Neuronal acetylcholine receptor subunit alpha-4

Overview
NameNeuronal acetylcholine receptor subunit alpha-4
Smed IDSMED30004906
Length (bp)1902
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Neuronal acetylcholine receptor subunit alpha-4 (SMED30004906) t-SNE clustered cells

Violin plots show distribution of expression levels for Neuronal acetylcholine receptor subunit alpha-4 (SMED30004906) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Neuronal acetylcholine receptor subunit alpha-4 (SMED30004906) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Neuronal acetylcholine receptor subunit alpha-4 (SMED30004906) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30004906

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30004906SMESG000023360.1 SmedASXL_015611SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30004906SMESG000023360.1 dd_Smed_v6_14923_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30004906SMESG000023360.1 dd_Smed_v6_14680_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Human
Match: CHRNA9 (cholinergic receptor nicotinic alpha 9 subunit [Source:HGNC Symbol;Acc:HGNC:14079])

HSP 1 Score: 181.415 bits (459), Expect = 1.001e-49
Identity = 153/528 (28.98%), Postives = 243/528 (46.02%), Query Frame = 1
Query:  232 WIYVAAWSTLLFRLIVTVHINKKYKSVEKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQ-VEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIM---AGQQEVSTIHQGILFTMNIGKGKSKIKSTEKNFQINHAAFRSKMRKQLNTGNRGENEYEIDGDEKPELNKKDGISNHSFNILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLYVTAILIALVVLI 1803
            WIY AA      RL      + KY    + L  +L   Y       RPV  +D ++ V   + L QI  ++E  QIL    W R +W D  L WD   Y G+  IRI    +W PDI L+N AD+  SE     VV+  DG + W   A+ KS+C V +TYFPFD Q C L FGSWTY+  Q+++            +  +   D +D+++  EW   G    K + SY                         +  Y  + + + +KR SSFY+  L+IPC+L+S L  + F+LP  S  K+ LG+ I +A  +  L++AE  P+S +N PLIG Y+   M LIT ST L  +V+N++F G     VP   R + +  + +++     G+  +S  H       ++ K  SK+   E N +   AA    + ++ +   R +N+    G    E           + +L +++  I   +       K H   +    EW+ +A ++DR F  ++   + +  +++I
Sbjct:   12 WIYFAA-----SRLRAAETADGKYA---QKLFNDLFEDYSN---ALRPVEDTDKVLNVTLQITLSQIKDMDERNQILTAYLWIRQIWHDAYLTWDRDQYDGLDSIRIPSDLVWRPDIVLYNKADDESSEPVNTNVVLRYDGLITWDAPAITKSSCVVDVTYFPFDNQQCNLTFGSWTYNGNQVDI------------FNALDSGDLSDFIEDVEWEVHGMPAVKNVISY----------------------GCCSEPYPDVTFTLLLKRRSSFYIVNLLIPCVLISFLAPLSFYLPAASGEKVSLGVTILLAMTVFQLMVAEIMPAS-ENVPLIGKYYIATMALITASTALTIMVMNIHFCGAEARPVPHWARVVILKYMSRVLFVYDVGESCLSPHHSR--ERDHLTKVYSKLP--ESNLK---AARNKDLSRKKDMNKRLKNDLGCQGKNPQEAESYCA----QYKVLTRNIEYIAKCL-------KDHKATNSKGSEWKKVAKVIDRFFMWIFFIMVFVMTILII 475          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Human
Match: CHRNA6 (cholinergic receptor nicotinic alpha 6 subunit [Source:HGNC Symbol;Acc:HGNC:15963])

HSP 1 Score: 177.563 bits (449), Expect = 3.866e-48
Identity = 131/498 (26.31%), Postives = 237/498 (47.59%), Query Frame = 1
Query:  307 SVEKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEW-ITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAG---QQEVSTIHQGILFTMNIGKGKSKIKSTEKNFQINHAAFRSKMRKQLNTGNRGENEYEIDGDEKPELNKKDGISNHSFNILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLYVTAILIA 1788
            + E+ L   L + Y +F    RPV    + + V + +A+ Q+  ++E  QI+ TN W R++W D  L+WDP  Y GI+ +R+   +IW PDI L+N A        + + ++  +G + W P A+FKS+CP+ IT+FPFD Q C L+FGSWTYD  +++L                  VD  D+ +++EW I D    K    Y+   +I ++                      + Y   ++R   FY   L+IPCL +S LT+++F+LP +   K+ L +++ ++  + LL++ E+ PS+    PL+G Y    MI +TLS  +   VLN+++R  +   +P  ++ +F+  L ++++      +   T    +   +     K K+ S  +   +    F      +L T  R  +   +    +         S HS      ++ D+ + +Q      K H     V  +W+ +A+++DR+F  +++   +  
Sbjct:   32 ATEERLFHKLFSHYNQFI---RPVENVSDPVTVHFEVAITQLANVDEVNQIMETNLWLRHIWNDYKLRWDPMEYDGIETLRVPADKIWKPDIVLYNNAVGDFQVEGKTKALLKYNGMITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWTYDKAEIDL------------LIIGSKVDMNDFWENSEWEIIDASGYKHDIKYNCCEEIYTD----------------------ITYSFYIRRLPMFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVVPLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPTTHTMPRWVKTVFLKLLPQVLLMRWPLDKTRGTGSDAVPRGLARRPAKGKLASHGEPRHLKE-CFHCHKSNELATSKRRLSHQPLQWVVEN--------SEHS-----PEVEDVINSVQFIAENMKSHNETKEVEDDWKYVAMVVDRVFLWVFIIVCVFG 478          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Human
Match: CHRNB3 (cholinergic receptor nicotinic beta 3 subunit [Source:HGNC Symbol;Acc:HGNC:1963])

HSP 1 Score: 175.252 bits (443), Expect = 1.220e-47
Identity = 146/503 (29.03%), Postives = 242/503 (48.11%), Query Frame = 1
Query:  313 EKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGR-VPGIIRRLFIDGLGKLIMAGQQEVSTIHQGILFTMNIGKGKSKIKSTEKNFQINHAAFRSKMRKQLNTGNRGENEYEIDGDEKPELNKKDGISNHSFNILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLY-VTAILIALVVLIPFQK 1815
            E  L+R+L   Y+++    RPV  S++ I V +GL + Q++ ++E  Q++ TN W +  W D  L+W+P +Y GI  I++  + +W PDI L   AD R       +V++ ++G V+W P A +KS+C + +T+FPFD Q C ++FGSWTYD T ++L      N+          VD  D+ D+ EW                L  K  K  R         ++    Y  + Y   ++R   FY   L+IPCL LS LT+++F+LP +   K+ L  ++ V+  + LL++ E  PSS K  PLIG Y    MI +TLS  +   V+N++ R  S    +   ++RLF+  L KL+                  ++ +  S  K  E    +       K +KQL+ G +    +                       LEK    I+ +I   V  +K+H +  +V Q+W+ +A +LDR+F  L+ + ++  ++++  P  K
Sbjct:   29 EDALLRHLFQGYQKWV---RPVLHSNDTIKVYFGLKISQLVDVDEKNQLMTTNVWLKQEWTDHKLRWNPDDYGGIHSIKVPSESLWLPDIVLFENADGRFEGSLMTKVIVKSNGTVVWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTMVDLIL---INEN---------VDRKDFFDNGEW--------------EILNAKGMKGNR---------RDGVYSYPFITYSFVLRRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIVTVFVINVHHRSSSTYHPMAPWVKRLFLQKLPKLLCMKD--------------HVDRYSSPEKE-ESQPVVKGKVLEKKKQKQLSDGEKVLVAF-----------------------LEKAADSIR-YISRHV--KKEHFISQVV-QDWKFVAQVLDRIFLWLFLIVSVTGSVLIFTPALK 451          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Human
Match: CHRNA4 (cholinergic receptor nicotinic alpha 4 subunit [Source:HGNC Symbol;Acc:HGNC:1958])

HSP 1 Score: 177.563 bits (449), Expect = 3.035e-47
Identity = 120/373 (32.17%), Postives = 204/373 (54.69%), Query Frame = 1
Query:  286 HINKKYKSVEKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYD-RKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQQEV 1401
            H+  +  + E+ L++ L + Y ++    RPV    ++++V++GL++ Q++ ++E  Q++ TN W +  W D  L+WDPA+Y  +  IRI  + IW PDI L+N AD   +     +  + +DG V W P A++KS+C + +T+FPFD Q C ++FGSWTYD  +++L   H              VD  D+ +S EW+    +   + +Y+ RK +  +E                   Y  + Y   ++R   FY   L+IPCLL+SCLT+++F+LP E   K+ L +++ ++  + LLL+ E  PS+    PLIG Y    MI +TLS  +   VLN++ R      +P  +RR+F+D + +L++  +  V
Sbjct:   29 HVETRAHAEER-LLKKLFSGYNKWS---RPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPADYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAHLFHDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDLVNMHS------------RVDQLDFWESGEWV----IVDAVGTYNTRKYECCAEI------------------YPDITYAFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPTWVRRVFLDIVPRLLLMKRPSV 363          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Human
Match: CHRNA5 (cholinergic receptor nicotinic alpha 5 subunit [Source:HGNC Symbol;Acc:HGNC:1959])

HSP 1 Score: 174.096 bits (440), Expect = 4.264e-47
Identity = 119/357 (33.33%), Postives = 187/357 (52.38%), Query Frame = 1
Query:  313 EKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSK-GRVPGIIRRLFIDGLGKLI 1380
            E +L+++L   Y+R+    RPV   ++ I +K+GLA+ Q++ ++E  Q++ TN W +  W D+ L+W+P +Y GIK IR+    +WTPDI L + AD R  E    + VI  +G V W P A +KS+C + +T+FPFD Q C ++FGSWTYD +Q+++       D+         VD  D+ D+ EW        K    D                           Y  + Y   +KR   FY   L+IPC+ LS LT+++F+LP     K+ L  ++ V+  + LL++ E  PSS K  PLIG Y    MI +TLS  +    +N++ R  S    +  ++R++F+  L KL+
Sbjct:   47 EDSLLKDLFQDYERWV---RPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTPDIVLFDNADGRF-EGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFDLQNCSMKFGSWTYDGSQVDI----ILEDQD--------VDKRDFFDNGEWEIVSATGSKGNRTDSCCW-----------------------YPYVTYSFVIKRLPLFYTLFLIIPCIGLSFLTVLVFYLPSNEGEKICLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLVFTMIFVTLSIMVTVFAINIHHRSSSTHNAMAPLVRKIFLHTLPKLL 364          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Celegans
Match: acr-3 (Acetylcholine receptor subunit beta-type acr-3 [Source:UniProtKB/Swiss-Prot;Acc:Q93149])

HSP 1 Score: 177.563 bits (449), Expect = 1.469e-48
Identity = 128/468 (27.35%), Postives = 234/468 (50.00%), Query Frame = 1
Query:  370 RPV-NQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEW-ITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQQEVSTIHQGILFTMNIGKGKSKIKSTEKNFQINHAAFRSKMRKQLNTGNRGENEYEIDGDEKPELNKKDGISNHSFNILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLY 1767
            RPV N S   I V + LA + ++ ++E  QI++TN W    W D  +QWDP  + GIK IR+ P ++W PDI L N AD        + VV+ + G++LW+P A++KS+C + + +FPFD QVC L FGSWT+   +L L +  G            +V+  DY+ S  W + D                       +I ER+ +            Y I+++R + FY  IL++P +L++ L++++F+LP ES  K+ L ++I +A  + LL++++  P +    PL+  Y  +  I+  ++  ++ +++N+YFRG +   +P  ++ +F+  L  L +  + E  +  + +       + +  +KS  K F   + A  S+  KQ +  +   +E ++  D K  +   + I+ H        L+   +F      RQ+         +EW+ +++++DR+   L+
Sbjct:   42 RPVLNASSPPIEVFFSLAFVLLINVDEKNQIMQTNVWPTMKWNDYQMQWDPREFDGIKTIRVPPDKVWLPDIVLFNNADGNYLVSFYSNVVVEHTGDMLWVPPAVYKSSCLIDVEFFPFDEQVCSLTFGSWTFRKDELQLSYLSGKR----------HVELNDYLPSGVWDLIDAPG-------------------LLIDERSKIS-----------YQIKIRRKALFYTVILIMPTVLMAFLSMMVFYLPAESSEKITLAISILLALVVFLLVVSKILPPTSSTIPLMAKYLLMTFIMNMITIMVSVIIINVYFRGPATHIMPNWVKTVFLKFLPVLFVMRRPE--STEKELAKMKREKRERRSMKSALKTFFKRNDAKISEQPKQTSRKDGSSSEEKLSSDAKKAIEAIEYITTH--------LTHDNAF-----KRQR---------EEWKFVSVVIDRLLLYLF 445          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Celegans
Match: lev-1 (Acetylcholine receptor subunit beta-type lev-1 [Source:UniProtKB/Swiss-Prot;Acc:Q27218])

HSP 1 Score: 177.178 bits (448), Expect = 2.716e-48
Identity = 136/487 (27.93%), Postives = 245/487 (50.31%), Query Frame = 1
Query:  328 RNLLTRYKRFGVIGRPV-NQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEW-ITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQQE-----VSTIHQGILFTMNIGKGKSKIKSTEKNFQINHAAFRSKMRKQLNTGNRGENEYEIDGDEKPELNKKDGISNHSFNILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLY 1767
            R ++  ++ +  + +PV N+S+  ++VK G+ L+ ++ ++E +Q++ TN W    W D  L+WDP +Y+ I QIR+ P+++W PDI L N AD          V+I + G VLW+P A++KS+C + + +FPFD Q+C L FGSWTY+  ++ LD+                VD+++Y  S+ W + DG     + + DR                             +E+ IR++R + FY  +L++P +L++ L + +F+LP  S  KM L MN+ ++  + LLL+++  P +  + PL+  Y  L  +L  ++  +  ++ N+YFR     R+P  +R++F+D L  L+M  Q+      +   H+ +L T      ++ ++S E +    H   +   R+      R +++ E+D +  PE  +                 D   FI E  NR+ +   K     +W+ +A ++DR  F LY
Sbjct:   40 RLMVDLFRGYNSLVQPVRNRSELPMIVKIGMQLVLLINVDEKEQVMHTNVWLTMKWDDFQLKWDPRDYANITQIRVAPEKVWLPDIVLFNNADGNYEVSFMCNVLILSTGTVLWVPPAIYKSSCIIDVEFFPFDDQLCSLTFGSWTYNRDEIKLDFLTSDR-----------VDFSEYSTSSIWDMMDG---PAVLTSDRSR---------------------------IEFQIRIRRKTLFYTVVLILPTVLMAFLNVTVFYLPTASGEKMGLTMNVLLSIVVFLLLVSKILPPTSSSIPLVAKYLLLTFVLNIITIMVTTIICNIYFRSPITHRLPPWVRKVFLDIL-PLLMCMQRPHRKNVIQRSHRRLLET-GPSVEENPMRSGEHHPLCRHTHNQDSCRRV-----RIQSD-ELDDELSPEAQRA---------------IDAIEFITE--NRRDEEITKQF-RDDWKFIASVVDR--FLLY 457          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Celegans
Match: acr-11 (AcetylCholine Receptor [Source:UniProtKB/TrEMBL;Acc:P91197])

HSP 1 Score: 175.252 bits (443), Expect = 5.518e-48
Identity = 128/447 (28.64%), Postives = 218/447 (48.77%), Query Frame = 1
Query:  274 IVTVHINKKYKSVEKT-LIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFP---QEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQQEVSTIHQGILFTMNIGKGKSKIKSTEKNFQINHAAFRSK----------MRKQLNTGNRGENEYEIDGD 1572
            +V +H N    SV +T L  +LL   K +  + RPV  S   + VK  L L QIL ++E  QI+  N W  Y W D  LQW+P  Y GI+ IR FP     IW PD+ L+N A E      ++ ++  + G V+WIP  + K  C + +T+FPFD QVC+++FGSWT+    ++L      +D+T     +   D + Y+ + EW       K++ SY +                          Y  + Y + ++R + +Y F L+IP LL+S + ++ F  PP++  K+ L + I +A    L +++E TP + +  PLIG +F   M++++ S     +VLNL+FR      +  ++RR+ ++ L  L+   +     +   ++ + +    K K    + N   NHA + ++          +R+ +   N+ E++  I  D
Sbjct:   12 LVIIHSNLCDGSVAETKLFTDLL---KGYNPLERPVQNSSQPLEVKIKLFLQQILDVDEKNQIVSVNAWLSYTWFDHKLQWEPKKYGGIQDIR-FPGSSDHIWKPDVLLYNSAAEDFDSTFKSNLLTYHTGTVVWIPPGVLKFVCQLDVTWFPFDDQVCEMKFGSWTFHGYAIDLQ----IDDDTNGTQSM---DLSTYLVNGEWQVISTNAKRVVSYYK---------------------CCPEPYPTVNYYLHIRRRTLYYGFNLIIPSLLISLMAILGFMFPPDAGEKITLEVTILLAIVFFLSMVSEMTPPTSEAVPLIGVFFSCCMLVVSASVVFTIVVLNLHFRSADSHEMNPLVRRVLLEFLPWLLFMSRPGYKFVKANVIDSTDKMPKKPK-NPLDCNLPSNHAGYEAQILLLHSVHTELRRVVAFYNKEEHDERIQTD 425          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Celegans
Match: unc-29 (Acetylcholine receptor subunit beta-type unc-29 [Source:UniProtKB/Swiss-Prot;Acc:P48181])

HSP 1 Score: 175.252 bits (443), Expect = 9.466e-48
Identity = 133/512 (25.98%), Postives = 246/512 (48.05%), Query Frame = 1
Query:  247 AWSTLLFRLIVTVHINKKYKSVEKTLIRNLLTRYKRFGVIGRPVNQSDNL-IVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQQEVSTIHQGILFTMNIGKGKSKIKSTEKNFQINHAAFRSKMRKQLNTGNRGENE----YEIDGDEKPELNKKDGISNHSFNILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLY 1767
            +W  +L  +I  V IN    S ++   R ++  ++ +  + +PV  S  L ++VK  L L+ ++ ++E  Q++ TN W    W D  ++W+P NY  IKQIR+ P ++W PDI L N AD          VVI++ G++LW+P A++KS+C + + +FPFD QVC L FGSWTY+  ++ L++                VD ++Y  S+ W                             +   +  ++  +   +E+ +R++R + FY  +L+IP +L++ L++ +F+LP +S  K+ L +++ ++  + LLL+++  P +    PL+  Y  L  +L  ++  +  +++N+YFRG    R+P  +R +F+  L KL+   + + ++    +   M    G  +   +      +H    S   +     N   NE    Y +  D    L   D I                 +I E + R +QH  KS    +W+ +A+I+DR+   ++
Sbjct:    7 SWILVLSVVIFLVIINTINASDDEE--RLMVDVFRGYNSLIQPVRNSSELPLIVKMALQLVLLINVDEKDQVMHTNVWLTLQWHDFQMKWNPVNYGEIKQIRVSPDKVWLPDIVLFNNADGNYEVSFMCNVVINHKGDMLWVPPAIYKSSCIIDVEFFPFDEQVCTLVFGSWTYNENEIKLEFVQA-----------ELVDVSEYSASSIW-----------------------------DVIDVPASLVNKRSRIEFQVRIRRKTLFYTVVLIIPTVLMAFLSMAVFFLPTDSGEKITLTISVLLSIVVFLLLVSKILPPTSSTIPLMAKYLLLTFVLNVITILVTVIIINVYFRGPRTHRMPQWVRVVFLQFLPKLVCMKRPKSASERSAVRSGMAQLPGVGQFTLSPSA---HHPLCPSADDRTTTIRNTASNETSAYYPLSTD---ALRAIDAI----------------EYITEHLKRDEQH--KSF-RDDWKYVAMIIDRLLLYVF 451          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Celegans
Match: unc-29 (Acetylcholine receptor subunit beta-type unc-29 [Source:UniProtKB/Swiss-Prot;Acc:P48181])

