVKCEVVNAVGKSE------------------QSKKLDISFGPVFRQ--RPVSVEADLGATVSMRCDVAGNPEPEIEW------ISENS--------------------DQVVGVAAELKLKVSSE-TAGRYFCKAVVNGFPEIGAEATLYVKRAPII----TSHKVQFGGVGGRVKIDCLAFSIPK--AEHILWSFEGKIINMSSADPDIYIFEEHHLPEGVRAALIIRDSKATHFGKYNCTVMNSYG 553          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Zebrafish
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:HGNC Symbol;Acc:HGNC:23204])

HSP 1 Score: 72.0182 bits (175), Expect = 1.955e-12
Identity = 114/574 (19.86%), Postives = 204/574 (35.54%), Query Frame = 2
Query:   41 IAFVVIMLSSFFLLSNSTKY---------VLKDEPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCH-IELTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMWTVKTET--------GLSDNGKIQRQNYSLMRLSSDFHNSN-ISCKIVNKKDYLDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKVIDSDYGT-YTCS 1702
            + F+ I  + F +   S            V   +P ++ V+ GQP  L C +     VV     W +D   L        Y  R  + G   SG + L  +  EL D+A++ C  I+  +R             L ++ PP +            +G        ++ +     LN TC + N  P   ++W    E          L  +G+ +    +L   +S+  +   I C+  NK    +GK  +  + +Q L + N  +        +P+  G  V F C++   P  +  Y W           G  +++  S +   +     F    + C     V      +NI+RN              +++ + P++    +++ V ++G   V +C    NP  +I W K   G                     V   EN+++       + V + D   Y+C A         K V +     PTI   Q T +  +     + C + S   P P  I W ++ + L   ++ R  +       GV S L    ++ +D+ T Y C+
Sbjct:    6 MEFIFICFACFSMCERSRGLRCTSRPLNAVFSQQPQDLVVVAGQPVTLPCSIPGYHGVV----LWLRDGLALGVGRDLSGYP-RYAVVGDHGSGEHHLRIQKVELMDDAVFECQAIQAAMRSR--------PARLTVLVPPDD---------PMITG------GPVVSLRAGDPLNLTCHADNAKPAASIIWIRNGEVLNGAMYSKTLLRDGRRESTVSTLYISASNIESGQKIICRASNKA-VPNGKETSVTIDIQHLPLVNLSVE------PQPVLEGNLVKFHCSAKANPP-VTQYKW---------AKGGSVIKEVSGDTYEVIVDHSFFTEPVSC----EVTNPLGSTNISRN--------------VDVYFGPRMAAEPQSLQV-DLGSDAVFNCAWTGNPSLTIVWMKRGSGV--------------------VLSNENILT------LKSVRQEDAGKYVCRAVVPRVGAAEKEVSLTVNGPPTISSTQ-THQAPHGEKGQIKCFIRS--TPPPDRIAWSWKETVLESGTSGRYTVETVSTEDGVLSTLTMSNIVPADFQTIYNCT 486          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Zebrafish
Match: kirrel1a (kirre like nephrin family adhesion molecule 1a [Source:ZFIN;Acc:ZDB-GENE-040426-2126])

HSP 1 Score: 68.9366 bits (167), Expect = 2.456e-11
Identity = 118/568 (20.77%), Postives = 207/568 (36.44%), Query Frame = 2
Query:  113 EPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYK-GRLTIPGSIQSGYYDLHFKTTELQDEALYGCH-IELTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMW---------TVKTETGLSDNGKIQRQNYSLMRLSSDFHNSNISCKIVNKKDYLDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINK----RQLMGVESKLFFKKVIDSDY-GTYTC----SFSYGKTIVT-KQIHLLPL 1753
            EP++  V+LGQ  VL C +     +V    QW+KD  GL     +D+    R  +   +  G Y+L     EL D++LY C   E  LR          +  L ++ PP E   +        +G+ +               N +C+S+   P   + W          V T   L D  ++  ++Y  ++        N +C   N    +  +   A +T+ V +    V L       + +  GE V+F+C +   P  I+ Y W           G  +++ +  +  V KA   F    + C +F +V   N                   S  +++ + P +    + +TV ++   V L+C+   NP  ++ W K   G+S    + N  Y                         + V++ D   Y+C+A           V +     P I  E     V  +    + C + S P P      W     E    +   RY + +     Q   V S L    +++SD+  TY C    SF  G  I++ +++ ++P+
Sbjct:   25 EPADQSVVLGQRVVLSCVVFNYSGIV----QWTKD--GLALGIGEDLRAWPRYRVLRLVDVGQYNLEISAAELSDDSLYECQATEAALRSR--------RAKLTVLIPPDEPVIEGSPEILLTAGVPY---------------NMSCVSRGAKPASVIEWQKDGLPIEGAVSTTEVLPDRKRVTTRSYLPIQPLDTDTGKNFTCVATNLAVPMGKR---ATITLNVHH-PPVVTLSIE---PRSVLEGERVTFTCQATANP-PIMGYKW---------AKGGVVIQGARESVFVTKADHSFFTEPVSCQVFNAVGSTNV------------------SILVDVHFGPILVVEPKPVTV-DVDSDVTLNCKWAGNPPLTLTWTKK--GSSMVLSNNNQLY------------------------LKSVSQADAGQYVCKAIVPRIGVGETEVTLTVNGPPIISSEPFQYAVRGE-RGEVKCYIASTPPPDKIVWAWKENVWEKEKGTLSERYTVEQSKPSAQGGAVLSTLTINNIMESDFQSTYNCTAWNSFGSGTMIISLEEMEIVPV 500          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Zebrafish
Match: kirrel1a (kirre like nephrin family adhesion molecule 1a [Source:ZFIN;Acc:ZDB-GENE-040426-2126])

HSP 1 Score: 68.9366 bits (167), Expect = 2.456e-11
Identity = 118/568 (20.77%), Postives = 207/568 (36.44%), Query Frame = 2
Query:  113 EPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYK-GRLTIPGSIQSGYYDLHFKTTELQDEALYGCH-IELTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMW---------TVKTETGLSDNGKIQRQNYSLMRLSSDFHNSNISCKIVNKKDYLDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINK----RQLMGVESKLFFKKVIDSDY-GTYTC----SFSYGKTIVT-KQIHLLPL 1753
            EP++  V+LGQ  VL C +     +V    QW+KD  GL     +D+    R  +   +  G Y+L     EL D++LY C   E  LR          +  L ++ PP E   +        +G+ +               N +C+S+   P   + W          V T   L D  ++  ++Y  ++        N +C   N    +  +   A +T+ V +    V L       + +  GE V+F+C +   P  I+ Y W           G  +++ +  +  V KA   F    + C +F +V   N                   S  +++ + P +    + +TV ++   V L+C+   NP  ++ W K   G+S    + N  Y                         + V++ D   Y+C+A           V +     P I  E     V  +    + C + S P P      W     E    +   RY + +     Q   V S L    +++SD+  TY C    SF  G  I++ +++ ++P+
Sbjct:   25 EPADQSVVLGQRVVLSCVVFNYSGIV----QWTKD--GLALGIGEDLRAWPRYRVLRLVDVGQYNLEISAAELSDDSLYECQATEAALRSR--------RAKLTVLIPPDEPVIEGSPEILLTAGVPY---------------NMSCVSRGAKPASVIEWQKDGLPIEGAVSTTEVLPDRKRVTTRSYLPIQPLDTDTGKNFTCVATNLAVPMGKR---ATITLNVHH-PPVVTLSIE---PRSVLEGERVTFTCQATANP-PIMGYKW---------AKGGVVIQGARESVFVTKADHSFFTEPVSCQVFNAVGSTNV------------------SILVDVHFGPILVVEPKPVTV-DVDSDVTLNCKWAGNPPLTLTWTKK--GSSMVLSNNNQLY------------------------LKSVSQADAGQYVCKAIVPRIGVGETEVTLTVNGPPIISSEPFQYAVRGE-RGEVKCYIASTPPPDKIVWAWKENVWEKEKGTLSERYTVEQSKPSAQGGAVLSTLTINNIMESDFQSTYNCTAWNSFGSGTMIISLEEMEIVPV 500          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Zebrafish
Match: kirrel3a (kirre like nephrin family adhesion molecule 3a [Source:ZFIN;Acc:ZDB-GENE-091117-44])

HSP 1 Score: 65.4698 bits (158), Expect = 1.846e-10
Identity = 106/542 (19.56%), Postives = 197/542 (36.35%), Query Frame = 2
Query:  113 EPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCH-IELTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMW---------TVKTETGLSDNGKIQRQNYSLMRLSSDFHNS-NISCKIVNKKDYLDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKVIDSDYGT-YTCS 1702
            +P ++ ++ G+P  L C +   + +V     W KD   L  +     Y  R  + G    G Y L  + TEL D+  + C  I++  R             L ++ PP +              II      ++ +     LN TC + N  P   ++W            T+T L D GK +    +L   +S+  +   I+C+  NK    +GK  T  + +Q   + N  +        +P+  G  V F C +   P  + +Y W           G  ++  ++ +   +     F    + C +  ++      +NI+RN              +++ + P++    +++ V   G   V SC    NP  +I W K   G                           ++S+ +    + V + D   Y+C A         K V++     P+I   Q    +  +    + C + S   P P  I W ++ + L   ++ R  +       GV S L  + ++ +D+ T Y C+
Sbjct:   26 QPHDLVIVAGEPVTLPCTIIGYQGMV----LWVKDGLALGVNRDLSGYP-RYDVIGDHSKGEYHLLIERTELVDDGSFECQAIQVAGRSR--------PAQLTVLVPPDD------------PVIIGAP---VVSLRAGDSLNLTCHANNAKPAASIIWIRNGEVINGAAYTKTLLRD-GKRESTVSTLHISASNIESGQQITCRASNKA-APNGKEATVTIDIQHFPLVNLSVE------PQPVLEGNLVKFHCAAKANPP-VTHYRW---------AKGGSMITDATGDTYEVLVDHSFFTEPVSCEVTNALGS----TNISRN--------------VDVYFGPRLAAEPQSLQVDR-GSDAVFSCAWIGNPSLTIVWMKRGHGV--------------------------VLSNENTLTLKAVRQEDAGKYVCRAVVPRVGVGEKEVMLTVNGPPSISSTQTQQALYGEK-GQIKCFIRS--TPPPDRIAWSWKETVLESGTSGRYTVETVSTEEGVISTLTMRNIVPTDFQTIYNCT 473          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Zebrafish
Match: kirrel3a (kirre like nephrin family adhesion molecule 3a [Source:ZFIN;Acc:ZDB-GENE-091117-44])

HSP 1 Score: 65.855 bits (159), Expect = 2.196e-10
Identity = 106/542 (19.56%), Postives = 197/542 (36.35%), Query Frame = 2
Query:  113 EPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCH-IELTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMW---------TVKTETGLSDNGKIQRQNYSLMRLSSDFHNS-NISCKIVNKKDYLDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKVIDSDYGT-YTCS 1702
            +P ++ ++ G+P  L C +   + +V     W KD   L  +     Y  R  + G    G Y L  + TEL D+  + C  I++  R             L ++ PP +              II      ++ +     LN TC + N  P   ++W            T+T L D GK +    +L   +S+  +   I+C+  NK    +GK  T  + +Q   + N  +        +P+  G  V F C +   P  + +Y W           G  ++  ++ +   +     F    + C +  ++      +NI+RN              +++ + P++    +++ V   G   V SC    NP  +I W K   G                           ++S+ +    + V + D   Y+C A         K V++     P+I   Q    +  +    + C + S   P P  I W ++ + L   ++ R  +       GV S L  + ++ +D+ T Y C+
Sbjct:   26 QPHDLVIVAGEPVTLPCTIIGYQGMVL----WVKDGLALGVNRDLSGYP-RYDVIGDHSKGEYHLLIERTELVDDGSFECQAIQVAGRSR--------PAQLTVLVPPDD------------PVIIGAP---VVSLRAGDSLNLTCHANNAKPAASIIWIRNGEVINGAAYTKTLLRD-GKRESTVSTLHISASNIESGQQITCRASNKA-APNGKEATVTIDIQHFPLVNLSVE------PQPVLEGNLVKFHCAAKANPP-VTHYRW---------AKGGSMITDATGDTYEVLVDHSFFTEPVSCEVTNALGS----TNISRN--------------VDVYFGPRLAAEPQSLQVDR-GSDAVFSCAWIGNPSLTIVWMKRGHGV--------------------------VLSNENTLTLKAVRQEDAGKYVCRAVVPRVGVGEKEVMLTVNGPPSISSTQTQQALYGEK-GQIKCFIRS--TPPPDRIAWSWKETVLESGTSGRYTVETVSTEEGVISTLTMRNIVPTDFQTIYNCT 473          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Xenopus
Match: eif4e (eukaryotic translation initiation factor 4E [Source:Xenbase;Acc:XB-GENE-855435])

HSP 1 Score: 71.633 bits (174), Expect = 3.704e-12
Identity = 134/591 (22.67%), Postives = 223/591 (37.73%), Query Frame = 2
Query:   47 FVVIMLSSFFLLSNSTKYVLKDEPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYK-GRLTIPGSIQSGYYDLHFKTTELQDEALYGCHIELTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMW---------TVKTETGLSDNGKIQRQNYSLMRLSSDFHNSNISCKIVNKKDYLDGKLPTA---VVTVQVLYIKNAVILRTNGNIDKP-IHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNIN-RNCNIE-LRHKAVSSKSLNILYPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKVIDSDYGT-YTCSF--SYGKTIVT---KQIHLLPL 1753
             V   + +FFL      +    +PS+  ++ G+   L C +     VV    QW+ D  GL     +D+    R ++ G    G ++LH +  EL D+A+Y C        S+       +  L ++ PP +      +  +  + ++            N   N TC++    P  ++ W          V T+  LSD       +  L+  S     S+ +C++ N+       LP      VT+ V Y     +     +++ P I  G +V+F C ++  P  +  Y W      +     +Y VE   +          F  + + C +  SV   N  + +N   C I    H   +S S+N++ P  +  P   +TV +IG+     C    NP  +  W K   GT +   + N      T+ L +VT                    D  IY+C+A         K V +  +  P I  E    +    G A + CL+ES   P+P  I W ++   L   S  R  +  +   +G  S L       SD+ T + CS    YG+  V    +Q   LPL
Sbjct:   21 LVPFSICAFFLTGFGAHF--SQQPSDKVIVAGKSVTLPCVVIGYRGVV----QWTMD--GLALGAERDLPGWSRYSVVGDPSLGEHNLHIEGVELSDDAIYECQATQAALRSQ-------RARLTVLLPPGDP----MIPGSPVANVLL-----------NVPYNLTCLAPVAKPAAEITWYRDGKKLDSAVYTKELLSDGKSEGSASSLLITPSLADSGSSYTCRVRNE------ALPEGREKSVTLSVQYPPKVTL-----SVEPPTITEGGSVTFLCGAVSNPE-VTGYRWAKGGVPLAVSGDKYTVEVDHT----------FFTAPVSCEVSNSVGASNVSTAVNVLRCPISNFIH---TSFSVNLVGPRLLTEP-RPMTV-DIGDDASFFCGWTGNPTPTQFWSKK--GTGEVLSNGN------TLLLTKVT------------------REDAGIYVCKAIVPRMGSTEKEVTLTVRGPPIITSEMH-YETTLGGKARMECLIES--TPAPDRIVWAWDKQSLEDGSWGRFSVETEVTEVGAISVLVIDGAEQSDFLTEFNCSAINQYGEDSVIVSLRQQAALPL 525          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Xenopus
Match: igfbp4 (insulin like growth factor binding protein 4 [Source:Xenbase;Acc:XB-GENE-484795])