HSP 1 Score: 175.252 bits (443), Expect = 9.466e-48
Identity = 133/512 (25.98%), Postives = 246/512 (48.05%), Query Frame = 1
Query:  247 AWSTLLFRLIVTVHINKKYKSVEKTLIRNLLTRYKRFGVIGRPVNQSDNL-IVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQQEVSTIHQGILFTMNIGKGKSKIKSTEKNFQINHAAFRSKMRKQLNTGNRGENE----YEIDGDEKPELNKKDGISNHSFNILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLY 1767
            +W  +L  +I  V IN    S ++   R ++  ++ +  + +PV  S  L ++VK  L L+ ++ ++E  Q++ TN W    W D  ++W+P NY  IKQIR+ P ++W PDI L N AD          VVI++ G++LW+P A++KS+C + + +FPFD QVC L FGSWTY+  ++ L++                VD ++Y  S+ W                             +   +  ++  +   +E+ +R++R + FY  +L+IP +L++ L++ +F+LP +S  K+ L +++ ++  + LLL+++  P +    PL+  Y  L  +L  ++  +  +++N+YFRG    R+P  +R +F+  L KL+   + + ++    +   M    G  +   +      +H    S   +     N   NE    Y +  D    L   D I                 +I E + R +QH  KS    +W+ +A+I+DR+   ++
Sbjct:    7 SWILVLSVVIFLVIINTINASDDEE--RLMVDVFRGYNSLIQPVRNSSELPLIVKMALQLVLLINVDEKDQVMHTNVWLTLQWHDFQMKWNPVNYGEIKQIRVSPDKVWLPDIVLFNNADGNYEVSFMCNVVINHKGDMLWVPPAIYKSSCIIDVEFFPFDEQVCTLVFGSWTYNENEIKLEFVQA-----------ELVDVSEYSASSIW-----------------------------DVIDVPASLVNKRSRIEFQVRIRRKTLFYTVVLIIPTVLMAFLSMAVFFLPTDSGEKITLTISVLLSIVVFLLLVSKILPPTSSTIPLMAKYLLLTFVLNVITILVTVIIINVYFRGPRTHRMPQWVRVVFLQFLPKLVCMKRPKSASERSAVRSGMAQLPGVGQFTLSPSA---HHPLCPSADDRTTTIRNTASNETSAYYPLSTD---ALRAIDAI----------------EYITEHLKRDEQH--KSF-RDDWKYVAMIIDRLLLYVF 451          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Fly
Match: nAChRalpha6 (gene:FBgn0032151 transcript:FBtr0331284)

HSP 1 Score: 185.267 bits (469), Expect = 2.852e-51
Identity = 148/517 (28.63%), Postives = 248/517 (47.97%), Query Frame = 1
Query:  262 LFRLIVTVHINKKY--KSVEKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQQEVSTIHQGILFTMNIGKGKSKIKSTEKNFQINHAAFRSKMRKQLNTGNRGENEYEIDGDEKPELNKKDGI-SNHSFNILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLYVTAILIALVVLI 1803
            LF L++ + I K+      EK L+ +LL+ Y     + RPV      + VK+GL L QI+ ++E  QIL TN W    W D  L+W+   Y G+K +RI P ++W PD+ ++N ADE         +V+ ++G+ L++P  +FKSTC + IT+FPFD Q C+++FGSWTYD  QL+L      N E          D +D++ + EW       KK                        +       Y  + + I+++R + +Y F L++PC+L+S + L+ F LPP+S  K+ LG+ I ++  + L L+AES P++    PLIG YF   M ++  S  L  +VLN + R      +P  I+ +F+  L  ++  G+       + IL +  + + + K +S+ K+   N        R  ++            G           I  NH      KDL  I   +Q    R ++   ++ +  +W+  A+++DR    ++    +IA V ++
Sbjct:   11 LFVLLIFLAIIKESCQGPHEKRLLNHLLSTYN---TLERPVANESEPLEVKFGLTLQQIIDVDEKNQILTTNAWLNLEWNDYNLRWNETEYGGVKDLRITPNKLWKPDVLMYNSADEGFDGTYHTNIVVKHNGSCLYVPPGIFKSTCKIDITWFPFDDQHCEMKFGSWTYDGNQLDL----VLNSEDGG-------DLSDFITNGEWYLLAMPGKK---------------------NTIVYACCPEPYVDITFTIQIRRRTLYYFFNLIVPCVLISSMALLGFTLPPDSGEKLTLGVTILLSLTVFLNLVAESMPTTSDAVPLIGTYFNCIMFMVASSVVLTVVVLNYHHRTADIHEMPPWIKSVFLQWLPWILRMGRPGRKITRKTILLSNRMKELELKERSS-KSLLANVLDIDDDFRHTISGSQTAIGSSASFGRPTTVEEHHTAIGCNH------KDLHLILKELQFITARMRKADDEAELIGDWKFAAMVVDRFCLIVFTLFTIIATVTVL 485          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Fly
Match: nAChRalpha6 (gene:FBgn0032151 transcript:FBtr0303898)

HSP 1 Score: 183.341 bits (464), Expect = 1.414e-50
Identity = 147/517 (28.43%), Postives = 248/517 (47.97%), Query Frame = 1
Query:  262 LFRLIVTVHINKKY--KSVEKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQQEVSTIHQGILFTMNIGKGKSKIKSTEKNFQINHAAFRSKMRKQLNTGNRGENEYEIDGDEKPELNKKDGI-SNHSFNILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLYVTAILIALVVLI 1803
            LF L++ + I K+      EK L+ +LL+ Y     + RPV      + VK+GL L QI+ ++E  Q+L TN W    W D  L+W+   Y G+K +RI P ++W PD+ ++N ADE         +V+ ++G+ L++P  +FKSTC + IT+FPFD Q C+++FGSWTYD  QL+L      N E          D +D++ + EW       KK                        +       Y  + + I+++R + +Y F L++PC+L+S + L+ F LPP+S  K+ LG+ I ++  + L L+AES P++    PLIG YF   M ++  S  L  +VLN + R      +P  I+ +F+  L  ++  G+       + IL +  + + + K +S+ K+   N        R  ++            G           I  NH      KDL  I   +Q    R ++   ++ +  +W+  A+++DR    ++    +IA V ++
Sbjct:   11 LFVLLIFLAIIKESCQGPHEKRLLNHLLSTYN---TLERPVANESEPLEVKFGLTLQQIIDVDEKNQLLITNLWLSLEWNDYNLRWNETEYGGVKDLRITPNKLWKPDVLMYNSADEGFDGTYHTNIVVKHNGSCLYVPPGIFKSTCKIDITWFPFDDQHCEMKFGSWTYDGNQLDL----VLNSEDGG-------DLSDFITNGEWYLLAMPGKK---------------------NTIVYACCPEPYVDITFTIQIRRRTLYYFFNLIVPCVLISSMALLGFTLPPDSGEKLTLGVTILLSLTVFLNLVAESMPTTSDAVPLIGTYFNCIMFMVASSVVLTVVVLNYHHRTADIHEMPPWIKSVFLQWLPWILRMGRPGRKITRKTILLSNRMKELELKERSS-KSLLANVLDIDDDFRHTISGSQTAIGSSASFGRPTTVEEHHTAIGCNH------KDLHLILKELQFITARMRKADDEAELIGDWKFAAMVVDRFCLIVFTLFTIIATVTVL 485          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Fly
Match: nAChRalpha6 (gene:FBgn0032151 transcript:FBtr0079916)

HSP 1 Score: 183.341 bits (464), Expect = 1.414e-50
Identity = 147/517 (28.43%), Postives = 248/517 (47.97%), Query Frame = 1
Query:  262 LFRLIVTVHINKKY--KSVEKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQQEVSTIHQGILFTMNIGKGKSKIKSTEKNFQINHAAFRSKMRKQLNTGNRGENEYEIDGDEKPELNKKDGI-SNHSFNILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLYVTAILIALVVLI 1803
            LF L++ + I K+      EK L+ +LL+ Y     + RPV      + VK+GL L QI+ ++E  Q+L TN W    W D  L+W+   Y G+K +RI P ++W PD+ ++N ADE         +V+ ++G+ L++P  +FKSTC + IT+FPFD Q C+++FGSWTYD  QL+L      N E          D +D++ + EW       KK                        +       Y  + + I+++R + +Y F L++PC+L+S + L+ F LPP+S  K+ LG+ I ++  + L L+AES P++    PLIG YF   M ++  S  L  +VLN + R      +P  I+ +F+  L  ++  G+       + IL +  + + + K +S+ K+   N        R  ++            G           I  NH      KDL  I   +Q    R ++   ++ +  +W+  A+++DR    ++    +IA V ++
Sbjct:   11 LFVLLIFLAIIKESCQGPHEKRLLNHLLSTYN---TLERPVANESEPLEVKFGLTLQQIIDVDEKNQLLITNLWLSLEWNDYNLRWNETEYGGVKDLRITPNKLWKPDVLMYNSADEGFDGTYHTNIVVKHNGSCLYVPPGIFKSTCKIDITWFPFDDQHCEMKFGSWTYDGNQLDL----VLNSEDGG-------DLSDFITNGEWYLLAMPGKK---------------------NTIVYACCPEPYVDITFTIQIRRRTLYYFFNLIVPCVLISSMALLGFTLPPDSGEKLTLGVTILLSLTVFLNLVAESMPTTSDAVPLIGTYFNCIMFMVASSVVLTVVVLNYHHRTADIHEMPPWIKSVFLQWLPWILRMGRPGRKITRKTILLSNRMKELELKERSS-KSLLANVLDIDDDFRHTISGSQTAIGSSASFGRPTTVEEHHTAIGCNH------KDLHLILKELQFITARMRKADDEAELIGDWKFAAMVVDRFCLIVFTLFTIIATVTVL 485          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Fly
Match: nAChRalpha5 (gene:FBgn0028875 transcript:FBtr0474155)

HSP 1 Score: 186.808 bits (473), Expect = 5.901e-50
Identity = 148/526 (28.14%), Postives = 252/526 (47.91%), Query Frame = 1
Query:  313 EKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHI-LEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQQEVSTI----------------HQGILFTMNIGKGKSKIKSTEKNFQINHAAFRSKMRKQLNTGNRGENE--YEI------DGDEKP--ELNKKDGISNHSF--NILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLYVTAILIALVVLI 1803
            EK L+ +LL  Y     + RPV    + + + +GL L+QI+ ++E  Q+L TN W +  W D+ L+W+ ++Y G+K +RI P  IW PD+ ++N ADE      +  VV+ N+G+ L++P  +FKSTC + IT+FPFD Q C+++FGSWTYD  QL+L       DET         D + YV + EW   G   K                      RN +  N     +I + + I ++R + +Y F L+IPC+L++ + L+ F LPP+S  K+ LG+ I ++  + L ++AE+ P++    PL+G YF   M ++  S     L+LN + R      +   IR +F+  L  ++   +     I                HQ IL  + + +  S  KS   N       FR   R     G    N   Y        DG   P       D +++H+   +  E +L  I   I+   ++ ++    + ++ +W+  A+++DR+   ++    ++A + ++
Sbjct:  313 EKRLLHDLLDPY---NTLERPVLNESDPLQLSFGLTLMQIIDVDEKNQLLVTNVWLKLEWNDMNLRWNTSDYGGVKDLRIPPHRIWKPDVLMYNSADEGFDGTYQTNVVVRNNGSCLYVPPGIFKSTCKIDITWFPFDDQRCEMKFGSWTYDGFQLDLQ----LQDETGG-------DISSYVLNGEWELLGVPGK----------------------RNEIYYNCCPEPYIDITFAIIIRRRTLYYFFNLIIPCVLIASMALLGFTLPPDSGEKLSLGVTILLSLTVFLNMVAETMPATSDAVPLLGTYFNCIMFMVASSVVSTILILNYHHRNADTHEMSEWIRIVFLCWLPWILRMSRPGRPLILEFPTTPCSDTSSERKHQ-ILSDVELKERSS--KSLLANVLDIDDDFRHNCRPMTPGGTLPHNPAFYRTVYGQGDDGSIGPIGSTRMPDAVTHHTCIKSSTEYELGLILKEIRFITDQLRKDDECNDIANDWKFAAMVVDRLCLIIFTMFTILATIAVL 799          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Fly
Match: nAChRalpha6 (gene:FBgn0032151 transcript:FBtr0079915)

HSP 1 Score: 181.415 bits (459), Expect = 6.646e-50
Identity = 146/517 (28.24%), Postives = 246/517 (47.58%), Query Frame = 1
Query:  262 LFRLIVTVHINKKY--KSVEKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQQEVSTIHQGILFTMNIGKGKSKIKSTEKNFQINHAAFRSKMRKQLNTGNRGENEYEIDGDEKPELNKKDGI-SNHSFNILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLYVTAILIALVVLI 1803
            LF L++ + I K+      EK L+ +LL+ Y     + RPV      + VK+GL L QI+ ++E  QIL TN W    W D  L+W+   Y G+K +RI P ++W PD+ ++N ADE         +V+ ++G+ L++P  +FKSTC + IT+FPFD Q C+++FGSWTYD  QL+L      N E          D +D++ + EW       KK                        +       Y  + + I+++R + +Y F L++PC+L+S + L+ F LPP+S  K+ LG+ I ++  + L L+AE+ P      PL+G YF   M ++  S  L  +VLN + R      +P  I+ +F+  L  ++  G+       + IL +  + + + K +S+ K+   N        R  ++            G           I  NH      KDL  I   +Q    R ++   ++ +  +W+  A+++DR    ++    +IA V ++
Sbjct:   11 LFVLLIFLAIIKESCQGPHEKRLLNHLLSTYN---TLERPVANESEPLEVKFGLTLQQIIDVDEKNQILTTNAWLNLEWNDYNLRWNETEYGGVKDLRITPNKLWKPDVLMYNSADEGFDGTYHTNIVVKHNGSCLYVPPGIFKSTCKIDITWFPFDDQHCEMKFGSWTYDGNQLDL----VLNSEDGG-------DLSDFITNGEWYLLAMPGKK---------------------NTIVYACCPEPYVDITFTIQIRRRTLYYFFNLIVPCVLISSMALLGFTLPPDSGEKLTLGVTILLSLTVFLNLVAETLPQVSDAIPLLGTYFNCIMFMVASSVVLTVVVLNYHHRTADIHEMPPWIKSVFLQWLPWILRMGRPGRKITRKTILLSNRMKELELKERSS-KSLLANVLDIDDDFRHTISGSQTAIGSSASFGRPTTVEEHHTAIGCNH------KDLHLILKELQFITARMRKADDEAELIGDWKFAAMVVDRFCLIVFTLFTIIATVTVL 485          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Zebrafish
Match: CR847523.3 (neuronal acetylcholine receptor subunit alpha-10-like [Source:NCBI gene;Acc:101882637])

HSP 1 Score: 196.823 bits (499), Expect = 2.946e-55
Identity = 158/529 (29.87%), Postives = 254/529 (48.02%), Query Frame = 1
Query:  322 LIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMA---GQQEVS-------------TIH---QGILFTMNIGKGKSKIKSTEKNFQINHAAFRSKMRKQLNTGNRGENEYEIDGDEKPELNKKDGISNHSF----------------NILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMF-FCLYVTAILIALVVL 1800
            L+++L   Y       RPV  ++N+I V   + L QI+ ++E  QIL T  W R VW D  L W+  +Y G+  IRI    +W PD+ L+N AD++ S   E  VVI +DG ++W   A+ KS+C V +++FPFD Q C+L FGSWT++  Q++L   H   D           D  D+V++ EW   G   KK                 +I     L    +  Y  + Y + +KR +SFY+F L+IPC+++S L  + F+LP +S  K+ LG+ + +A  +  LL+AES P S +N PLIG Y+   M +IT ST L   ++N++  G     VP   RR  ++ L +       GQ  VS             TI+   +G  F + + +G S+ K  ++  +        + RK+  +G R     EI+  E      + G S                      L +++  I +F QE    Q+++        EWR +A ++DR F +  ++   L++L+++
Sbjct:   20 LLKDLFVNYTS---ALRPVEDTNNIINVTLQITLSQIIDMDERNQILTTYLWIRQVWFDAYLTWNTTDYDGLDTIRIPSSYVWRPDVVLYNNADDQFSSSMETNVVIRHDGQIMWDQPAITKSSCKVDVSFFPFDVQHCRLTFGSWTHNGNQMDL---HNALDSA---------DLADFVENVEWEVQGMPAKK----------------NVI-----LYGCCSDPYPDITYTLHLKRRASFYIFNLLIPCMMISFLAPLGFYLPADSGEKVSLGVTVLLALTVFQLLVAESMPPS-ENVPLIGKYYIATMTMITASTALTIFIMNIHHCGPEAQPVPSWARRFILNYLARFCFVYDMGQSCVSVHTDQPAKKGNNCTINGQARGEDFALRLHEGCSQ-KVKDQFNEDASPTLSPQQRKEHQSGWRIGTFVEIEHGESAGATGETGASRKESVKKREILVESQCLCHQQALLRNVEYIANFYQEQKATQRRNA-------EWRKVAKVMDRFFMWIFFIMVFLMSLLII 503          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Zebrafish
Match: CR388402.1 (cholinergic receptor, nicotinic, alpha 9 [Source:NCBI gene;Acc:568807])

HSP 1 Score: 177.178 bits (448), Expect = 4.367e-48
Identity = 145/510 (28.43%), Postives = 237/510 (46.47%), Query Frame = 1
Query:  370 RPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEF-REARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQ--QEVSTIHQGILFTMNIGKGKSKIKSTEKNFQINHAAFRS-KMRKQLNTGNRGENEYEI----DGDEKPELNKKDGISNHSFNILEK------------------------DLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMF-FCLYVTAILIALVVL 1800
            RPV  +D  + V   + L QI  ++E  Q+L T  W R +W D  L WD   Y G++ IRI    +W PDI L+N ADE  S    +  VV+  +G + W   A+ KS+C V ++YFPFD+Q C L FGSWTY+  Q+++        E+         D +D+VD+ EW   G              + + K + M           +  Y  + Y + +KR SSFY+F L++PC L+S L  + F+LP +S  K+ LG+ + +A  +  L++AES P S ++ PLIG Y+   M +IT ST L   ++N++F G     VP   + L ID + K+    +  +  +T      F  +    +         +   ++++R  +  +Q  T +    +Y      DG EK  L  ++ + +   +I EK                         L     +I      Q+ H  K     EW+ +A ++DR F +  ++   L++++VL
Sbjct:   40 RPVEDTDKALNVTLQITLSQIKDMDERNQVLTTYLWVRQIWHDAYLSWDKEEYDGLEVIRIPSNLVWRPDIVLYNNADEEDSSGPPDTNVVLRYNGEITWDSPAITKSSCKVDVSYFPFDSQECNLTFGSWTYNGNQVDI----AMGMESG--------DLSDFVDNVEWECHG--------------MPAVKNVIMYG-------CCSDPYPDITYTVLLKRRSSFYIFNLLLPCFLISFLAPLGFYLPADSGEKVSLGVTVLLALTVFQLMVAESMPPS-ESVPLIGKYYIATMTMITASTSLTIFIMNIHFCGAEAKPVPHWAKVLIIDYMSKIFFVYEVGENCTTPESDRGFYEDCHLDERIHHRHGNGYHHKNSSYRQHRHEQQRRTRSSHHPKYTHFIGRDGSEKLPLTSQEKLKDSEISIPEKINGYTYDQGNGYLNGVGCVCGKHQKLVRNIEYIANCFREQRGHQAK---GAEWKKVAKVMDRFFMWVFFIMVFLMSILVL 512          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Zebrafish
Match: chrnb1l (cholinergic receptor, nicotinic, beta 1 (muscle) like [Source:ZFIN;Acc:ZDB-GENE-060811-1])