HSP 1 Score: 71.633 bits (174), Expect = 4.321e-12
Identity = 112/561 (19.96%), Postives = 195/561 (34.76%), Query Frame = 2
Query:   98 YVLKDEPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCH-IELTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMWTVKTETGLSDNGKIQRQNYSLMRLSSDFHNSNISCKIVNKKDYLDGKLPTAVVTVQVLYIKNAVILRTNGNIDKP-----------IHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKF-QVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKVIDSDYGT-YTC----SFSYGKTIV 1726
            Y+L  EP++  V+ GQ  VL C +     +V    QW+KD   L       ++  R  I G+++SG Y+L      + D+A + C   E  LR          K  L ++ PP +   +                   I +      N TC + +  P   ++W         D  +     YS   L+     + +S  +++  D   G++ T   + + +       ++   N+  P           +  GE V F+C++   P  I  Y W           G  ++E +  ++   +    F    + C +   V   N                   S  +++ + P++       T +++G  V L+C    NP  ++ W K                              NM+ S     F + V + D   Y+C+A         + V +     P I  E+       D    + C + S   P P  I W ++ + L   + ER  +       GV S L    V++SD+ T Y C    SF  G  I+
Sbjct:    5 YLLLTEPTDQTVVAGQKVVLTCVVLNYSGIV----QWTKDGLALGLGQNLRIWP-RYQIVGNVESGQYNLEISNASIVDDANFECQATEAALRSQ--------KAKLTVLIPPEDPVIEGGPE---------------ILLRAGTPTNLTCRANSAKPPASIVW-------FRDGNQQAGDVYSTEVLADGKRATTVSYLLISPTDQDIGRVFTCRTSNEAIPSGKETSVKL--NVHHPPTVTLSIHPQTVQEGERVRFTCSATANPE-IKGYRW---------AKGGMIIESARDSSYETQVDYSFFTEPVSCEVHNEVGSTNV------------------STLVDVQFAPRVVVE-PKPTTTDMGSDVTLTCIWAGNPPLTLTWTKKG---------------------------SNMVLSNGNQLFLKSVKQEDAGPYVCKAIVPRIGVGEREVTLFVNGPPIIASEEVQYAARGDK-GKVECFIGS--TPPPDRIAWAWKENVLETGTLERYTVERTTSTSGVLSTLTINNVMESDFQTRYNCTAWNSFGPGTAII 469          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Xenopus
Match: eif4e (eukaryotic translation initiation factor 4E [Source:Xenbase;Acc:XB-GENE-855435])

HSP 1 Score: 70.0922 bits (170), Expect = 1.122e-11
Identity = 119/545 (21.83%), Postives = 203/545 (37.25%), Query Frame = 2
Query:  113 EPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYK-GRLTIPGSIQSGYYDLHFKTTELQDEALYGCHIELTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMW---------TVKTETGLSDNGKIQRQNYSLMRLSSDFHNSNISCKIVNKKDYLDGKLPTA---VVTVQVLYIKNAVILRTNGNIDKP-IHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKVIDSDYGT-YTCS 1702
            +PS+  ++ G+   L C +     VV    QW+ D  GL     +D+    R ++ G    G ++LH +  EL D+A+Y C        S+       +  L ++ PP +      +  +  + ++            N   N TC++    P  ++ W          V T+  LSD       +  L+  S     S+ +C++ N+       LP      VT+ V Y     +     +++ P I  G +V+F C ++  P  +  Y W         + G  L    S +   ++    F  + + C +  SV   N                   S ++N+L+ P++ T    +TV +IG+     C    NP  +  W K   GT +   + N      T+ L +VT                    D  IY+C+A         K V +  +  P I  E    +    G A + CL+ES   P+P  I W ++   L   S  R  +  +   +G  S L       SD+ T + CS
Sbjct:   33 QPSDKVIVAGKSVTLPCVVIGYRGVV----QWTMD--GLALGAERDLPGWSRYSVVGDPSLGEHNLHIEGVELSDDAIYECQATQAALRSQ-------RARLTVLLPPGDP----MIPGSPVANVLL-----------NVPYNLTCLAPVAKPAAEITWYRDGKKLDSAVYTKELLSDGKSEGSASSLLITPSLADSGSSYTCRVRNE------ALPEGREKSVTLSVQYPPKVTL-----SVEPPTITEGGSVTFLCGAVSNPE-VTGYRW--------AKGGVPLA--VSGDKYTVEVDHTFFTAPVSCEVSNSVGASNV------------------STAVNVLFGPRLLTEPRPMTV-DIGDDASFFCGWTGNPTPTQFWSKK--GTGEVLSNGN------TLLLTKVT------------------REDAGIYVCKAIVPRMGSTEKEVTLTVRGPPIITSEMH-YETTLGGKARMECLIES--TPAPDRIVWAWDKQSLEDGSWGRFSVETEVTEVGAISVLVIDGAEQSDFLTEFNCS 479          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Xenopus
Match: eif4e (eukaryotic translation initiation factor 4E [Source:Xenbase;Acc:XB-GENE-855435])

HSP 1 Score: 70.4774 bits (171), Expect = 1.158e-11
Identity = 126/565 (22.30%), Postives = 213/565 (37.70%), Query Frame = 2
Query:  113 EPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYK-GRLTIPGSIQSGYYDLHFKTTELQDEALYGCH-IELTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMW---------TVKTETGLSDNGKIQRQNYSLMRLSSDFHNSNISCKIVNKKDYLDGKLPTAVVTVQVLYIKNAVILRTNGNIDKP-IHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKVIDSDYGT-YTCSF--SYGKTIVT---KQIHLLPL 1753
            +PS+  ++ G+   L C +     VV    QW+ D  GL     +D+    R ++ G    G ++LH +  EL D+A+Y C   +  LR          +  L ++ PP +      +  +  + ++            N   N TC++    P  ++ W          V T+  LSD       +  L+  S     S+ +C++ N+    +G+     VT+ V Y     +     +++ P I  G +V+F C ++  P  +  Y W      +     +Y VE   +          F  + + C +  SV   N                   S ++N+L+ P++ T    +TV +IG+     C    NP  +  W K   GT +   + N      T+ L +VT                    D  IY+C+A         K V +  +  P I  E    +    G A + CL+ES   P+P  I W ++   L   S  R  +  +   +G  S L       SD+ T + CS    YG+  V    +Q   LPL
Sbjct:   25 QPSDKVIVAGKSVTLPCVVIGYRGVV----QWTMD--GLALGAERDLPGWSRYSVVGDPSLGEHNLHIEGVELSDDAIYECQATQAALRSQ--------RARLTVLLPPGDP----MIPGSPVANVLL-----------NVPYNLTCLAPVAKPAAEITWYRDGKKLDSAVYTKELLSDGKSEGSASSLLITPSLADSGSSYTCRVRNEA-LPEGR--EKSVTLSVQYPPKVTL-----SVEPPTITEGGSVTFLCGAVSNPE-VTGYRWAKGGVPLAVSGDKYTVEVDHT----------FFTAPVSCEVSNSVGASNV------------------STAVNVLFGPRLLTEPRPMTV-DIGDDASFFCGWTGNPTPTQFWSKK--GTGEVLSNGN------TLLLTKVT------------------REDAGIYVCKAIVPRMGSTEKEVTLTVRGPPIITSEMH-YETTLGGKARMECLIES--TPAPDRIVWAWDKQSLEDGSWGRFSVETEVTEVGAISVLVIDGAEQSDFLTEFNCSAINQYGEDSVIVSLRQQAALPL 493          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Xenopus
Match: eif4e (eukaryotic translation initiation factor 4E [Source:Xenbase;Acc:XB-GENE-855435])

HSP 1 Score: 69.707 bits (169), Expect = 1.408e-11
Identity = 131/573 (22.86%), Postives = 211/573 (36.82%), Query Frame = 2
Query:  113 EPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYK-GRLTIPGSIQSGYYDLHFKTTELQDEALYGCHIELTLRDSEIVESLIGKGSLKIIEPPTELGFQFH-VANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMW---------TVKTETGLSDNGKIQRQNYSLMRLSSDFHNSNISCKIVNKKDYLDGKLPTA---VVTVQVLYIKNAVILRTNGNIDKP-IHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKVIDSDYGT-YTCSF--SYGKTIVT---KQIHLLPLKNKFI 1768
            +PS+  ++ G+   L C +     VV    QW+ D  GL     +D+    R ++ G    G ++LH +  EL D+A+Y C        S+       +  L ++ PP +       VAN                V  N   N TC++    P  ++ W          V T+  LSD       +  L+  S     S+ +C++ N+       LP      VT+ V Y     +     +++ P I  G +V+F C ++  P  +  Y W      +     +Y VE   +          F  + + C +  SV   N                   S ++N+L+ P++ T    +TV +IG+     C    NP  +  W K   GT +   + N      T+ L +VT                    D  IY+C+A         K V +  +  P I  E    +    G A + CL+ES   P+P  I W ++   L   S  R  +  +   +G  S L       SD+ T + CS    YG+  V    +Q   LPL    I
Sbjct:   29 QPSDKVIVAGKSVTLPCVVIGYRGVV----QWTMD--GLALGAERDLPGWSRYSVVGDPSLGEHNLHIEGVELSDDAIYECQATQAALRSQ-------RARLTVLLPPGDPMIPGSPVAN----------------VLLNVPYNLTCLAPVAKPAAEITWYRDGKKLDSAVYTKELLSDGKSEGSASSLLITPSLADSGSSYTCRVRNE------ALPEGREKSVTLSVQYPPKVTL-----SVEPPTITEGGSVTFLCGAVSNPE-VTGYRWAKGGVPLAVSGDKYTVEVDHT----------FFTAPVSCEVSNSVGASNV------------------STAVNVLFGPRLLTEPRPMTV-DIGDDASFFCGWTGNPTPTQFWSKK--GTGEVLSNGN------TLLLTKVT------------------REDAGIYVCKAIVPRMGSTEKEVTLTVRGPPIITSEMH-YETTLGGKARMECLIES--TPAPDRIVWAWDKQSLEDGSWGRFSVETEVTEVGAISVLVIDGAEQSDFLTEFNCSAINQYGEDSVIVSLRQQAALPLTLLLI 502          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Mouse
Match: Kirrel (kirre like nephrin family adhesion molecule 1 [Source:MGI Symbol;Acc:MGI:1891396])

HSP 1 Score: 89.3521 bits (220), Expect = 9.128e-18
Identity = 134/604 (22.19%), Postives = 212/604 (35.10%), Query Frame = 2
Query:   17 KMTVGKRKIAFVVIMLSSFFLLSNSTKYVLKDEPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCH-IELTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMW--------TVKTETGLSDNGKIQRQNYSLMRLSSDFHNSNI-SCK-----IVNKKDY---LDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYH-KFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKVIDSDYGT-YTC----SFSYGKTIV-TKQIHLLPL 1753
            KM      +A+++ +  +  L    T++    EP++  V+ GQ  VL C L     +V    QW+KD   L        +  R  + GS  +G Y+L     EL D+A Y C   E  LR          +  L ++ PP E                      +I +      N TC + N  P   ++W           T T L  +GK +     L+   +D     + +C+     I N K+    LD   P  V     L I+   +L            GE V F+C +   P  I+ Y W           G +L+E +  +         F    + C ++  V   N                   S  +N+ + P+I   +   T ++IG  V L+C    NP  ++ W K                              NM+ S S     + V + D   Y C A         + V +     P I  E     V  DG   + C + S   P P  I W ++ + L + + ER  +       GV S L    V+++D+ T Y C    SF  G  I+  ++  +LP+
Sbjct:   28 KMWAPHLVVAYLIFVTLALALPGTQTRF--SQEPADQTVVAGQRAVLPCVLLNYSGIV----QWTKDGLALGMGQGLKAWP-RYRVVGSADAGQYNLEITDAELSDDASYECQATEAALRSR--------RAKLTVLIPPEETRID---------------GGPVILLQAGTPYNLTCRAFNAKPAATIIWFRDGTQQEGAVTSTELLKDGKRETTISQLLIEPTDLDIGRVFTCRSMNEAIPNGKETSIELDVHHPPTV----TLSIEPQTVL-----------EGERVIFTCQATANPE-ILGYRW---------AKGGFLIEDAHESRYETNVDYSFFTEPVSCEVYNKVGSTNV------------------STLVNVHFAPRIVV-YPKPTTTDIGSDVTLTCVWVGNPPLTLTWTKKD---------------------------SNMVLSNSNQLLLKSVTQADAGTYTCRAIVPRIGVAEREVPLYVNGPPIISSEAVQFAVRGDG-GKVECFIGS--TPPPDRIAWAWKENFLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPGTAIIQLEEREVLPV 527          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Mouse
Match: Kirrel (kirre like nephrin family adhesion molecule 1 [Source:MGI Symbol;Acc:MGI:1891396])

HSP 1 Score: 89.3521 bits (220), Expect = 1.164e-17
Identity = 134/604 (22.19%), Postives = 212/604 (35.10%), Query Frame = 2
Query:   17 KMTVGKRKIAFVVIMLSSFFLLSNSTKYVLKDEPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCH-IELTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMW--------TVKTETGLSDNGKIQRQNYSLMRLSSDFHNSNI-SCK-----IVNKKDY---LDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYH-KFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKVIDSDYGT-YTC----SFSYGKTIVT-KQIHLLPL 1753
            KM      +A+++ +  +  L    T++    EP++  V+ GQ  VL C L     +V    QW+KD   L        +  R  + GS  +G Y+L     EL D+A Y C   E  LR          +  L ++ PP E                      +I +      N TC + N  P   ++W           T T L  +GK +     L+   +D     + +C+     I N K+    LD   P  V     L I+   +L            GE V F+C +   P  I+ Y W           G +L+E +  +         F    + C ++  V   N                   S  +N+ + P+I   +   T ++IG  V L+C    NP  ++ W K                              NM+ S S     + V + D   Y C A         + V +     P I  E     V  DG   + C + S   P P  I W ++ + L + + ER  +       GV S L    V+++D+ T Y C    SF  G  I+  ++  +LP+
Sbjct:   28 KMWAPHLVVAYLIFVTLALALPGTQTRF--SQEPADQTVVAGQRAVLPCVLLNYSGIV----QWTKDGLALGMGQGLKAWP-RYRVVGSADAGQYNLEITDAELSDDASYECQATEAALRSR--------RAKLTVLIPPEETRID---------------GGPVILLQAGTPYNLTCRAFNAKPAATIIWFRDGTQQEGAVTSTELLKDGKRETTISQLLIEPTDLDIGRVFTCRSMNEAIPNGKETSIELDVHHPPTV----TLSIEPQTVL-----------EGERVIFTCQATANPE-ILGYRW---------AKGGFLIEDAHESRYETNVDYSFFTEPVSCEVYNKVGSTNV------------------STLVNVHFAPRIVV-YPKPTTTDIGSDVTLTCVWVGNPPLTLTWTKKD---------------------------SNMVLSNSNQLLLKSVTQADAGTYTCRAIVPRIGVAEREVPLYVNGPPIISSEAVQFAVRGDG-GKVECFIGS--TPPPDRIAWAWKENFLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPGTAIIQLEEREVLPV 527          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Mouse
Match: Kirrel (kirre like nephrin family adhesion molecule 1 [Source:MGI Symbol;Acc:MGI:1891396])

HSP 1 Score: 89.3521 bits (220), Expect = 1.164e-17
Identity = 134/604 (22.19%), Postives = 212/604 (35.10%), Query Frame = 2
Query:   17 KMTVGKRKIAFVVIMLSSFFLLSNSTKYVLKDEPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCH-IELTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMW--------TVKTETGLSDNGKIQRQNYSLMRLSSDFHNSNI-SCK-----IVNKKDY---LDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYH-KFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKVIDSDYGT-YTC----SFSYGKTIVT-KQIHLLPL 1753
            KM      +A+++ +  +  L    T++    EP++  V+ GQ  VL C L     +V    QW+KD   L        +  R  + GS  +G Y+L     EL D+A Y C   E  LR          +  L ++ PP E                      +I +      N TC + N  P   ++W           T T L  +GK +     L+   +D     + +C+     I N K+    LD   P  V     L I+   +L            GE V F+C +   P  I+ Y W           G +L+E +  +         F    + C ++  V   N                   S  +N+ + P+I   +   T ++IG  V L+C    NP  ++ W K                              NM+ S S     + V + D   Y C A         + V +     P I  E     V  DG   + C + S   P P  I W ++ + L + + ER  +       GV S L    V+++D+ T Y C    SF  G  I+  ++  +LP+
Sbjct:   28 KMWAPHLVVAYLIFVTLALALPGTQTRF--SQEPADQTVVAGQRAVLPCVLLNYSGIV----QWTKDGLALGMGQGLKAWP-RYRVVGSADAGQYNLEITDAELSDDASYECQATEAALRSR--------RAKLTVLIPPEETRID---------------GGPVILLQAGTPYNLTCRAFNAKPAATIIWFRDGTQQEGAVTSTELLKDGKRETTISQLLIEPTDLDIGRVFTCRSMNEAIPNGKETSIELDVHHPPTV----TLSIEPQTVL-----------EGERVIFTCQATANPE-ILGYRW---------AKGGFLIEDAHESRYETNVDYSFFTEPVSCEVYNKVGSTNV------------------STLVNVHFAPRIVV-YPKPTTTDIGSDVTLTCVWVGNPPLTLTWTKKD---------------------------SNMVLSNSNQLLLKSVTQADAGTYTCRAIVPRIGVAEREVPLYVNGPPIISSEAVQFAVRGDG-GKVECFIGS--TPPPDRIAWAWKENFLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPGTAIIQLEEREVLPV 527          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Mouse
Match: Kirrel3 (kirre like nephrin family adhesion molecule 3 [Source:MGI Symbol;Acc:MGI:1914953])

HSP 1 Score: 57.3806 bits (137), Expect = 9.922e-8
Identity = 87/400 (21.75%), Postives = 152/400 (38.00%), Query Frame = 2
Query:   83 SNSTKYVLKDEPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCH-IELTLRDSEIVESLIGKGSLKIIEPPTE---LGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMWTVKTET--------GLSDNGKIQRQNYSLMRLSSDFHNS-NISCKIVNKKDYLDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCD-SNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFG 1240
            S    Y    +P +  V+ GQP  L C   IPE      + W KD   L        Y   L + G+  SG + L     ELQD+A+Y C  I+  +R             L ++ PP +   LG                    +I +     LN TC + N  P   ++W  K E          L  +GK +    +L     D  N  +I C+  NK     GK  +  + +Q   + N  +        +P+     V+F C++   P  +  Y W                  +   +I+ +AS + + + +    F+  +  +C+ +N   + N+        S+++++ + P++ +  +++ V ++G   V SC    NP  +I W K   G
Sbjct:   17 SQGQVYSFSQQPQDQVVVSGQPVTLLC--AIPE--YDGFVLWIKDGLALGVGRDLSSYPQYLVV-GNHLSGEHHLKILRAELQDDAVYECQAIQAAIRSR--------PARLTVLVPPDDPIILG------------------GPVISLRAGDPLNLTCHADNAKPAASIIWLRKGEVINGATYSKTLLRDGKRESIVSTLFISPGDVENGQSIVCRATNKA-IPGGKETSVTIDIQHPPLVNLSVE------PQPVLEDNIVTFHCSAKANPA-VTQYRW------------------AKRGHIIKEASGELYRTTVDYTYFS--EPVSCEVTNALGSTNL--------SRTVDVYFGPRMTSEPQSLLV-DLGSDAVFSCAWIGNPSLTIVWMKRGSG 348          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. UniProt/SwissProt
Match: sp|Q08180|ICCR_DROME (Irregular chiasm C-roughest protein OS=Drosophila melanogaster OX=7227 GN=rst PE=1 SV=2)

HSP 1 Score: 105.145 bits (261), Expect = 1.072e-21
Identity = 130/601 (21.63%), Postives = 225/601 (37.44%), Query Frame = 2
Query:   41 IAFVVIML-SSFFLLSNSTKYVLKDEPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCHIELTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMWTVKTETGLSDNGKI-------QRQ--NYSLMRLSS--DFHNSNISCKIVNKKDY--------------------LDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKVIDSDYGTYTCSF--SYGKTIVTKQIH 1741
            +A +V M+ SS +    + ++ +  EP +   ++G    L CR+   +      LQW+KD FGL  S     ++ R  + GS + G Y L      L D+A Y C +         + S      L ++ PP                     +  +I+  E++K+   C+S  G P  ++ W       L+DN +        QR+    S++RL+   + HN+N SC+  N  D                     + G LP             +V + T   I +  H+   V   C +   P   + Y WF+        N E ++    +  ++   + KFH + + C +  SV K                     S++L+I Y P  +   +++  +++G  V L+CEVDSNPQ  I W +                             + ++ +++   F V NE     Y C+A    + +I     V  K  P I  ++    +  D  A + C   S P+    ++ W F   E++  S     ++      GV+S L  +      YG Y C+    YG  +   Q+ 
Sbjct:   10 LATIVGMVRSSPYTSYQNQRFAM--EPQDQTAVVGARVTLPCRVINKQGT----LQWTKDDFGLGTSRDLSGFE-RYAMVGSDEEGDYSLDIYPVMLDDDARYQCQVSPGPEGQPAIRSTFA--GLTVLVPPEAPKI---------------TQGDVIYATEDRKVEIECVSVGGKPAAEITWIDGLGNVLTDNIEYTVIPLPDQRRFTAKSVLRLTPKKEHHNTNFSCQAQNTADRTYRSAKIRVEVKYAPKVKVNVMGSLPGGAGGSVGGAGGGSVHMSTGSRIVE--HS--QVRLECRADANPS-DVRYRWFI--------NDEPIIGGQKTEMVIRNVTRKFHDAIVKCEVQNSVGKSE------------------DSETLDISYAPSFRQRPQSME-ADVGSVVSLTCEVDSNPQPEIVWIQHPS--------------------------DRVVGTSTNLTFSVSNE-TAGRYYCKANVPGYAEISADAYVYLKGSPAIGSQRTQYGLVGD-TARIECFASSVPR--ARHVSWTFNGQEISSESGHDYSILVDAVPGGVKSTLIIRDSQAYHYGKYNCTVVNDYGNDVAEIQLQ 524          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. UniProt/SwissProt
Match: sp|Q80W68|KIRR1_MOUSE (Kin of IRRE-like protein 1 OS=Mus musculus OX=10090 GN=Kirrel1 PE=1 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 8.139e-17
Identity = 134/604 (22.19%), Postives = 212/604 (35.10%), Query Frame = 2
Query:   17 KMTVGKRKIAFVVIMLSSFFLLSNSTKYVLKDEPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCH-IELTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMW--------TVKTETGLSDNGKIQRQNYSLMRLSSDFHNSNI-SCK-----IVNKKDY---LDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYH-KFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKVIDSDYGT-YTC----SFSYGKTIVT-KQIHLLPL 1753
            KM      +A+++ +  +  L    T++    EP++  V+ GQ  VL C L     +V    QW+KD   L        +  R  + GS  +G Y+L     EL D+A Y C   E  LR          +  L ++ PP E                      +I +      N TC + N  P   ++W           T T L  +GK +     L+   +D     + +C+     I N K+    LD   P  V     L I+   +L            GE V F+C +   P  I+ Y W           G +L+E +  +         F    + C ++  V   N                   S  +N+ + P+I   +   T ++IG  V L+C    NP  ++ W K                              NM+ S S     + V + D   Y C A         + V +     P I  E     V  DG   + C + S   P P  I W ++ + L + + ER  +       GV S L    V+++D+ T Y C    SF  G  I+  ++  +LP+
Sbjct:   28 KMWAPHLVVAYLIFVTLALALPGTQTRF--SQEPADQTVVAGQRAVLPCVLLNYSGIV----QWTKDGLALGMGQGLKAWP-RYRVVGSADAGQYNLEITDAELSDDASYECQATEAALRSR--------RAKLTVLIPPEETRID---------------GGPVILLQAGTPYNLTCRAFNAKPAATIIWFRDGTQQEGAVTSTELLKDGKRETTISQLLIEPTDLDIGRVFTCRSMNEAIPNGKETSIELDVHHPPTV----TLSIEPQTVL-----------EGERVIFTCQATANPE-ILGYRW---------AKGGFLIEDAHESRYETNVDYSFFTEPVSCEVYNKVGSTNV------------------STLVNVHFAPRIVV-YPKPTTTDIGSDVTLTCVWVGNPPLTLTWTKKD---------------------------SNMVLSNSNQLLLKSVTQADAGTYTCRAIVPRIGVAEREVPLYVNGPPIISSEAVQFAVRGDG-GKVECFIGS--TPPPDRIAWAWKENFLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPGTAIIQLEEREVLPV 527          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. UniProt/SwissProt
Match: sp|Q6X936|KIRR1_RAT (Kin of IRRE-like protein 1 OS=Rattus norvegicus OX=10116 GN=Kirrel1 PE=1 SV=2)

HSP 1 Score: 86.6557 bits (213), Expect = 6.063e-16
Identity = 132/604 (21.85%), Postives = 211/604 (34.93%), Query Frame = 2
Query:   17 KMTVGKRKIAFVVIMLSSFFLLSNSTKYVLKDEPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCH-IELTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMW--------TVKTETGLSDNGKIQRQNYSLMRLSSDFHNSNI-SCK-----IVNKKDY---LDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYH-KFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKVIDSDYGT-YTC----SFSYGKTIVT-KQIHLLPL 1753
            KM      +A+++ +  +  L    T++    EP++  V+ G   VL C L     +V    QW+KD   L        +  R  + GS  +G Y+L     EL D+A Y C   E  LR          +  L ++ PP +                      +I +      N TC + N  P   ++W           T T L  +GK +     L+   +D     + +C+     I N K+    LD   P  V     L I+   +L            GE V F+C +   P  I+ Y W           G +L+E +  +         F    + C ++  V   N                   S  +N+ + P+I   +   T ++IG  V L+C    NP  ++ W K                              NM+ S S     + V + D   Y C A         + V +     P I  E     V  DG   + C + S   P P  I W ++ + L + + ER  +       GV S L    V+++D+ T Y C    SF  G  I+  ++  +LP+
Sbjct:   28 KMWAPHLVVAYLIFVTLALALPGTQTRF--SQEPADQTVVAGHRAVLPCVLLNYSGIV----QWTKDGLALGMGQGLKAWP-RYRVVGSADAGQYNLEITDAELSDDASYECQATEAALRSR--------RAKLTVLIPPEDTRID---------------GGPVILLQAGTPYNLTCRAFNAKPAATIIWFRDGTQQEGAVTSTELLKDGKRETTISQLLIQPTDLDIGRVFTCRSMNEAIPNGKETSIELDVHHPPTV----TLSIEPQTVL-----------EGERVIFTCQATANPE-ILGYRW---------AKGGFLIEDAHESRYETNVDYSFFTEPVSCEVYNKVGSTNV------------------STLVNVHFAPRIVV-YPKPTTTDIGSDVTLTCVWVGNPPLTLTWTKKD---------------------------SNMVLSNSNQLLLKSVTQADAGTYTCRAIVPRIGVAEREVPLYVNGPPIISSEAVQFAVRGDG-GKVECFIGS--TPPPDRIAWAWKENFLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPGTAIIQLEEREVLPV 527          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. UniProt/SwissProt
Match: sp|Q96J84|KIRR1_HUMAN (Kin of IRRE-like protein 1 OS=Homo sapiens OX=9606 GN=KIRREL1 PE=1 SV=2)