HSP 1 Score: 176.022 bits (445), Expect = 6.877e-48
Identity = 139/512 (27.15%), Postives = 252/512 (49.22%), Query Frame = 1
Query:  292 NKKYKSVEKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQQEVSTIHQGILFTMNIGKGKSKIKSTEKNFQINHAAFRSKMRKQLNTGNRGENEYEIDGDEKPELNKKDGISNHSFNILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLYVTAILIALVVLIPFQKNDFN 1827
            ++K    E+ L+ +L   ++ + +  RP    +  ++V+ G+ L+Q++ L +    + TN +    W D  L W+P +Y  I  +RI P ++W PDI L N  D +        V++ +DG V W+P A+++S+C + + YFPFD Q C + F S+TYD+++++L   +G +++    + I  +D   + ++ EW    Q+  K           S K I     ++ L ++IT  Y I+E      R   FYV  +++PC+L S L + +F+LPP +  KM L +++ +A  + +LLLA+  P +    P+I  Y    MIL+T S  L+ +VLNL+ R  S   +PG +R++FI+ L +  +   +             N+  G       E + +     F  K+  +L    RG +      +   +L +     N+   IL  +L    + I     + K+  +   ++ +W+ +A++LDR+F  L+V  ++  L  L  F    FN
Sbjct:   13 SRKASEAERRLLEDL---FQDYNLKVRPARTWNERVMVRVGMTLVQLISLNQKNGEMTTNVFMNMEWTDYRLSWNPEDYDKIDVVRIPPVKVWRPDIYLINNNDGQFDVALYVNVLVRSDGTVSWLPPAIYRSSCSIEVAYFPFDWQNCSMVFRSYTYDSSEVDLQ--YGLDEDGNELHEI-VIDENAFTENGEW----QICHK----------PSRKNI-----QDDLYEDIT-FYLIIE------RKPLFYVINIIVPCILTSVLAIFVFYLPPGAGEKMTLSISVLIALTVFMLLLADKVPETSLAIPIIVNYVMFTMILVTFSVILSVVVLNLHHRTPSTHHMPGWVRKVFINLLPRY-LGVLRPTPEEPVEEEPKENVPMG-----CLENSLRPGGEYFIRKINPELVMPWRGSH-----NESTVKLQRFSNSDNYCL-ILPPNLKSAIAAITYMSEQLKKQDVDDTMTDDWQYIAVVLDRLFLWLFV--VITTLGTLTMFLDASFN 478          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Zebrafish
Match: chrna6 (cholinergic receptor, nicotinic, alpha 6 [Source:ZFIN;Acc:ZDB-GENE-090312-91])

HSP 1 Score: 176.407 bits (446), Expect = 9.021e-48
Identity = 144/543 (26.52%), Postives = 249/543 (45.86%), Query Frame = 1
Query:  244 AAWSTLLFRLIVTVHINKKYKSVEKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEW-ITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQQEVSTIHQGILFTMNIGKGKSKIKSTEKNFQINHAAFRSKMRKQLNTGNRGENEYEIDGDEKPEL-NKKDGISNH--------------------------SFNILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLYVTAILIA 1788
            A   TL F LI  +  +      E  L R L  RY +F    RPV    + + V++ +++ Q++ ++E  QI+ TN W R++W D  L+W PA + GI+ IR+   +IW PDI L+N A        + + ++  DG + W+P A+FKS+CP+ ITYFPFD Q C ++FGSWTYD  +++L                  V+  D+ +S EW I D    K    Y+   +I                      Y  + Y   ++R   FY   L+IPCLL+S LT+++F+LP +   K+ L +++ ++  + LL++ E+ PS+    PLIG Y    MI +TLS  +   VLN+++R      +P  +R +F+  L ++++  +             ++   GK  +++   +          K RK   +     N  E  G+ K  L  KK G   H                          +F+++  ++      ++      +       V  +W+ +A+++DR+F  ++V   ++ 
Sbjct:    4 AGRVTLFFLLIALITQDCFSSKGEDRLFRRLFRRYNQFI---RPVENVSDPVTVEFEVSISQLVKVDEVNQIMETNLWLRHIWNDYKLKWSPAEFDGIEFIRVPSNKIWRPDIVLYNNAVGDFLVEDKTKALLKFDGTITWVPPAIFKSSCPMDITYFPFDYQNCSMKFGSWTYDKAKIDLVLIGS------------KVNLKDFWESGEWEIIDAPGYKHDIKYNCCEEI----------------------YPDITYSFYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPMTHTMPSWVRTVFLRALPRIMLMRRP----------LDLSESSGKGGLETGGSSGTGAGRGGEGKKRKNSGSQQGAMNSLEF-GEGKAALEGKKGGCPCHPLKEATEGDCGKVSRQLSPQAINTVVAFSVVSPEIKQAIESVKYIAENMRSRNKAKEVEDDWKYVAMVIDRIFLWVFVLVCVLG 498          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Zebrafish
Match: chrna6 (cholinergic receptor, nicotinic, alpha 6 [Source:ZFIN;Acc:ZDB-GENE-090312-91])

HSP 1 Score: 176.022 bits (445), Expect = 1.042e-47
Identity = 131/501 (26.15%), Postives = 233/501 (46.51%), Query Frame = 1
Query:  370 RPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEW-ITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQQEVSTIHQGILFTMNIGKGKSKIKSTEKNFQINHAAFRSKMRKQLNTGNRGENEYEIDGDEKPEL-NKKDGISNH--------------------------SFNILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLYVTAILIA 1788
            RPV    + + V++ +++ Q++ ++E  QI+ TN W R++W D  L+W PA + GI+ IR+   +IW PDI L+N A        + + ++  DG + W+P A+FKS+CP+ ITYFPFD Q C ++FGSWTYD  +++L                  V+  D+ +S EW I D    K    Y+   +I                      Y  + Y   ++R   FY   L+IPCLL+S LT+++F+LP +   K+ L +++ ++  + LL++ E+ PS+    PLIG Y    MI +TLS  +   VLN+++R      +P  +R +F+  L ++++  +             ++   GK  +++   +          K RK   +     N  E  G+ K  L  KK G   H                          +F+++  ++      ++      +       V  +W+ +A+++DR+F  ++V   ++ 
Sbjct:   29 RPVENVSDPVTVEFEVSISQLVKVDEVNQIMETNLWLRHIWNDYKLKWSPAEFDGIEFIRVPSNKIWRPDIVLYNNAVGDFLVEDKTKALLKFDGTITWVPPAIFKSSCPMDITYFPFDYQNCSMKFGSWTYDKAKIDLVLIGS------------KVNLKDFWESGEWEIIDAPGYKHDIKYNCCEEI----------------------YPDITYSFYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPMTHTMPSWVRTVFLRALPRIMLMRRP----------LDLSESSGKGGLETGGSSGTGAGRGGEGKKRKNSGSQQGAMNSLEF-GEGKAALEGKKGGCPCHPLKEATEGDCGKVSRQLSPQAINTVVAFSVVSPEIKQAIESVKYIAENMRSRNKAKEVEDDWKYVAMVIDRIFLWVFVLVCVLG 484          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Xenopus
Match: CHRNA2 (cholinergic receptor, nicotinic alpha 2 [Source:NCBI gene;Acc:100495873])

HSP 1 Score: 195.282 bits (495), Expect = 1.925e-54
Identity = 146/513 (28.46%), Postives = 249/513 (48.54%), Query Frame = 1
Query:  313 EKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEK-KIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIM-----AGQQEVSTIHQGILFTMNIGK------GKSKIKSTEKNFQINHAAFRSKMRKQLNTGNRGENEYEIDGDEKPELNKKDGISNHSFNILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLYVTAILIALV--VLIPF 1809
            E+ L + L T Y R+    RPV  + ++++VK+GL++ Q++ ++E  Q++ TN W +  W D  L+W+PA+Y  +  IR+  + IW PDI L+N AD   +     +  + ++G V W+P A++KS+C + +T+FPFD Q CK++FGSWTYD   L+L+     + E         VD  DY +S EW     V K   K YD   +I                      Y  + Y   ++R   FY   L+IPCLL+SCLT+++F+LP +   K+ L +++ ++  + LLL+ E  PS+    PLIG Y    MI +TLS  +   VLN++ R  S  ++P  +R +F+D + + +      A  +EV + +      ++  K         K    E   Q  H    +   + L    R +  + + G +          +  S  +L   +      +    N  +       V ++W+ +A+++DR+F  +++   L+  V   L PF
Sbjct:   32 EERLFKRLFTGYNRWS---RPVPNTSDVVIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWNPADYDNVTSIRVPSEMIWIPDIVLYNNADGEFAITHMTKAHLFHNGKVKWVPPAIYKSSCSIDVTFFPFDQQSCKMKFGSWTYDKAWLDLE-----SMERN-------VDLKDYWESGEWAIVNAVGKYNSKKYDCCTEI----------------------YPDITYYFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHKMPLWVRSVFLDHIPRWLFMKRPPAPVEEVVSQYDAPELKLSTSKYWMETDVDDKWAEPEAELQTCHVRHMTTHNQSLQ--YRYDYNHHVSGGQSQTPRHSSTETAESSFLLSPSVLKALEGVHYIANHLRAEDADFSVKEDWKYVAMVIDRIFLWMFIIVCLLGTVGLFLPPF 505          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Xenopus
Match: mppe1 (metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GENE-987928])

HSP 1 Score: 186.422 bits (472), Expect = 1.708e-51
Identity = 141/498 (28.31%), Postives = 251/498 (50.40%), Query Frame = 1
Query:  304 KSVEKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQQEVSTIHQGILFTMNIGKGKSKIKSTEKNFQINHAAFRSKMRKQLNTGNRGENEY---EIDGDEKPELNKKDGISNHSFNILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLYVTAILIA 1788
             +VE  L  +LL  Y  +    RPV    + +++ + +++ Q++ ++E  QI+ TN W R++W D  L+W+P++Y GI+ +RI   +IW PDI L+N A        +A+ V+   G+V WIP A+FKS+C + +T+FPFD Q C L+FGSWTYD  ++NL                  ++  ++ +S EW+        I +   K +IK    + +              Y  + Y + ++R   FY   ++IPCLL+SCLT+++F+LP +   K+ L M++ ++  + LL++ E  PS+    PLIG Y    MI +TLS  +   VLN+++R      +P  ++R F+  L K++   + E           ++I    S+I+S +       ++      K+L T +   N      ++      L+   G+S      + + + D+  FI E  N + Q   K  V  +W+ +A+++DR+F  ++V   ++ 
Sbjct:   17 SNVEHRLYEDLLKSYNPYI---RPVMNVSDPVILHFEVSMSQLVKVDEVNQIMETNLWLRHLWNDYKLKWNPSDYGGIEFLRIPASQIWRPDIVLYNNAVGAFHVDDKAKAVVRYSGDVTWIPPAIFKSSCKIDVTFFPFDYQNCSLKFGSWTYDKAKINLVMIGS------------KINLKEFWESGEWVI-------INAPGYKHEIKYNCCVEI--------------YQDITYSLYIRRLPLFYTIYIIIPCLLISCLTILVFYLPSDCGEKVTLCMSVLLSLTVFLLVITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPKTHTMPHWVKRFFLHLLPKVMFMTRPEKQPYALKPQAYLDI--SSSEIRSCQDQLFYQDSSCACGQLKRLYTSDTACNVTRGSSLESMYNLGLHSGSGLSPE----IREAIEDVH-FIAE--NMKAQDEAKE-VQDDWKYVAMVIDRIFLWVFVLVCILG 468          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Xenopus
Match: mppe1 (metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GENE-987928])

HSP 1 Score: 186.422 bits (472), Expect = 1.710e-51
Identity = 141/498 (28.31%), Postives = 251/498 (50.40%), Query Frame = 1
Query:  304 KSVEKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQQEVSTIHQGILFTMNIGKGKSKIKSTEKNFQINHAAFRSKMRKQLNTGNRGENEY---EIDGDEKPELNKKDGISNHSFNILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLYVTAILIA 1788
             +VE  L  +LL  Y  +    RPV    + +++ + +++ Q++ ++E  QI+ TN W R++W D  L+W+P++Y GI+ +RI   +IW PDI L+N A        +A+ V+   G+V WIP A+FKS+C + +T+FPFD Q C L+FGSWTYD  ++NL                  ++  ++ +S EW+        I +   K +IK    + +              Y  + Y + ++R   FY   ++IPCLL+SCLT+++F+LP +   K+ L M++ ++  + LL++ E  PS+    PLIG Y    MI +TLS  +   VLN+++R      +P  ++R F+  L K++   + E           ++I    S+I+S +       ++      K+L T +   N      ++      L+   G+S      + + + D+  FI E  N + Q   K  V  +W+ +A+++DR+F  ++V   ++ 
Sbjct:   25 SNVEHRLYEDLLKSYNPYI---RPVMNVSDPVILHFEVSMSQLVKVDEVNQIMETNLWLRHLWNDYKLKWNPSDYGGIEFLRIPASQIWRPDIVLYNNAVGAFHVDDKAKAVVRYSGDVTWIPPAIFKSSCKIDVTFFPFDYQNCSLKFGSWTYDKAKINLVMIGS------------KINLKEFWESGEWVI-------INAPGYKHEIKYNCCVEI--------------YQDITYSLYIRRLPLFYTIYIIIPCLLISCLTILVFYLPSDCGEKVTLCMSVLLSLTVFLLVITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPKTHTMPHWVKRFFLHLLPKVMFMTRPEKQPYALKPQAYLDI--SSSEIRSCQDQLFYQDSSCACGQLKRLYTSDTACNVTRGSSLESMYNLGLHSGSGLSPE----IREAIEDVH-FIAE--NMKAQDEAKE-VQDDWKYVAMVIDRIFLWVFVLVCILG 476          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Xenopus
Match: mppe1 (metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GENE-987928])

HSP 1 Score: 186.422 bits (472), Expect = 1.911e-51
Identity = 141/498 (28.31%), Postives = 251/498 (50.40%), Query Frame = 1
Query:  304 KSVEKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQQEVSTIHQGILFTMNIGKGKSKIKSTEKNFQINHAAFRSKMRKQLNTGNRGENEY---EIDGDEKPELNKKDGISNHSFNILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLYVTAILIA 1788
             +VE  L  +LL  Y  +    RPV    + +++ + +++ Q++ ++E  QI+ TN W R++W D  L+W+P++Y GI+ +RI   +IW PDI L+N A        +A+ V+   G+V WIP A+FKS+C + +T+FPFD Q C L+FGSWTYD  ++NL                  ++  ++ +S EW+        I +   K +IK    + +              Y  + Y + ++R   FY   ++IPCLL+SCLT+++F+LP +   K+ L M++ ++  + LL++ E  PS+    PLIG Y    MI +TLS  +   VLN+++R      +P  ++R F+  L K++   + E           ++I    S+I+S +       ++      K+L T +   N      ++      L+   G+S      + + + D+  FI E  N + Q   K  V  +W+ +A+++DR+F  ++V   ++ 
Sbjct:   22 SNVEHRLYEDLLKSYNPYI---RPVMNVSDPVILHFEVSMSQLVKVDEVNQIMETNLWLRHLWNDYKLKWNPSDYGGIEFLRIPASQIWRPDIVLYNNAVGAFHVDDKAKAVVRYSGDVTWIPPAIFKSSCKIDVTFFPFDYQNCSLKFGSWTYDKAKINLVMIGS------------KINLKEFWESGEWVI-------INAPGYKHEIKYNCCVEI--------------YQDITYSLYIRRLPLFYTIYIIIPCLLISCLTILVFYLPSDCGEKVTLCMSVLLSLTVFLLVITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPKTHTMPHWVKRFFLHLLPKVMFMTRPEKQPYALKPQAYLDI--SSSEIRSCQDQLFYQDSSCACGQLKRLYTSDTACNVTRGSSLESMYNLGLHSGSGLSPE----IREAIEDVH-FIAE--NMKAQDEAKE-VQDDWKYVAMVIDRIFLWVFVLVCILG 473          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Xenopus
Match: mppe1 (metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GENE-987928])

HSP 1 Score: 186.422 bits (472), Expect = 1.930e-51
Identity = 141/498 (28.31%), Postives = 251/498 (50.40%), Query Frame = 1
Query:  304 KSVEKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQQEVSTIHQGILFTMNIGKGKSKIKSTEKNFQINHAAFRSKMRKQLNTGNRGENEY---EIDGDEKPELNKKDGISNHSFNILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLYVTAILIA 1788
             +VE  L  +LL  Y  +    RPV    + +++ + +++ Q++ ++E  QI+ TN W R++W D  L+W+P++Y GI+ +RI   +IW PDI L+N A        +A+ V+   G+V WIP A+FKS+C + +T+FPFD Q C L+FGSWTYD  ++NL                  ++  ++ +S EW+        I +   K +IK    + +              Y  + Y + ++R   FY   ++IPCLL+SCLT+++F+LP +   K+ L M++ ++  + LL++ E  PS+    PLIG Y    MI +TLS  +   VLN+++R      +P  ++R F+  L K++   + E           ++I    S+I+S +       ++      K+L T +   N      ++      L+   G+S      + + + D+  FI E  N + Q   K  V  +W+ +A+++DR+F  ++V   ++ 
Sbjct:   21 SNVEHRLYEDLLKSYNPYI---RPVMNVSDPVILHFEVSMSQLVKVDEVNQIMETNLWLRHLWNDYKLKWNPSDYGGIEFLRIPASQIWRPDIVLYNNAVGAFHVDDKAKAVVRYSGDVTWIPPAIFKSSCKIDVTFFPFDYQNCSLKFGSWTYDKAKINLVMIGS------------KINLKEFWESGEWVI-------INAPGYKHEIKYNCCVEI--------------YQDITYSLYIRRLPLFYTIYIIIPCLLISCLTILVFYLPSDCGEKVTLCMSVLLSLTVFLLVITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPKTHTMPHWVKRFFLHLLPKVMFMTRPEKQPYALKPQAYLDI--SSSEIRSCQDQLFYQDSSCACGQLKRLYTSDTACNVTRGSSLESMYNLGLHSGSGLSPE----IREAIEDVH-FIAE--NMKAQDEAKE-VQDDWKYVAMVIDRIFLWVFVLVCILG 472          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Mouse
Match: Chrna6 (cholinergic receptor, nicotinic, alpha polypeptide 6 [Source:MGI Symbol;Acc:MGI:106213])

HSP 1 Score: 196.438 bits (498), Expect = 3.190e-55
Identity = 140/497 (28.17%), Postives = 238/497 (47.89%), Query Frame = 1
Query:  313 EKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEW-ITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQQEVSTIHQGILFTMNIGKGKSKIKSTEKNFQINHAAFRSKMRKQLNTGNRGENEYEIDGDEKPELNKKDGISNHSFNILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLYVTAILIALVVL 1800
            E+ L   L   Y RF    RPV    + + V + LA+ Q+  ++E  QI+ TN W R++WKD  L+WDP  Y GI+ +R+    IW PDI L+N A        + + ++  DG + W P A+FKS+CP+ IT+FPFD Q C L+FGSWTYD  +++L                  VD  D+ +++EW I D    K    Y+   +I                      Y  + Y   ++R   FY   L+IPCL +S LT+++F+LP +   K+ L +++ ++  + LL++ E+ PS+    PL+G Y    MI +TLS  +   VLN+++R  +   +P  ++ +F+     ++M  +    T   G      +   KS  K   K  +  H    SK+ K+ +   +  +     G  +        ++ +S +    D+ D+   +Q      K H   + V  +W+ +A+++DR+F  +++   +   V L
Sbjct:   34 EEQLFHRLFAHYNRFI---RPVENVSDPVTVHFELAITQLANVDEVNQIMETNLWLRHIWKDYRLRWDPTEYDGIETLRVPADNIWKPDIVLYNNAVGDFQVEGKTKALLKYDGVITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWTYDKAEIDL------------LIIGSKVDMNDFWENSEWEIVDASGYKHDIKYNCCEEI----------------------YTDITYSFYIRRLPMFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPATHTMPKWVKTIFLQAFPSILMMRKPLDKTKEAG-----GVKDPKSHTKRPAK-VKFTHRG-ESKLLKECHHCQKSSD--IAPGKRRSSQQPARWVAENSEH--SSDVEDVIESVQFIAENMKSHNETNEVEDDWKYMAMVVDRVFLWVFIIVCVFGTVGL 482          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Mouse
Match: Chrna9 (cholinergic receptor, nicotinic, alpha polypeptide 9 [Source:MGI Symbol;Acc:MGI:1202403])

HSP 1 Score: 177.948 bits (450), Expect = 1.386e-48
Identity = 139/480 (28.96%), Postives = 227/480 (47.29%), Query Frame = 1
Query:  370 RPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQ-VEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQQEVSTIHQGILFTMNIGKGKSKIKSTEKNFQINHAAFRSKMRKQLNTGNRG-ENEYEIDGDEKPELNKKDGISNHSFNILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLYVTAILIALVVLI 1803
            RPV  +D ++ V   + L QI  ++E  QIL    W R  W D  L WD   Y G+  IRI    +W PDI L+N AD+  SE     VV+  DG + W   A+ KS+C V +TYFPFD+Q C L FGSWTY+  Q+++            +  +   D +D+++  EW   G    K + SY                         +  Y  + + + +KR SSFY+  L+IPC+L+S L  + F+LP  S  K+ LG+ I +A  +  L++AE  P+S +N PLIG Y+   M LIT ST L  +V+N++F G     VP   + + +  + +               ILF  ++G+     + +++  QI     +        + N+    + E+    K +L  + GI  ++ +   +  +  K+ I+      K H   +    EW+ +A ++DR F  ++   + +  V++I
Sbjct:   47 RPVEDTDAVLNVTLQVTLSQIKDMDERNQILTAYLWIRQTWHDAYLTWDRDQYDGLDSIRIPSDLVWRPDIVLYNKADDESSEPVNTNVVLRYDGLITWDSPAITKSSCVVDVTYFPFDSQQCNLTFGSWTYNGNQVDI------------FNALDSGDLSDFIEDVEWEVQGMPAVKNVISYG----------------------CCSEPYPDVTFTLLLKRRSSFYIVNLLIPCVLISFLAPLSFYLPAASGEKVSLGVTILLAMTVFQLMVAEIMPAS-ENVPLIGKYYIATMALITASTALTIMVMNIHFCGAEARPVPHWAKVVILKYMSR---------------ILFVYDVGESCLSPRHSQEPEQITKVYGKLPGSNLKASRNKDLSRKKELRKLLKNDLGYQGGIPQNTDSYCARYEALTKN-IEYIAKCLKDHKATNSKGSEWKKVAKVIDRFFMWIFFAMVFVMTVLII 475          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Mouse
Match: Chrna2 (cholinergic receptor, nicotinic, alpha polypeptide 2 (neuronal) [Source:MGI Symbol;Acc:MGI:87886])

HSP 1 Score: 178.718 bits (452), Expect = 1.420e-48
Identity = 147/545 (26.97%), Postives = 250/545 (45.87%), Query Frame = 1
Query:  232 WIYVAAWSTLLFRLIVTVHINKKYKSVEKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEW-ITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQQEVSTIHQGILFTMNI-GKGKSKIKSTEKNFQINHAAFRSKMRKQLNTGNRGENEYEIDGDEKPELNKKDG---------------ISNHSFNILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLYVTAILIALV--VLIPF 1809
            WI++  W  LL   ++       +   E  L ++L   Y R+    RPV  + ++++V++GL++ Q++ ++E  Q++ TN W +  W D  L+WDPA +  I  +R+  + IW PDI L+N AD   +     +  +   G V W+P A++KS+C + +T+FPFD Q CK++FGSWTYD  +++L+         +T      VD  DY +S EW I +       K YD   +I                      Y  + Y   ++R   FY   L+IPCLL+SCLT+++F+LP E   K+ L +++ ++  + LLL+ E  PS+    PLIG Y    MI +TLS  +   VLN++ R  S   +P  +R   +  + + +M  +          L  M + G    K+  T    + N  A   +  ++       EN     G     +    G                S  S  +L   +      +    +  +     S V ++W+ +A+++DR+F  L++    +  +   L PF
Sbjct:   11 WIHLYLWCLLLMPAVLAQ--QGSHTHAEDRLFKHLFGGYNRWA---RPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWDPAEFGNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFFTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLE------QMERT------VDLKDYWESGEWAIINATGTYNSKKYDCCAEI----------------------YPDVTYYFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHNMPNWVRVALLGRVPRWLMMNRP---------LPPMELHGSPGLKLSPTYHWLETNMDAEEREETEEEEEEEEDENICMCAGLPDSSMGVLYGHGSLHLRAMGPEAKTPSQASEILLSPQIQKALEGVHYIADHLRSEDADSSVKEDWKYVAMVVDRIFLWLFIIVCFLGTIGLFLPPF 507          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Mouse
Match: Chrna2 (cholinergic receptor, nicotinic, alpha polypeptide 2 (neuronal) [Source:MGI Symbol;Acc:MGI:87886])

HSP 1 Score: 178.718 bits (452), Expect = 1.420e-48
Identity = 147/545 (26.97%), Postives = 250/545 (45.87%), Query Frame = 1
Query:  232 WIYVAAWSTLLFRLIVTVHINKKYKSVEKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEW-ITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQQEVSTIHQGILFTMNI-GKGKSKIKSTEKNFQINHAAFRSKMRKQLNTGNRGENEYEIDGDEKPELNKKDG---------------ISNHSFNILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLYVTAILIALV--VLIPF 1809
            WI++  W  LL   ++       +   E  L ++L   Y R+    RPV  + ++++V++GL++ Q++ ++E  Q++ TN W +  W D  L+WDPA +  I  +R+  + IW PDI L+N AD   +     +  +   G V W+P A++KS+C + +T+FPFD Q CK++FGSWTYD  +++L+         +T      VD  DY +S EW I +       K YD   +I                      Y  + Y   ++R   FY   L+IPCLL+SCLT+++F+LP E   K+ L +++ ++  + LLL+ E  PS+    PLIG Y    MI +TLS  +   VLN++ R  S   +P  +R   +  + + +M  +          L  M + G    K+  T    + N  A   +  ++       EN     G     +    G                S  S  +L   +      +    +  +     S V ++W+ +A+++DR+F  L++    +  +   L PF
Sbjct:   11 WIHLYLWCLLLMPAVLAQ--QGSHTHAEDRLFKHLFGGYNRWA---RPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWDPAEFGNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFFTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLE------QMERT------VDLKDYWESGEWAIINATGTYNSKKYDCCAEI----------------------YPDVTYYFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHNMPNWVRVALLGRVPRWLMMNRP---------LPPMELHGSPGLKLSPTYHWLETNMDAEEREETEEEEEEEEDENICMCAGLPDSSMGVLYGHGSLHLRAMGPEAKTPSQASEILLSPQIQKALEGVHYIADHLRSEDADSSVKEDWKYVAMVVDRIFLWLFIIVCFLGTIGLFLPPF 507          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Mouse
Match: Chrna4 (cholinergic receptor, nicotinic, alpha polypeptide 4 [Source:MGI Symbol;Acc:MGI:87888])

HSP 1 Score: 176.792 bits (447), Expect = 4.157e-47
Identity = 120/373 (32.17%), Postives = 201/373 (53.89%), Query Frame = 1
Query:  286 HINKKYKSVEKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYD-RKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQQEV 1401
            HI  +  + E+ L++ L + Y ++    RPV    ++++V++GL++ Q++ ++E  Q++ TN W +  W D  L+WDP +Y  +  IRI  + IW PDI L+N AD   +     +  +  DG V W P A++KS+C + +T+FPFD Q C ++FGSWTYD  +++L   H              VD  D+ +S EW+    +   + +Y+ RK +  +E                   Y  + Y   ++R   FY   L+IPCLL+SCLT+++F+LP E   K+ L +++ ++  + LLL+ E  PS+    PLIG Y    MI +TLS  +   VLN++ R      +P  +RR+F+D + +L+   +  V
Sbjct:   31 HIETRAHAEER-LLKRLFSGYNKWS---RPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPGDYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAHLFYDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDLVSMHS------------RVDQLDFWESGEWV----IVDAVGTYNTRKYECCAEI------------------YPDITYAFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKVTLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPAWVRRVFLDIVPRLLFMKRPSV 365          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. UniProt/SwissProt
Match: sp|Q9R0W9|ACHA6_MOUSE (Neuronal acetylcholine receptor subunit alpha-6 OS=Mus musculus OX=10090 GN=Chrna6 PE=2 SV=2)

HSP 1 Score: 196.438 bits (498), Expect = 2.231e-54
Identity = 140/497 (28.17%), Postives = 238/497 (47.89%), Query Frame = 1
Query:  313 EKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEW-ITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQQEVSTIHQGILFTMNIGKGKSKIKSTEKNFQINHAAFRSKMRKQLNTGNRGENEYEIDGDEKPELNKKDGISNHSFNILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLYVTAILIALVVL 1800
            E+ L   L   Y RF    RPV    + + V + LA+ Q+  ++E  QI+ TN W R++WKD  L+WDP  Y GI+ +R+    IW PDI L+N A        + + ++  DG + W P A+FKS+CP+ IT+FPFD Q C L+FGSWTYD  +++L                  VD  D+ +++EW I D    K    Y+   +I                      Y  + Y   ++R   FY   L+IPCL +S LT+++F+LP +   K+ L +++ ++  + LL++ E+ PS+    PL+G Y    MI +TLS  +   VLN+++R  +   +P  ++ +F+     ++M  +    T   G      +   KS  K   K  +  H    SK+ K+ +   +  +     G  +        ++ +S +    D+ D+   +Q      K H   + V  +W+ +A+++DR+F  +++   +   V L
Sbjct:   34 EEQLFHRLFAHYNRFI---RPVENVSDPVTVHFELAITQLANVDEVNQIMETNLWLRHIWKDYRLRWDPTEYDGIETLRVPADNIWKPDIVLYNNAVGDFQVEGKTKALLKYDGVITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWTYDKAEIDL------------LIIGSKVDMNDFWENSEWEIVDASGYKHDIKYNCCEEI----------------------YTDITYSFYIRRLPMFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPATHTMPKWVKTIFLQAFPSILMMRKPLDKTKEAG-----GVKDPKSHTKRPAK-VKFTHRG-ESKLLKECHHCQKSSD--IAPGKRRSSQQPARWVAENSEH--SSDVEDVIESVQFIAENMKSHNETNEVEDDWKYMAMVVDRVFLWVFIIVCVFGTVGL 482          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. UniProt/SwissProt
Match: sp|P43143|ACHA6_RAT (Neuronal acetylcholine receptor subunit alpha-6 OS=Rattus norvegicus OX=10116 GN=Chrna6 PE=2 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 5.993e-53
Identity = 141/498 (28.31%), Postives = 234/498 (46.99%), Query Frame = 1
Query:  313 EKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEW-ITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQQEVSTIH-QGILFTMNIGKGKSKIKSTEKNFQINHAAFRSKMRKQLNTGNRGENEYEIDGDEKPELNKKDGISNHSFNILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLYVTAILIALVVL 1800
            E+ L   L   Y RF    RPV    + + V + LA+ Q+  ++E  QI+ TN W R+VWKD  L WDP  Y GI+ +R+    IW PDI L+N A        + + ++  DG + W P A+FKS+CP+ IT+FPFD Q C L+FGSWTYD  +++L                  VD  D+ +++EW I D    K    Y+   +I                      Y  + Y   ++R   FY   L+IPCL +S LT+++F+LP +   K+ L +++ ++  + LL++ E+ PS+    PL+G Y    MI +TLS  +   VLN+++R  +   +P  ++ +F+     ++M  +    T    G+       K  +K+K T +           K  K L          EI   ++        ++ +S +    D+ D+   +Q      K H     V  +W+ +A+++DR+F  +++   +   V L
Sbjct:   34 EEQLFHTLFAHYNRFI---RPVENVSDPVTVHFELAITQLANVDEVNQIMETNLWLRHVWKDYRLCWDPTEYDGIETLRVPADNIWKPDIVLYNNAVGDFQVEGKTKALLKYDGVITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWTYDKAEIDL------------LIIGSKVDMNDFWENSEWEIVDASGYKHDIKYNCCEEI----------------------YTDITYSFYIRRLPMFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPATHTMPKWVKTMFLQVFPSILMMRRPLDKTKEMDGVKDPKTHTKRPAKVKFTHR-----------KEPKLLKECRHCHKSSEIAPGKRLSQQPAQWVTENSEH--PPDVEDVIDSVQFIAENMKSHNETKEVEDDWKYMAMVVDRVFLWVFIIVCVFGTVGL 481          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. UniProt/SwissProt
Match: sp|Q9UGM1|ACHA9_HUMAN (Neuronal acetylcholine receptor subunit alpha-9 OS=Homo sapiens OX=9606 GN=CHRNA9 PE=1 SV=2)

HSP 1 Score: 181.415 bits (459), Expect = 4.809e-49
Identity = 153/528 (28.98%), Postives = 243/528 (46.02%), Query Frame = 1
Query:  232 WIYVAAWSTLLFRLIVTVHINKKYKSVEKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQ-VEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIM---AGQQEVSTIHQGILFTMNIGKGKSKIKSTEKNFQINHAAFRSKMRKQLNTGNRGENEYEIDGDEKPELNKKDGISNHSFNILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLYVTAILIALVVLI 1803
            WIY AA      RL      + KY    + L  +L   Y       RPV  +D ++ V   + L QI  ++E  QIL    W R +W D  L WD   Y G+  IRI    +W PDI L+N AD+  SE     VV+  DG + W   A+ KS+C V +TYFPFD Q C L FGSWTY+  Q+++            +  +   D +D+++  EW   G    K + SY                         +  Y  + + + +KR SSFY+  L+IPC+L+S L  + F+LP  S  K+ LG+ I +A  +  L++AE  P+S +N PLIG Y+   M LIT ST L  +V+N++F G     VP   R + +  + +++     G+  +S  H       ++ K  SK+   E N +   AA    + ++ +   R +N+    G    E           + +L +++  I   +       K H   +    EW+ +A ++DR F  ++   + +  +++I
Sbjct:   12 WIYFAA-----SRLRAAETADGKYA---QKLFNDLFEDYSN---ALRPVEDTDKVLNVTLQITLSQIKDMDERNQILTAYLWIRQIWHDAYLTWDRDQYDGLDSIRIPSDLVWRPDIVLYNKADDESSEPVNTNVVLRYDGLITWDAPAITKSSCVVDVTYFPFDNQQCNLTFGSWTYNGNQVDI------------FNALDSGDLSDFIEDVEWEVHGMPAVKNVISY----------------------GCCSEPYPDVTFTLLLKRRSSFYIVNLLIPCVLISFLAPLSFYLPAASGEKVSLGVTILLAMTVFQLMVAEIMPAS-ENVPLIGKYYIATMALITASTALTIMVMNIHFCGAEARPVPHWARVVILKYMSRVLFVYDVGESCLSPHHSR--ERDHLTKVYSKLP--ESNLK---AARNKDLSRKKDMNKRLKNDLGCQGKNPQEAESYCA----QYKVLTRNIEYIAKCL-------KDHKATNSKGSEWKKVAKVIDRFFMWIFFIMVFVMTILII 475          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. UniProt/SwissProt
Match: sp|P18257|ACHN3_CARAU (Neuronal acetylcholine receptor subunit non-alpha-3 OS=Carassius auratus OX=7957 PE=2 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 7.036e-49
Identity = 142/504 (28.17%), Postives = 245/504 (48.61%), Query Frame = 1
Query:  310 VEKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRR-----YHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGR-VPGIIRRLFIDGLGKLI-MAGQQEVSTIHQGILFTMNIGKGKSKIKSTEKNFQINHAAFRSKMRKQLNTGNRGENEYEIDGDEKPELNKKDGISNHSFNILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLYVTAILIALVVL 1800
            +E TL+RNL   Y+++    RP+  +++ I V++GL + Q++ ++E   ++ TN W    W D  L+W+P +Y GI  IR+  + IW PDI L+  AD R       + ++  +G ++W P A +KS+C + +T+FPFD Q C ++FGSWTYD T ++L                 YVD  D+ D+ EW                               N  GQ  +RR     Y  + Y   +KR   FY   L+IPCL LS LT+++F+LP +   K++L  ++ V+  + LL++ E  PSS K  PLIG Y    MI +T S  +   V+N++ R  +    +   ++ LF+  L +L+ M G  +        L +  + +G       +K  Q +    R  +++        EN+  I   EK         + HS + + + +             +K+H ++ +V Q+W+ +A +LDR+F  +++TA ++  +++
Sbjct:   31 MEDTLLRNLFRGYQKWV---RPILHANDTITVRFGLKISQLVDVDEKNHLMTTNVWLWQEWTDYKLRWNPEDYGGITSIRVPSETIWLPDIVLYENADGRFEGSLMTKAIVRFNGTIMWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTMVDLTLLDA------------YVDRKDFFDNGEW----------------------------EILNATGQRGSRRDGIYSYPYVTYSFILKRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLLLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTFSIIVTLFVINVHHRSSATYHPMAPWVKSLFLQRLPRLLCMRGHTDRYQYPDIELRSPELKRG------MKKGQQKSAGGGRGGLKED-------ENQAWIALLEK---------ATHSVHYISRHI-------------KKEHFIREVV-QDWKFVAQVLDRIFLWVFLTASVLGTILI 455          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. UniProt/SwissProt
Match: sp|P17644|ACH2_DROME (Acetylcholine receptor subunit alpha-like 2 OS=Drosophila melanogaster OX=7227 GN=nAChRalpha2 PE=2 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 8.231e-49
Identity = 149/532 (28.01%), Postives = 256/532 (48.12%), Query Frame = 1
Query:  316 KTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYND-ETKTYYPIPYVDYTDYVDSNEW-ITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQQE-------VSTIHQGILFTMNIGKGKSKIKSTEKNFQINHAAFRSKMRKQLNTG-----------NRGENEYEIDGDEKPELNKKDGISNHSFNILEKDLSDIKS----------------FIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLYVTAILIALVVLI 1803
            K L  +LL+ Y R   + RPV+ + + ++VK GL L Q++ L    QIL TN W  + W+D   +WDP+ Y G+ ++ +  + IW PDI L+N AD         + ++   G V+W P A+FKS+C + + YFPFD Q C ++FGSWTYD  Q++L      ND + K    I   D  +Y  S EW I     E+  K Y                            Y  + + I ++R + FY   L+IPC+ +S L++++F+LP +S  K+ L ++I ++  +  LL++E  PS+    PL+G Y    M+L+ LS  +  ++LN+++R  S  ++   IR  FI  L KL++    +        + I+ G+ F+     G++ +   + N   +      +M+ ++  G           NR        G     L+  +G+ +   + L+  LSD+ +                FIQ  + RQ +   +    Q+W  +A+++DR+F  L++ A L+   V++
Sbjct:   46 KRLYDDLLSNYNR---LIRPVSNNTDTVLVKLGLRLSQLIDLNLKDQILTTNVWLEHEWQDHKFKWDPSEYGGVTELYVPSEHIWLPDIVLYNNADGEYVVTTMTKAILHYTGKVVWTPPAIFKSSCEIDVRYFPFDQQTCFMKFGSWTYDGDQIDLKHISQKNDKDNKVEIGI---DLREYYPSVEWDILGVPAERHEKYY----------------------PCCAEPYPDIFFNITLRRKTLFYTVNLIIPCVGISYLSVLVFYLPADSGEKIALCISILLSQTMFFLLISEIIPSTSLALPLLGKYLLFTMLLVGLSVVITIIILNIHYRKPSTHKMRPWIRSFFIKRLPKLLLMRVPKDLLRDLAANKINYGLKFS-KTKFGQALMDEMQMNSGGSSPDSLRRMQGRVGAGGCNGMHVTTATNRFSGLVGALGGGLSTLSGYNGLPS-VLSGLDDSLSDVAARKKYPFELEKAIHNVMFIQHHMQRQDEFNAE---DQDWGFVAMVMDRLFLWLFMIASLVGTFVIL 544          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. TrEMBL
Match: A0A3Q0KEK5 (Putative nachr subunit OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 481.871 bits (1239), Expect = 6.146e-160
Identity = 291/568 (51.23%), Postives = 376/568 (66.20%), Query Frame = 1
Query:  298 KYKSVEKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQN--ITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQQ------------EVSTIHQGILFTMNIGKGKSKIKSTEKNF-----------------------------QINHAA--------FRSKMR-----KQLNTGNRGENEYEIDGDE-KPELNKKDGISNH--------SFNILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLYVTAILIALVVLIP 1806
            K KSVEK LIR LL RY++FGVIGRPVN S   + V+YGL L QIL L+ENKQILRTNCWS Y W D LL+W+ ++Y  IK +RIFP +IWTPDIKL+NFADERL E R+ARVV+S++G +LW+PQALFKSTC V ITYFPFDTQ+C LEFGSWTYD TQ+++ WW     ++     +PY+D++DYV SNEW TDG+ E+++   +R +QI+S KK R    R+    N  ITR Y +L Y IR++RN SFYVF+LVIPC+LLS LTLV+FWLPPESPAKMMLGMNIFVAFF+LLLLLAESTPS+VKNFPLIG YFCLNMI+ITLSTFLA LV++LYFRGD  G VP ++RR+ I+G+G+L +  Q+             +   H+ I      G   +KI + E+ +                             Q+  AA         RS  R         T  +  N  +I G   K   N+ D  +NH        S   LE+D+ ++K +++  VNRQK+   KS+V+ EWR+LA++LDR+FF +Y+T I+IA+VV +P
Sbjct:   33 KTKSVEKNLIRMLLNRYEQFGVIGRPVNDSKIKVDVRYGLQLFQILDLDENKQILRTNCWSMYKWTDSLLRWNESDYGDIKTVRIFPSQIWTPDIKLYNFADERLREHRDARVVVSSNGEMLWVPQALFKSTCEVEITYFPFDTQICMLEFGSWTYDKTQMDILWWI---PDSPPIEEMPYLDFSDYVPSNEWRTDGEKEREVHHVNRTIQIRSVKKHR---RRSQTVGNEVITREYPVLRYLIRLRRNPSFYVFMLVIPCVLLSSLTLVVFWLPPESPAKMMLGMNIFVAFFVLLLLLAESTPSAVKNFPLIGVYFCLNMIMITLSTFLATLVIHLYFRGDRNGSVPYVLRRIIIEGIGRLTLVRQRIPLPEMKKPIRPSIIKPHKKIQIP---GISPNKIPANEETYCENERIRHFGGGAFQQCNMVGSHFLYGEEQLGGAASNWFAPNEHRSVPRYPNQFDSYPTATQINNISQIPGSAGKSSENEPDNTANHNESPSVLNSTTTLERDVRELKKYVKMLVNRQKETARKSLVAMEWRTLAIVLDRLFFFIYITTIVIAVVVSVP 591          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. TrEMBL
Match: A0A4S2L6C9 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010246 PE=3 SV=1)