HSP 1 Score: 83.1889 bits (204), Expect = 5.935e-15
Identity = 126/588 (21.43%), Postives = 207/588 (35.20%), Query Frame = 2
Query:   41 IAFVVIMLSSFFLLSNSTKYVLKDEPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCH-IELTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMW--------TVKTETGLSDNGKIQRQNYSLMRLSSDFHNSNI-SCKIVNKKDYLDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYH-KFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKVIDSDYGT-YTC----SFSYGKTIVT-KQIHLLPL 1753
            ++ +V +L+     S  T+     EP++  V+ GQ  VL C L     +V    QW+KD   L        +  R  + GS  +G Y+L     EL D+A Y C   E  LR          +  L ++ PP +                      +I +      N TC + N  P   ++W             T L  +GK +     L+   +D     + +C+ +N+       +P+   T   L + +   + T     + +  GE V F+C +   P  I+ Y W           G +L+E +  +         F    + C +   V   N                   S  +N+ + P+I       T ++IG  V L+C    NP  ++ W K                              NM+ S S     + V + D   Y C A         + V +     P I  E     V  DG   + C + S   P P  I W ++ + L + + ER  +       GV S L    V+++D+ T Y C    SF  G  I+  ++  +LP+
Sbjct:    2 LSLLVWILTLSDTFSQGTQTRFSQEPADQTVVAGQRAVLPCVLLNYSGIV----QWTKDGLALGMGQGLKAWP-RYRVVGSADAGQYNLEITDAELSDDASYECQATEAALRSR--------RAKLTVLIPPEDTRID---------------GGPVILLQAGTPHNLTCRAFNAKPAATIIWFRDGTQQEGAVASTELLKDGKRETTVSQLLINPTDLDIGRVFTCRSMNE------AIPSGKETSIELDVHHPPTV-TLSIEPQTVQEGERVVFTCQATANPE-ILGYRW---------AKGGFLIEDAHESRYETNVDYSFFTEPVSCEVHNKVGSTNV------------------STLVNVHFAPRIVVD-PKPTTTDIGSDVTLTCVWVGNPPLTLTWTKKD---------------------------SNMVLSNSNQLLLKSVTQADAGTYTCRAIVPRIGVAEREVPLYVNGPPIISSEAVQYAVRGDG-GKVECFIGS--TPPPDRIAWAWKENFLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPGTAIIQLEEREVLPV 495          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. UniProt/SwissProt
Match: sp|Q9U3P2|SYG2_CAEEL (Synaptogenesis protein syg-2 OS=Caenorhabditis elegans OX=6239 GN=syg-2 PE=1 SV=1)

HSP 1 Score: 58.9214 bits (141), Expect = 2.254e-7
Identity = 106/421 (25.18%), Postives = 165/421 (39.19%), Query Frame = 2
Query:   53 VIMLSSFFLLSNSTKYVLKDEPSEVKVILGQPTVLKCRLE-IPENVVKIKLQWSKD---MFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTE--LQDEALYGCHIELTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMWTVKTETGLSDNGKIQRQN-------YSLMRLSSDF--HNSNISCKIVNKK--------DYLDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDN-----CDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVSNI--GEWVVLSCE-VDSNPQASIRW 1222
             I+L  F  +  S+++ L + PS +  I G+    +C  E  PE +V    QW  +   + G     I   ++GR +    I+    +LH K T   L D+  Y C +   L   E    +  K  L II PP  + F  +  N            SII V EN  LN TC+  N  P P+++W +  +    D  +    +       Y+ + + SD   H   I+C+   K+          LD   P +  TV++L  +N   LR+  N+         ++ S      P  + +Y     + N   Q+   L  RS      IK          +   F + Q DN     C +N +R  N   + KA+    L + YPP      E    SNI  G    + C+ + SNP + I W
Sbjct:    5 AILLWLFGSIHISSQFFL-ESPSNLSTIAGESITFRCSAEKSPEPIVYS--QWKSNTGSLLGYHQEGILPGHQGRFSY---IKQNAEELHLKITHVNLDDDGEYECQM---LHPEE--GPIRAKSFLNIIVPPQLVYFSNYQPN------------SIIAVKENTPLNITCVVPNVKPEPEVLWYMDGKVMSRDVKQASTPHLNKTFTVYTSLVVQSDRNDHGKVITCEAFQKETDIRITTNTTLDVLFPPSDPTVEIL--RNPSALRSGDNV--------TIACSVTGGNPPPDVFWY-----HENKRLQSHSTLDTRSKE----IK----------NIYSFIASQNDNMAEYECRANNSRTGNP--KRKAM---KLEVNYPP---ASVELFGESNIRYGSSANIQCKSLPSNPASQITW 365          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. TrEMBL
Match: A0A0H3YJP5 (NEPH-1 OS=Schmidtea mediterranea OX=79327 GN=NEPH-1 PE=2 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 6.165e-40
Identity = 150/601 (24.96%), Postives = 256/601 (42.60%), Query Frame = 2
Query:  116 PSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCHIELTLRDSEIVESLIGKGSLKIIEPPTELGF---QFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMW---------------------TVKTETGLSDNGK---IQRQNYSLMRLSSDFHNSNISCKIVNKKDYLDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHN---GEAVSFSCNSIFTPGIIIYYSWFVEYN-NVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRN---------CNIELRHKAVSSKS--LNILYPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFGTSK---NTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKVIDSDYGTYTCSFS--YGKTIVTKQIHLLPLKNKFIIFI 1777
            P    V++     L+CR+    +   +K+QW KD FG EN T++D + GR  +PG  ++G YDL   + + QD+  Y C +   +   E  +S+    +L +I PP ++     QF   N S +  I Q     IW   N+ L  +C  +   P  +L+W                     TV T++   D+      + +++  +RL  D +   + C I N++ ++      A++ + VL++ +   ++ +    +P  +    E +  +C++   P  +I Y+W ++YN   +        +RS    I ++      F R  C + + +    C SN              N   RH A  S    L + Y P I         + +G+ V L C  DSNP A I WYK+ F + +   N   +          ++  + +  +  S  YH F + +  +L ++IC A    F  + K V V +   P I   Q  I  ++     + C + S P P    I W+   +   I +  +  +  + +L GV S L+  KV   DYGTY CS S  YG+  V+  I L+P     +IFI
Sbjct:   36 PVSTSVLINSTARLRCRVTFNNSNTPVKVQWQKDGFGYENETLRDHFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKSI----NLTVIVPPDKIKLKSSQFDFQNNSTNNEIIQN----IWGHLNEFLILSCEIQYSRPATELVWKLGEFALREGKSGDIDGQEVGTVTTKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLD---VKMDVIPHRPFFHFTEHEMIQINCSASTNPANVI-YNW-IKYNPTTKTTTIIKYFDRSGVLKIKVRRDLNNMFIR--CQVLSVLAGKECYSNFQAESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDSILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQMSSYSSMTLLSISDKYH-FTITDADNLGLFICIALTDGFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQIYEEERLAGVVSYLYIHKVTYEDYGTYNCSVSNPYGR--VSSTIELIPPVETPMIFI 618          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. TrEMBL
Match: A0A2A4J6J8 (Uncharacterized protein OS=Heliothis virescens OX=7102 GN=B5V51_6892 PE=4 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 4.149e-30
Identity = 149/608 (24.51%), Postives = 242/608 (39.80%), Query Frame = 2
Query:   26 VGKRKIAFVVIMLSSFFLLSNSTKYVLKDEPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCHIELTLRDSEIVESLIGKGSLKII-EPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMWT----------VKTETGLSDNGKIQRQNYSLMRLSSD--FHNSNISCKIVNKKDYLDGKLP-TAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWY---KTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGV-ESKLFFKKVIDSDYGTYTCSFS--YG---KTIVTKQIHLLPLKNKFIIFIS 1780
            VG + ++F+V+M+          ++ +  EP +   I+G    L CR+E   N V   LQW+KD FGL        Y  R  + GS + G + L  K   L+D+  Y C +         + S   + ++ +  E P  L                  R + I   E Q +   C+S  G P  ++ W           VK+   L  +G+ + +  S++RL+     HN  I+C+  N  D    + P  A+V ++V Y+    +  T+G+  + I  G  +   C+    P   IY  W++  N V    G+Y  E      I+   + K H + + C +  SV K   ++                  +L + YPP  +T  +N+  ++IG  VVLSC+VD  PQ  IRW        G      ++  Y +  T                               YIC+     + +I     +  K  PTI   +    +E + +  + C   S PK  P +I+WYFE  E+++I       + +    GV +S L  +      YG Y CS +  YG     I+ K +  LPL   +II I 
Sbjct:   42 VGIQILSFLVLMVGCHGY--QEQRFAM--EPQDQSAIVGSRVTLPCRVE---NKVG-ALQWTKDDFGLGTHRNLSGYD-RYAMIGSDEEGDFSLDIKDLTLEDDGQYQCQVSSGHNGEPAIRSRYAQLTVLVAPEAPRIL------------------RGAFIDATEGQPVEIECVSSGGKPASEITWLDGNQSVIKKHVKSTVELLPDGQ-RYKTRSVLRLTPAKIHHNQTITCQAQNTAD----RAPRMAIVHIEVKYVPKVNVSMTSGH--RRIPEGSELRVRCDVDANPPAQIY-RWYINNNPVV---GDYAEEM-----IIFNVTRKHHKAIVRCEVSNSVGKGEGNT------------------TLEVTYPPTFRTRPQNVE-TDIGSSVVLSCDVDGQPQPEIRWLFHEPGRIGVKGKAPNLKVYVKPETAGR----------------------------YICKVIEEGYPEIESEATIFIKSAPTILSNRTQFGMEGESV-RIECAARSVPK--PDDIRWYFEGREISVIQDPDYATLEESLPDGVIKSSLVIRASQSKHYGQYNCSVTNEYGNANAAIMLKPLKTLPL---YIILIG 553          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. TrEMBL
Match: A0A2A4J512 (Uncharacterized protein OS=Heliothis virescens OX=7102 GN=B5V51_6892 PE=4 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 4.032e-29
Identity = 151/605 (24.96%), Postives = 243/605 (40.17%), Query Frame = 2
Query:   26 VGKRKIAFVVIMLSSFFLLSNSTKYVLKDEPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCHIELTLRDSEIVESLIGKGSLKII-EPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMWT----------VKTETGLSDNGKIQRQNYSLMRLSSD--FHNSNISCKIVNKKDYLDGKLP-TAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGV-ESKLFFKKVIDSDYGTYTCSFS--YG---KTIVTKQIHLLPLKNKFIIFIS 1780
            VG + ++F+V+M+          ++ +  EP +   I+G    L CR+E   N V   LQW+KD FGL        Y  R  + GS + G + L  K   L+D+  Y C +         + S   + ++ +  E P  L                  R + I   E Q +   C+S  G P  ++ W           VK+   L  +G+ + +  S++RL+     HN  I+C+  N  D    + P  A+V ++V Y+    +  T+G+  + I  G  +   C+    P   IY  W++  N V    G+Y  E      I+   + K H + + C +  SV K   ++                  +L + YPP  +T  +N+  ++IG  VVLSC+VD  PQ  IRW                         +E   I  +       K  V  E     YIC+     + +I     +  K  PTI   +    +E + +  + C   S PK  P +I+WYFE  E+++I       + +    GV +S L  +      YG Y CS +  YG     I+ K +  LPL   +II I 
Sbjct:   42 VGIQILSFLVLMVGCHGY--QEQRFAM--EPQDQSAIVGSRVTLPCRVE---NKVG-ALQWTKDDFGLGTHRNLSGYD-RYAMIGSDEEGDFSLDIKDLTLEDDGQYQCQVSSGHNGEPAIRSRYAQLTVLVAPEAPRIL------------------RGAFIDATEGQPVEIECVSSGGKPASEITWLDGNQSVIKKHVKSTVELLPDGQ-RYKTRSVLRLTPAKIHHNQTITCQAQNTAD----RAPRMAIVHIEVKYVPKVNVSMTSGH--RRIPEGSELRVRCDVDANPPAQIY-RWYINNNPVV---GDYAEEM-----IIFNVTRKHHKAIVRCEVSNSVGKGEGNT------------------TLEVTYPPTFRTRPQNVE-TDIGSSVVLSCDVDGQPQPEIRWL-----------------------FHEPGRIGQVKGKAPNLKVYVKPE-TAGRYICKVIEEGYPEIESEATIFIKSAPTILSNRTQFGMEGESV-RIECAARSVPK--PDDIRWYFEGREISVIQDPDYATLEESLPDGVIKSSLVIRASQSKHYGQYNCSVTNEYGNANAAIMLKPLKTLPL---YIILIG 554          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. TrEMBL
Match: A0A2A4J5B3 (Uncharacterized protein OS=Heliothis virescens OX=7102 GN=B5V51_6892 PE=4 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 4.750e-29
Identity = 152/604 (25.17%), Postives = 241/604 (39.90%), Query Frame = 2
Query:   26 VGKRKIAFVVIMLSSFFLLSNSTKYVLKDEPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCHIELTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMWT----------VKTETGLSDNGKIQRQNYSLMRLSSD--FHNSNISCKIVNKKDYLDGKLP-TAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGV-ESKLFFKKVIDSDYGTYTCSFS--YG---KTIVTKQIHLLPLKNKFIIFIS 1780
            VG + ++F+V+M+          ++ +  EP +   I+G    L CR+E   N V   LQW+KD FGL        Y  R  + GS + G + L  K   L+D+  Y C +         + S                  Q  V  A  +  I   R + I   E Q +   C+S  G P  ++ W           VK+   L  +G+ + +  S++RL+     HN  I+C+  N  D    + P  A+V ++V Y+    +  T+G+  + I  G  +   C+    P   IY  W++  N V    G+Y  E      I+   + K H + + C +  SV K   ++                  +L + YPP  +T  +N+  ++IG  VVLSC+VD  PQ  IRW                         +E   I  +       K  V  E     YIC+     + +I     +  K  PTI   +    +E + +  + C   S PK  P +I+WYFE  E+++I       + +    GV +S L  +      YG Y CS +  YG     I+ K +  LPL   +II I 
Sbjct:   42 VGIQILSFLVLMVGCHGY--QEQRFAM--EPQDQSAIVGSRVTLPCRVE---NKVG-ALQWTKDDFGLGTHRNLSGYD-RYAMIGSDEEGDFSLDIKDLTLEDDGQYQCQVSSGHNGEPAIRSRYA---------------QLTVLVAPEAPRIL--RGAFIDATEGQPVEIECVSSGGKPASEITWLDGNQSVIKKHVKSTVELLPDGQ-RYKTRSVLRLTPAKIHHNQTITCQAQNTAD----RAPRMAIVHIEVKYVPKVNVSMTSGH--RRIPEGSELRVRCDVDANPPAQIY-RWYINNNPVV---GDYAEEM-----IIFNVTRKHHKAIVRCEVSNSVGKGEGNT------------------TLEVTYPPTFRTRPQNVE-TDIGSSVVLSCDVDGQPQPEIRWL-----------------------FHEPGRIGQVKGKAPNLKVYVKPE-TAGRYICKVIEEGYPEIESEATIFIKSAPTILSNRTQFGMEGESV-RIECAARSVPK--PDDIRWYFEGREISVIQDPDYATLEESLPDGVIKSSLVIRASQSKHYGQYNCSVTNEYGNANAAIMLKPLKTLPL---YIILIG 554          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. TrEMBL
Match: A0A212F1H1 (Putative nephrin OS=Danaus plexippus plexippus OX=278856 GN=KGM_202424 PE=4 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 3.199e-27
Identity = 151/615 (24.55%), Postives = 244/615 (39.67%), Query Frame = 2
Query:   23 TVGKRKIAFV-----VIMLSSFFLLS----NSTKYVLKDEPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCHIELTLRDSEIVESLIGKGSLKII-EPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMWTVKTETGLSDNGKIQ------RQNY---SLMRL--SSDFHNSNISCKIVNKKDYLDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQ-VVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTI-------KVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSEL-AIISTERRYLINKRQLMGVESKLFFKKVIDSDYGTYTCSFSYGKTIVTKQIHLLPLKNKFIIFI 1777
            T+ +RK+  +     + +LS+ F +        ++ +  EP +   I+G    L CR+E   N +   LQW+KD FGL        Y+ R ++ GS + G Y L  +   L+D+ LY C +   L     + S     ++ I  +PP  L   F                  I   E + ++  C+S+ G P  ++ W    +  + DN + +       Q Y   S++RL  SS  H  +I+C+  N  D        A V ++V Y     I  + G + +    G  V   C++   P   I Y W++   N +   G+Y  E      +VI     F+ SR H       +  N               K+ ++ +LN+ YPP  +   +NI  S +G  V L C+VD +P+  IRW                +++   I +                KF  VVNE     YIC+A    +  I    ++  K  P I        +E  T++VE     S +C+      P P +I+WYFE  E+ AI+  +   L+        +S L  +      YG Y CS +         I L PLK   ++ I
Sbjct:   21 TLTRRKLGCIGQDVTIWILSALFFVGCHGYQEQRFAM--EPQDQSAIVGSRVTLPCRVE---NKIG-SLQWTKDDFGLGTHRNLSGYE-RYSMIGSDEEGDYSLDIRDVSLEDDGLYQCQVSSGLNGEPPIRSRYAHLTVLIAPQPPKILQGAF------------------IDATEGEPVDIECVSEGGKPAAEITWVDGNQVVIKDNVRSRIDELPDGQRYKTSSVLRLIPSSSHHEQHITCQAQNTADR---AYRMATVLIEVKYAPKINITMSTGVVSE----GGEVRVRCSADANPPAQI-YRWYL---NNKLLVGDYNEE------LVI-----FNVSRKHNNAVVKCEVSNAAG------------KSEATITLNVTYPPSFRFRPQNIE-STVGSNVTLICDVDGHPKPKIRW---------------LFHEPGKIGVKGKAA-----------KFSVVVNENTAGRYICKATVDGYPDIESEAIIFIKGPPKILSNRTQSGIEGETVRVE----CSSLCV------PKPDDIRWYFEGREISAILDPDYATLLETLPDGITKSSLVIRSSQSKHYGVYNCSVTNEYGNANAAISLKPLKTLPLVII 539          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Cavefish
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:HGNC Symbol;Acc:HGNC:23204])