HSP 1 Score: 477.633 bits (1228), Expect = 1.885e-158
Identity = 293/558 (52.51%), Postives = 369/558 (66.13%), Query Frame = 1
Query:  298 KYKSVEKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNIT--RRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQQ----EVSTIHQGILFTMNIGKGKSKIKSTEKN-------------------------FQIN--HAAFR--------------SKMRKQLNTGNRGENEYEIDGDEKPELNKKDGISNHSFN--------ILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLYVTAILIALVVLIP 1806
            K KSVEK+LIR LL RY++FGV+GRPVN S   +VV YGL L QIL L+ENKQILRTNCWS Y W+D LL W+ + Y  I+ IRIFP  IWTPDIKL+NFADERL E REARVVI  DG+VLWIPQAL+KSTC V ITYFPFDTQVC LEFGSWTYD TQ+++ WW G +DE       P+VD++DYV SNEW TDG++E++I   +RKLQI+S K+ R    RN    N T  R Y +L Y IR++RN SFYVF+LVIPC+LLS LTLV+FWLPPESPAKMMLGMNIFVAFF+LLLLLAESTPS+V+NFPLIG +FCLNM++ITLST LA LV++LYFRGD  G VP  +RR+ I+G+G+L+   Q+    +V           +  K +S+    EK+                         FQ    H  +               S+M +   T   G  +    G   PE    DG++   F+         LE D+ ++K +++ FVNRQK+   K++V+ EWR+LALILDR+FF LY+  I IA++V +P
Sbjct:   34 KVKSVEKSLIRMLLNRYEQFGVVGRPVNDSKIQVVVAYGLQLFQILDLDENKQILRTNCWSMYKWQDSLLTWNHSEYGDIRSIRIFPSNIWTPDIKLYNFADERLKEHREARVVIEKDGSVLWIPQALYKSTCEVEITYFPFDTQVCMLEFGSWTYDRTQMDIIWWTG-SDEGAVMS--PFVDFSDYVPSNEWRTDGELEREINPLERKLQIRSVKRYR---RRNQTVGNETMMREYPVLCYLIRLRRNPSFYVFMLVIPCVLLSSLTLVVFWLPPESPAKMMLGMNIFVAFFVLLLLLAESTPSAVRNFPLIGVFFCLNMVMITLSTVLATLVIHLYFRGDRNGSVPAFLRRIVIEGIGRLVYVRQRIPLPDVKKTGSHSSPRGSAAKSRSQHSMLEKDGNKLFLNYVPYGEDGRTGYYGMNNRFQPGCIHCGYPQTYGNLAPTGGPSISQMGRLTGTKYPGYADSAACGCVGPE--PPDGMNELIFSPDLLQSTATLEHDVREVKRYVKMFVNRQKEIHRKNLVAMEWRTLALILDRLFFFLYIATIGIAVLVSVP 583          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. TrEMBL
Match: A0A5K4EQN5 (Putative nachr subunit OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 477.248 bits (1227), Expect = 3.708e-158
Identity = 282/565 (49.91%), Postives = 374/565 (66.19%), Query Frame = 1
Query:  298 KYKSVEKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQN--ITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQQ------------EVSTIHQGILFTMNIGKGKSKIKSTEKNF----------QINHAAFRSKMRKQLNTGNRGENEY----EIDGDEKPE-------------------LNKKDGISNHSF--------------NILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLYVTAILIALVVLIPF 1809
            K KSVEK LIR LL RY++FG+IGRPVN S   + V+YGL L QIL L+ENKQILRTNCW  + W D LL+W+ + Y  IK +RIFP +IWTPDIKL+NFADERL E+R+ARVV+S++G  LW+PQALFKSTC V ITYFPFDTQ+C LEFGS TYD TQ+++ WW     ++     +PY+D++DYV SNEW TDG+ E+++   +R +QI+S KK R    R+    N  ITR Y +L Y IR++RN SFYVF+LVIPC+LLS LTLV+FWLPPESPAKMMLGMNIFVAFF+LLLLLAESTPS+VKNFPLIG +FCLNMI+ITLSTFLA +V++LYFRGD KG VP  +RR+ I+G+G+L +  Q+              +  H+  L +  I   K+K     + F           +NH A   +  + + T   G  E+    E  G   P                    ++  + I+N+ F                LE+D+ ++K +++  VNRQK+   KS+++ EWR+LA++LDR+FF +Y+T ILIA+VV +P+
Sbjct:   39 KTKSVEKDLIRMLLNRYEQFGIIGRPVNDSKIKVDVRYGLQLFQILDLDENKQILRTNCWCMHKWTDSLLRWNESEYGNIKTVRIFPSQIWTPDIKLYNFADERLREYRDARVVVSSNGETLWLPQALFKSTCEVEITYFPFDTQICMLEFGSLTYDRTQMDILWWI---PDSPPIEEMPYLDFSDYVPSNEWRTDGEKEREVHHVNRTIQIRSVKKHR---RRSQTVGNEVITREYPVLRYLIRLRRNPSFYVFMLVIPCVLLSSLTLVVFWLPPESPAKMMLGMNIFVAFFVLLLLLAESTPSAVKNFPLIGVFFCLNMIMITLSTFLATMVIHLYFRGDRKGAVPYFLRRIIIEGIGRLTLVRQRIPLSDVKNSKRNVFAKYHKKTLIS-QISPAKTKQACQNRYFGGGFFPQCNDPVNHPACGDQYLENITTNWSGSTEFQTLKEYSGKSCPHMMRTSIKVNNQIPEILQQIMHNDNQINNYPFRTINYDESEGFNSTTTLERDVRELKKYVKIVVNRQKETIHKSLIAMEWRTLAIVLDRLFFFIYITTILIAVVVSVPY 596          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. TrEMBL
Match: A0A4Z2D9W9 (Neuronal acetylcholine receptor subunit alpha-7 OS=Schistosoma japonicum OX=6182 GN=EWB00_003130 PE=3 SV=1)

HSP 1 Score: 476.478 bits (1225), Expect = 9.917e-158
Identity = 286/568 (50.35%), Postives = 375/568 (66.02%), Query Frame = 1
Query:  298 KYKSVEKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQN--ITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQ----------QEVST-IHQGILFT-MNIGKGKSKIKSTEKNFQ---------------INHAAFRSKMRKQLNTGNRGENEYEID------------------GDEKPE-----LNKKDGISNHSFNI-------------LEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLYVTAILIALVVLIP 1806
            K KSVEK LIR LL RY++FGVIGRPVN S   + V+YGL L QIL L+ENKQILRTNCW  + W D LL+W+ + Y  IK +RIFP +IWTPDIKLHNFADERL E R+ARVV+S++G  LW+PQALFKSTC V ITYFPFDTQ+C LEFGS TYD TQ+++ WW     ++     +PY+D++DYV SNEW TDG+ E+ +   +R +QI+S KK R    R+    N  ITR Y +L Y +R++RN SFYVF+LVIPC+LLS LTLV+FWLPPESPAKMMLGMNIFVAFF+LLLLLAESTPS+VKNFPLIG +FCLNMI+ITLSTFLA +V++LYFRGD KG VP  +RR+ I+G+G+L +  Q          + VST  H+    + +   K K   ++T +N +               + H A   +  + +N    G  E++                      E PE     +N  +G   +SF +             LE+D+ ++K +++  VNRQK+   KS+++ EWR+LA++LDR+FF +YVT ILIA+VV +P
Sbjct:   36 KTKSVEKDLIRMLLNRYEQFGVIGRPVNDSKIKVDVRYGLQLFQILDLDENKQILRTNCWCMHKWTDSLLRWNESEYGNIKTVRIFPSQIWTPDIKLHNFADERLREHRDARVVVSSNGETLWLPQALFKSTCEVEITYFPFDTQICMLEFGSLTYDRTQMDILWW---IPDSVPLVEMPYLDFSDYVPSNEWCTDGEKERDVHHINRTIQIRSVKKHR---RRSQTVGNEVITREYPVLRYLVRLRRNPSFYVFMLVIPCVLLSSLTLVVFWLPPESPAKMMLGMNIFVAFFVLLLLLAESTPSAVKNFPLIGVFFCLNMIMITLSTFLATMVIHLYFRGDRKGAVPLFLRRIIIEGIGRLTLVRQRIPLSDMNLKRNVSTKCHKTTPISQIRSVKCKQDSQNTCQNRRNRCSRSGLFPPFEEFVGHPACEGQYMESVNGNWFGSTEFQAHQRYCRNSYSHMSRAPSKVSHEIPEMAQQNMNYDNGTKQYSFGMINYEAENLNSTSTLERDVKELKKYVKMVVNRQKETAHKSLIAMEWRTLAIVLDRLFFFIYVTTILIAVVVSVP 597          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. TrEMBL
Match: A0A094ZRW8 (Neuronal acetylcholine receptor subunit alpha-7 OS=Schistosoma haematobium OX=6185 GN=MS3_04061 PE=3 SV=1)

HSP 1 Score: 464.537 bits (1194), Expect = 1.148e-153
Identity = 278/559 (49.73%), Postives = 367/559 (65.65%), Query Frame = 1
Query:  334 LLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQN--ITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQQ------------EVSTIHQGILFTM-NIGKGKSKIKSTEKNFQ---------------INHAAFRSKMRKQLNTGNRGENEY----EIDGDEKPELNKKDGISNH------------------------------SFN---ILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLYVTAILIALVVLIPF 1809
            LL RY++FG+IGRPVN S   + V+YGL L QIL L+ENKQILRTNCW  + W D LL+W+ + Y  IK +RIFP +IWTPDIKL+NFADERL E+R+ARVV+S++G  LW+PQALFKSTC V ITYFPFDTQ+C LEFGS TYD TQ+++ WW     ++     +PY+D++DYV SNEW TDG+ E+++   +R +QI+S KK R    R+    N  ITR Y +L Y IR++RN SFYVF+LVIPC+LLS LTLV+FWLPPESPAKMMLGMNIFVAFF+LLLLLAESTPS+VKNFPLIG +FCLNMI+ITLSTFLA +V++LYFRGD KG VP  +RR+ I+G+G+L +  Q+              +  H+  L +  +  K K   ++  KN Q               +N  A   +  + + T   G NE+    E  G   P + K     NH                              SFN    LE+D+ ++K +++  VNRQK+ T KS+++ EWR+LA++LDR+FF +Y+T ILIA+VV +P+
Sbjct:    2 LLNRYEQFGIIGRPVNDSKIKVDVRYGLQLFQILDLDENKQILRTNCWCMHKWTDSLLRWNESEYGNIKTVRIFPSQIWTPDIKLYNFADERLREYRDARVVVSSNGETLWLPQALFKSTCEVEITYFPFDTQICMLEFGSLTYDRTQMDILWWIP---DSPPIEEMPYLDFSDYVPSNEWRTDGEKEREVHHVNRTIQIRSVKKHR---RRSQTVGNEVITREYPVLRYLIRLRRNPSFYVFMLVIPCVLLSSLTLVVFWLPPESPAKMMLGMNIFVAFFVLLLLLAESTPSAVKNFPLIGVFFCLNMIMITLSTFLATMVIHLYFRGDRKGAVPYFLRRIIIEGIGRLTLVRQRIPLPDVKNSKRNVFAKYHRKTLISQTSPAKTKQAYQNRCKNEQNRYFGGGFFPQCSESVNQPACGDQYFENVTTNWSGSNEFQTLKEYSGKSCPHMMKTSIKLNHRIPEILQQIMHNDNNMNNYPFRMINYDESESFNSTTTLERDVRELKKYVKIVVNRQKETTHKSLIAMEWRTLAIVLDRLFFFIYITTILIAVVVSVPY 554          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Cavefish
Match: ENSAMXT00000019858.2 (neuronal acetylcholine receptor subunit alpha-10 [Source:NCBI gene;Acc:103033580])

HSP 1 Score: 195.667 bits (496), Expect = 2.122e-55
Identity = 146/494 (29.55%), Postives = 245/494 (49.60%), Query Frame = 1
Query:  322 LIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQQEVSTIHQGILFTMNIGKGKSKIKSTEKNFQINHAAFRSKMRKQLNTGNRGENEYEIDGDEKPELNKKDGISNHSFNILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCL-YVTAILIALVVL 1800
            L+++L   Y       RPV  +DN+I V   + L QI+ ++E  QIL T  W R VW D  L W+ A+Y G+  IRI    +W PDI L+N AD++ S   E  VVI +DG ++W   A+ KS+C V +++FPFD+Q C+L FGSWT++  Q+++   +G +            D  D+V++ EW   G   KK                        L    +  Y  + Y +++KR +SFY+F L+IPC+++S L  + F+LP +S  K+ LG+ + +A  +  LL+AES P S +N PLIG Y+   M +IT ST L   ++N++  G     VP   RR  ++ L +               I F   +G+    +  TE   +  ++ F ++              +   G+++P   K+  +        +  L +I+     +  R+++ T +   + EWR +A ++DR F  L ++   L++L+++
Sbjct:   23 LLKDLFVNYSN---AVRPVEDTDNIINVTLQITLSQIIDMDERNQILTTYLWIRQVWLDAYLTWNKADYDGLDTIRIPSSYVWRPDIVLYNNADDQFSSSMETNVVIHHDGQIMWDQPAISKSSCKVDVSFFPFDSQKCRLTFGSWTHNGNQMDI--LNGMDS----------ADLADFVENVEWEVLGMPAKK---------------------NVILYGCCSEPYPDITYTLQLKRRASFYIFNLLIPCMMISFLAPLGFYLPADSGEKVSLGVTVLLALTVFQLLVAESMPPS-ENVPLIGKYYIATMTMITASTALTIFIMNIHHCGSDAQPVPEWARRFILNYLAR---------------ICFVYEVGESCLTVP-TETTSRRGNSCFVNE-----------SESFRAVGNKEPVKRKEVLLRGQCMCHQQPLLKNIEYMANCY--REQKSTQRR--TGEWRKVAKVMDRFFMWLFFIMVFLMSLLIM 448          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Cavefish
Match: ENSAMXT00000032409.1 (neuronal acetylcholine receptor subunit alpha-10 [Source:NCBI gene;Acc:103033580])

HSP 1 Score: 189.504 bits (480), Expect = 2.671e-52
Identity = 123/352 (34.94%), Postives = 190/352 (53.98%), Query Frame = 1
Query:  322 LIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKL 1377
            L+++L   Y       RPV  +DN+I V   + L QI+ ++E  QIL T  W R VW D  L W+ A+Y G+  IRI    +W PDI L+N AD++ S   E  VVI +DG ++W   A+ KS+C V +++FPFD+Q C+L FGSWT++  Q+++   +G +            D  D+V++ EW   G   KK                        L    +  Y  + Y +++KR +SFY+F L+IPC+++S L  + F+LP +S  K+ LG+ + +A  +  LL+AES P S +N PLIG Y+   M +IT ST L   ++N++  G     VP   RR  ++ L ++
Sbjct:   33 LLKDLFVNYSN---AVRPVEDTDNIINVTLQITLSQIIDMDERNQILTTYLWIRQVWLDAYLTWNKADYDGLDTIRIPSSYVWRPDIVLYNNADDQFSSSMETNVVIHHDGQIMWDQPAISKSSCKVDVSFFPFDSQKCRLTFGSWTHNGNQMDI--LNGMDS----------ADLADFVENVEWEVLGMPAKK---------------------NVILYGCCSEPYPDITYTLQLKRRASFYIFNLLIPCMMISFLAPLGFYLPADSGEKVSLGVTVLLALTVFQLLVAESMPPS-ENVPLIGKYYIATMTMITASTALTIFIMNIHHCGSDAQPVPEWARRFILNYLARI 347          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Cavefish
Match: chrna4b (neuronal acetylcholine receptor subunit alpha-2 [Source:NCBI gene;Acc:103025036])

HSP 1 Score: 176.792 bits (447), Expect = 1.564e-47
Identity = 122/377 (32.36%), Postives = 201/377 (53.32%), Query Frame = 1
Query:  274 IVTVHINKKYKSVEKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQQEVS 1404
            ++T+H        E+ L++ L +RY +   + RPV    ++++V +GL++ Q++ ++E  Q++ TN W +  W D  L+W+P  Y  +  IRI  + IW PDI L+N AD   +     +  + +DG + W P A++KS+C + +T+FPFD Q CK++FGSWTYD  +++L      +D+         VD  DY +S EW+    V K            + KK    TE           Y  + Y   ++R   FY   L+IPCLL+SCLT+++F+LP E   K+ L +++ ++  + LLL+ E  PS+    PLIG Y    MI +TLS  +   VLN++ R     R+P  +R+LF+  + + +   +   S
Sbjct:   18 MITIH---SRAHAEERLLQVLFSRYNK---LSRPVANISDVVLVHFGLSIAQLIDVDEKNQMMTTNVWVKQEWSDYKLRWNPEEYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAQLFHDGRIKWKPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDRAKIDLV---SMDDD---------VDQMDYWESGEWVIINAVGK-----------YNTKKYECCTE----------IYPDITYSFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECAEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIIITVFVLNVHHRSSRTHRMPHWVRQLFLQLVPRYLFMKRPPAS 355          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Cavefish
Match: chrna6 (neuronal acetylcholine receptor subunit alpha-3 [Source:NCBI gene;Acc:103022127])