HSP 1 Score: 74.3294 bits (181), Expect = 4.463e-13
Identity = 120/582 (20.62%), Postives = 210/582 (36.08%), Query Frame = 2
Query:  101 VLKDEPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCH-IELTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMWTVKTET--------GLSDNGKIQRQNYSLMRLSSDFHNSN-ISCKIVNKKDYLDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKVIDSDYGT-YTCSF--SYG---KTIVTKQIHLLPLK-------NKFIIFI 1777
            +   +P ++ V+ GQP  L C +     VV     W KD   L        Y  R T+ G   SG + L  +  EL D+A++ C  I+  +R             L ++ PP +      V +             I+ +     LN TC + N  P   ++W    E          L  +G+ +    +L    S+      I C+  NK    +GK  +  + +Q L + N  +        +P+  G  V F C++   P  +  Y W           G  +++  S +   +     F    + C +   +      +NI+RN              +++ + P++    +++ V ++G   V +C    NP  +I W K   G                     V   EN+++       + V + D   Y+C A         K V +     PTI   Q T +  +     + C + S   P P  I W ++ + L   ++ R  +       GV S L    ++ +D+ T Y C+   S+G   + I  K+   LP+          F+ FI
Sbjct:    1 MFSQQPQDLVVVAGQPVTLPCSIPGYHGVV----LWIKDGLALGVGRDLSGYP-RYTVVGDHSSGEHHLRIQRVELMDDAVFECQAIQAAMRSR--------PARLTVLVPPED-----PVIDGG----------PIVSLRAGDPLNLTCHADNAKPAASIIWIRNGEVLNGAMYSKTLLRDGRRESTVSTLYISPSNIETGQKIICRASNKA-IPNGKETSVTIDIQHLPLVNLSVE------PQPVLEGNLVKFHCSAKANP-PVTQYKW---------AKGGTVIKEVSGDTYEVIVDHSFFTEAVSCEVTNPLGS----TNISRN--------------VDVYFGPRMAAEPQSLQV-DLGSDAVFNCAWTGNPSLTIVWMKRGSGV--------------------VLSNENILT------LKAVRQEDAGKYVCRAVVPRVGAGEKEVSLTVNGPPTISSTQ-THQAPHGEKGQIKCFIRS--TPPPDRIAWSWKETVLESGTSGRYTVETVSTEDGVLSTLTMSNIVPADFQTIYNCTAWNSFGSDTEIIRLKEQESLPVAVIIGVAVGAFVAFI 489          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Cavefish
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:HGNC Symbol;Acc:HGNC:23204])

HSP 1 Score: 73.9442 bits (180), Expect = 5.531e-13
Identity = 120/582 (20.62%), Postives = 210/582 (36.08%), Query Frame = 2
Query:  101 VLKDEPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCH-IELTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMWTVKTET--------GLSDNGKIQRQNYSLMRLSSDFHNSN-ISCKIVNKKDYLDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKVIDSDYGT-YTCSF--SYG---KTIVTKQIHLLPLK-------NKFIIFI 1777
            +   +P ++ V+ GQP  L C +     VV     W KD   L        Y  R T+ G   SG + L  +  EL D+A++ C  I+  +R             L ++ PP +      V +             I+ +     LN TC + N  P   ++W    E          L  +G+ +    +L    S+      I C+  NK    +GK  +  + +Q L + N  +        +P+  G  V F C++   P  +  Y W           G  +++  S +   +     F    + C +   +      +NI+RN              +++ + P++    +++ V ++G   V +C    NP  +I W K   G                     V   EN+++       + V + D   Y+C A         K V +     PTI   Q T +  +     + C + S   P P  I W ++ + L   ++ R  +       GV S L    ++ +D+ T Y C+   S+G   + I  K+   LP+          F+ FI
Sbjct:    1 MFSQQPQDLVVVAGQPVTLPCSIPGYHGVV----LWIKDGLALGVGRDLSGYP-RYTVVGDHSSGEHHLRIQRVELMDDAVFECQAIQAAMRSR--------PARLTVLVPPED-----PVIDGG----------PIVSLRAGDPLNLTCHADNAKPAASIIWIRNGEVLNGAMYSKTLLRDGRRESTVSTLYISPSNIETGQKIICRASNKA-IPNGKETSVTIDIQHLPLVNLSVE------PQPVLEGNLVKFHCSAKANPP-VTQYKW---------AKGGTVIKEVSGDTYEVIVDHSFFTEAVSCEVTNPLGS----TNISRN--------------VDVYFGPRMAAEPQSLQV-DLGSDAVFNCAWTGNPSLTIVWMKRGSGV--------------------VLSNENILT------LKAVRQEDAGKYVCRAVVPRVGAGEKEVSLTVNGPPTISSTQ-THQAPHGEKGQIKCFIRS--TPPPDRIAWSWKETVLESGTSGRYTVETVSTEDGVLSTLTMSNIVPADFQTIYNCTAWNSFGSDTEIIRLKEQESLPVAVIIGVAVGAFVAFI 489          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Cavefish
Match: kirrel3a (kirre like nephrin family adhesion molecule 3a [Source:ZFIN;Acc:ZDB-GENE-091117-44])

HSP 1 Score: 68.1662 bits (165), Expect = 3.513e-11
Identity = 111/564 (19.68%), Postives = 202/564 (35.82%), Query Frame = 2
Query:   53 VIMLSSFFLLSNSTKYVLKDEPSEVKVILGQPTVLKCRLEIPENVV---KIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCH-IELTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMW---------TVKTETGLSDNGKIQRQNYSLMRLSSDFHNSNISCKIVNKKDYLDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKVIDSDYGT-YTCS 1702
            +I L   F +S +   V   +P +V V+ GQP  L C +     +V    + L  ++D+ G            R  + G    G Y L  + TEL D+  + C  I+  +R             L ++ PP +              II      I+ +     LN TC + N  P   ++W          + ++T L D  +    +   +  S+      I+C+  NK    +GK  T  + +Q L + N  +        +PI  G  V F C++   P  + +Y W           G  ++     ++        F    + C +  ++      +NI+RN              +++ + P++    +++ V ++G   V +C    NP  +I W K   G                           ++S+ +    + V + D   Y+C A         K V +     PTI   Q    +  +    + C + S   P P  I W ++ + L   ++ R  +       GV S L    ++ +D+ T Y C+
Sbjct:   15 LIPLCLCFCVSGACA-VFVQQPHDVVVVAGQPVTLPCSITGFHGMVLWDGLALGVNRDLSGYP----------RYDVIGDHSKGEYHLLIQRTELGDDGSFECQGIQAGIRSR--------PARLTVLVPPDD------------PVIIGAP---IVSLRAGDPLNLTCHADNAKPAASIIWIRNGEVLNGAMYSKTLLRDGQRESTVSTLYISASNIESGQRITCRASNKA-APNGKEATVTIDIQHLPLVNLSVE------PQPILEGNLVKFHCSAKANP-PVTHYRW---------AKGGAVIRDVLGDSYEAVVDHSFFTEPVSCEVTNALGS----TNISRN--------------VDVYFGPRLAAEPQSLQV-DLGSDAVFNCAWTGNPSLTIVWMKRGHGV--------------------------VLSNENTLTLKAVKQEDAGKYVCRAVVPRVGVGEKEVTLTVNGPPTISSTQTQQALYGEK-GQIKCFIRS--TPPPDRIAWSWKETVLESGTSGRYTVETVSTEEGVISTLTMSNIVPADFQTIYNCT 479          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Cavefish
Match: kirrel1a (kirre like nephrin family adhesion molecule 1 [Source:NCBI gene;Acc:103031116])

HSP 1 Score: 64.3142 bits (155), Expect = 5.094e-10
Identity = 119/574 (20.73%), Postives = 208/574 (36.24%), Query Frame = 2
Query:  113 EPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYK-GRLTIPGSIQSGYYDLHFKTTELQDEALYGCH-IELTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMW---------TVKTETGLSDNGKIQRQNY-SLMRLSSDFHNSNISCKIVNKKDYLDGKLPTAVVTVQ-----VLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLM----GVESKLFFKKVIDSDY-GTYTCS----FSYGKTIVT-KQIHLLPL 1753
            EP++  V+LGQ  VL C +     +V    QW+KD  GL     +D+    R  +   +  G Y+L   + EL D++LY C   E  LR          +  L ++ PP E   +        +G+                 N +C+S+   P   + W            T   L D  ++  +++  ++ + +D    N +C   N    + GK  T  + V      VL I+   +L            GE V+F+C +   P  I+ Y W           G  +++ +  +  + KA   F    + C +F +V   N                   S  +++ + P +    + +TV +  + V L+C+   NP  ++ W K   G+S    + N  Y                         + V++ D   Y+C+A           V +     P I  E     V  +    + C + S P P      W     E    +   RY + + +       V S L    V++SD+  TY C+    F  G  I+T ++  ++P+
Sbjct:    7 EPADQSVVLGQRVVLSCVVFNYSGIV----QWTKD--GLALGIGEDLRAWPRYRVLRMVDIGQYNLEISSAELSDDSLYECQATEAALRSR--------RAKLTVLIPPDEPVIEGSPEILLTAGV---------------PHNLSCVSRGAKPPAAIEWQKDGLPIEGAFSTTEVLPDRKRVTTRSFLPVLPVDTDT-GKNFTCMATNPAVPM-GKRTTITLNVHHPPVVVLSIEPRSVL-----------EGERVTFTCQATANP-PIMGYKW---------AKGGVVIQGARESVFITKADHSFFTEPVSCQVFNAVGSTNV------------------SILVDVHFGPILVVEPKPVTVDSDSD-VTLNCKWAGNPPLTLTWTKK--GSSMVLSNNNQLY------------------------LKSVSQADAGQYVCKAIVPRIGVGETEVTLTVNGPPIISSEPVQYAVRGE-RGEVKCYIASTPPPDKIVWAWKENVWEKEKGTLPERYTVEQSKPSSDGGAVLSTLTINNVMESDFQSTYNCTAWNGFGPGTMIITLEETEVVPV 482          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Cavefish
Match: robo1 (roundabout, axon guidance receptor, homolog 1 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-000209-3])