HSP 1 Score: 174.096 bits (440), Expect = 1.600e-47
Identity = 127/479 (26.51%), Postives = 232/479 (48.43%), Query Frame = 1
Query:  370 RPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEW-ITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQQEVSTIHQGILFTMNIGKGKSKIKSTEKNFQINHAAFRSKMRKQLNTGNRGENEYEID-GDEKPELNKKDGISNHSFNILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLYVTAILIALVVL 1800
            RPV    + + V++ +++ Q++ ++E  QI+ TN W R++W D  L+W PA + GI+ IR+   +IW PDI L+N A        + + ++  DG + W+P A+FKS+CP+ ITYFPFD Q C ++FGSWTYD  +++L                  V+  D+ +S EW I D         Y   ++    ++I                Y  + Y   ++R   FY   L+IPCLL+S LT+++F+LP +   K+ L +++ ++  + LL++ E+ PS+    PLIG Y    MI +TLS  +   VLN+++R  +   +PG +R +F+  L ++++  +               I + +S  K+ E                            E+D G    +L+ +   +  +F+++  ++      ++      +       V  +W+ +A+++DR+F  ++V   ++  V L
Sbjct:   33 RPVENVSDPVTVEFEVSISQLVKVDEVNQIMETNLWLRHIWNDYKLKWIPAEFDGIEYIRVPSNKIWRPDIVLYNNAVGDFLVEDKTKALLKFDGTITWVPPAIFKSSCPMDITYFPFDYQNCSMKFGSWTYDKAKIDLVLIGS------------KVNLKDFWESGEWEIIDA------PGYKHDIKYNCCEEI----------------YPDITYSFYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPGWVRTVFLRALPRIMLMRRP--------------IDQSESSTKAKEGP--------------------------EVDCGKVSRQLSPQAINTVVAFSVVSPEIKQAIESVKYIAENMRSRNKAKEVEDDWKYVAMVIDRIFLWVFVLVCVLGTVGL 437          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Cavefish
Match: chrnb1l (acetylcholine receptor subunit beta-like [Source:NCBI gene;Acc:103034907])

HSP 1 Score: 174.866 bits (442), Expect = 1.931e-47
Identity = 138/506 (27.27%), Postives = 248/506 (49.01%), Query Frame = 1
Query:  313 EKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQQEVSTIHQGILFTMNIGKGKSKIKSTEKNFQINHAAFRSKMRKQLNTGNRGENEYEIDGDEKPELNKKDGISNHSFNILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLYVTAILIALVVLIPFQKNDFNE 1830
            E++L+++L   ++ + V  RP    +  ++V+ G+ L+Q++ L++    + TN +    W D  L W+PA+Y  I  IRI P ++W PDI L N  D +        V++++DG V W+P A+++S+C + + YFPFD Q C + F S+TYD ++++L   +G +++    + I  +D   + ++ EW                 QI  +   + I E   L ++IT  Y I+E      R   FY+  +++PC+L S L + +F+LPP +  KM L +++ +A  + +LLLA+  P +    P+I  Y    MIL+T S  L+ +VLNL+ R      +P  +R++FID L   +   + +     +          G   I  T +        F  K+  +L    +G        D   +L +     ++   IL  DL    + +     + K+  +   ++ +W+ +A+++DR+FF L+V  I+  L  L  F    FN 
Sbjct:   27 ERSLLQDL---FENYNVKVRPARVWNETVMVRVGMTLVQLISLDQKNGEMTTNVYMNMAWTDYRLSWNPADYDNIDVIRIPPTKVWRPDIYLINNNDGQFDVALYVNVLVNSDGTVSWLPPAIYRSSCSIEVAYFPFDWQNCTMVFRSYTYDASEVDLQ--YGLDEDGNELHEI-VIDKNAFTENGEW-----------------QICHKPTRKNIQE--DLYEDIT-FYLIIE------RKPLFYIINIIVPCILTSVLAIFVFYLPPGAGEKMTLSISVLIALTVFMLLLADKVPETSLAIPIIVNYVMFTMILVTFSVILSVVVLNLHHRTPGTHYMPSWVRKVFIDFLPPYLGMFRPQTEETTEEEEAEEQQPHG-GHIDHTRRP---GGEYFIRKINPELVMPWKGSRP-----DSTVQLQRFFDSDSYCL-ILPPDLKSAIAAVTYMAEQLKKQDVDDTITDDWQYIAIVVDRLFFWLFV--IITTLGTLGMFLDASFNH 488          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Sea Lamprey
Match: chrna3 (cholinergic receptor, nicotinic, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-070822-1])

HSP 1 Score: 177.563 bits (449), Expect = 4.590e-49
Identity = 112/354 (31.64%), Postives = 194/354 (54.80%), Query Frame = 1
Query:  322 LIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIM 1383
            L + L T Y  +    RPV    + ++V++ +++ Q++ L+E  QI+ TN W ++ W D   QW+P  + G++ IR+   +IW PDI L+N AD       + + ++  DG V+W+P A+FKS+C + +TYFPFD Q C ++FGSWTYD  +++L         TK       ++  D+ +S EW+        +  Y   ++    ++I                Y  + Y + ++R   FY   L+IPCLL+S LT+++F+LP +   K+ L +++ ++  + LL++ E+ PS+    PLIG Y    MI +TLS  +   VLN+++R      +P  +RR+F+D L K+++
Sbjct:   11 LYKTLFTSYNPYI---RPVFNVSDPVIVRFEVSMSQLVKLDEVNQIMATNLWLKHTWNDYKFQWNPGQFEGMEYIRVPSDKIWKPDIVLYNNADGDFQVEGKTKALLKYDGTVMWMPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWTYDKAKIDL-----VLVGTK-------INLKDFWESGEWVI-----IDVPGYKHDIKYNCCEQI----------------YPDITYSVYVRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLSISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITIFVLNVHYRTPEAHTMPNWVRRVFLDTLPKIML 328          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Sea Lamprey
Match: chrnb3b (cholinergic receptor, nicotinic, beta 3b (neuronal) [Source:ZFIN;Acc:ZDB-GENE-030102-4])

HSP 1 Score: 174.481 bits (441), Expect = 2.510e-48
Identity = 118/358 (32.96%), Postives = 191/358 (53.35%), Query Frame = 1
Query:  310 VEKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGR-VPGIIRRLFIDGLGKLI 1380
            +E  L++ +L  Y+++    RPV++  + + VK+GL + Q++ ++E  Q++ TN W +  W DI L+W+P +Y GI  IR+    IW PDI L++ AD R       + V+ +DG + W P A++KS+C + +T+FPFD Q C ++FGSWTYD T ++L      N +         VD  +Y D+ EW                L     K +R+         +  R Y  + Y   ++R   FY   L++PCL LS LT+ +F+LP +   K+ L  ++ V+  + LL++ E  PSS K  PLIG Y    MI +TLS  +   V+N++ R  S    +   +R+LF+  L K++
Sbjct:   34 LEDRLLKRMLKDYQKWV---RPVDKLSDTVEVKFGLGIAQLVDVDEKNQLMTTNVWLKQEWVDINLRWNPDDYGGINSIRVPASSIWLPDIVLYDNADGRFEGSIVTKAVVKHDGRIKWTPPAIYKSSCTIDVTFFPFDQQNCSMKFGSWTYDGTLVDL---IMVNSD---------VDRGEYFDNGEW--------------EFLNATGNKGVRL---------DGHRFYPYITYSFVIRRLPLFYTLFLIVPCLGLSFLTVFVFYLPSDEGEKISLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIITVFVINVHHRSSSTHHPMAPWVRQLFLHKLPKIL 353          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Sea Lamprey
Match: chrnb1l (cholinergic receptor, nicotinic, beta 1 (muscle) like [Source:ZFIN;Acc:ZDB-GENE-060811-1])

HSP 1 Score: 149.058 bits (375), Expect = 4.556e-39
Identity = 110/378 (29.10%), Postives = 191/378 (50.53%), Query Frame = 1
Query:  310 VEKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLI---------MAGQQEVSTIHQ 1416
             E+ L+++L    +++  + RP   +   + V+ G+ L Q++ L   +  +  +      W+D  L WDP NY  ++ IR+ P+ +W PDI L N  D          V++   G V W+P ++++S+C + + YFPFD Q C + F S+TYDT+++NL++     DE +       +D + +  S EW                 QIK +   +    R+ L Q+IT       + + M+R   FY+  +V+PC+L++   +  F+LPP++  KM L +++ +A  + LLLLA+  P +    P+I  Y    M+++T    L  +VLNL+FR  +   +P  +RR+FI  L K +         +A +  V T HQ
Sbjct:   23 AEENLLKDLFV-VQQYKTLVRPARTATGRVTVRLGMTLSQLISLPACQPDMTLSRLISLSWEDPRLSWDPRNYDNLRSIRLSPKRVWLPDIALSNNNDGNFDFGLYVHVLVDYTGAVRWVPPSIYRSSCGMQVKYFPFDWQNCSMVFQSFTYDTSEINLEY---ALDEHRQEIRHIIIDESTFPVSGEW-----------------QIKHKPSRKNTNPRDPLYQDIT-------FYLIMERKPLFYIINIVVPCILITICAVFTFYLPPDAGEKMGLCISVLLALTVFLLLLADKVPETSLGVPVIVNYLMFTMVIVTACVILTVIVLNLHFRSPATHIMPYWVRRIFIHSLPKYLWIERPKKEELAPKLPVLTQHQ 372          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Sea Lamprey
Match: chrna2a (cholinergic receptor, nicotinic, alpha 2a (neuronal) [Source:ZFIN;Acc:ZDB-GENE-040108-2])

HSP 1 Score: 147.517 bits (371), Expect = 5.032e-38
Identity = 108/328 (32.93%), Postives = 167/328 (50.91%), Query Frame = 1
Query:  403 VKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEW-ITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIM 1383
            V+Y      +   +E  Q++ TN W +  W D  LQWDPA Y  +  IR+  + IW PDI L+N AD   +     +  + + G V W P A++KS+C + +T+FPFD Q C ++FGSWTYD  +++L       D          VD  DY +S EW I         K YD   Q+                      Y  + Y   ++R   FY   L+IPCLL+SCLT+++F+LP +   K+ L +++ ++  + LLL+ E  PS+    PLIG Y    MI +TLS  +   VLN++ R  +   +P  +RR+F+D + + ++
Sbjct:    1 VRYAEFRTHLCDCDEKNQMMTTNVWLKQEWDDYKLQWDPAEYENVTSIRVPSELIWVPDIVLYNNADGDFAVTHMTKAHLFHTGRVRWKPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDLV--SMARD----------VDLKDYWESGEWAIVHAVGTYNTKKYDCCPQV----------------------YPDITYSFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPATHAMPRWVRRVFLDRVPRWLV 294          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008550.1 (pep scaffold:Pmarinus_7.0:GL476601:34:38373:1 gene:ENSPMAG00000007717.1 transcript:ENSPMAT00000008550.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.109 bits (331), Expect = 1.470e-33
Identity = 104/445 (23.37%), Postives = 201/445 (45.17%), Query Frame = 1
Query:  526 YSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRR-YHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQ---------QEVSTIHQGILFTMNIGKGKSKIKSTEKNFQINHAAF----RSKMRKQLNTGNRG-----ENEYEIDGDEKPELNKKDGISNHSFNILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLYVTAILIALVVLI 1803
            + G+K +R  P +IWTPDI L+N ADER        V+++  GN   +P  + KSTC + + +FPFD Q C L+FGSWT+D   ++L                   D + Y+ + EW                        + +  +RN L  +  +  Y  + Y + ++R + +Y   L++PC+L+S L+L++F LP +S  K+ LG+ + ++  + +LL+AE  P++  + PLIG YF   MI++  S  +  +VL  +       ++P  +R + +D     +   Q         + +S +H+  + ++++    +     + N    H  F         +Q  T + G     E  +   G E+   N + G+       +  +++ I   ++    R +       ++ EW+  A ++DR+    +    +I+ + ++
Sbjct:    3 HPGVKNLRFQPHQIWTPDILLYNSADERFDATFHTNVLVNYTGNCQHLPPGMLKSTCYIDVRWFPFDVQKCDLKFGSWTHDGWLIDLQMLEA--------------DTSGYIANGEW----------------------DLVEIPGKRNELYYDCCQEPYPDVTYTLTIRRRTLYYGLNLLVPCVLISALSLLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIGQYFASTMIIVAFSVVVTVIVLQYHHHNPDGKKMPQWVRVILLDWCAWFLRMKQPGRERHELARRLSILHRNSMVSLDLALLSASGIHKKTN---GHGVFIGFTNPDAPQQPPTSDSGVMCGRETCFNSTGPEEEPGNAQRGMPPDPTAGMSSEITKILIELRYIAGRFRTQDENEAIASEWKFAAAVVDRLCLLAFTLFTIISTISIL 408          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Nematostella
Match: EDO42054 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2J7])

HSP 1 Score: 170.629 bits (431), Expect = 1.225e-46
Identity = 137/506 (27.08%), Postives = 237/506 (46.84%), Query Frame = 1
Query:  304 KSVEKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLS---EFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRR--YHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQQEVSTIHQGILFTMNIGKGKSKIKSTEKNFQINHAAFRSKMRKQLNTGNRGENEYEIDGDEKP-ELNKKDGISNHSFNILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFF-CLYVTAILIALVVL 1800
            ++ EK L+ +L   ++ +    RPV    + + V++ L+LIQI+ +    Q++  + W R  W + +L W+ + Y GI+ + + P ++W PDI L+N ADE  +   E  +  V+ S+DG   W   A F STC + + YFPFD+Q C L+FGSWTY   +L +      +D           D + YV++ EW                        + M  + N +  N  +   Y +  Y + ++R   +YVF L+IPC L++ LTL+ F+LPPES  K+ LG+ + +A  + LLL+AE+ PS+  + PL+G YF   M +  +S     L+LN + R  S   +P  ++ + +D + +                               + +N ++                 R ++     G   P E  +   +S+      E+ L DI    ++   RQ+   ++    +EWR  AL+LDRMFF  + VT+++ + ++ 
Sbjct:   35 ETAEKRLLADL---FRNYDSEVRPVFNDSDKVNVEFSLSLIQIIAVNSKSQLVTVSVWIRQKWTNPMLAWNTSKYGGIESVNLNPAKVWIPDIILYNNADETYAGGLEKYKTSVIASSDGTQEWNSPASFTSTCNINVRYFPFDSQNCSLKFGSWTYVGNRLTMT---STSDS---------ADLSKYVNNGEW----------------------HLLAMPAKLNRVFYNCCKYPFYDVTLY-LEIQRKPLYYVFNLIIPCALIATLTLIKFFLPPESGEKVGLGITVLLAMTVFLLLVAETLPSTSDHIPLLGQYFVATMFVTAISLVATCLILNFFHRNPSTSPMPHWVKVIILDYMAR-------------------------------SPRNARL----------------MRDDSVIPPSGRSTPCERRRMSTVSSQLNPFTERLLDDINVLAEDVRARQEDERLR----EEWRCAALVLDRMFFWIMLVTSLMTSFMIF 451          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Nematostella
Match: EDO47969 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKU6])

HSP 1 Score: 163.31 bits (412), Expect = 2.732e-45
Identity = 110/344 (31.98%), Postives = 175/344 (50.87%), Query Frame = 1
Query:  313 EKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLS---EFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEW-ITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRV 1332
            E+ LI +LL  Y R     RPV  S++ + V +G+ ++QI+ +E   QI++TN W R  W + LL W P+NY G++ +R+  + +W PDI L++ AD   S   E  +  V+IS DG+  W   A F+STC + +TYFPFD Q C ++FGSWTY    +++              P P V  + Y+ S EW +      +K + Y    +  S+  I M   R  L                      FY F L+ PC+++  + L+ F+LPPES  ++ L + + +A  + L L+AE+ P + ++ PL+G ++   M  I +S      VLN++ R      V
Sbjct:    1 EQRLISDLLQGYSRNA---RPVLNSNHTLKVFFGMEIVQIVNVENRNQIIQTNVWIRQRWDNELLTWHPSNYEGVQTVRLDAKSVWIPDIVLYDSADSVFSGGHEKYKTHVIISKDGSSAWFSPASFRSTCKIDVTYFPFDEQTCYMKFGSWTYTIADVDIQ-----------ASPAP-VKSSKYLKSAEWDLMSATTSRKSQIYACCPEPISDVTIAMTIRRKPL----------------------FYAFNLITPCMIMLTMILLGFFLPPESGERITLSITVLLAMAVFLQLVAETLPRNSESIPLLGRFYITIMTEIAVSLMATCWVLNIHHRNSGTTLV 307          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Nematostella
Match: EDO40862 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S622])

HSP 1 Score: 161.384 bits (407), Expect = 7.684e-45
Identity = 103/334 (30.84%), Postives = 181/334 (54.19%), Query Frame = 1
Query:  313 EKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFR---EARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNL-DWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKK-IKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLN 1299
            E+ L+R+L   Y ++    RP  +SD   +V +   L QI+ L++N+Q+L+   ++   W++ +L WDP +Y G+++I + P+E+W PDI ++N A++ L       +  VVI  +G  +W+  A+F +TC + + YFPFD Q C L+FGSWT+D+++L++    +G N +              Y +  EW   G  +K+ +K YD                         + Y  + Y + ++R S FY   L++P LL++ + LV F LPPES  +M LG+ + +A  + L  + ++ PS+  + PL+G ++ + M LI+LS     ++LN
Sbjct:    1 EQRLLRDLFQNYSKYA---RPSIESDAPAIVTFRAKLKQIVDLKDNEQLLKIILYNYMQWENPILTWDPRDYGGVQEINVAPEEVWVPDIVIYNSAEDVLGGLTHKYKTDVVIQANGTNIWLAPAMFLTTCQLDVRYFPFDEQKCLLKFGSWTHDSSRLDMRTQTNGSNKDI-------------YTEHGEWQLVGVEQKRNVKYYD----------------------CCPKPYVDISYTVHIRRKSLFYSLYLILPALLITSMVLVGFHLPPESGERMQLGITVLLAMIVFLQFVYQNLPSTSDSAPLLGKFYIVMMFLISLSLGCTCIILN 296          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Nematostella
Match: EDO44896 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUG1])

HSP 1 Score: 164.851 bits (416), Expect = 2.827e-44
Identity = 131/518 (25.29%), Postives = 243/518 (46.91%), Query Frame = 1
Query:  313 EKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLS---EFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEW-ITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFR--GDSKGRVPGIIRRLFIDGLGKLIMAGQQEVSTIHQGILFTMNIGKGKSKIKSTEKNFQINHAAFRSKMRKQLNTGNRGENEYEIDGDEKPELNKKDG---------------ISNHSFNILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLYVTAILIALVVLI 1803
            E TL+ +LL  Y +       +N++  +  V +GL L+Q++ +++  QI+ TN W R  W ++LL+WDP  Y GI ++RI   +IW PDI L+N AD   S   E  + RV++++DG   W   A F+STC + +T+FPFD Q C ++FGSWT++   L++     + D++  +        + Y+ S EW +     ++ ++ Y       S+  +  +  R  L                      FYVF L++PCL+++ + L+ F LPPES  ++ L + + +A  + L L AE+ P +  N P++G ++   M+ + LS      VL+++ +  G +   VP  ++   +  LGK++   +      +     +  +   +  +   +    +     R  +     +G R  +    D       +++D                 +  +F++     +     I    +  K   +  I   EWR LA++LDR+FF L+V  I+++  V++
Sbjct:   12 EHTLLGDLLKGYNKDAHPVPILNKTQYM--VTFGLELVQLVNVDDKNQIITTNVWVRQRWTNLLLKWDPDKYGGITRVRIDASKIWIPDIVLYNSADSEFSGGLEKYKTRVILNHDGVNAWYSPASFRSTCQIDVTFFPFDQQTCFMKFGSWTFEVVDLDI-----FADKSPLH-------SSQYMKSAEWDLIAASKKRNVEYYACCTYPFSDVTVTWVFRRKPL----------------------FYVFNLIVPCLIITGMVLLGFMLPPESGERITLSITVLLAMAVFLQLAAENLPRNSDNVPVLGIFYITVMVEVALSLIATCYVLHIHHKNSGIAVVPVPHWVQVYMLGYLGKILGVKKPITEDTYDA---SSKLDFKRLSMMKRDMERAVGDGKRRFGLSNGGKSGRRLGSRAVSDDLLMDSFDQEDDTNSNSTNQNTTNNTGNNQRTFSVQSSMNTKATQGIIVLADHVKHKRLVEINQGEWRYLAMVLDRLFFWLFVLMIILSASVIL 490          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Nematostella
Match: EDO32053 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW63])