HSP 1 Score: 59.3066 bits (142), Expect = 2.106e-8
Identity = 95/397 (23.93%), Postives = 158/397 (39.80%), Query Frame = 2
Query:  101 VLKDE----PSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCHIE--LTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMWTVKTETGLSDNGKIQ-RQNYS--LMRLSSDFHNSNISCKIVNKKDYLDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASP-----KFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSL----NILY---PPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYK 1228
            +L+DE    PS+V V  G+P V++C  + P    +  + W KD   +      D    R+TI G        L    T   D   Y C     +  R+SEI E       L ++E P+ L                 +R S   V  +Q + F C ++ G P+P + W  + E G    G+ + R +++  L RLSS    S  +C   N     +    TA +TV V  +     +R    +   +  G  V+F C +  +P   I++                  +R  S N++  + P     +F  S+   +  T +++ +      +  NI     +V +K+L    +I+    PP ++    N TV+  G  VVL C+    P  +I W K
Sbjct:  264 ILRDEFRQNPSDVMVAAGEPAVMEC--QPPRGHPEPTISWKKDGVNV------DDRDERITIRGG------KLMITNTRKSDAGKYVCVGTNMMGERESEIAE-------LTVLERPSFL-----------------RRPSSQSVLVDQSVEFRCEAQ-GDPVPTVRW--RKEDGELPKGRFEIRDDHTLKLKRLSSADAGS-YTCLAENMMGKTEA---TATLTVHVPPV---FAVRPRNQV---VGVGRTVTFQCEATGSPQPAIFW------------------QREGSQNLLFSSQPPQPSSRFSVSQTGDLTITGIERGDAGYYSCQALNIA---GSVITKALLEVTDIISDRPPPVVRQGPTNQTVAVDGT-VVLGCQATGTPTPTILWRK 587          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Nematostella
Match: EDO31942 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWF5])

HSP 1 Score: 50.0618 bits (118), Expect = 3.633e-6
Identity = 57/248 (22.98%), Postives = 89/248 (35.89%), Query Frame = 2
Query:  968 ASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKV-ENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKVIDSDYGTYTCSFS 1708
             SP  H +    +    +Q+        +  N   R       ++N+ YPP+I TP +N TV   GE + L+C V  NP  S+ W K   G S      N    T       V    N++S  +  K                       +  YV+V  K +P+I        V E  G   L C+ + +P P    + W   + +  ++S    Y              +   V  S+ GTYTC+ +
Sbjct:   42 GSPVAHGTGSAILSLLKIQRHQAGVYQCQATNDVKRGAITQDFTINVQYPPEI-TPIQNTTV-RAGETITLTCAVAGNPTPSVSWSKAGSGQSTGGNVFNEAGATKAETGQYVCTAVNIVSGNTQTK----------------------TVSTYVIV--KYKPSIIANSPYQTVNETTGSLKLSCISDGYPAPM---VTW---SRDGVVVSPTSVY--------------YSDSVTRSEAGTYTCTAT 243          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Medaka
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:NCBI gene;Acc:101170290])

HSP 1 Score: 73.1738 bits (178), Expect = 9.239e-13
Identity = 111/565 (19.65%), Postives = 209/565 (36.99%), Query Frame = 2
Query:   41 IAFVVIMLSSFFLLSNSTKYVLKDEPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCH-IELTLRDSEIV--------ESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMWTVKTETGLSDNGKIQRQNYSLMRLSSDFHNS-NISCKIVNKKDYLDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKVIDSDYGT-YTCS 1702
            I +V+++L   ++  +    +   +P ++ V+ GQP  L C +     +V     W KD   L        Y  R T+ G   SG + L  +  EL D+A++ C  ++  +R             + +IG G +  +     L    H  NA  +        SIIW+            +NG  +   M++  +   L  +G+ +    +L    S+      I C+  NK    +GK  +  + +Q L + N  +        + +  G  V F C++   P + + Y W           G  +++  S +   +     F    + C +  S+      +N++RN              +++ + P++    +++ V ++G   V +C    NP  +I W K   G                     V   EN+++       + V + D   Y+C A         K V +     PTI   Q    +  +    + C + S   P P  I W ++ + L   ++ R  +       GV S L    ++ +D+ T Y C+
Sbjct:    2 IPWVLLIL---WISGHEVSAMFSQQPQDLVVVAGQPVTLPCSIPGYHGIVL----WIKDGLALGVGRDLSGYP-RYTVIGDHGSGEHHLRIQRVELMDDAVFECQAVQAAMRSRPARLTVLVPPDDPVIGGGPVVSLRAGDPLNLTCHADNAKPAA-------SIIWM------------RNGEVLNGAMYSKVSIEALVRDGRRESTVSTLYLSPSNIETGQQIICRASNKA-VPNGKEASVTIDIQHLPLVNLSVE------PQAVLEGSLVRFQCSAKANPPVTL-YRW---------AKGGSIIKEVSGDTYEVIVDHSFFTEPVSCEVTNSLGS----TNVSRN--------------VDVYFGPRMAAEPQSLQV-DLGSDAVFNCAWTGNPSLTIVWMKRGSGV--------------------VLSNENLLT------LKSVRQEDAGKYVCRAVVPRVGAGEKEVSLTVNGPPTISSTQTQQALHGEK-GQIKCFIRS--TPPPDRIAWSWKETVLESGTSGRYTVETVNTEEGVISTLTMSNIVPADFQTIYNCT 474          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Medaka
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:NCBI gene;Acc:101170290])

HSP 1 Score: 72.4034 bits (176), Expect = 1.822e-12
Identity = 109/567 (19.22%), Postives = 206/567 (36.33%), Query Frame = 2
Query:   41 IAFVVIMLSSFFLLSNSTKYVLKDEPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCH-IELTLRDSEIVESLIGKGSLKIIEPPTE--LGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMWTVKTET--------GLSDNGKIQRQNYSLMRLSSDFHNS-NISCKIVNKKDYLDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKVIDSDYGT-YTCS 1702
            I +V+++L   ++  +    +   +P ++ V+ GQP  L C +     +V     W KD   L        Y  R T+ G   SG + L  +  EL D+A++ C  ++  +R             L ++ PP +  +G                    ++ +     LN TC + N  P   ++W    E          L  +G+ +    +L    S+      I C+  NK    +GK  +  + +Q L + N  +        + +  G  V F C++   P + +Y  W           G  +++  S +   +     F    + C +  S+      +N++RN              +++ + P++    +++ V ++G   V +C    NP  +I W K   G                     V   EN+++       + V + D   Y+C A         K V +     PTI   Q    +  +    + C + S   P P  I W ++ + L   ++ R  +       GV S L    ++ +D+ T Y C+
Sbjct:   72 IPWVLLIL---WISGHEVSAMFSQQPQDLVVVAGQPVTLPCSIPGYHGIV----LWIKDGLALGVGRDLSGYP-RYTVIGDHGSGEHHLRIQRVELMDDAVFECQAVQAAMRSR--------PARLTVLVPPDDPVIGG-----------------GPVVSLRAGDPLNLTCHADNAKPAASIIWMRNGEVLNGAMYSKALVRDGRRESTVSTLYLSPSNIETGQQIICRASNKA-VPNGKEASVTIDIQHLPLVNLSVE------PQAVLEGSLVRFQCSAKANPPVTLYR-W---------AKGGSIIKEVSGDTYEVIVDHSFFTEPVSCEVTNSLG----STNVSRN--------------VDVYFGPRMAAEPQSLQV-DLGSDAVFNCAWTGNPSLTIVWMKRGSGV--------------------VLSNENLLT------LKSVRQEDAGKYVCRAVVPRVGAGEKEVSLTVNGPPTISSTQTQQALHGEK-GQIKCFIRS--TPPPDRIAWSWKETVLESGTSGRYTVETVNTEEGVISTLTMSNIVPADFQTIYNCT 540          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Medaka
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:NCBI gene;Acc:101170290])

HSP 1 Score: 72.0182 bits (175), Expect = 2.356e-12
Identity = 105/545 (19.27%), Postives = 194/545 (35.60%), Query Frame = 2
Query:  101 VLKDEPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCH-IELTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMWTVKTET--------GLSDNGKIQRQNYSLMRLSSDFHNS-NISCKIVNKKDYLDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKVIDSDYGT-YTCS 1702
            +   +P ++ V+ GQP  L C +     +V     W KD   L        Y  R T+ G   SG + L  +  EL D+A++ C  ++  +R             L ++ PP +                      ++ +     LN TC + N  P   ++W    E          L  +G+ +    +L    S+      I C+  NK    +GK  +  + +Q L + N  +        + +  G  V F C++   P + + Y W           G  +++  S +   +     F    + C +  S+      +N++RN              +++ + P++    +++ V ++G   V +C    NP  +I W K   G                     V   EN+++       + V + D   Y+C A         K V +     PTI   Q    +  +    + C + S   P P  I W ++ + L   ++ R  +       GV S L    ++ +D+ T Y C+
Sbjct:   47 MFSQQPQDLVVVAGQPVTLPCSIPGYHGIVL----WIKDGLALGVGRDLSGYP-RYTVIGDHGSGEHHLRIQRVELMDDAVFECQAVQAAMRSR--------PARLTVLVPPDDPVI---------------GGGPVVSLRAGDPLNLTCHADNAKPAASIIWMRNGEVLNGAMYSKALVRDGRRESTVSTLYLSPSNIETGQQIICRASNKA-VPNGKEASVTIDIQHLPLVNLSVE------PQAVLEGSLVRFQCSAKANPPVTL-YRW---------AKGGSIIKEVSGDTYEVIVDHSFFTEPVSCEVTNSLGS----TNVSRN--------------VDVYFGPRMAAEPQSLQV-DLGSDAVFNCAWTGNPSLTIVWMKRGSGV--------------------VLSNENLLT------LKSVRQEDAGKYVCRAVVPRVGAGEKEVSLTVNGPPTISSTQTQQALHGEK-GQIKCFIRS--TPPPDRIAWSWKETVLESGTSGRYTVETVNTEEGVISTLTMSNIVPADFQTIYNCT 498          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Medaka
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:NCBI gene;Acc:101170290])

HSP 1 Score: 71.633 bits (174), Expect = 2.381e-12
Identity = 106/547 (19.38%), Postives = 196/547 (35.83%), Query Frame = 2
Query:  101 VLKDEPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCH-IELTLRDSEIVESLIGKGSLKIIEPPTE--LGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMWTVKTET--------GLSDNGKIQRQNYSLMRLSSDFHNS-NISCKIVNKKDYLDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKVIDSDYGT-YTCS 1702
            +   +P ++ V+ GQP  L C +     +V     W KD   L        Y  R T+ G   SG + L  +  EL D+A++ C  ++  +R             L ++ PP +  +G                    ++ +     LN TC + N  P   ++W    E          L  +G+ +    +L    S+      I C+  NK    +GK  +  + +Q L + N  +        + +  G  V F C++   P + + Y W           G  +++  S +   +     F    + C +  S+      +N++RN              +++ + P++    +++ V ++G   V +C    NP  +I W K   G                     V   EN+++       + V + D   Y+C A         K V +     PTI   Q    +  +    + C + S   P P  I W ++ + L   ++ R  +       GV S L    ++ +D+ T Y C+
Sbjct:   15 MFSQQPQDLVVVAGQPVTLPCSIPGYHGIV----LWIKDGLALGVGRDLSGYP-RYTVIGDHGSGEHHLRIQRVELMDDAVFECQAVQAAMRSR--------PARLTVLVPPDDPVIGG-----------------GPVVSLRAGDPLNLTCHADNAKPAASIIWMRNGEVLNGAMYSKALVRDGRRESTVSTLYLSPSNIETGQQIICRASNKA-VPNGKEASVTIDIQHLPLVNLSVE------PQAVLEGSLVRFQCSAKANPPVTL-YRW---------AKGGSIIKEVSGDTYEVIVDHSFFTEPVSCEVTNSLGS----TNVSRN--------------VDVYFGPRMAAEPQSLQV-DLGSDAVFNCAWTGNPSLTIVWMKRGSGV--------------------VLSNENLLT------LKSVRQEDAGKYVCRAVVPRVGAGEKEVSLTVNGPPTISSTQTQQALHGEK-GQIKCFIRS--TPPPDRIAWSWKETVLESGTSGRYTVETVNTEEGVISTLTMSNIVPADFQTIYNCT 466          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Medaka
Match: kirrel1a (kin of IRRE-like protein 1 [Source:NCBI gene;Acc:101168819])

HSP 1 Score: 67.781 bits (164), Expect = 3.881e-11
Identity = 116/563 (20.60%), Postives = 206/563 (36.59%), Query Frame = 2
Query:  113 EPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYK-GRLTIPGSIQSGYYDLHFKTTELQDEALYGCHI-ELTLRDSEIVESLIGKGSLKIIEPPTEL---GFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMW---------TVKTETGLSDNGKIQRQNYSLMRLSSDFHNSNISCKIVNKKDYLDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKF-QVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLM----GVESKLFFKKVIDSDY-GTYTC----SFSYGKTIVT 1729
            EP++  V+ GQ  +L C +     +V    QW+KD  GL     +D+    R  +    +SG Y+L   + +L D+A+Y C   +  LR          +  L ++ PP +    G    + NA                   +  N +C+S+   P   + W          V     L+D  ++  Q++  +         N SC   N        +P+   T   L + +  ++ T     + +  G+ V+F+C +   P  I+ Y W           G  +++ +  +    KA   F    + C++F +V K N       +  ++++   +      +L  P+ KT        ++   V L+C+   NP  ++ W+K                              NM+ S S   + Q V++ D   Y+C+A           V +     P I  +     V  +    + C + S P P      W     E    + + RY + + +L     GV S L    V++SD+  TY C    SF  G  I+T
Sbjct:   21 EPADQSVVRGQRVILSCVVFNYSGIV----QWTKD--GLALGIGEDLRAWPRYRVLRVQESGQYNLEILSADLSDDAVYECQAPDAALRSR--------RAKLTVLIPPDDPVIDGGPEVLLNA------------------GESYNLSCVSRGAKPPSTIEWLKDGLPVEGAVSITEVLADRKRVTTQSHLPIHPVDTDTGRNYSCVTSNL------AVPSGKSTTVTLNVHHPPVV-TLSIEPRSVLEGDRVTFTCQAHANP-PIMGYRW---------AKGGVVLQGARESVFTTKADHSFFTEPVSCLVFNAVGKTNV------SILVDVQFGPI------LLVEPQPKT-------VDVNSDVTLNCKWAGNPPLTLTWFKKG---------------------------SNMVLSNSNQLYLQSVSQADAGQYVCKAIVPRIGVGETEVTLTVNGPPIISSDPVQYAVRGE-RGEVKCYIASTPPPDKIVWAWKENVWEKERGTLQERYTVEQSKLSAEGGGVLSTLTINNVMESDFLSTYNCTAWNSFGPGTMIIT 487          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Planmine SMEST
Match: SMESG000077979.1 (SMESG000077979.1)