HSP 1 Score: 156.377 bits (394), Expect = 8.433e-43
Identity = 108/360 (30.00%), Postives = 185/360 (51.39%), Query Frame = 1
Query:  313 EKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFR---EARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIM 1383
            E  L++ LL  Y +     RPV   ++ + +K G+ L Q++ L E  QIL  N W R  WKD LL+W+P ++ GIK I I P  +W PD+ L+N  D R        +  V++++DG+  W+  A+ KS C + + +FPFD Q C+L FGSWT+D  ++++   H   +          +D  ++ D+ EW   G   ++    D K+ I   +                  Y  + Y I ++R + FYVF +V+P  +++ L+L  F+LPP S  ++   + + +A  + L+++ E+ P S  + PL+  +F  +MI I LS  LAA  + + F   +K  +  +I+ +  D L   ++
Sbjct:    1 EPALLKYLLQNYSK---DARPVLNVNDPVQLKLGIMLRQVIDLNERDQILTINVWIRQYWKDHLLKWNPDDFGGIKSINIAPDRVWKPDVLLYNRTDLRFGSLNNKIDTNVIVNHDGSTTWLAPAIIKSECKIDVRFFPFDVQSCELTFGSWTHDGLKIDI---HLKQESG--------IDTENFSDNREWFLKGTSGRR----DVKMYICCPEP-----------------YPTVTYTIILRRRAMFYVFNMVLPTGVIALLSLFSFYLPPNSGERVSFVITVLLAMSVYLIMVTENIPRST-DIPLVSKFFMASMIQIALS--LAATCVVIRF-DTTKKPMSSVIKLVVNDWLATALL 321          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Medaka
Match: chrnb3a (neuronal acetylcholine receptor subunit non-alpha-3 [Source:NCBI gene;Acc:101168098])

HSP 1 Score: 183.726 bits (465), Expect = 6.584e-51
Identity = 148/535 (27.66%), Postives = 251/535 (46.92%), Query Frame = 1
Query:  244 AAWSTLLFRLIVTVHINKKYKS-------VEKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRR-----YHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGR-VPGIIRRLFIDGLGKLIMAGQQEVSTIHQGILFTMNIGKGKSKIKSTEKNFQINHAAFRS-KMRKQLNTGNRGENEYEIDGDEKPELNKKDGISNHSFNILEKDLSDIKSFIQEFVNR--QKQHTMKSIVSQEWRSLALILDRMFFCLYVTAILIALVVL 1800
            AAW  L   L++     ++ +        +E +L+RNL   Y+++    RPV  +++ I V++GL + Q++ ++E  Q++ TN W    W D+ L+W+P +Y GI  IR+  + IW PDI L+  AD R       + ++  DG + W P A +KS+C + +T+FPFD Q C ++FGSWTYD   ++L       D         YVD  D+ D+ EW                               N  GQ  +RR     Y  L Y   +KR   FY   L+IPCL LS LT+++F+LP +   K+ L  ++ V+  + LL++ E  PSS K  PLIG Y    MI +T S  +   V+N++ R  +    +   ++ LF+  L +L+                          ++     +       RS +++ +   G R        G +K  L   +  S     +LEK  + +      +++R  +K+H ++ +V Q+W+ +A +LDR+F   ++T  ++  V++
Sbjct:    4 AAWMLLCAALVLEQTAAQEVQENVLSLAELEDSLLRNLFKGYQKWV---RPVQHANDTITVRFGLKISQLVDVDEKNQLMTTNVWLWQEWIDVKLKWNPDDYGGITSIRVPSETIWLPDIVLYENADGRFEGSLMTKAIVRWDGTITWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGNMVDL----VLVDH--------YVDRKDFFDNGEW----------------------------EILNATGQRGSRRDEMYWYPFLTYSFILKRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTFSIIVTVFVINVHHRSSATYHPMAPWVKSLFLQKLPRLLC-------------------------MRGHTDRYHFPDIEMRSPELKTRRGAGRRAVP----GGQQKGALGGMEDDSQAWLAMLEKATNSV-----HYISRHIRKEHFIREVV-QDWKFVAQVLDRIFLWAFLTVSILGTVLI 460          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Medaka
Match: chrna5 (neuronal acetylcholine receptor subunit alpha-5 [Source:NCBI gene;Acc:101173433])

HSP 1 Score: 183.726 bits (465), Expect = 7.220e-51
Identity = 147/508 (28.94%), Postives = 241/508 (47.44%), Query Frame = 1
Query:  295 KKYKSVEKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLN--LDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGR-VPGIIRRLFIDGLGKLIMAGQQEVSTIHQGILFTMNIGKGKSKIKSTEKNFQINHAAFRSKMRKQLNTGNRGENEYEIDGDEKPELNKKDGISNHSFNILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMF-FCLYVTAILIALVVLIP 1806
              Y   E TL ++L   Y+++    RP+   +  I VK+GLA+ Q++ ++E KQ++ TN W +  W D+ L+W P +Y GI  IR+    IW PD+ L++ +D R  E    + V+  DG + W P A FKS C + +T+FPFD Q C ++FGSWTYD +Q++  L+ +H              VD  DY D+ EW                       +I   T    L  + +  Y  + Y   ++R   FY   L+IPC+ LS LT+++F+LP     K+ L  ++ V+  + LL++ E  PSS K  PLIG Y    MI +TLS  +    +N+++R  S    +   +RR+F+  L KL+            G+      GKGK  ++   K                               D  P+L        H+ + L+  L  I+      V   K++ ++ +V Q+W+ +A +LDRMF +  ++ ++L + ++ +P
Sbjct:   36 SSYAKAEDTLFKHLFGTYQKWV---RPIEYLNQTIPVKFGLAISQLVDVDEKKQLMTTNVWLKQEWIDMKLRWKPEDYLGITTIRVPSDRIWLPDVVLYDNSDGRF-EGTVTKAVVKYDGTISWNPPANFKSACTIDVTFFPFDLQNCSMKFGSWTYDGSQVDIILEDFH--------------VDKKDYFDNGEW-----------------------EIVKATGSRGLRTDGSTSYPTITYFFIIRRLPLFYTLFLIIPCIGLSFLTILVFYLPSNGNEKISLCTSVLVSLTVFLLVIEEIIPSSSKAIPLIGEYLVFTMIFVTLSIIITVFAINIHYRSSSTHHDMAPWVRRIFLHRLPKLLCMRSHVDRYATAGL-----AGKGKVTVQEKTK-------------------------------DSTPDLTH----ILHTRHNLQTALESIRYITMHVV---KENQVREVV-QDWKYVAQVLDRMFLWAFFLVSVLGSALLFVP 458          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Medaka
Match: ENSORLT00000017941.2 (neuronal acetylcholine receptor subunit alpha-3-like [Source:NCBI gene;Acc:101168601])

HSP 1 Score: 183.726 bits (465), Expect = 1.059e-50
Identity = 137/495 (27.68%), Postives = 243/495 (49.09%), Query Frame = 1
Query:  313 EKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEW-ITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQ--QEVSTIHQGILFTMNIGKGKSKIKSTEKNFQINHAAFRSKMRKQLNTGNRGENEYEIDGDEKPELNKKDGISNHSFNILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLYVTAILIA 1788
            E  L R L  RY +F    RPV    + + V++ +++ Q++ ++E  QI+ TN W R++W D  L+W PA + GI+ IR+   +IW PDI L+N A        + + ++  DG + W+P A+FKS+CP+ ITYFPFD Q C ++FGSWTYD  +++L                  V+  D+ +S EW I D         Y   ++    ++I                Y  + Y   ++R   FY   L+IPCLL+S LT+++F+LP +   K+ L +++ ++  + LL++ E+ PS+    PLIG Y    MI +TLS  +   VLN+++R      +PG +  +F+  L ++++  +   E   +  G L  +    G  K+ S +        A +     Q     R   E       K +L+++   +  +F+++  ++      ++      +       V  +W+ +A+++DR+F  ++VT  L+ 
Sbjct:   29 EDRLFRKLFRRYNQFI---RPVENVSDPVTVEFEVSISQLVKVDEVNQIMETNLWLRHIWNDYKLRWTPAEFDGIEFIRVPSNKIWRPDIVLYNNAVGDFLVEDKTKALLKFDGTITWVPPAIFKSSCPMDITYFPFDYQNCSMKFGSWTYDKAKIDLVLIGS------------KVNLKDFWESGEWEIIDA------PGYKHDIKYNCCEEI----------------YPDITYSFYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPMTHTMPGWVHLVFLKVLPRIMLMRRPTDEDGKVGGGSLNCLE--YGDCKLSSMD-----GCGAKKCPCPCQ---HGRETPETAASVRMKHQLSQQSINTVVAFSVVSPEVKQAIESVKYIAENMRSRNKAKEVEDDWKYVAMVIDRIFLWVFVTVCLLG 476          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Medaka
Match: ENSORLT00000016544.2 (neuronal acetylcholine receptor subunit alpha-10-like [Source:NCBI gene;Acc:101157879])

HSP 1 Score: 183.341 bits (464), Expect = 3.883e-50
Identity = 127/403 (31.51%), Postives = 200/403 (49.63%), Query Frame = 1
Query:  370 RPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQQEVSTIHQGILFTMNIGKGKSKIKS-----TEKNFQINHAAFRSKMRKQLNTGNRGENEYEI 1563
            RPV  +DN+I V   + L QI+ ++E  QIL T  W R VW D  L W   +Y G+  IRI    +W PDI L+N A++  S   E  VV+ NDG V+W   A+ KS+C V + +FPFD Q C L FGSWT++  Q++L            +  +   D +D+V + EW   G   KK                        L    +  Y  + + + +KR +SFY+F L+IPC+++S L  + F+LP +S  K+ LG+ + +A  +  LL+AES P S ++ PLIG Y+   M ++T ST L   ++N++  G     VP   +R  ++ L ++    +   S + +       + + +S   S     T  N+  N   +R K+ +  NTG     E ++
Sbjct:   45 RPVEDTDNIINVTLQITLSQIIDMDERNQILTTYLWIRQVWMDAFLSWRKEDYDGLDTIRIPSSLVWRPDIVLYNSANDEFSSSMETNVVLRNDGQVMWDQPAITKSSCSVDVAFFPFDVQQCHLTFGSWTHNGNQMDL------------FNALDSADLSDFVPNVEWEVLGMPAKK---------------------NVILYGCCSDPYPDITFTLNLKRRASFYIFNLLIPCMMISFLAPLGFYLPADSGEKVSLGVTVLLALTVFQLLVAESMPPS-ESVPLIGKYYIATMTMVTASTALTIFIMNIHHCGSEARPVPQWAQRFVLNFLARICFLREAGDSCLSRASSLKQPLSQQESDAPSAGAGTTGTNWDRNGQVWRGKVEED-NTGVSLSTEQDL 412          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Medaka
Match: chrna9 (cholinergic receptor nicotinic alpha 9 subunit [Source:NCBI gene;Acc:101173121])

HSP 1 Score: 174.866 bits (442), Expect = 1.211e-47
Identity = 142/508 (27.95%), Postives = 236/508 (46.46%), Query Frame = 1
Query:  316 KTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQN-ITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQQEVSTIHQGILFTMNIGKGKSKIKS------TEKNFQINHAAFRSKMRKQLNTGNRGENEYEIDGDE--KPELNKK-DGISNHSFNIL--EKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLYVTAILIALVVLI 1803
            + L+++L+  Y       RPV  +D  + V   + L QI  ++E  Q+L T  W R VW D  L+WD  +Y  ++ I I    +W PDI L+N ADE  S      V +  +G ++W   A+ KS+C V ++YFPFD Q C L FGSWTY+  Q+++    G +            D +D+V++ EW   G                      M   RN +     +  Y  + Y + +KR SSFY+F L++PC L+S L  + F+LP +S  K+ LG+ + +A  +  LL+AES P + ++ P IG Y+   M +IT ST L   ++N++F G     VP   + L ID + K               I F   +G+  +  +S       E+   +    +           +   ++Y +   +  K + N   +G  +H   +L    DL  +K+ IQ   N  ++     I   EW+ +A ++DR F  ++   + +  +++I
Sbjct:   20 RKLLKDLMEDYSS---DLRPVEDTDEALNVSLQITLSQIKDMDERNQVLTTYLWIRQVWHDAYLKWDKEDYDDLEMINIPSDRVWKPDIVLYNKADEESSGPSTTNVKLRYNGEIVWDSPAITKSSCVVDVSYFPFDWQSCNLTFGSWTYNGNQVDISL--GMDSG----------DLSDFVENVEWECHG----------------------MPAVRNVMMYGCCSDPYTEITYTLLLKRRSSFYIFNLLLPCFLISFLAPLGFYLPADSGEKVSLGVTVLLALTVFQLLVAESMPPA-ESMPYIGKYYIATMTMITASTSLTIFIMNIHFCGAEAKPVPHWAKVLIIDYMSK---------------IFFVYEVGENCTTPESKRTPLYPEEPMGVESVYYDDCCHDSFLHHDSNPHKYSLQHHQHHKGQANGSINGCHHHQRLVLTYPSDLQLVKN-IQYIANCFREQRATCIKVAEWKKVAKVMDRFFMWIFFFMVFLMSILII 473          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Planmine SMEST
Match: SMESG000023360.1 (SMESG000023360.1)

HSP 1 Score: 1046.19 bits (2704), Expect = 0.000e+0
Identity = 535/535 (100.00%), Postives = 535/535 (100.00%), Query Frame = 1
Query:  226 MKWIYVAAWSTLLFRLIVTVHINKKYKSVEKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQQEVSTIHQGILFTMNIGKGKSKIKSTEKNFQINHAAFRSKMRKQLNTGNRGENEYEIDGDEKPELNKKDGISNHSFNILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLYVTAILIALVVLIPFQKNDFNE 1830
            MKWIYVAAWSTLLFRLIVTVHINKKYKSVEKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFILVIPCLLLSCLTLVLFWLPPESPAKMMLGMNIFVAFFILLLLLAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQQEVSTIHQGILFTMNIGKGKSKIKSTEKNFQINHAAFRSKMRKQLNTGNRGENEYEIDGDEKPELNKKDGISNHSFNILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLYVTAILIALVVLIPFQKNDFNE
Sbjct:    1 MKWIYVAAWSTLLFRLIVTVHINKKYKSVEKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFILVIPCLLLSCLTLVLFWLPPESPAKMMLGMNIFVAFFILLLLLAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQQEVSTIHQGILFTMNIGKGKSKIKSTEKNFQINHAAFRSKMRKQLNTGNRGENEYEIDGDEKPELNKKDGISNHSFNILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLYVTAILIALVVLIPFQKNDFNE 535          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Planmine SMEST
Match: SMESG000021568.1 (SMESG000021568.1)

HSP 1 Score: 453.751 bits (1166), Expect = 4.557e-153
Identity = 276/544 (50.74%), Postives = 366/544 (67.28%), Query Frame = 1
Query:  301 YKSVEKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIK-SYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQQ-----EVSTIHQGILFTMN--IGKGKSKIKSTEKNFQINHAAFRSKMRKQLNTGNRGENEYEIDGDEKPELN--------------------------KKDGISN--------HSFNILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLYVTAILIALVVLIP 1806
            + SVEK L  ++L  Y+R+G+ GRPV+ S  L+ V+YGL LIQ+L L+ENKQILRTNCWS Y W D LL+W+PA + GI +IR+FP +IWTPDIKL+NFAD RL E R ARVV+ + G  LW+PQ++FKSTC V ITYFPFDTQ+C LEFGSW YD  QL++ WW        T   +PY+D+ DY+ SNEW TDG+V+ ++K   D K QIKS KK R     +  GQ I + Y +L Y +R++RNSSFYV ILVIPC+LLS LTLV+FWLPPESPAKMMLGMNIFVAFF+LLLLLAESTPS+VK FPLIGAYFCLNMI+ITLSTFLAALV+N YFRGD  G +P ++RR+ ++GLG+L++  Q      E + + + +    N  I K + KI + + N  +      ++   Q +   R  N + I+ DE  E N                          + + I++             LE D+ ++K +I+ FVNRQK++  K+++S EWR+LAL+LDR+FF LY+++ILIA++  IP
Sbjct:   19 WPSVEKNLTVSILNNYQRYGIFGRPVSHSKELMKVQYGLQLIQLLDLDENKQILRTNCWSMYRWHDKLLEWNPAEHGGITEIRVFPDQIWTPDIKLYNFADVRLREARVARVVVKHTGKTLWVPQSIFKSTCAVEITYFPFDTQICMLEFGSWAYDIHQLDIIWWV----PDGTNVSMPYIDFNDYLQSNEWRTDGEVDFQLKLEGDNKTQIKSVKKYRTRVYVSSNGQPINKHYPVLRYLVRLRRNSSFYVLILVIPCILLSSLTLVVFWLPPESPAKMMLGMNIFVAFFVLLLLLAESTPSAVKKFPLIGAYFCLNMIMITLSTFLAALVINYYFRGDFAGPLPILVRRIIVEGLGRLLLVRQHIPLPDETNLMDRVLTRAENGCIRKCRLKIPNLDSNKFLTSPVQTAEPPLQQDLSPRNTNPF-INNDELAESNVWQTNVRPLRSYSSVYRNTPQASMTARPNPITDTEDSPLLMRCNTTLENDVRELKRYIRMFVNRQKENNRKNLISMEWRTLALVLDRLFFVLYISSILIAVIACIP 557          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Planmine SMEST
Match: SMESG000073518.1 (SMESG000073518.1)

HSP 1 Score: 436.802 bits (1122), Expect = 2.674e-146
Identity = 256/553 (46.29%), Postives = 349/553 (63.11%), Query Frame = 1
Query:  304 KSVEKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYDRKLQIKSEKKIRM--ITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQ------------------QEVSTIHQGILFTMNIGKGK---SKIKSTEKNFQINHAAFRSKMRKQL-----------------NTGNRGENE---YEIDGDEKPELNKKDGISN-HSFNIL--------EKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLYVTAILIALVVLIP 1806
            KSVEK L++ L+  Y+ +GV GRPVN S N I V YGLAL+QILGL+ N QILRTNCW RY W D LL WDP +Y GI QIR+    +W PDI+L NFADER+   REARVV+SNDG++LW+PQALFKS+C V I+YFPFD Q+C+++FGSWTYDT+QL L W+   ND       +PYVD+  Y+ +NEW TDG+ EK I    R  QIKS + +R   IT+ + +   I + +H+L Y IR++RN SFYVFIL+IPC+LLS L  ++FWLP ESPAK++LGMNIFVAFFILLLLL  S P++VK FPLIG++FCLNMI+ITLSTFL  +V+N Y RGD KG +P  IR++ ID +G+L+   Q                  Q  +   Q  L+   +   K   + I + E+       + R+ + K                   N G+R  N+    EI+    P      G+SN H   I+        EKD+ +I  ++++++ +QK+   K+ ++ EWR+L L+LDR+F   Y+  I+IA+++ IP
Sbjct:   27 KSVEKNLLQKLMKSYEFYGVNGRPVNDSRNKIRVNYGLALVQILGLDGNTQILRTNCWGRYTWHDELLNWDPKDYDGIDQIRLEKDYMWMPDIQLFNFADERMKVHREARVVVSNDGSILWVPQALFKSSCSVEISYFPFDVQICRMDFGSWTYDTSQLELHWYGFPNDS------LPYVDFKAYIHNNEWHTDGEKEKNISHLHRTKQIKSLRFLRYQNITDGDEI---IQKTFHVLRYRIRLRRNPSFYVFILIIPCILLSLLVNIVFWLPTESPAKLLLGMNIFVAFFILLLLLKSSIPTAVKAFPLIGSFFCLNMIMITLSTFLVTIVINFYVRGDRKGPMPNYIRKIMIDNIGRLLFVSQFIPLPPPQPPNNCNVYITQSPAGKIQHKLYVPELTCNKFMATDIPNIEQTSTSQDLSNRNNINKPYSKNFISADKNLNQKYSRNNGHRSHNQKPNSEINNIPNP------GVSNSHDSPIMICGGTSSIEKDVIEITRYVRKYIGKQKEAQRKNQLTMEWRTLGLVLDRLFCIFYMATIVIAVIIGIP 564          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Planmine SMEST
Match: SMESG000005358.1 (SMESG000005358.1)

HSP 1 Score: 377.096 bits (967), Expect = 8.580e-124
Identity = 238/528 (45.08%), Postives = 335/528 (63.45%), Query Frame = 1
Query:  259 LLFRLIVTVHINKKYKSVEKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEW-----ITDGQVEKKI--KSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQQ-EVSTIHQG-------ILFTMNIGKGKSKIKSTEKNFQINHAAFRSKMRKQLNTGNRGENEYEIDGDEKPELNKKDGISNHSFNILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLYVTAILIALVV 1797
            ++F L   ++   + KS+EK LIR L+ +Y+  G+ GRPVN S   IV+++ L LIQIL L+EN+QIL TNCWS   WKD LL WDP  Y  I  +R++P  IWTPDI L+NFADER  + RE RV I  +G VLW+PQ+L+KS+C V ITYFPFDTQ CKLEFGS  YD+T+L++ WW   N          Y+DY DY+ SNEW       D  + +KI  K   R  QI SEK+ +++             Y IL Y +R+ RN SFY+ IL++PC LLS LTLV+FWLPPESPAK+MLG++IFVAFF+LLLLLA+ TP  VKNFPLIGAYFCLNM++IT STFLA L++N++F+G   G +P  IRR+ ++GLG+L++  Q   +   + G           +     +  IK+T+K F+      +  +   +    R ++  ++    +P LN    I  H     E+D+ +I  +I+  VNR+K    +++++ E+R+LALILDR+FF LY++ +  +++V
Sbjct:    8 MIFGLFPVLNALTEVKSIEKDLIRTLINKYEHHGIFGRPVNNSMETIVIEHKLQLIQILDLDENRQILVTNCWSNLRWKDSLLIWDPQKYGNITTVRVYPDHIWTPDIMLYNFADERSEDRRECRVKIYANGMVLWVPQSLYKSSCSVEITYFPFDTQNCKLEFGSLAYDSTKLDIIWWITENISEN------YIDYADYMKSNEWEIYGSSIDSSITEKIFSKKIYRFSQI-SEKESKLL-------------YPILRYILRLNRNPSFYITILIVPCTLLSLLTLVIFWLPPESPAKLMLGISIFVAFFVLLLLLADFTPREVKNFPLIGAYFCLNMVMITSSTFLATLIINIHFKGAKTGPIPKTIRRIILEGLGRLVLIRQNINLPPYNDGNENCIKKSSLKVKSKNSQLWIKNTDKRFR------KRSINSSVIYKPRNDHSKKLIPIAEPCLNA--FIQGHLE--FERDIREISRYIRIIVNREKTEISRNLIAMEYRTLALILDRLFFILYISTMATSVIV 505          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Planmine SMEST
Match: SMESG000069967.1 (SMESG000069967.1)

HSP 1 Score: 306.605 bits (784), Expect = 5.689e-96
Identity = 213/590 (36.10%), Postives = 327/590 (55.42%), Query Frame = 1
Query:  226 MKWIYVAAWSTLLFRLIVTVHINKKYKSVEKTLIRNLLTRYKRFGVIGRPVNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPANYSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTYYPIPYVDYTDYVDSNEWITDGQVEKKIKSYDRKLQIKSEKKIRMITERNHLGQNITRRYHILEYGIRMKRNSSFYVFXXXXXXXXXXXXXXXXXXXPPESPAKMMLGMNIFVAFFIXXXXXAESTPSSVKNFPLIGAYFCLNMILITLSTFLAALVLNLYFRGDSKGRVPGIIRRLF-----IDGLGKLIMAGQQE-VSTIHQGILFTMNIGKGKSKIKSTEKNFQI--------NHAAFRSKMRKQLNTGNRGENEYEI-------DGDEKPELNKKDGISNHSFN-----------------------------------------ILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWRSLALILDRMFFCLY-VTAILIALVVLIP 1806
            M+ I V  W  ++F   +T+  +    S EK LI  +L  YK+ G IGRPV    + +VVKYGLALIQI+ L+E  QIL  N W++Y W D +L W+P N+S ++++R+ P +IWTPDI L+N+ADERL E R+  V ++  G ++W+P A+FKSTC + I+ FPFD Q C L+FGSWTY   +L++  +  +++          +D  DY +SNEW+        +    R+  +K+ K        N    ++T       + + +KRNS+++ ++LV+PC+LLS LTLV+FWLPPESPAKM+LGMNIFVAF +LL LLAE+TPS+  + P +G Y+CLNMILITLSTFL+ +V+NLYFR D +  +P  +R+       I G+ ++I +   E +  I   I  + N  K + + ++TE    I         H + +  M  Q  +G+    +          D  + P     D I  +SFN                                         +LEK+LS+I+  ++  + +  +    + +++EWR +A++LDR+FF +Y V  IL  L++L+P
Sbjct:    1 MRLIGVIVWIFVIFPSYITLA-DYASMSGEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSE----------IDIIDYTESNEWLI-------LHKPARRFVLKNMKD-------NTSQPDLT-------FFLILKRNSAYHAYLLVVPCVLLSLLTLVIFWLPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMILITLSTFLSIIVINLYFRCDKRRNLPDWLRKGVNATSKILGMKQVISSASSEKLHLIKSEIKNSRNHIKRQQEKETTESRETIPTPISPRARHKSSKMAMEMQNLSGSSSNYQTRFQYPRQNTDVTDIPYTAHSD-IPRNSFNPGYSYEYRYSNAPPPAAPASPLPSSTTKKQTQQKKSNQSAILLEKNLSEIRKALKNLMTKIAEKDRGNRIAKEWRMVAMVLDRLFFWVYFVIVILSGLILLLP 557          
The following BLAST results are available for this feature:
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CHRNA91.001e-4928.98cholinergic receptor nicotinic alpha 9 subunit [So... [more]
CHRNA63.866e-4826.31cholinergic receptor nicotinic alpha 6 subunit [So... [more]
CHRNB31.220e-4729.03cholinergic receptor nicotinic beta 3 subunit [Sou... [more]
CHRNA43.035e-4732.17cholinergic receptor nicotinic alpha 4 subunit [So... [more]
CHRNA54.264e-4733.33cholinergic receptor nicotinic alpha 5 subunit [So... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acr-31.469e-4827.35Acetylcholine receptor subunit beta-type acr-3 [S... [more]
lev-12.716e-4827.93Acetylcholine receptor subunit beta-type lev-1 [S... [more]
acr-115.518e-4828.64AcetylCholine Receptor [Source:UniProtKB/TrEMBL;A... [more]
unc-299.466e-4825.98Acetylcholine receptor subunit beta-type unc-29 [... [more]
unc-299.466e-4825.98Acetylcholine receptor subunit beta-type unc-29 [... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nAChRalpha62.852e-5128.63gene:FBgn0032151 transcript:FBtr0331284[more]
nAChRalpha61.414e-5028.43gene:FBgn0032151 transcript:FBtr0303898[more]
nAChRalpha61.414e-5028.43gene:FBgn0032151 transcript:FBtr0079916[more]
nAChRalpha55.901e-5028.14gene:FBgn0028875 transcript:FBtr0474155[more]
nAChRalpha66.646e-5028.24gene:FBgn0032151 transcript:FBtr0079915[more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CR847523.32.946e-5529.87neuronal acetylcholine receptor subunit alpha-10-l... [more]
CR388402.14.367e-4828.43cholinergic receptor, nicotinic, alpha 9 [Source:N... [more]
chrnb1l6.877e-4827.15cholinergic receptor, nicotinic, beta 1 (muscle) l... [more]
chrna69.021e-4826.52cholinergic receptor, nicotinic, alpha 6 [Source:Z... [more]
chrna61.042e-4726.15cholinergic receptor, nicotinic, alpha 6 [Source:Z... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CHRNA21.925e-5428.46cholinergic receptor, nicotinic alpha 2 [Source:NC... [more]
mppe11.708e-5128.31metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GE... [more]
mppe11.710e-5128.31metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GE... [more]
mppe11.911e-5128.31metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GE... [more]
mppe11.930e-5128.31metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Chrna63.190e-5528.17cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna91.386e-4828.96cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna21.420e-4826.97cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna21.420e-4826.97cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna44.157e-4732.17cholinergic receptor, nicotinic, alpha polypeptide... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9R0W9|ACHA6_MOUSE2.231e-5428.17Neuronal acetylcholine receptor subunit alpha-6 OS... [more]
sp|P43143|ACHA6_RAT5.993e-5328.31Neuronal acetylcholine receptor subunit alpha-6 OS... [more]
sp|Q9UGM1|ACHA9_HUMAN4.809e-4928.98Neuronal acetylcholine receptor subunit alpha-9 OS... [more]
sp|P18257|ACHN3_CARAU7.036e-4928.17Neuronal acetylcholine receptor subunit non-alpha-... [more]
sp|P17644|ACH2_DROME8.231e-4928.01Acetylcholine receptor subunit alpha-like 2 OS=Dro... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q0KEK56.146e-16051.23Putative nachr subunit OS=Schistosoma mansoni OX=6... [more]
A0A4S2L6C91.885e-15852.51Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A5K4EQN53.708e-15849.91Putative nachr subunit OS=Schistosoma mansoni OX=6... [more]
A0A4Z2D9W99.917e-15850.35Neuronal acetylcholine receptor subunit alpha-7 OS... [more]
A0A094ZRW81.148e-15349.73Neuronal acetylcholine receptor subunit alpha-7 OS... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000019858.22.122e-5529.55neuronal acetylcholine receptor subunit alpha-10 [... [more]
ENSAMXT00000032409.12.671e-5234.94neuronal acetylcholine receptor subunit alpha-10 [... [more]
chrna4b1.564e-4732.36neuronal acetylcholine receptor subunit alpha-2 [S... [more]
chrna61.600e-4726.51neuronal acetylcholine receptor subunit alpha-3 [S... [more]
chrnb1l1.931e-4727.27acetylcholine receptor subunit beta-like [Source:N... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrna34.590e-4931.64cholinergic receptor, nicotinic, alpha 3 [Source:Z... [more]
chrnb3b2.510e-4832.96cholinergic receptor, nicotinic, beta 3b (neuronal... [more]
chrnb1l4.556e-3929.10cholinergic receptor, nicotinic, beta 1 (muscle) l... [more]
chrna2a5.032e-3832.93cholinergic receptor, nicotinic, alpha 2a (neurona... [more]
ENSPMAT00000008550.11.470e-3323.37pep scaffold:Pmarinus_7.0:GL476601:34:38373:1 gene... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO420541.225e-4627.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479692.732e-4531.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO408627.684e-4530.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448962.827e-4425.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320538.433e-4330.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrnb3a6.584e-5127.66neuronal acetylcholine receptor subunit non-alpha-... [more]
chrna57.220e-5128.94neuronal acetylcholine receptor subunit alpha-5 [S... [more]
ENSORLT00000017941.21.059e-5027.68neuronal acetylcholine receptor subunit alpha-3-li... [more]
ENSORLT00000016544.23.883e-5031.51neuronal acetylcholine receptor subunit alpha-10-l... [more]
chrna91.211e-4727.95cholinergic receptor nicotinic alpha 9 subunit [So... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023360.10.000e+0100.00SMESG000023360.1[more]
SMESG000021568.14.557e-15350.74SMESG000021568.1[more]
SMESG000073518.12.674e-14646.29SMESG000073518.1[more]
SMESG000005358.18.580e-12445.08SMESG000005358.1[more]
SMESG000069967.15.689e-9636.10SMESG000069967.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30004906 ID=SMED30004906|Name=Neuronal acetylcholine receptor subunit alpha-4|organism=Schmidtea mediterranea sexual|type=transcript|length=1902bp
CAGAGATTTCATCATTGCTACAATTTCCCTTTTATTTATTGCATGTGTGC
ATTCTGGTATTTGCTCAAACATACTGCTAGCCATAATTAATAATATCACC
GACCAATGAGAATCGAGGAGATCAGTAATTGTTGTTTCTCTACATTATCG
AATAAAATCAATTGTCAATTATTAATTATCAACGTTGGGATGATTTTGAT
GAAAACTTTTTAATTAAATTGAAACATGAAATGGATTTATGTCGCCGCTT
GGTCAACATTGTTGTTTCGTTTAATTGTAACAGTACACATAAACAAAAAG
TACAAATCAGTCGAAAAAACTCTCATTCGTAATTTGCTCACTCGATATAA
AAGATTTGGAGTAATTGGACGGCCTGTTAACCAAAGTGACAACCTCATTG
TAGTAAAATATGGTCTAGCTTTGATTCAAATTTTGGGTTTAGAAGAAAAC
AAACAAATACTGCGAACGAATTGTTGGTCACGTTATGTTTGGAAAGATAT
TCTTCTTCAATGGGATCCAGCTAATTACAGCGGGATCAAGCAAATTAGAA
TATTTCCCCAAGAAATTTGGACTCCAGATATAAAACTTCATAATTTTGCC
GATGAGAGGTTATCTGAATTTCGGGAGGCCAGAGTTGTTATAAGTAATGA
CGGAAATGTTTTATGGATACCACAAGCTCTGTTTAAAAGTACCTGTCCGG
TGACCATAACTTATTTTCCATTTGATACTCAAGTGTGCAAACTTGAATTC
GGATCATGGACATACGACACTACTCAATTAAATCTAGATTGGTGGCATGG
ATATAATGATGAGACGAAAACCTATTACCCGATTCCATATGTTGACTACA
CAGACTATGTTGATTCCAATGAATGGATAACTGATGGGCAAGTGGAGAAA
AAGATCAAATCATATGACAGAAAATTACAGATAAAATCAGAAAAAAAAAT
AAGAATGATAACGGAGAGAAACCATTTGGGTCAGAACATAACAAGGCGTT
ACCATATCCTAGAATATGGAATCAGAATGAAACGCAATTCAAGTTTTTAT
GTTTTCATTCTTGTTATTCCATGTCTTCTTTTGTCATGCTTAACTTTGGT
TTTATTTTGGCTTCCACCAGAATCTCCTGCAAAAATGATGTTAGGAATGA
ATATATTCGTAGCATTCTTCATTTTACTTCTCTTACTAGCCGAGTCTACT
CCAAGTTCTGTAAAAAATTTCCCATTAATTGGAGCATACTTTTGTCTGAA
TATGATTTTAATTACATTGTCAACCTTTTTAGCGGCCCTGGTTCTGAATC
TTTATTTTCGTGGAGATTCCAAAGGTCGAGTTCCTGGAATTATTAGAAGA
TTATTTATTGATGGACTTGGAAAATTAATAATGGCTGGTCAACAAGAAGT
TTCAACAATTCACCAAGGAATCCTTTTCACAATGAATATTGGTAAAGGGA
AATCCAAAATCAAATCAACTGAAAAGAATTTTCAAATCAACCATGCTGCT
TTTCGATCAAAAATGCGAAAACAATTAAATACTGGAAACAGGGGTGAAAA
TGAATACGAAATAGACGGCGATGAAAAACCAGAATTAAATAAAAAAGATG
GCATTTCTAATCATAGTTTCAATATTCTGGAGAAAGATCTCAGTGATATT
AAATCATTCATCCAGGAGTTTGTAAACCGCCAGAAACAACACACAATGAA
AAGTATAGTTTCCCAAGAATGGAGATCTTTGGCATTAATCTTGGATAGAA
TGTTCTTTTGTCTTTATGTGACAGCTATCTTAATAGCTCTTGTTGTCCTT
ATTCCTTTCCAGAAAAATGATTTCAACGAATAGATTGGAGAGTATATTAA
ATTTTAAAATTTCATTTTGTTTTAAAGCTTCCTTTATTCAATATATTTTT
GC
back to top

protein sequence of SMED30004906-orf-1

>SMED30004906-orf-1 ID=SMED30004906-orf-1|Name=SMED30004906-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=536bp
MKWIYVAAWSTLLFRLIVTVHINKKYKSVEKTLIRNLLTRYKRFGVIGRP
VNQSDNLIVVKYGLALIQILGLEENKQILRTNCWSRYVWKDILLQWDPAN
YSGIKQIRIFPQEIWTPDIKLHNFADERLSEFREARVVISNDGNVLWIPQ
ALFKSTCPVTITYFPFDTQVCKLEFGSWTYDTTQLNLDWWHGYNDETKTY
YPIPYVDYTDYVDSNEWITDGQVEKKIKSYDRKLQIKSEKKIRMITERNH
LGQNITRRYHILEYGIRMKRNSSFYVFILVIPCLLLSCLTLVLFWLPPES
PAKMMLGMNIFVAFFILLLLLAESTPSSVKNFPLIGAYFCLNMILITLST
FLAALVLNLYFRGDSKGRVPGIIRRLFIDGLGKLIMAGQQEVSTIHQGIL
FTMNIGKGKSKIKSTEKNFQINHAAFRSKMRKQLNTGNRGENEYEIDGDE
KPELNKKDGISNHSFNILEKDLSDIKSFIQEFVNRQKQHTMKSIVSQEWR
SLALILDRMFFCLYVTAILIALVVLIPFQKNDFNE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004888transmembrane signaling receptor activity
GO:0005216ion channel activity
GO:0004889acetylcholine-activated cation-selective channel activity
GO:0005230extracellular ligand-gated ion channel activity
GO:0022848acetylcholine-gated cation-selective channel activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036734Neur_chan_lig-bd_sf
IPR036719Neuro-gated_channel_TM_sf
IPR006202Neur_chan_lig-bd
IPR018000Neurotransmitter_ion_chnl_CS
IPR002394Nicotinic_acetylcholine_rcpt
IPR006201Neur_channel
IPR006029Neurotrans-gated_channel_TM
IPR027361Acetylcholine_rcpt_TM
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0006810transport
GO:0034220ion transmembrane transport
GO:0060078regulation of postsynaptic membrane potential
GO:0060079excitatory postsynaptic potential
Vocabulary: cellular component
TermDefinition
GO:0045211postsynaptic membrane
GO:0016021integral component of membrane
GO:0016020membrane
GO:0005886plasma membrane
GO:0030054cell junction
GO:0045202synapse
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006201Neurotransmitter-gated ion-channelPRINTSPR00252NRIONCHANNELcoord: 266..278
score: 23.29
coord: 157..171
score: 48.84
coord: 80..96
score: 32.31
coord: 113..124
score: 46.0
IPR006201Neurotransmitter-gated ion-channelPANTHERPTHR18945NEUROTRANSMITTER GATED ION CHANNELcoord: 34..516
IPR002394Nicotinic acetylcholine receptorPRINTSPR00254NICOTINICRcoord: 67..83
score: 32.48
coord: 101..115
score: 35.19
coord: 137..155
score: 40.99
NoneNo IPR availableGENE3DG3DSA:1.20.58.390coord: 274..393
e-value: 5.9E-29
score: 102.6
NoneNo IPR availablePANTHERPTHR18945:SF783ACETYLCHOLINE RECEPTORcoord: 34..516
NoneNo IPR availableCDDcd19051LGIC_TM_cationcoord: 273..378
e-value: 5.38047E-24
score: 94.7368
NoneNo IPR availableCDDcd19033LGIC_ECD_nAChR_proto-likecoord: 58..230
e-value: 5.17987E-89
score: 269.541
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.747
NoneNo IPR availableTMHMMTMhelixcoord: 335..357
NoneNo IPR availableTMHMMTMhelixcoord: 504..526
NoneNo IPR availableTMHMMTMhelixcoord: 305..322
NoneNo IPR availableTMHMMTMhelixcoord: 273..295
NoneNo IPR availableTMHMMTMhelixcoord: 5..22
IPR006029Neurotransmitter-gated ion-channel transmembrane domainPFAMPF02932Neur_chan_membcoord: 279..525
e-value: 1.7E-32
score: 113.4
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilyGENE3DG3DSA:2.70.170.10coord: 29..248
e-value: 3.5E-57
score: 195.1
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilySUPERFAMILYSSF63712Nicotinic receptor ligand binding domain-likecoord: 30..230
IPR006202Neurotransmitter-gated ion-channel ligand-binding domainPFAMPF02931Neur_chan_LBDcoord: 31..231
e-value: 1.2E-48
score: 165.4
IPR018000Neurotransmitter-gated ion-channel, conserved sitePROSITEPS00236NEUROTR_ION_CHANNELcoord: 157..171
IPR036719Neurotransmitter-gated ion-channel transmembrane domain superfamilySUPERFAMILYSSF90112Neurotransmitter-gated ion-channel transmembrane porecoord: 274..526