HSP 1 Score: 1741.47 bits (4509), Expect = 0.000e+0
Identity = 882/883 (99.89%), Postives = 883/883 (100.00%), Query Frame = 2
Query:   20 MTVGKRKIAFVVIMLSSFFLLSNSTKYVLKDEPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCHIELTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMWTVKTETGLSDNGKIQRQNYSLMRLSSDFHNSNISCKIVNKKDYLDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKVIDSDYGTYTCSFSYGKTIVTKQIHLLPLKNKFIIFISXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPLQKIMLPSPTIDSSIDNEIFINQINSIPGYQKENGLNESIVLPSNRCFVFRNQPNVQKMSFSGDSRNGQDDKSTTKGNESNRSWDSGVGADDTVYRNGQHFQNIRGSNIVSPFSTLASSNNSIGPVNMNHIPNRYWQSYQPIELISQQNPETSSSRLSNNETSNFNGSNHSSFLPAQDETHIPMIATSANQSFVCIPIEEYQHHMRILQESQGPPSLRSFSIASYSTNNGGNSTFHPNYRPQNGNVSPTDVSVKSTSTNSKM 2668
            MTVGKRKIAFVVIMLSSFFLLSNSTKYVLKDEPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCHIELTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMWTVKTETGLSDNGKIQRQNYSLMRLSSDFHNSNISCKIVNKKDYLDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITV+NIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKVIDSDYGTYTCSFSYGKTIVTKQIHLLPLKNKFIIFISIGALGVLVLLIIAVAIICACKKGTSKKRKCKKTPLQKIMLPSPTIDSSIDNEIFINQINSIPGYQKENGLNESIVLPSNRCFVFRNQPNVQKMSFSGDSRNGQDDKSTTKGNESNRSWDSGVGADDTVYRNGQHFQNIRGSNIVSPFSTLASSNNSIGPVNMNHIPNRYWQSYQPIELISQQNPETSSSRLSNNETSNFNGSNHSSFLPAQDETHIPMIATSANQSFVCIPIEEYQHHMRILQESQGPPSLRSFSIASYSTNNGGNSTFHPNYRPQNGNVSPTDVSVKSTSTNSKM
Sbjct:    1 MTVGKRKIAFVVIMLSSFFLLSNSTKYVLKDEPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCHIELTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMWTVKTETGLSDNGKIQRQNYSLMRLSSDFHNSNISCKIVNKKDYLDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVTNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKVIDSDYGTYTCSFSYGKTIVTKQIHLLPLKNKFIIFISIGALGVLVLLIIAVAIICACKKGTSKKRKCKKTPLQKIMLPSPTIDSSIDNEIFINQINSIPGYQKENGLNESIVLPSNRCFVFRNQPNVQKMSFSGDSRNGQDDKSTTKGNESNRSWDSGVGADDTVYRNGQHFQNIRGSNIVSPFSTLASSNNSIGPVNMNHIPNRYWQSYQPIELISQQNPETSSSRLSNNETSNFNGSNHSSFLPAQDETHIPMIATSANQSFVCIPIEEYQHHMRILQESQGPPSLRSFSIASYSTNNGGNSTFHPNYRPQNGNVSPTDVSVKSTSTNSKM 883          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Planmine SMEST
Match: SMESG000077979.1 (SMESG000077979.1)

HSP 1 Score: 1732.61 bits (4486), Expect = 0.000e+0
Identity = 880/883 (99.66%), Postives = 881/883 (99.77%), Query Frame = 2
Query:   20 MTVGKRKIAFVVIMLSSFFLLSNSTKYVLKDEPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCHIELTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMWTVKTETGLSDNGKIQRQNYSLMRLSSDFHNSNISCKIVNKKDYLDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKVIDSDYGTYTCSFSYGKTIVTKQIHLLPLKNKFIIFISXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPLQKIMLPSPTIDSSIDNEIFINQINSIPGYQKENGLNESIVLPSNRCFVFRNQPNVQKMSFSGDSRNGQDDKSTTKGNESNRSWDSGVGADDTVYRNGQHFQNIRGSNIVSPFSTLASSNNSIGPVNMNHIPNRYWQSYQPIELISQQNPETSSSRLSNNETSNFNGSNHSSFLPAQDETHIPMIATSANQSFVCIPIEEYQHHMRILQESQGPPSLRSFSIASYSTNNGGNSTFHPNYRPQNGNVSPTDVSVKSTSTNSKM 2668
            MTVGKRKIAFVVIMLSSFFLLSNSTKYVLKDEPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCHIELTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMWTVKTETGLSDNGKIQRQNYSLMRLSSDFHNSNISCKIVNKKDYLDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITV+NIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKVIDSDYGTYTCSFSYGKTIVTKQIHLLPLKNKFIIFISIGALGVLVLLIIAVAIICACKKGTSKKRKCKKTPLQKIMLPSPTIDSSIDNEIFINQINSIPGYQKENGLNESIVLPSNRCFVFRNQPNVQKMSFSGDSRNGQDDKSTTKGNE  RSWDSGVGADDTVYRNGQHFQNIRGSNIVSPFSTLASSNNSIGPVNMNHIPNRYWQSYQPIELISQQNPETSSSRLSNNETSNFNGSNHSSFLPAQDETHIPMIATSANQSFVCIPIEEYQHHMRILQESQGPPSLRSFSIASYSTNNGGNSTFHPNYRPQNGNVSPTDVSVKSTSTNSKM
Sbjct:    1 MTVGKRKIAFVVIMLSSFFLLSNSTKYVLKDEPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCHIELTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMWTVKTETGLSDNGKIQRQNYSLMRLSSDFHNSNISCKIVNKKDYLDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVTNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKVIDSDYGTYTCSFSYGKTIVTKQIHLLPLKNKFIIFISIGALGVLVLLIIAVAIICACKKGTSKKRKCKKTPLQKIMLPSPTIDSSIDNEIFINQINSIPGYQKENGLNESIVLPSNRCFVFRNQPNVQKMSFSGDSRNGQDDKSTTKGNE--RSWDSGVGADDTVYRNGQHFQNIRGSNIVSPFSTLASSNNSIGPVNMNHIPNRYWQSYQPIELISQQNPETSSSRLSNNETSNFNGSNHSSFLPAQDETHIPMIATSANQSFVCIPIEEYQHHMRILQESQGPPSLRSFSIASYSTNNGGNSTFHPNYRPQNGNVSPTDVSVKSTSTNSKM 881          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Planmine SMEST
Match: SMESG000077979.1 (SMESG000077979.1)

HSP 1 Score: 1713.35 bits (4436), Expect = 0.000e+0
Identity = 869/870 (99.89%), Postives = 870/870 (100.00%), Query Frame = 2
Query:   59 MLSSFFLLSNSTKYVLKDEPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCHIELTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMWTVKTETGLSDNGKIQRQNYSLMRLSSDFHNSNISCKIVNKKDYLDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKVIDSDYGTYTCSFSYGKTIVTKQIHLLPLKNKFIIFISXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPLQKIMLPSPTIDSSIDNEIFINQINSIPGYQKENGLNESIVLPSNRCFVFRNQPNVQKMSFSGDSRNGQDDKSTTKGNESNRSWDSGVGADDTVYRNGQHFQNIRGSNIVSPFSTLASSNNSIGPVNMNHIPNRYWQSYQPIELISQQNPETSSSRLSNNETSNFNGSNHSSFLPAQDETHIPMIATSANQSFVCIPIEEYQHHMRILQESQGPPSLRSFSIASYSTNNGGNSTFHPNYRPQNGNVSPTDVSVKSTSTNSKM 2668
            MLSSFFLLSNSTKYVLKDEPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCHIELTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMWTVKTETGLSDNGKIQRQNYSLMRLSSDFHNSNISCKIVNKKDYLDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITV+NIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKVIDSDYGTYTCSFSYGKTIVTKQIHLLPLKNKFIIFISIGALGVLVLLIIAVAIICACKKGTSKKRKCKKTPLQKIMLPSPTIDSSIDNEIFINQINSIPGYQKENGLNESIVLPSNRCFVFRNQPNVQKMSFSGDSRNGQDDKSTTKGNESNRSWDSGVGADDTVYRNGQHFQNIRGSNIVSPFSTLASSNNSIGPVNMNHIPNRYWQSYQPIELISQQNPETSSSRLSNNETSNFNGSNHSSFLPAQDETHIPMIATSANQSFVCIPIEEYQHHMRILQESQGPPSLRSFSIASYSTNNGGNSTFHPNYRPQNGNVSPTDVSVKSTSTNSKM
Sbjct:    1 MLSSFFLLSNSTKYVLKDEPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCHIELTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMWTVKTETGLSDNGKIQRQNYSLMRLSSDFHNSNISCKIVNKKDYLDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVTNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKVIDSDYGTYTCSFSYGKTIVTKQIHLLPLKNKFIIFISIGALGVLVLLIIAVAIICACKKGTSKKRKCKKTPLQKIMLPSPTIDSSIDNEIFINQINSIPGYQKENGLNESIVLPSNRCFVFRNQPNVQKMSFSGDSRNGQDDKSTTKGNESNRSWDSGVGADDTVYRNGQHFQNIRGSNIVSPFSTLASSNNSIGPVNMNHIPNRYWQSYQPIELISQQNPETSSSRLSNNETSNFNGSNHSSFLPAQDETHIPMIATSANQSFVCIPIEEYQHHMRILQESQGPPSLRSFSIASYSTNNGGNSTFHPNYRPQNGNVSPTDVSVKSTSTNSKM 870          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Planmine SMEST
Match: SMESG000077979.1 (SMESG000077979.1)

HSP 1 Score: 1703.72 bits (4411), Expect = 0.000e+0
Identity = 867/870 (99.66%), Postives = 868/870 (99.77%), Query Frame = 2
Query:   59 MLSSFFLLSNSTKYVLKDEPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCHIELTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMWTVKTETGLSDNGKIQRQNYSLMRLSSDFHNSNISCKIVNKKDYLDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKVIDSDYGTYTCSFSYGKTIVTKQIHLLPLKNKFIIFISXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPLQKIMLPSPTIDSSIDNEIFINQINSIPGYQKENGLNESIVLPSNRCFVFRNQPNVQKMSFSGDSRNGQDDKSTTKGNESNRSWDSGVGADDTVYRNGQHFQNIRGSNIVSPFSTLASSNNSIGPVNMNHIPNRYWQSYQPIELISQQNPETSSSRLSNNETSNFNGSNHSSFLPAQDETHIPMIATSANQSFVCIPIEEYQHHMRILQESQGPPSLRSFSIASYSTNNGGNSTFHPNYRPQNGNVSPTDVSVKSTSTNSKM 2668
            MLSSFFLLSNSTKYVLKDEPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCHIELTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMWTVKTETGLSDNGKIQRQNYSLMRLSSDFHNSNISCKIVNKKDYLDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITV+NIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKVIDSDYGTYTCSFSYGKTIVTKQIHLLPLKNKFIIFISIGALGVLVLLIIAVAIICACKKGTSKKRKCKKTPLQKIMLPSPTIDSSIDNEIFINQINSIPGYQKENGLNESIVLPSNRCFVFRNQPNVQKMSFSGDSRNGQDDKSTTKGNE  RSWDSGVGADDTVYRNGQHFQNIRGSNIVSPFSTLASSNNSIGPVNMNHIPNRYWQSYQPIELISQQNPETSSSRLSNNETSNFNGSNHSSFLPAQDETHIPMIATSANQSFVCIPIEEYQHHMRILQESQGPPSLRSFSIASYSTNNGGNSTFHPNYRPQNGNVSPTDVSVKSTSTNSKM
Sbjct:    1 MLSSFFLLSNSTKYVLKDEPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKTTELQDEALYGCHIELTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMWTVKTETGLSDNGKIQRQNYSLMRLSSDFHNSNISCKIVNKKDYLDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVTNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKVIDSDYGTYTCSFSYGKTIVTKQIHLLPLKNKFIIFISIGALGVLVLLIIAVAIICACKKGTSKKRKCKKTPLQKIMLPSPTIDSSIDNEIFINQINSIPGYQKENGLNESIVLPSNRCFVFRNQPNVQKMSFSGDSRNGQDDKSTTKGNE--RSWDSGVGADDTVYRNGQHFQNIRGSNIVSPFSTLASSNNSIGPVNMNHIPNRYWQSYQPIELISQQNPETSSSRLSNNETSNFNGSNHSSFLPAQDETHIPMIATSANQSFVCIPIEEYQHHMRILQESQGPPSLRSFSIASYSTNNGGNSTFHPNYRPQNGNVSPTDVSVKSTSTNSKM 868          
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Planmine SMEST
Match: SMESG000077979.1 (SMESG000077979.1)

HSP 1 Score: 276.174 bits (705), Expect = 1.108e-87
Identity = 135/135 (100.00%), Postives = 135/135 (100.00%), Query Frame = 2
Query: 2264 MNHIPNRYWQSYQPIELISQQNPETSSSRLSNNETSNFNGSNHSSFLPAQDETHIPMIATSANQSFVCIPIEEYQHHMRILQESQGPPSLRSFSIASYSTNNGGNSTFHPNYRPQNGNVSPTDVSVKSTSTNSKM 2668
            MNHIPNRYWQSYQPIELISQQNPETSSSRLSNNETSNFNGSNHSSFLPAQDETHIPMIATSANQSFVCIPIEEYQHHMRILQESQGPPSLRSFSIASYSTNNGGNSTFHPNYRPQNGNVSPTDVSVKSTSTNSKM
Sbjct:    1 MNHIPNRYWQSYQPIELISQQNPETSSSRLSNNETSNFNGSNHSSFLPAQDETHIPMIATSANQSFVCIPIEEYQHHMRILQESQGPPSLRSFSIASYSTNNGGNSTFHPNYRPQNGNVSPTDVSVKSTSTNSKM 135          
The following BLAST results are available for this feature:
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
KIRREL11.236e-1521.43kirre like nephrin family adhesion molecule 1 [Sou... [more]
KIRREL11.461e-621.25kirre like nephrin family adhesion molecule 1 [Sou... [more]
IGSF101.983e-624.66immunoglobulin superfamily member 10 [Source:HGNC ... [more]
KIRREL14.498e-620.60kirre like nephrin family adhesion molecule 1 [Sou... [more]
back to top
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syg-21.625e-825.18Synaptogenesis protein syg-2 [Source:UniProtKB/Sw... [more]
syg-21.700e-825.18Synaptogenesis protein syg-2 [Source:UniProtKB/Sw... [more]
unc-891.513e-629.45Muscle M-line assembly protein unc-89 [Source:Uni... [more]
unc-891.595e-629.45Muscle M-line assembly protein unc-89 [Source:Uni... [more]
unc-891.637e-629.45Muscle M-line assembly protein unc-89 [Source:Uni... [more]
back to top
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rst1.070e-2221.63gene:FBgn0003285 transcript:FBtr0343758[more]
rst1.070e-2221.63gene:FBgn0003285 transcript:FBtr0070562[more]
kirre7.600e-1821.94gene:FBgn0028369 transcript:FBtr0332492[more]
kirre7.600e-1821.94gene:FBgn0028369 transcript:FBtr0309498[more]
kirre7.600e-1821.94gene:FBgn0028369 transcript:FBtr0070560[more]
back to top
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIRREL31.955e-1219.86kirre like nephrin family adhesion molecule 3 [Sou... [more]
kirrel1a2.456e-1120.77kirre like nephrin family adhesion molecule 1a [So... [more]
kirrel1a2.456e-1120.77kirre like nephrin family adhesion molecule 1a [So... [more]
kirrel3a1.846e-1019.56kirre like nephrin family adhesion molecule 3a [So... [more]
kirrel3a2.196e-1019.56kirre like nephrin family adhesion molecule 3a [So... [more]
back to top
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif4e3.704e-1222.67eukaryotic translation initiation factor 4E [Sourc... [more]
igfbp44.321e-1219.96insulin like growth factor binding protein 4 [Sour... [more]
eif4e1.122e-1121.83eukaryotic translation initiation factor 4E [Sourc... [more]
eif4e1.158e-1122.30eukaryotic translation initiation factor 4E [Sourc... [more]
eif4e1.408e-1122.86eukaryotic translation initiation factor 4E [Sourc... [more]
back to top
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Kirrel9.128e-1822.19kirre like nephrin family adhesion molecule 1 [Sou... [more]
Kirrel1.164e-1722.19kirre like nephrin family adhesion molecule 1 [Sou... [more]
Kirrel1.164e-1722.19kirre like nephrin family adhesion molecule 1 [Sou... [more]
Kirrel39.922e-821.75kirre like nephrin family adhesion molecule 3 [Sou... [more]
back to top
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q08180|ICCR_DROME1.072e-2121.63Irregular chiasm C-roughest protein OS=Drosophila ... [more]
sp|Q80W68|KIRR1_MOUSE8.139e-1722.19Kin of IRRE-like protein 1 OS=Mus musculus OX=1009... [more]
sp|Q6X936|KIRR1_RAT6.063e-1621.85Kin of IRRE-like protein 1 OS=Rattus norvegicus OX... [more]
sp|Q96J84|KIRR1_HUMAN5.935e-1521.43Kin of IRRE-like protein 1 OS=Homo sapiens OX=9606... [more]
sp|Q9U3P2|SYG2_CAEEL2.254e-725.18Synaptogenesis protein syg-2 OS=Caenorhabditis ele... [more]
back to top
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJP56.165e-4024.96NEPH-1 OS=Schmidtea mediterranea OX=79327 GN=NEPH-... [more]
A0A2A4J6J84.149e-3024.51Uncharacterized protein OS=Heliothis virescens OX=... [more]
A0A2A4J5124.032e-2924.96Uncharacterized protein OS=Heliothis virescens OX=... [more]
A0A2A4J5B34.750e-2925.17Uncharacterized protein OS=Heliothis virescens OX=... [more]
A0A212F1H13.199e-2724.55Putative nephrin OS=Danaus plexippus plexippus OX=... [more]
back to top
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIRREL34.463e-1320.62kirre like nephrin family adhesion molecule 3 [Sou... [more]
KIRREL35.531e-1320.62kirre like nephrin family adhesion molecule 3 [Sou... [more]
kirrel3a3.513e-1119.68kirre like nephrin family adhesion molecule 3a [So... [more]
kirrel1a5.094e-1020.73kirre like nephrin family adhesion molecule 1 [Sou... [more]
robo12.106e-823.93roundabout, axon guidance receptor, homolog 1 (Dro... [more]
back to top
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO319423.633e-622.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIRREL39.239e-1319.65kirre like nephrin family adhesion molecule 3 [Sou... [more]
KIRREL31.822e-1219.22kirre like nephrin family adhesion molecule 3 [Sou... [more]
KIRREL32.356e-1219.27kirre like nephrin family adhesion molecule 3 [Sou... [more]
KIRREL32.381e-1219.38kirre like nephrin family adhesion molecule 3 [Sou... [more]
kirrel1a3.881e-1120.60kin of IRRE-like protein 1 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Irregular chiasm C-roughest-like isoform X2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077979.10.000e+099.89SMESG000077979.1[more]
SMESG000077979.10.000e+099.66SMESG000077979.1[more]
SMESG000077979.10.000e+099.89SMESG000077979.1[more]
SMESG000077979.10.000e+099.66SMESG000077979.1[more]
SMESG000077979.11.108e-87100.00SMESG000077979.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004930 ID=SMED30004930|Name=Irregular chiasm C-roughest-like isoform X2|organism=Schmidtea mediterranea sexual|type=transcript|length=2844bp
TTTTGATTTCTAATTTAAAATGACAGTTGGAAAAAGGAAAATTGCTTTTG
TTGTAATTATGCTTAGTTCTTTTTTCCTGTTGTCCAATTCTACCAAGTAT
GTACTCAAAGACGAACCATCTGAGGTTAAGGTTATTCTTGGCCAACCGAC
TGTTTTAAAATGTCGTCTTGAGATTCCTGAAAATGTTGTAAAAATCAAAC
TGCAATGGTCAAAAGATATGTTTGGCTTAGAAAACAGCACGATTCAAGAT
GTATATAAAGGCAGACTAACGATACCAGGATCCATTCAATCAGGTTATTA
CGATCTCCATTTTAAAACTACTGAACTTCAAGATGAAGCACTATATGGTT
GTCATATTGAATTGACACTTAGAGATAGTGAAATTGTCGAAAGTCTTATT
GGAAAAGGATCTTTAAAAATTATTGAGCCTCCTACTGAATTGGGATTCCA
ATTTCATGTAGCTAACGCTTCATATTCGGGAATTATCTGGCAAAAACGAG
ATTCTATCATTTGGGTGCCAGAAAATCAGAAATTAAATTTCACATGCATT
TCTAAAAATGGAAGTCCGATGCCTCAGTTGATGTGGACTGTTAAAACTGA
AACCGGTTTATCTGATAATGGGAAAATACAAAGACAAAACTATAGCTTAA
TGAGATTATCATCGGATTTCCATAATTCAAACATATCATGTAAAATTGTA
AACAAAAAAGACTATTTAGATGGGAAACTACCAACGGCTGTTGTTACGGT
TCAAGTATTGTATATAAAAAATGCAGTTATTTTGAGAACAAACGGCAATA
TAGATAAACCCATTCACAATGGCGAAGCTGTATCTTTTTCATGCAATTCT
ATTTTTACTCCTGGTATCATAATTTATTACAGTTGGTTTGTTGAATACAA
CAATGTTGAAAAGCAAAACGGAGAATATTTGGTTGAAAGATCTTCATCGA
ACAACATCGTTATAAAAGCCTCCCCTAAATTTCATTTCAGTCGGTTGCAC
TGCATGTTATTCACCAGTGTACAAAAGGACAATTGTGATTCCAACATCAA
CAGAAATTGTAACATTGAACTACGTCATAAAGCTGTTTCATCAAAATCTC
TTAATATCCTTTATCCTCCAAAAATCAAAACTCCATTTGAAAATATTACA
GTGAGCAATATTGGTGAGTGGGTCGTATTATCATGCGAAGTCGACTCCAA
CCCTCAAGCTTCAATCAGATGGTATAAAACGCACTTCGGCACTAGTAAGA
ATACGCGATCTATCAATTGGTATTACCAGACTTCAACCATCAATCTGAAT
GAAGTAACTGTAATCGAAAATATGATTAGTTCTACATCGTATCACAAATT
TCAAGTCGTAAATGAATACGATTTAGATATTTATATTTGTGAAGCCCAAG
CTTCCACATTTCAAAAGATTTATAAGTACGTCGTCGTGGCCAAAAAGGAA
GAGCCGACAATAAAAGTAGAACAGGCAACAATTAAAGTTGAGAATGATGG
AATAGCATCATTAATGTGTTTGGTTGAGTCATGGCCTAAACCTTCACCCT
CCAACATTAAATGGTATTTTGAAACTTCAGAATTGGCAATTATTTCCACT
GAAAGACGATATTTAATAAACAAACGGCAATTGATGGGAGTCGAATCAAA
ATTATTCTTCAAAAAAGTCATAGATTCCGATTATGGAACATATACTTGTT
CTTTCTCTTATGGGAAAACAATTGTAACAAAACAAATTCATCTTCTTCCG
TTAAAAAACAAATTTATAATTTTCATATCGATTGGAGCACTCGGTGTTTT
AGTTTTGTTAATAATCGCCGTTGCAATAATTTGCGCTTGTAAAAAAGGTA
CTTCGAAAAAGAGAAAATGCAAAAAAACTCCTCTACAAAAGATTATGTTG
CCATCACCGACAATAGATTCAAGCATTGACAATGAAATATTTATCAATCA
AATAAACTCCATTCCTGGGTATCAGAAAGAAAACGGATTAAATGAATCTA
TTGTTTTGCCTTCTAACAGATGTTTCGTTTTTCGAAATCAGCCAAATGTT
CAGAAAATGTCCTTCAGTGGTGACTCTCGAAATGGACAAGATGATAAATC
AACTACTAAAGGAAATGAGAGTAATAGATCATGGGATAGTGGAGTAGGAG
CTGATGATACCGTTTATAGAAATGGTCAACATTTTCAAAATATTCGAGGA
TCCAATATCGTGTCCCCATTCTCTACATTAGCATCTTCTAATAATTCCAT
TGGACCAGTGAATATGAACCATATTCCAAATAGATATTGGCAGTCATATC
AACCTATTGAATTGATCTCTCAACAAAATCCAGAGACGAGTTCTAGTAGA
CTAAGCAATAACGAAACTTCCAATTTTAATGGTTCTAATCATTCAAGTTT
TCTTCCTGCCCAAGATGAGACTCACATACCTATGATAGCAACCTCTGCCA
ACCAGTCCTTCGTATGTATCCCAATTGAAGAATATCAACATCATATGAGA
ATCCTTCAAGAATCTCAAGGACCGCCATCCTTGCGCTCATTCTCGATTGC
GTCTTATTCAACGAATAATGGCGGTAATTCAACATTTCATCCAAATTATA
GACCCCAAAATGGAAATGTCAGTCCGACAGACGTTTCTGTAAAATCTACA
TCGACAAATTCAAAAATGTGAAAAAATTATTTTATGTTTTACTGCTAAAA
TGAAATTTGAAAATTTTTGCAATTATTCGACGATAAAAGACAAAATTTAT
TTATTTTGTAAACATTTTAATTTTCTAAACATAAATTATCATAATATTTA
ATATTGAAAATGTAAATCTATTTTTATAAAATTTGTAAATAGTA
back to top

protein sequence of SMED30004930-orf-1

>SMED30004930-orf-1 ID=SMED30004930-orf-1|Name=SMED30004930-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=884bp
MTVGKRKIAFVVIMLSSFFLLSNSTKYVLKDEPSEVKVILGQPTVLKCRL
EIPENVVKIKLQWSKDMFGLENSTIQDVYKGRLTIPGSIQSGYYDLHFKT
TELQDEALYGCHIELTLRDSEIVESLIGKGSLKIIEPPTELGFQFHVANA
SYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMWTVKTETGLSDN
GKIQRQNYSLMRLSSDFHNSNISCKIVNKKDYLDGKLPTAVVTVQVLYIK
NAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQN
GEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIE
LRHKAVSSKSLNILYPPKIKTPFENITVSNIGEWVVLSCEVDSNPQASIR
WYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEY
DLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMC
LVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVESKLFFKKV
IDSDYGTYTCSFSYGKTIVTKQIHLLPLKNKFIIFISIGALGVLVLLIIA
VAIICACKKGTSKKRKCKKTPLQKIMLPSPTIDSSIDNEIFINQINSIPG
YQKENGLNESIVLPSNRCFVFRNQPNVQKMSFSGDSRNGQDDKSTTKGNE
SNRSWDSGVGADDTVYRNGQHFQNIRGSNIVSPFSTLASSNNSIGPVNMN
HIPNRYWQSYQPIELISQQNPETSSSRLSNNETSNFNGSNHSSFLPAQDE
THIPMIATSANQSFVCIPIEEYQHHMRILQESQGPPSLRSFSIASYSTNN
GGNSTFHPNYRPQNGNVSPTDVSVKSTSTNSKM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000420parapharyngeal region
PLANA:0000478pharynx musculature
Vocabulary: INTERPRO
TermDefinition
IPR036179Ig-like_dom_sf
IPR003599Ig_sub
IPR013783Ig-like_fold
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 33..135
e-value: 4.0
score: 14.9
coord: 161..245
e-value: 37.0
score: 6.5
coord: 374..473
e-value: 62.0
score: 4.6
coord: 485..578
e-value: 0.23
score: 20.5
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 152..248
e-value: 5.8E-5
score: 25.2
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 23..141
e-value: 2.5E-11
score: 45.6
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 352..469
e-value: 2.4E-8
score: 35.9
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 470..576
e-value: 1.1E-9
score: 40.2
NoneNo IPR availablePFAMPF13927Ig_3coord: 479..561
e-value: 5.2E-8
score: 33.4
coord: 366..459
e-value: 4.2E-7
score: 30.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 680..710
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 859..883
NoneNo IPR availablePANTHERPTHR11640:SF31NEPHROSIS 1, CONGENITAL, FINNISH TYPE (NEPHRIN)-RELATEDcoord: 12..654
NoneNo IPR availablePANTHERPTHR11640NEPHRINcoord: 12..654
NoneNo IPR availableCDDcd00096Igcoord: 496..574
e-value: 6.88461E-5
score: 39.9181
NoneNo IPR availableCDDcd00096Igcoord: 385..431
e-value: 0.00592671
score: 34.1401
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..24
score: 0.722
NoneNo IPR availableTMHMMTMhelixcoord: 583..605
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 367..468
score: 8.811
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 479..576
score: 11.061
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 25..123
score: 6.687
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 363..461
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 32..113
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 479..575